1C1FA

Ligand-free congerin i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
GGLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNSTLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFLSLAGDARLTLVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of the conger eel galectin, congerin I, in lactose-liganded and ligand-free forms: emergence of a new structure class by accelerated evolution.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords PROTEIN (CONGERIN I)
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1999-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c1fA00
5IK5A 3AYEA 3RMYA 3QCWA 2JE7A 4ISRA 3VKNA 2D3PA 5IK8A 2Z42A 1BZWA 2ES3A 3AXEA 1DQ6A 1KDKA 1V00A 1U0AA 3NV4A 4FP2A 3OBTA 4FPLA 1AX1A 1LU2A 2JECA 2A71A 1N1YA 3ZSJA 1IS3A 1DQ4A 4XBNA 1YIFA 1W6NA 1N47A 4YZ3A 2A6XA 3SH3A 1SLIA 1QOSA 2JJ6A 1SBFA 1CQ9A 1AJOA 1F31A 3RRDA 3ATGA 2ZKNA 1GV9A 5HCFA 3U4XA 1LOGA 3V0BA 2E7TA 2LTNA 5EXOA 1SBDA 1AX2A 4XJ8A 2WJSA 4U36A 4AGGA 1QGLA 3FFZA 2ZMKA 5GALA 5JOWA 4BLIA 1D0HA 3AZVA 5H9RA 4M01A 2GMMA 3BTAA 4FPGA 4YM1A 4YZ4A 3TB0A 2CWSA 4YFZA 3RG0A 1CPNA 4UW6A 2YROA 1WLCA 3QLQA 3AZWA 3RSJA 4AGRA 5CB7A 3AYAA 3WUCA 1Q8VA 4XOGA 1MR5A 2D6LX 2UWBA 1UPSA 2VXRA 4YW3A 3B3QE 5T54A 3ZYPA 1FNYA 3OY8A 2PHRA 4R9AA 3RS6A 1LULA 2UWCA 5BYNA 2ENRA 2Q5TA 3AYCA 1JHNA 2P37A 4PF5A 2R16A 5E88A 2JKBA 2DU0A 3VV1A 2EF6A 1LECA 1LHVA 2ZABA 3GNEA 2CTVA 2P3JA 1Q8QA 2A6YA 4AYUA 1WD4A 4XMAA 3VKLA 5DUVA 1KITA 4Y20B 1V6MA 2ZBJA 4Y22A 1LOFA 2GDFA 1FATA 3M3CA 2DWRA 2A75A 2DVFA 3ZXJA 4LBNA 1RITA 4PCRA 2PHTA 2DUPA 1YO8A 1DFQA 2VU9A 4K1YA 5DZGA 3ASIA 2WSVA 1GNZA 1O4YA 2GMEA 1LHWA 4YW2A 3M3EA 4Y1ZA 1AXKA 1SLBA 3W58A 3NV1A 3D5OA 2UU8A 2W52A 1Q56A 3N7KA 4BPZA 3AXDA 2D43A 4BMEA 4Z8BA 1MVQA 4Y20A 4U2AA 2GNBA 2WNEA 5EWSA 5KXCA 3OJBA 3SH5A 1SFYA 2D6KA 1WCSA 1LJ7A 1CJPA 2EXKA 1GKBA 2LALA 1W6PA 1BYHA 2WSUA 1DBNA 1QDCA 1V6LA 3UJOA 2OUJA 1KRIA 1Q8SA 1I1EA 1Z0HA 1S0DA 1ZM1A 3AZYA 3AJYA 4JC1A 1IS5A 3JUUA 3WG2A 1XQNA 3AP6A 4WVWA 3USUA 2W39A 2OUHA 3ENRA 3T1MA 1QKQA 1S0CA 2KM2A 2XG3A 5GJ6A 2JE9A 3IKWA 1IKQA 2C9AA 1SCSA 1VALA 3WHUA 1O4ZA 1BQPA 1MS4A 3OBRA 4ATFA 3JU9A 4YM3A 1H9WA 2DVGA 2HYKA 3WV6A 2GNTA 5GLWA 4ASMB 3POSA 3TAYA 4TZDA 4YZ1A 1LGBA 3KQRA 1Q8PA 4UW5A 1W6QA 2E53A 1OFSA 3BIWE 5GZEA 1GLHA 2DU1A 3KM5A 3SLIA 3PVEA 4LBKA 2ZGOA 1UKGA 4OZXA 3WCSA 5KXDA 3ZXKA 5HCAA 5GLVA 4BM8A 4P9XA 2B7YA 1GYKA 5DUUA 1G8WA 1MS0A 4FPKA 2YV8A 3ILFA 3VUOA 2P34A 4I30A 2WKKA 4P14A 1GBGA 4L8QA 4Y26A 4BOWA 2NP0A 4WV8A 4XDQA 4M3CE 1W0PA 1QNWA 2D6MA 1GANA 1S1AA 3N3HA 2ZAAA 1CN1A 2R0FA 3WDWA 1CPMA 3V0AB 1G9CA 5T5OA 1D2SA 3ZXEA 1N3QA 2DYCA 3UL2A 1AF9A 4Q1PA 4AGVA 4FVVA 4P9YA 1LODA 1JXNA 1ULEA 2PHWA 1LOFC 2XB6C 3I4IA 5T5JA 4XJAA 1IS6A 1PZ9A 4YGDA 1BJQA 2P2KA 2VW2A 1N1VA 2D3RA 3FLRA 1W6MA 2E7QA 4NOTA 4PBOA 1LGCA 2NZ9A 2ZACA 2D3SA 3FUQA 2WT2A 4YW5A 1VAMA 1Z78A 1QF3A 3RMXA 1AX0A 4PBPA 1EPWA 4GA9A 3FLTA 3ZXFA 5H9QA 1MZ5A 1MS1A 3OYWA 2ZA9A 5H9SA 1BXHA 3O0VA 4BQ1A 1W6MB 1MS5A 2ZGTA 2E51A 2ZGRA 4KBBA 4D69A 3BODA 5JLVA 4XJUA 4HL0A 2RHPA 2W68A 2EXIA 2AREA 4BLJA 2BQPA 4GWMA 1WBLA 4LBJA 3USUB 4GWNA 5FREA 4C1XA 4DRRA 2AR6A 1HLCA 3WCRA 2DTWA 2R1BA 1DYPA 2SBAA 2WLQA 1SLCA 4Y1UA 1AXYA 2I2SA 1AXZA 3O12A 4WVVA 3MW3A 1A78A 4XBQA 2P3IA 1G86A 5LK5A 3V65A 3VKMA 5GZCA 2ZZJA 1J1TA 5DG2A 4FP3A 4DS0A 4W65A 4AVTA 4GKXA 2ZHLA 1DIWA 2AGSA 2YXSA 2NYYA 1SLLA 1UMZA 4UW4A 1WW5A 1S0FA 2PHXA 3HMYA 1Y7BA 2ZMNA 1FAYA 4YG6A 2A5ZA 3ZVXA 1V6IA 5IK7A 1LESA 3OGGA 3B01A 2A6VA 1GSLA 2PHUA 5DZFA 3H0OA 3AP5A 3O0XA 4GKYA 3N35A 5JMCA 1JBCA 4PQ9A 1UAIA 3ILRA 3AYDA 4Q8LA 4YGCA 3FUOA 3IM0A 2SLIA 5GZFA 3OYWB 4Y1XA 1DGLA 1LEDA 4YZ5A 2D6PA 1V6KA 5DG1A 4XBLA 2CY6A 1DQ2A 2GNDA 2AUYA 1VIWB 2E6VA 1YXWA 1V6OA 3ZSMA 1B09A 3PMEA 1A8DA 4WZFA 3PVOA 3IN9A 4FOYA 1FNZA 5T55A 3WDTA 1JYIA 1W6PB 1W6OB 3IMNA 4GALA 4H55A 5KXEA 4XMIA 3NWKA 1AJKA 3N7LA 3WG3A 4DRVA 4YZ2A 5KXBA 1JOJA 2D44A 2EALA 1IOAA 3ZPYA 4YGEA 1LOBA 5IK4A 3VKOA 1QOTA 1RIRA 4FPCA 2JDZA 2WT1A 3MW4A 4Y24A 2ZGSA 2ZHMA 2ERFA 1DZQA 3B69A 4XIOA 3O0WA 2DURA 3I8TA 1WLWA 2ZGMA 1N3PA 3MW2A 4YGBA 1S0IA 3R05A 2CYFA 3D4KA 3M3OA 1CESA 4R9DA 1MVEA 1UL9A 1MS9A 1KDMA 1X50A 4GXLA 1C57A 4LBLA 1LU1A 2ZMLA 2YZ4A 1R1ZA 4M3CF 1KJLA 2YMZA 4RL7A 3ZXLA 1NXD1 2UURA 3Q9OA 3WDUA 5GZGA 1ULDA 4LBMA 1IKPA 3B00A 1BKZA 3W59A 5IT6A 1V6JA 1S0JA 5AVAA 1LTEA 1WLDA 1G9FA 1QNYA 1AZDA 1DQ1A 2PELA 1DQ0A 4UW3A 3AP4A 1LOEA 1SBEA 2R0HA 3MPPG 5CNAA 4YW1A 3T2TA 4M3CB 3WG1A 5IUQA 1SLTA 1VAVA 1C4RA 1UZZA 3R4UA 1G7YA 2CNAA 5EYXA 2R49A 3M3QA 3WHTA 3N7JA 5H9PA 1LHNA 1MS3A 1S0GA 4C1WA 4FPYA 4TYSA 4K1ZA 3A0NA 1WBFA 4Q1RA 1GZWB 4FPJA 1C1LA 1WUVA 3OPZA 1CONA 1FV2A 4FPHA 5FRAA 4YG3A 2C5DA 1QMJA 2EXHA 3POYA 3RQ0A 1SLAA 4ZXKA 4LBQB 2ZHKA 4YG0A 1HQLA 1VLNA 4CTEA 1UZYA 2DVBA 2GN3A 2OVUA 4XHBA 5E8AA 2YY1A 1W6QB 2D6NA 3WOGA 1GZWA 2VY0A 1GNHA 4M3CA 3SNMA 3D6EA 2D6OX 2FHRA 3N7MA 1ULCA 3M2MA 1FX5A 4XTMA 2WQZC 1DHKB 5JDBA 1LENA 2W08A 2EAKA 2CWMA 1ONAA 3PJQA 4LBOA 2A3XA 1WW6A 3CNAA 1LCLA 5GM0A 2AENA 2ZGNA 1LOAA 4P9WA 1MS8A 2NMOA 3LSDA 4NO4A 4HANA 1MZ6A 3SITA 3WG4A 1LHUA 2EXJA 4JRAA 1JN2P 1HKDA 1WW4A 3WNXA 3C2UA 3AP9A 4XILA 1CR7A 4YM2A 5DZEA 3WUDA 2ZGUA 2P3KA 2VUAA 4XE9A 3UJQA 2H0BA 4YLZA 2A3YA 5SV8A 4CZSA 1ENSA 1KJRA 1DQ5A 1LOCA 1LEMA 1NLSA 5CA6A 2DTYA 4XIKA 1G9AA 2CL2A 1PZ8A 4K20A 2DVAA 1S0EA 4AWDA 1H9PA 4FQ4A 1C1FA 4Y1VA 2G4IA 2DVDA 1Q8OA 4XZPA 1DYKA 2A6ZA 1TEIA 4MYEA 4Y22B 5T5PA 3R4SA 3VKFC 1UX6A 2UWAA 1ULGA 3T1LA 3WZ1A 1A3KA 3NV2A 3SH4A 5JOZA 5CAZA 2D7FA 1PZ7A 3N36A 1GZ9A 2R1DA 5GLZA 1LGNA 1URXA 4Q27A 2AH2A 4AVVA 5JOYA 3BOPA 5GLUA 2ZHNA 4XYXA 5GZDA 4YM0A 3AP7A 5L73A 3V64A 3WLUA 1FYUA 2GNMA 2WT0A 4FPEA 5T5LA 1JYCA 3OY8B 5F9TA 1G9BA 5JVVA 1I3HA 1AVBA 4RA0A 2A7AA 3AX4A 3INAA 3FBYA 2JD4A 1F5FA 2ZGKA 2GN7A 3WDXA 4ITCA 1IS4A 3A0KA 4XTPA 1HQWA 3ZYRA 3B9CA 3DUIA 3ZSLA 2A70A 2DUQA 3ILNA 1ENRA 2GMPA 3NV3A 4Q2FA 1YRZA 4LBQD 2VW0A 3HN1A 5DUXA 1QU0A 3APBA 1DLLA 4Y1YA 4XJZA 2PHFA 5DXDA 5CBLA 2NMNA 4FPOB 4M00A 2VH9A 1N1TA 3A4UA 1UN1A 2DV9A 1YI7A 3AFKA 5GLTA 1KQRA 1WD3A 1W6OA 1GICA 2NM1A 4LBQA 2ZGQA 3SISA 2ZGPA 5DUWA 4DPNA 5JOXA 4DQAA 2FMDA 4FPFA 1QOOA 2EIGA 1YYNA 1V6NA 2VW1A 4SLIA 3WDVA 2DUOA 5F5QA 3LCPA 1OQ1A 2V73A 4XXAA 4F83A 3WVJA 3AK0A 1W0OA 4XHXA 4YFWA 1S0BA 4AVSA 5T50A 1RINA 1N3OA 1W6NB 1F9KA 3AJZA 3AZZA 4ATEA 3IPVA 1SACA 3L2YA 4ISQA 5T52A 1CVNA 1G9DA 4XJ9A 4CRQA 3MEPA 4R9BA 4FOVA 4Q8KA 2TEPA 1ENQA 1JUIA 2V5YA 5EYYA 4XJWA 3GALA 4FOQA 3LSEA 1LHOA 1GZCA 4Q26A 4K21A 1CIWA 1APNA 2ARXA 2GALA 1FV3A 2OW4A 3DGTA 1MACA 2NN8A 3HR9A 4R9CA 4YW4A 3ZSKA 1H30A 4FQZA 4JCKA 3PVNA 2ARBA 2A6WA 4FOWA 4BMBA 1HDKA 3POWA 3AZXA 3FLPA 1WW7A 3IPVB 3UK9A 1OKQA 1SCRA 3M1HA 3WDYA 5E89A 3V0AA 2A3WA 1ZA4A 4ZKTB 3O5SA 1JW6A 4IQPA 2AYHA 5HCBA 1ULFA 4XXPA 4DFSA 1QDOA 1N1SA 2ZGLA 3V0BB
chains in the Genus database with same CATH superfamily
4PDWC 1WLTA 2PYTA 1W0NA 2C4XA 2Y60A 5IK5A 3NNFA 1AR62 3VBFA 2JB4A 3K4DA 2D3PA 1UXXX 4EN7B 1AYN3 2ZEWA 3NV4A 4FPLA 3TNQA 3S6PA 1AX1A 2E7AA 2A71A 4PIZA 4QX5A 1J58A 4NUBA 1NCRB 1N47A 5CG8A 2XJVA 4YZ3A 1JZ5A 5KHKA 2FZ2A 5AC91 4XCBA 2V4VA 5A7SA 5HXMA 3D3AA 1F31A 3JQXA 3RRDA 3WF2A 1XYOA 2BNOA 2ZKNA 2RJKA 5LW9A 2WZEA 2YB7A 2F17A 1W9YA 5FP3A 5FWJA 1REFA 2LTNA 3CJIC 3H1YA 4XJ8A 3BU7A 4U36A 3SEEA 4AGGA 3LZZA 1O3SA 2ZMKA 4FFHA 2X5IC 4QKDA 4OCTA 1BCXA 5H9RA 2WNUB 1OF3A 3QBQA 3ZKUA 1D2QA 1ZZ9A 1JH5A 4HVOA 2RM22 1XJAA 4E2GA 1OOPA 2VVFA 3KCCA 2ZCWA 2HJIA 4OULA 2RM23 5ABJA 2KA3A 5FZ0A 1T6BX 1WLCA 3RSJA 5BNNC 2JWPA 2RVAA 3SQOA 4QPWA 1W2TA 4LHNA 4OHXA 4Z2AA 3ZYPA 2WFF2 1QXJA 4QKFA 3E6CC 1AR83 3ZYGA 1FNYA 2WWSA 5FY4A 5FZOB 1TME1 4A3ZA 4R9AA 3P6BA 2XL9A 5BYNA 2N7GA 4XFBA 4CPBA 3NNLA 5F3GA 5E88A 3PU3A 4JHZA 4F3JA 1UNBA 2P3YA 1GQGA 2DU0A 5JXJA 4AEDB 3J26N 1AR92 3K3OA 4XF1A 5GKAC 3KV6A 3TWIA 4ET7A 1COV1 1VBB1 3VB9A 5F7UA 4MOAA 3PUAA 2BGCA 2WS92 3H8UA 3OOXA 4XMAA 4CXYA 3WW1A 5FQ0A 5CFCB 1KITA 4GB33 2VCMA 2G9ZA 2OS2A 2A75A 4BQ4A 4LTAA 1CAVA 5A33A 1W8OA 1RITA 4JGYA 2PHTA 2VBBA 3PDQA 1DFQA 1AYM2 1KS5A 2ADDA 4HK8A 4K1YA 4RS5A 3ASIA 3F95A 1MZFA 4D6QA 1HRI2 1GNZA 2GMEA 1GU3A 1HQNA 2BZDA 3K77A 4YW2A 4BIOA 3NL1A 5C3RA 2X10A 1CX1A 2BJSA 3E1F1 3MI8A 4QDSA 1K42A 1Y9QA 4XFCA 2JXAA 3CBNA 4UYBA 2UU8A 1Q56A 4JGZB 1QXPA 1O3QA 4N43A 3AXDA 3AM2A 4Z8BA 4RYDA 5EWSA 2JDNA 2VPVA 5JI9A 2VMHA 5KXCA 4YYOA 4XUOA 3K75B 4XAEA 4BWOA 3DL3A 5HPOA 1WGPA 5C9AC 4MGIE 2BPA2 2VBPA 1DBNA 1QDCA 4IE5A 1V6LA 2OKXA 2OUJA 3U07A 3KZ4C 1KRIA 4EN0A 4YVSA 4AL9A 1I1EA 1S0DA 1ZM1A 4LEJA 1UYXA 1V9U2 2OPKA 2TBVA 1KS4A 3GF6A 3PNAA 3WG2A 4PI2A 2W39A 3POBA 4W50A 1S0CA 5GJ6A 4WZCA 4IEOA 1W2UA 4KG0A 1A34A 1QH6A 3J8F2 4XFAA 4BH9A 1BEV1 3AVRA 5FYMA 3WHUA 4DZGA 3OBRA 5FZ3A 3ZDSA 4YM3A 5CFDA 2WNUA 2GNTA 4L11A 3E5XA 2WWJA 3K4AA 3ZFGA 1YQ6A 5FPUA 2XQXA 1HN0A 5JSRA 4RS5B 5FBZA 2O1QA 4Y4YA 1Q43A 5APAA 4YZ1A 1LGBA 1UOJA 2J42A 3HT1A 1E5SA 4NROA 2P6HA 3PVEA 5FWEA 2ZGOA 4OZXA 5KXDA 3WCSA 5F6KA 4X8NA 1YC61 2B7YA 1S4CA 2E31A 4K8FA 4BXSV 1EUTA 1NCQC 1TE1B 5FYIA 1ULPA 1OMIA 3ILFA 1ASJ3 2P34A 1PIV1 1UY4A 1YIPA 1O6UA 2R32A 2WKKA 3I2IA 4I30A 4P14A 4QU2A 5IVYA 4Z07A 3EJKA 4LJHA 1GWLA 1A6CA 1VBD1 2P1BA 1QNWA 1YFUA 4IV3A 1RVF1 4NPRA 5JZGC 3GJAA 1FMD3 1XE0A 2IXKA 3N3HA 3ZMOA 2VZSA 1CPMA 3JD73 2RDRA 4V2VA 2K9ZA 1D2SA 4CYDA 1MPXA 5FIXA 1OT5A 5FZ1A 2VJXA 2WC2A 5LB6A 1YQ8A 1X7NA 4MHUA 4AFCA 4COZA 1OFNA 3GXUA 1V70A 4WM7C 1ULEA 1VBE2 2PHWA 3I2JA 5F8PA 5I91A 5LEJA 3CDZB 2EAAA 1OBNA 1DCSA 4JTNA 1QIQA 1VBE3 1U5XA 1OHFA 3LGRA 5FP4A 1FOD1 2VW2A 3WW2A 1AYN1 1RUG3 4NOTA 4PBOA 4MGSA 2NZ9A 1XU1A 4IL7A 4YW5A 1VAMA 4E2QA 2G19A 2YC2A 4Z1VA 1QF3A 3RMXA 2BWAA 2QCSB 5FPZA 3EO6A 1CIYA 4KI5M 3OYWA 5LY2A 1POV3 1AL21 1NCQB 4BQ1A 4QAWA 1I5ZA 1OURA 5DDJ1 4IESA 4PQQA 4HBNA 5JLVA 1WCQA 1SDWA 1BVVA 4HL0A 1R092 1AR61 3D0SA 4KWUA 5FJHA 3LEKA 2BQPA 2WFF3 4GWNA 1BLZA 5A3UA 5C4WB 2OX0A 3H3ZA 3JB4C 1ST8A 5FCCA 1NKGA 2I2SA 4GMP0 1OC1A 4Q29A 3NAPC 4TN7A 4WVVA 4M0NA 3THPA 1W8ZA 5LK5A 3VKMA 4N7IA 2ZXQA 2W47A 2RS53 1DGWA 4AQ2A 2WNVA 4FP3A 1ZBA2 4RD7A 3POIA 4DS0A 2Q8CA 4FTSA 4GKXA 4LKEA 4E8DA 3PUIA 2YXSA 2NYYA 3Q8EA 2PHXA 4FAGA 2R6QA 5FZCA 1XNKA 5A7PA 3VBHB 2VZRA 3E5QA 4QKNA 3I59B 3ZVXA 4CDUB 5DAPA 4M0HA 1V6IA 5FJKA 4YW7A 2VZPA 3OGGA 3AMMA 4LKSA 3TNPB 4A3XA 4E4ZA 1OOPB 5BNOA 2PHUA 5DZFA 1AR73 2PAMA 1O3TA 2RM21 1WA6X 1RUI1 1RUD2 4FXGB 3QH7A 4PQ9A 5FZMA 5JMCA 4RQPB 3AYDA 3JBG2 4UFMA 1JMUB 5CZKA 2FMYA 1RC6A 2QZ2A 3FUOA 1W2OA 1UX7A 2PN5A 3QOPA 1DGLA 2WO2A 2MNGA 4UF0A 2C26A 1RJ7A 4YZ5A 1F4HA 2ZX2A 2WFF1 4G9SB 2E6VA 4K7JA 4QM8A 2XJQA 1V6OA 4OMDA 1B09A 4JQTA 3MIEA 2VE1A 5FPBA 4AEDC 2VNVA 1H8TA 3SCHA 1HB4A 1JZ6A 3ZN6A 4AI9A 1JYIA 5F3IA 2QBXA 1RGSA 2FCUA 3N7LA 3FMGA 1JOJA 2EALA 3W21A 4AEKA 1NAEA 3ZPYA 4CEWA 3KSCA 1RHI3 3POFA 2XUMA 4XFFA 4YVWB 2QJVA 4XAAA 1XOYA 4W4ZA 2XJTA 2ID4A 3HPNA 4OI4A 4OVEA 3J7MA 3B69A 4XIOA 3LOIA 2JIGA 5J36A 3JBG3 5CU1A 1N3PA 3MW2A 3RWNA 1E57A 4DINB 1AL23 3D4KA 3DXUA 3FC0A 3I2OA 2W92A 5I8YA 1H2NA 4N9HA 3T0BA 2RMU2 4IV1B 3VBFC 1C8NA 3BUCA 1UL9A 2CAVA 5CEHA 1RVF3 1W03A 1UY0A 2YHJA 4LBLA 1C57A 4B4PA 1LU1A 1W9FA 2QQKA 2XQRA 3TEXA 1HXS1 5FZDA 3OGJA 4MUVA 3ZXLA 5EFUA 2GU9A 5LRRA 1NXD1 3Q9OA 4AQSA 3E6BA 3I49A 5GZGA 4CUCA 4QGLA 4LBMA 1UU5A 5F5CA 4DXRA 1ASJ1 1PIV3 3W59A 5SV5A 4EWAA 3NJVA 1S0JA 5AVAA 4D3WA 3NRUA 3T09A 1G9FA 1QNYA 2YBPA 2BYVE 1H4GA 1XNBA 2VC9A 5ABJC 1OQEA 1DQ0A 2WL1A 4P9LA 2VUCA 4JDMA 1SBEA 5CNAA 3MPPG 1B35C 2VOXA 4OI1A 3WNPA 3O1VA 2PFWA 4LHKA 5EYXA 3N7JA 3GDBA 4AVCA 4FPYA 4LO7A 3CLPA 2HEYF 5EQUA 1H0BA 4KMQA 3LKJA 4FPJA 4B3NA 4N9IA 4NJ4A 4OQ8A 1CONA 3ZYHA 1QMJA 4Q5OA 2RMU3 3RQ0A 1IPSA 3W9AA 2ZHKA 1VLNA 4EZHA 1HV1A 2BGPA 3WOGA 1GZWA 4MLOA 2HH9A 1MEC1 1D4M2 2QQNA 2VMGA 2QNKA 1ODMA 4PIYA 2VULA 3MO4A 4HKWA 4Q4W3 4UF0B 4JGYC 3NJYA 1OPOA 5C5TA 1DHKB 1W28A 1LENA 4LO6B 2EAKA 5F37A 3KQ4B 1S2KA 3PJQA 2UY9A 2QQOA 2VTXA 5FY1A 4D7SA 1RUF2 1LOAA 2ZGNA 1MS8A 2NMOA 5FYHA 4BJ0A 3UT0A 5C3PA 4RR3A 1LHUA 4H14A 5FYYA 2BV4A 1HKDA 3WNXA 1QJFA 3AP9A 4XILA 5L36A 2Y38A 1XRUA 3OGVA 4BHPA 2VMDA 4XE9A 1D0GA 3QD6A 3P1IA 4OUSA 4YLZA 1JZ4A 3H8OA 4N90A 3OUIA 1DQ5A 4GH4A 3MIFA 3VBOB 1YCIA 2QQVA 4AWDA 1S0EA 3ZKYA 3ES4A 3OG2A 1I9RA 3QH6A 4I2OA 3VBUC 1RMU2 4AAPA 3PU8A 4GIQA 2FZ1A 4HONA 4XZPA 3NQHA 4WVMA 3R4SA 2J1RA 1UX6A 5FLHA 1ULGA 5C6CA 1W8TA 2WNVB 4QQLA 5D8AC 4MADA 5JOZA 4BE3A 4URTA 5FZ9A 2X8KA 5C9AA 3EB7A 4Y5Z0 4LLOA 3RZGA 2IZWA 5D8AB 4Q27A 3E97A 1EV12 4I0WB 2RV9A 2ARAA 3BOPA 4HETA 4QWNA 3BTYA 4AVBA 5GZDA 4YM0A 3AP7A 3RZMA 1ZA7A 1UMHA 1VBD3 5T5LA 3H7JA 4FPEA 4MXWA 2ZX4A 3OY8B 3M4FA 1Q3EA 1RUC2 2VOTA 5F9TA 5J3UA 5JVVA 1DU3D 2WWUA 5DDJ2 5B4NA 2IXCA 1AVBA 3INAA 1U5ZA 3FBYA 4UT5A 5A6ZA 1NQJA 1IS4A 1ND2C 2ZEYA 5L7OA 3ZYRA 2OT7A 1JYTA 2A70A 2DUQA 1AR91 1JOPA 3ILNA 3IT8A 3NV3A 5JIUA 1COV2 4LBQD 1YQ5A 3HN1A 4AEJA 1JYNA 4BQ2A 1DF0A 4XJZA 4DNYA 1OA4A 1Y43B 4TLGA 5CBLA 2AC1A 1PO13 2PLV1 2BFUS 4RGGA 3A4UA 1UN1A 4JDOA 4E2SA 3AFKA 4FBFA 1KQRA 1WD3A 1H2KA 2NM1A 4LBQA 2ZGQA 5JPNB 5DUWA 4AEMA 5FZLA 4DQAA 3ZYJB 2Q8OA 3DPRC 2EIGA 2VW1A 3LPGA 4JRLA 5ISLA 3ZFGC 1JYXA 2YC4A 3LCPA 4XXAA 1C28A 1JODA 4BQYA 3OEAA 3VDDA 4YFWA 3WF4A 2BTVC 3A23A 5BUVA 3N9LA 1W6NB 3GCXA 4ATEA 4DO0A 4LITA 3U78A 4WM7A 5C8CA 4LXLA 1R1A2 4ZU7A 2BERA 3BGAA 4CRQA 1GWKA 3DYPA 2VD7A 3MEPA 4CCJA 5B2GB 2QQLA 2VQ0A 3JCIA 4FOVA 3ROUA 3SCGA 3UGFA 2K0GA 4C0HA 4EE2A 3N4MA 3ON7A 5AC93 4UAPA 2ARXA 2YU2A 1UMIA 1VR3A 3DGTA 1FPN3 4R9CA 3W5MA 3HN3A 2X53S 2MHFA 3ZSKA 1HRV2 4FQZA 2XVKA 1CAUA 4BQ5A 3PVNA 4CSWA 2BFUL 2WS93 1QXRA 4KNCA 3IB3A 3UK9A 4KU7A 2D93A 5E89A 5LY1A 3BPSA 4XFIA 4HPKB 1ZA4A 3IMMA 3VD7A 3X29B 4CXXA 3UKVA 2AYHA 3NSTA 1J83A 5FMBA 2Q8EA 4EN9B 2FDJA 4MXVA 3WP6A 4JZRA 1RUE2 4PIXA 3VZMA 5J09A 2VTXJ 4A6SA 1VMJA 1CX4A 4KWKA 3V0BB 5K4LA 5I8TA 3RMYA 3ZFEA 4ONUA 3W20A 3WQBA 2W5FA 2VZ3A 3VHNA 3AXEA 4FP2A 1KDKA 1V00A 1ZBE2 3PIGA 2YGMA 2OYZA 1IS3A 3FWEA 2RS31 3MF6A 4QXHA 4HLTA 3ELNA 3PMSA 5LA9A 1ZRDA 1SLIA 2PA7A 2JJ6A 4L97A 2XLAA 3LA7A 5A3NA 5KBFA 1AJOA 2VZOA 4XEZA 3ATGA 1GV9A 5DAWA 1RYYA 1LOGA 2E7TA 3VD9A 3RNSA 5EJ1B 1SG3A 1AR82 3FFZA 5FMDA 5GALA 5A6XA 5J7MA 5JOWA 5K9YA 2WINB 2Y26A 3WP3A 5IVVA 1TG7A 4ZZ8A 4GWJA 1OLMA 4M01A 2RJ2A 4IE4A 4YM1A 2DCZA 4N7UA 2BVVA 4W6WA 5FAXA 4CCMA 3TB0A 2CWSA 4YFZA 5A3TA 5J1XA 1FXZA 2RDSA 3DECA 2YROA 4UW6A 2EIBA 4N43B 1KXGA 3QLQA 1OA3A 5CB7A 1WWYA 2YC0A 3AYAA 3PURA 2WNVC 1K12A 2EIEA 1VBE1 2G9GA 1LB2A 3D8CA 1HJGA 1Q8VA 4XOGA 1XXNA 2D6LX 3VZKA 5FV3A 5LATA 4JKLA 4RQPC 2MEV3 2PHRA 4PHZA 1VMHA 1LULA 2UWCA 2VZTA 2C9KA 4PF5A 1K5JA 3RJRA 4FFFA 3CMGA 2JKBA 4B4QA 5BNOC 5LA0A 4QQ2A 3ACIA 1PO22 1LHVA 4MGZE 2VTFA 3RWKX 2XONA 1QJX3 1PK6C 2VGDA 4TWTA 3RYKA 3CF6E 4Y22A 2GDFA 3M3CA 5F2SA 1F8VA 1R091 1U12A 3G6JB 3OB8A 5KR7A 4I02A 1HRI3 1XYNA 1RXGA 1AR72 5DZGA 5FP8A 3S0MA 2ORXA 1LHWA 5C4WC 1SMVA 4EROA 3M3EA 3N9OA 3WNLA 3J7NA 5BPXA 5FZFA 1IGOA 5IHRA 3W58A 5A33B 3ZFFB 3D0JA 2W52A 4RHV1 4COUA 3N7KA 4TLFA 4BPZA 5ABJB 4AFBA 2D43A 2WFPA 4KWJA 1MVQA 4U2AA 2WNEA 4B7KA 4WM7B 3WT3A 4ZPIA 1STMA 2AZ5A 3AC0A 4QQOA 4XC9A 3T2PA 1W06A 1LJ7A 2EXKA 3C7EA 3UKTA 2BOIA 1GKBA 1KEXA 4QX2A 1MQTA 3ZFGB 1UY1A 1OXCA 2B9VA 1J3PA 2PQQA 2YDEA 3LFMA 4YVWC 1Q8SA 2W1SA 5F3CA 5D21A 3AZYA 3AJYA 3C7GA 3G7DA 1RUI2 3JUUA 4JVAA 3VBSB 2VOWA 3RYRA 4AI0A 1QKQA 2VZUA 4OI0A 3IKWA 5E6HA 1IKQA 1IG0A 1UZ0A 2C9AA 1UY3A 5JCTA 3N9MA 3THTA 1POQA 1WMDA 3UNPA 3JU9A 3NVCA 5IAXA 4QHZA 2BNNA 2CSGA 2HYKA 5J37A 1LNSA 1ZRFA 3CEWA 3PL0A 4KQ7A 1QJU3 3POSA 4GJYA 2TNFA 1AR93 1F15A 1VRBA 1W99A 2X5IA 3I3DA 5FXWA 3BI3A 1L7RA 4H2AA 4LKFA 2JKXA 1W6QA 5JZGB 1OFSA 4Y5SA 4LO4B 1GLHA 5GZEA 2DU1A 3KM5A 5EIYB 3O14A 3OPTA 3SLIA 2Y33A 2W0XA 1UKGA 5FZKA 3WQ1A 1JOBA 5KHJA 2WN3A 4P9XA 2PMWB 1MS0A 4QDRA 5FXVA 3WP5A 2O8OA 2YV8A 3MLLA 4NHLA 1PHMA 4J1WA 4RFRB 3RVHA 3S7EA 4AZZA 5KHHA 3VUOA 1PVC3 1US2A 4Q4X3 2HWD3 3UGGA 4BOWA 5JSPA 4QM9A 4XDOA 5I0UA 4KU8A 3WR0A 4R8HA 2D6MA 2WAAA 2DDUA 1K5MA 1X9PA 2XVGA 2JDPA 3WDWA 2BW8A 3V0AB 5BXXA 3VBFB 1UWWA 4NIDA 1HXS2 3MLJA 2B42B 5A6YA 3BCWA 4AF9A 3UL2A 3GZUC 4D6SA 4YNIA 1REEA 4AGVA 5C3SA 1HN1A 4P9YA 1LODA 1JXNA 1OI6A 1VBC3 4GMP1 3MPBA 3C7HA 2XB6C 2PAEA 1BVP1 4RN5A 1E5RA 4OHZA 4D7TA 4XJAA 1IS6A 1PZ9A 2GAUA 4XACA 1NA1B 3VBUA 1N1VA 4E8CA 1TME2 2D3RA 3WD5A 1W6MA 1GMMA 3VL8A 1LGCA 1NUKA 4EWDA 4LO5B 2GSYA 3DF0A 3FUQA 4ASKA 3L9JT 1UZWA 4PBPA 1EPWA 4GA9A 3FLTA 5FZBA 3ZXFA 1CZTA 4Y4RA 3CJXA 3BB6A 3ACLA 4YW6A 5L7OC 2XMLA 1IHMA 2ZGTA 5FPVA 5A3MA 4IEUA 3VDAA 1UCXA 2HEWF 1EP0A 1XNAA 4I01A 2R073 2JICA 4FFGA 1VBA2 2A73B 2ZS6B 2W68A 2EXIA 2AREA 1OLME 5ANNA 4HXCA 5FY9A 3KT7A 3VBUB 5L9RA 4LBJA 4DXTA 3USUB 4Q0VA 4DRRA 5A7OA 1PGW1 2Z69A 1OSGA 3TEZA 2R1BA 5EHDA 1SLCA 3ZIXA 2VOKA 3VDBA 3O12A 2RS52 3MW3A 2EVXA 2VUJA 3ACFA 4KH9A 2WLPA 2V5DA 1IQAA 4WM8C 1S2EA 3GBWA 1QJX2 1NYWA 1WMXA 4W65A 4AVTA 4LHLA 5IVBA 2CAUA 4A41A 2ZHLA 4XURA 4CCKA 1WCDJ 1F5JA 1SLLA 2XOMA 1C8M1 1WW5A 2YG0A 2ZMNA 3NO8A 4NRPA 4LHSA 5BV6A 4MH0E 4GH4B 1PX4A 5FYCA 3ALQA 2XJRA 1RUD3 1LESA 3FX3A 2Y6LA 3HAGA 2BEOA 4QXKA 5FR3A 3N35A 4DMIA 1JBCA 3VBRA 4EN8B 1UAIA 3ILRA 4LK6A 2HWF2 1RTVA 2VVEA 3IM0A 3OYWB 2RR12 4Q0UA 5IVFA 1JU3A 2GH8A 1BEV2 1E5IA 3ZR6A 5A7WA 2X29A 1IZ3A 1VIWB 1GOGA 1YXWA 4XCAA 3PMEA 5FLJA 3IDAA 3VDDC 3DXTA 1A8DA 4WZFA 4IV3C 2OIIA 2B46X 1X8MA 4QB2A 1EV11 4CCEA 1FNZA 1PO12 4GB31 5T55A 3WDTA 3SXWA 1W6OB 1PGSA 1PO21 4P00B 2X5IB 1FPN1 4NRMA 4H55A 5A7WB 4CP9A 3U75A 4IV1C 1AJKA 3UKNA 4CDWA 4IE0A 5CADA 1DG6A 2E26A 5C8WA 4YGEA 5IFTA 2VR4A 4IUGA 3O1OA 3ABZA 2F4LA 3VKOA 2WZ8A 1YQ2A 3Q8CA 4FPCA 3WEZA 2QKDA 1SDDB 2WT1A 4XF9A 2ZHMA 3R6SA 2ERFA 2Q1MA 2DURA 2XUEA 2JG8B 2ZGMA 4LORA 4Q4Y2 4XUNA 3URFA 4NN0A 3M7AA 3R05A 3T0AA 4K40A 4QXBA 3CL1A 3LB9A 4F8AA 3BU0A 1EUUA 4Y3OA 3TN91 4GXLA 3RZHA 2ZMLA 1R1ZA 2CU5A 2YMZA 4RL7A 2UURA 3ZFFC 5I0SA 2HLEA 5FK8A 2RS33 1H1IA 4FTEA 1HRV3 4JDNA 1BKZA 4AQTA 5IT6A 1V6JA 3TOJA 1QHDA 1J3RA 2GP3A 1WLDA 2VCBA 1HW5A 1Y9GA 4UFIA 1XBFA 2PELA 4MGTA 3CKHA 3N9PA 4XFGA 4AI2A 3AP4A 1LOEA 1CAXA 1CZSA 4FI9A 2QQUA 4NVPA 1SLTA 2XR4A 2DF7A 5BY5A 2OPWA 5LZ6A 3WHTA 3MV01 1BHGA 3I3MA 4INDA 4BU2A 1W9SA 2IXIA 2B9UA 2JIJA 4W6XA 4CU9A 2BGOA 3O1UA 3I2FA 4IEYA 3ZO0B 5FZAA 1C1LA 1OQDA 2IFRA 3LDKA 3OPZA 4YG3A 4N53B 5J98B 5C7GA 4R4ZA 3ZMNA 2GC0A 5FBJA 4CDUA 4EWEA 2QQIA 1SLAA 4ZXKA 1BMV2 3U14A 1T6GC 1UZYA 5E1RA 5C3OA 1PMIA 3AMPA 3I3EA 2J1VA 2JB8A 2YY1A 3NKTA 4XHBA 5E8AA 5K0UA 1FT9A 3K46A 3VBRB 4IGQA 4M3CA 2VMIA 1ZREA 2BDRA 5IFPA 5JUVA 3LA3A 3N7MA 2R043 5I0TA 1W2NA 2WQZC 3S30A 3VBOC 3SKJE 3CNAA 4JKMA 1LCLA 3WG4A 5I8SA 3LSDA 5CFCA 1VJ2A 1VRH2 2IXLA 4HANA 3WW3A 4BA6A 4NHXA 3ZX7A 1WW4A 4XUPA 4DXZA 5C3QA 3C2UA 4YM2A 2NQYA 4PT6A 2W3JA 1K5MB 2WBKA 1X36A 1XSRA 3I3QA 4OUMA 2TUNA 4HOOA 4WVZA 4ARXA 1FOD3 4OZOA 5FZEA 2WZR2 5ACA1 1JZ3A 3U0ZA 4AE2A 3C8XA 2YGLA 1NLSA 5JAXA 4N8MA 2ZKLA 2LROA 2ZZQA 4K20A 4IGOA 4XF0A 3IBMA 4XQDA 4ZONA 1H9PA 3VZJA 3ZYFA 2GP5A 3GZTB 1C1FA 2AACA 4Y1VA 3SCFA 1AR81 1DYKA 1TEIA 2BP6A 3M8LA 4MYEA 1NA1C 1H2LA 1PM4A 5LBCA 5A3WA 2UWAA 1ZZBA 3T1LA 2R071 3T4VA 3WZ1A 5BNQA 1MEC3 1A3KA 3SH4A 2FBEA 5CAZA 4WBBA 1TQ5A 2IUWA 1RXFA 1DGRA 1SZBA 5FZ8A 1TMF3 4CDXB 1M4WA 4ZXEA 4COVA 1HB3A 3RGBA 4XETA 3VN4A 2WNUC 1ODNA 4NWVA 1FYUA 3J8F1 2WT0A 3CO2A 3H8XA 1XE7A 1NX9A 3BYWA 3MFCA 5FP9A 2QFEA 2OA2A 2W94A 4RA0A 4A42A 3AX4A 1VBA1 2JD4A 1F5FA 1CAUB 4CE8A 2HBTA 1QY4A 3ZN5A 3VDDB 1HQWA 2VZQA 1PM7A 2GMPA 2R063 3HQRA 4ZHNA 2VW0A 5EP9A 3ZM8A 3APBA 2NPIA 4Y1YA 2PHFA 4FPOB 3ORJA 5JR2A 2LW8A 5EJZB 2DV9A 4CU6A 1DGWX 4GULA 2IFWA 1NE4A 2ZGPA 3H1WA 1UKRA 2JDUA 2P4EA 3TEWA 3RZKA 3WF0A 2VBDA 5F5QA 1EYBA 3I2DA 2R041 1OQ1A 2V73A 1CAWA 3WVJA 1EAH2 4XHXA 3T0DA 1ZZ8A 4J1XA 1DDLA 3B94A 5T50A 3VZNA 4S2HA 1JU4A 3AJZA 3MIGA 3POGA 5JPMB 1W8UA 1P8JA 1REDA 4ISQA 2OXBA 1CVNA 4H7MA 4OQ9A 4X8PA 5FOJB 3ACGA 3Q8BA 4XJ9A 1PMJX 4HN0A 4O9GA 3UYJA 4XQ4A 4R9BA 4MXWB 5FYZA 1QJU2 2TEPA 4OHWA 5I0DA 4DIQA 5EYYA 1D4M3 4A7ZA 3KD4A 3U1XA 1LHOA 1UQXA 2VL4A 4CVUA 4DY3A 1JS9A 3RDIA 3ITQA 3AL5A 3J9SA 1AYN2 3P3NA 2Y6JA 2ARBA 4IV1A 4JCKA 4XDPA 2X05A 4BMBA 4OLLA 1ZBE3 1U5YA 2VXJA 3FLPA 4M4RA 1O91A 5E16A 1TZOA 1OH4A 1PO11 3IPVB 4GB32 4LKDA 3VD3A 3C7FA 3WDYA 2Q4SA 3NNMA 1W8NA 2PHLA 4I3GA 5HXVA 2DBNA 2H6CA 4AXOA 2ET1A 4IQPA 2HEVF 4KBZA 4G3YC 1ULFA 3HNYM 4DFSA 2DUPA 2O0OA 3H9AA 5A70A 1RUF1 2YU1A 1DZRA 4NRQA 5FKBA 3ACHA 3LA2A 1JUHA 1L7QA 2JE7A 5FKCA 4ISRA 3VKNA 4CEYA 2VG9A 3NAPA 2Z42A 1I5PA 3E5UA 5A32A 2ES3A 2GH2A 1U0AA 4NPLA 1HIXA 3OBTA 1SFNA 1LU2A 3ZSJA 4XBNA 1W6NA 2BBVA 1BBT1 2WA4A 3GHMA 2CGNA 3LDRA 2Y6KA 3TYJA 2YPDA 2A6XA 5DABA 5FOBB 5K0UB 3NAPB 1TNRA 1CQ9A 4UOJA 2VCCA 1ZBA1 3I2GA 5HCFA 1PO23 1O4TA 5CFDC 2HWB2 1SBDA 4OFGA 1AX2A 1EV13 3ZYIB 5B4XA 1RMU1 1WKYA 4CP1A 3CHXA 1CD3G 4WM8A 5FZOA 3LQCA 3IAQA 3CJIB 4BLIA 1D0HA 3AZVA 3JB8A 4AHZA 1DYOA 2XWBB 4CP2A 2GMMA 1UIJA 3BTAA 4XQWA 4YZ4A 3WNMA 3RZLA 1RUD1 5FPAA 2YBKA 4S2DA 3N9QA 3RG0A 3CQOA 4UBHA 4AQ6A 1U5IA 4Q4V1 2Y8KA 4AGRA 3A21A 3VGIA 5LASA 3WUCA 1YQCA 4NAMA 2UWBA 1RUC1 4ES8A 3OY8A 2XKPA 3H8RA 1CWPA 1NZCA 1PX3A 3FHIB 4XF3A 5IVJA 1BMV1 5F3EA 3KVAA 2ENRA 3MICA 3MIBA 2W46A 3AYCA 1JHNA 2P37A 3LEMA 2R16A 1PVC1 3CU7A 3C7OA 3VBOA 3VLBB 3VV1A 3E6DA 3N9NA 2EF6A 2I45A 1QEXA 2ZABA 3PIJA 2P3JA 1NCRC 2A6YA 1YWKA 2HYXA 3T2QA 4AYUA 4C8DA 2ARCA 3ZDVA 2ETEA 3DYMA 3VKLA 1WMFA 4BQXA 5JXGA 2EA7A 4IGPA 2XH6A 2ZBJA 4H7LA 4K6BA 2WO1A 4Y20B 5AFEA 4FSJA 1LOFA 4BIFA 1L3JA 2PXJA 4CDWC 1FATA 1OUSA 1VRH1 4LBNA 4ZZ5A 4LA2A 2QQPA 5FYSA 4NHYA 1YO8A 2WA3A 4DB5A 1PGW2 1O4YA 4PF1A 4LIVA 3AMNA 3NMBA 3A22A 4Y1ZA 1XC6A 1RUI3 2RS51 4UFLA 5FZ7A 4LUMA 2VMEA 3KV4A 2XLFA 3NV1A 4XPVA 1EY2A 1ND3B 1UF2C 3PUHA 4PJYA 1UXZA 4LNVA 2W1UA 3WW4A 3ETPA 3ZFEB 2OZ6A 4Y5TA 1GZTA 4AHYA 1SFYA 3ZXAC 2YBSA 4NHMA 1VPHA 1WCSA 3FJSA 1LR5A 2J1EA 1BYHA 2WO7A 3ZFFA 1KGYA 2WSUA 3UJOA 5C9AB 4OUEA 1Z0HA 1HRV1 4Q4X2 2LM3A 1IS5A 3PUSA 4RGAA 5F39A 2XBO2 4XZUG 5HBAA 3MHZA 4WVWA 2W9XA 3USUA 4CPBD 1W90A 2XWJB 3ENRA 1JI6A 4JGZA 3NNJA 1ND3A 1KD7A 2DCKA 2RR11 1YJKA 4L92A 4EZ4A 1SCSA 2WZPP 3MF9A 1O4ZA 1HB1A 1MS4A 1WMEA 4SBVA 4PLMA 4MGKE 3OGSA 4ATFA 1RUE1 3OSDA 4UFKA 5GLWA 3ST7A 5CG9A 3GZAA 4MX3A 1QQP1 2JDKA 2JE8A 1GR3A 2QZ3A 3TAYA 1JYVA 4XUQA 4TZDA 2O8QA 4Q4V3 3KQRA 1R081 2Y6HA 2ZAHA 5D1IA 5C8CB 3WQ7A 1Q8PA 2E53A 1GQPA 3BIWE 5JIAA 3U37A 1UOGA 4O65A 5L9VA 2RS32 1L7LA 5L9BA 3ZXKA 5HCAA 5GLVA 3RJ2X 3SMHA 1OOPC 4MZUA 4CCDA 5DUUA 3J7HA 1PK6B 1QWRA 1UYPA 4JAAA 2E33A 1GBGA 2B4KA 1UY2A 3LPFA 5I93A 5FDBA 2FCTA 3S57A 3LWCA 4Q4Y1 5A3OA 4GH4C 2KR2A 1ZBA3 5A7QA 2Q1ZB 5KHGA 1JZ7A 1YNAA 1EAH1 1S1AA 3VZOA 3J4UH 3LDBA 2R0FA 1DLCA 2RG4A 4A2UA 3HJRA 5KWRA 2RR13 3VHPA 4Q4W1 5FY5A 5IW0A 5A32B 1H8TB 2LRPA 4W6YA 3ZXEA 3PVBB 3BALA 4UWDA 2DYCA 1AF9A 4Q1PA 1RUJ2 4AI1A 4L9BA 1QJU1 1X8EA 4NWWA 4QT6A 1NY71 1RUJ3 4ASLA 4GWIA 4DUVA 5A3LA 4BXFA 3I4IA 5JI7A 1BJQA 2P2KA 2FDFA 4JQRA 2WNOA 3HBZA 4RHV3 3FHQA 2C6SA 3JD72 4Z2WA 2ZACA 4UXAA 2D98A 2BUKA 3WQ0A 4V2WA 4CUGA 1RHI2 2WT2A 5FZ4A 2IVIB 1DZTA 1TMF1 3LIGA 3VD4A 2C0ZA 2WO3A 3MLKA 4CDQA 4E4DX 5H9QA 2HWF3 2WUHA 5H9SA 2ZA9A 4GJZA 2CV6A 3O0VA 1W6MB 5CKNA 2AEZA 2XDVA 1WCUA 2O14A 4KBBA 3U4SA 4D69A 1H1MA 2W1QA 3BODA 3BN6A 1KFUL 3TRSB 2DCYA 4AI8A 4BLJA 3ES1A 1Z7S2 1WBLA 3VBSA 4C1XA 1B35A 3IDEA 4QXCA 2AR6A 1HLCA 5FZGA 1FI2A 2DTWA 3M3IA 1DYPA 2SBAA 4UFJA 3FHAA 5JMOA 5T3NA 1GOFA 1AXYA 3HBKA 1AXZA 5LA1A 1A78A 1SPPA 1G86A 2FQPA 2P3IA 3LEGA 3DEMA 3KWVA 1GNYA 3GM8A 4QB6A 3VHRA 3GYDA 2AGSA 1R093 2QVSB 2VCAA 2J1TA 3KMHA 5C8CC 2YUEA 2UY8A 5LWBA 1QH7A 2A5ZA 2WZR1 2R061 4AFAA 4META 1W2AX 2A6VA 1VE0A 1O5LA 3Q8FA 3AP5A 4EV0A 2HWE2 4GKYA 3B7MA 3I2HA 2HWC2 4DUWA 2MEV1 2B5HA 1OVPA 4MV2A 4E9KA 4DEQA 2SLIA 4Q4V2 5DAVA 1UU4A 2PQSA 2XKOA 2YYOA 4Y1XA 4BYYA 1LEDA 2XL7A 2D6PA 1V6KA 3MUZ1 5DG1A 4XBLA 2CY6A 3MFAA 4F7ZA 2FD8A 3HEIA 2QTWB 1ACCA 4QHBA 2AUYA 1RUG2 1LAJA 5EV7A 5A1LA 1H6YA 2VZ1A 1K45A 5FLIA 5FMCA 3ZSMA 5AVPA 2ILMA 3MV11 2A1XA 1PVC2 4B4RA 4LLFA 3P5BA 2IC1A 3HNMA 2FCVA 2ZTNA 3WF3A 4LULA 4TTGA 5IAVA 2JDMA 3NWKA 4XMIA 4DRVA 2D44A 4IE7A 1RUH2 3ECQA 3T08A 5FMOL 4CA9A 1LOBA 2B8MA 4LE4A 2JDZA 4Y24A 2ZGSA 1QJY1 1H8VA 1DZQA 2WRAA 4YWAA 4NIHA 2L9LA 4IEPA 3O7OA 1WLWA 3LAGA 4FAHA 1AYM1 1ZBE1 3I59A 1K3IA 1W04A 1WCKA 2VO5A 1ZX5A 4NAOA 1CJDA 4YRDA 3RI8A 1MS9A 3AKQA 4COWA 3K4ZA 4KGGA 2XJUA 2FDKA 4UBGA 3ZLIA 3T4HB 5K8SA 4LT5A 5IATA 4O7XA 3WDUA 1SHWB 4UFHA 2K46A 1JZ2A 2D40A 2JENA 1MQTB 3UGHA 2R042 2HWD1 4C0BA 2J1UA 4QPGA 1LTEA 4IEZA 4KG8A 4CEYC 3WSOA 2JD9A 2I07B 3EMRA 1DQ1A 2ZX3A 1H1AA 1Y3TA 4LO8A 2D5FA 3ZOIA 1RUH3 2VUDA 1Y4WA 4HZFA 2R0HA 4M3CB 1V9U1 3OD0A 4Q0PA 2XBO1 3DKQA 2RDQA 3R4UA 2UYBA 4QX8A 1G7YA 2CNAA 1OLQA 2R49A 3M3QA 5H9PA 2WQ4A 1LHNA 1MS3A 4C1WA 3SEPA 4YSFA 2YFUA 4V1PA 3RZZA 3KVBA 4K1ZA 4TYSA 1ZRRA 2VQAA 4CXWA 2VNOA 2XLGA 3OUJA 1CAXB 4FPHA 2E63A 5FRAA 4WVMB 3NKGA 2C5DA 1ULOA 2DFCA 3BOWA 3VBHC 4LPLA 3POYA 1IPJA 4YG0A 1HQLA 2HBUA 2PLV3 3IDCB 2GN3A 2DVBA 4P9IA 1UYZA 3MBWA 5JR7B 2CGPA 1W6QB 2Y34A 4L99A 2D6NA 5DQ0A 4AFDA 5JZGA 1PGL2 2VY0A 1ZZ6A 1GNHA 3SNMA 3VL9A 4AG4A 4QPIB 2FHRA 5FYTA 1ZRIA 4MVTA 4RFT0 3M2MA 1FX5A 1XPWA 3POEA 4W8JA 3KCXA 5EPAA 2F6BA 1HV0A 5IYYA 2W08A 4LBOA 2CWMA 3WNKA 5KHIA 5GM0A 3SC7X 2JG9B 2VOVA 4P9WA 1PIV2 1W3VA 4NO4A 3SITA 2Z2SB 4BQ3A 1MZ6A 1SFPA 2AEYA 4B8EA 2J1SA 4EN6B 5IVCA 2EXJA 4JRAA 1JN2P 4A6OA 4HT1T 3O1TA 1ZVFA 1CR7A 3KS7A 1NCQA 3WUDA 4I09A 3CZUA 1NG0A 1RVF2 4QQPA 4P5YA 3KGZA 3UJQA 2VUAA 1BBT2 2H0BA 2JG9A 3LOBA 5SV8A 4CZSA 1YEWA 1KJRA 2CDOA 2IXJA 4Q4W2 2V72A 5AC92 1F35A 2CL2A 2DVAA 3DV8A 1RUJ1 2H0VA 4FQ4A 3V56A 2IVJA 4PLOA 1POV1 2DVDA 1Q8OA 4HMZA 2JG8A 4A7KA 1NY72 4Y22B 5FUIA 5CISA 2V4AA 4D8MA 2VM9A 2ZX0A 3NV2A 5LBFA 3N36A 2BWCA 4IE6A 1J3QA 1O59A 3B93A 5A80A 5GLZA 1IG3A 3RYPA 1LGNA 3ZR5A 4AVVA 4D6RA 2WIIB 5JOYA 4XUTA 4PLNA 4QPIA 4IETA 5GLUA 5F2WA 2JX9A 5L73A 4Q4Y3 2GNMA 4HSLA 5FFOC 1JYCA 2DFBA 5BNPA 1JHJA 3WXPA 5LEKA 5G04L 3Q8AA 4IEWA 1ND3C 1I3HA 5C70A 1CZVA 2E32A 2A7AA 2H6BA 1XE8A 2ZGKA 2GN7A 3LE0A 2QUOA 4YVWA 3WDXA 5KC5A 4QKBA 4CDXC 3NW4A 3EYPA 3ZSLA 3FE5A 1W8FA 2VQTA 1ENRA 3KHBA 1R083 5FUPA 4HPKA 1QU0A 4J6GA 3WINE 2WS91 1QQP3 5DXDA 4JHTA 2NMNA 3AMQA 1RB8G 4M00A 3TN92 2VH9A 1N1TA 1YI7A 3A7QA 4AI3A 3SISA 2VQUA 1W6OA 1GICA 4O61A 4DPNA 5JOXA 3RZJA 1QOOA 1YYNA 1UO9A 1V6NA 2XPJA 4BDVB 2DUOA 2WZR3 4QU1A 4NIAA 5LA2A 4BZ4A 4CDUC 4DEVA 4HFSA 4F83A 2QQMA 4HSJA 4CCNA 2RS12 1S0BA 1RINA 4QHOA 3D82A 3IPVA 4GQ7A 1SEFA 3L2YA 3T2OA 2VVDA 5FXXA 2HKXA 1YI9A 2MEV2 2PTMA 3KGLA 5FPLA 1PNFA 5CVRA 4CEWC 2JDHA 3H1MA 1C5IA 4QX3A 1SQ4A 4A45A 4Q8KA 3VZLA 1ENQA 2V5YA 4XJWA 3GALA 3I2KA 3ZIWA 3LSEA 4ORFA 1GZCA 3RFRA 4XTPA 1CIWA 1APNA 2OW4A 2CDPA 3PHMA 3MIHA 1WA4A 2NN8A 3AL6A 3HR9A 3FZ3A 1AL0G 3BKZA 1H30A 4AFMA 4NMIA 3LEIA 1O5UA 4FOWA 1HDKA 3AZXA 4B7EA 1WW7A 3H3UA 1SCRA 3M1HA 3MUY1 4HKLA 2Z5WA 4QGNA 1Y9MA 2A3WA 1XNDA 3V0AA 3GGLA 4N43C 1BK0A 1UOBA 2WAOA 4L0PA 5FXZA 1JW6A 5HCBA 2BBAA 3GBFA 4XXPA 4FO9A 2IXHA 5FUNA 1N1SA 1UYYA 2ZGLA 5D2AA 1TVGA 1W05A 3AYEA 2W91A 2Y6GA 3QCWA 1QJY2 2YFZA 2P17A 4BK4A 1BZWA 1RUC3 1DQ6A 5DDJ3 2JECA 3I3BA 1N1YA 4G4FA 3H3LA 1DQ4A 1JTZX 2Y0OA 3I97A 1YIFA 2B45X 4FFIA 4CU8A 4I0BA 5FY7A 3B9IA 3LF7A 4ZS3A 4CDQC 5FPXA 3GHNA 2KD7A 3NJZA 1QOSA 3SH3A 1SBFA 3K3NA 5DPNA 1QJX1 4C91A 3U4XA 3V0BA 5EXOA 1OF4A 4DOUA 1HJFA 2ATFA 2WJSA 3R4DB 2XBO3 1QGLA 4NPMA 4CCOA 1F2NA 3NNGA 4RSUA 2CGOA 1XU2A 1QJZA 4FPGA 1ND2A 3GCWA 2OZJA 1S2BA 5F1RA 1C8M3 4N53C 1D7PM 1UPIA 1CPNA 3OTFA 3UV9A 1MZEA 2HWF1 3AZWA 1VB4A 5DAXA 2RE9A 2F4PA 3I7DA 5LK7B 4XABA 1YHFA 1MR5A 4RR3C 1UPSA 2VXRA 4YW3A 3B3QE 3H7YA 3J8F3 4Q0QA 5T54A 1W9WA 3U11A 1CGPA 1C3HA 1UIKA 4OI2A 3RS6A 4C90A 3TN93 5C33A 1H6XA 4QMAA 4LMFA 3OF1A 2Q5TA 2XHNA 5JSOA 2W1WA 3DN7A 3THCA 3FL7A 4D94A 2B39A 5FYBA 4IV3B 3S5QA 2D5HA 1LECA 1FPN2 1O7FA 3GNEA 2CTVA 1Q8QA 4HN1A 4J25A 5F6LB 5FP7A 3QACA 4OHVA 1WD4A 5FZ6A 4LQRA 1EAH3 3IZOA 5FK7A 4CUBA 1W9TA 1OA2A 2Y0IA 5DUVA 1V6MA 4CU7A 5C5UA 2DWRA 2DVFA 3HIFA 1B35B 3SKVA 3ZXJA 4ES9A 2JG9C 2VNRA 1Z7S1 4PCRA 1GP5A 2VU9A 5DMYA 5D8AA 2WSVA 1Q5OA 4CUAA 1ZZ7A 5FYUA 1VB2A 5HV0A 2ET7A 1AXKA 2X09A 3DKWA 4ZS2A 1JYWA 1SLBA 4FTBA 2YPJA 2RDNA 3D5OA 3UESA 2BRTA 4PI0A 2G1MA 4MO3M 4BMEA 3JXSA 4Y20A 2GNBA 1R64A 3OJBA 3SH5A 2OQ7A 4MHRA 2VMFA 4EQVA 2D6KA 1OLRA 2ZOEB 1CJPA 1RL3A 1VMFA 2LALA 1W6PA 4S2GA 5KC6A 3BTXA 3F2ZA 5A6QA 3BPZA 4GD4A 4FCAA 3ZYBA 3OBAA 3KV9A 2HWE1 4JC1A 4QPGC 4CEWB 2BNMA 1XQNA 2HWC1 3AP6A 4E27A 4QX0A 5BNPC 1FMD1 2OUHA 1J1LA 3T1MA 1HXS3 1V9U3 1X33A 2KM2A 2XG3A 2JE9A 4LA3A 3AB0A 1VBA3 3IWZA 3HVDA 1VALA 1BQPA 1NT0A 3OPWA 4TSVA 1YUDA 4R4XA 1H9WA 2DVGA 3WV6A 4AHWA 5HCHA 1CAVB 4ASMB 3LIHA 1RJ8A 3CZJA 4UW5A 5LBBA 1GP4A 5J96B 3VBRC 5CFCC 4COYA 1ZZCA 4LBKA 1OUXA 3KF3A 4BM8A 2Z79A 3ETQA 1GYKA 4GZ9A 4YPJA 2XGXA 1G8WA 1NQDA 3KHCA 1OD5A 4FPKA 4MG2A 2K2SA 4URAA 2KXLA 1OVSA 1VBC2 4L8QA 4Y26A 2WQ8A 2NP0A 4WV8A 4XDQA 4M3CE 1W0PA 4BISA 5FO9B 4QX7A 1VBB3 1BK1A 3MIDA 4AEDA 1GANA 2ADEA 5LBEA 4ZU5A 3HQXA 2WABA 3S5AA 2ZAAA 5ACA2 1CN1A 1M06G 3R0RA 1G9CA 2I74A 3TEYA 5T5OA 4BQWA 1HX6A 1DP0A 1YFXA 4P02B 5ACA3 5JXHA 2JG8C 4FT8A 1BEV3 4NE9A 1Z7S3 1N3QA 1O8PA 2ZEXA 2D97A 3ME2A 5BNNB 5CKQA 3FFQA 1PK6A 2C24A 1ASJ2 2ZJCA 4FVVA 3H50A 3PUQA 5LRSA 2HWD2 2DCJA 1LOFC 4PDWA 4EYUA 5T5JA 1QJEA 4OMCA 4YGDA 2PHDA 2R072 1GUIA 4NHKA 1YJLA 3KT4A 3AVSA 3UETA 3FLRA 2E7QA 3AKTA 4Z92B 4IERA 2VAUA 2D3SA 3USSA 2XXZA 5CKMA 4A44A 4PDWB 1Z78A 1AX0A 3DPRB 2DCTA 4UI9L 5FY8A 2LS6A 1J59A 1SPPB 2XVLA 1MZ5A 1MS1A 1VBB2 4LK7A 5FZIA 1BXHA 4R52A 3I54A 4AVAA 1US3A 3HD8B 2J1AA 1MS5A 2ZGRA 2C1FA 2E51A 2EICA 2HWE3 4AAXA 5FYVA 4BCUA 3CJIA 3AKPA 3RPQA 1OD3A 2QDNA 3AKRA 4XJUA 2RHPA 5IVEA 4QD2A 1ZRCA 3P3PA 4M4PA 4GWMA 5FREA 3GJBA 4AR2A 5IJRA 1D4M1 3WCRA 2XJSA 1HRI1 3KV5A 5BNOB 4JV4A 4CCLA 4CP9B 2WLQA 4CP0A 5EJ3A 3BIEA 4Y1UA 2XHKA 4YARA 1POV0 1IQDC 2VMCA 4QPIC 4CDXA 2Q0AA 4XBQA 5EZWA 3V65A 4S2FA 5GZCA 2ZZJA 5BNNA 5M0TA 1J1TA 5DG2A 1E5HA 1IPKA 5FZHA 5G05L 3RI9A 2Z4FA 4WM8B 3FBMA 1DIWA 3EBRA 2QQWA 4UW4A 1UMZA 4RQPA 4AK3A 4A4AA 4YG6A 1S0FA 3HMYA 1Y7BA 1FAYA 5K0UC 3H42B 1TME3 3CIHA 4MSVA 1CAWB 5IK7A 2QDRA 5I0RA 3O1MA 1RUF3 4AW7A 3B01A 1UZVA 1F4AA 3WNNA 1J84A 1GSLA 1AYM3 2ORZA 3H0OA 3IIAA 3O0XA 1LKNA 4IEVA 3O1RA 4Q8LA 4A7YA 4YGCA 3LD8A 2UYAA 1GQHA 4LR4A 5CIRA 5GZFA 2GC2A 1X82A 1NXMA 3VDCA 4MGYE 5L7OB 1DQ2A 4B29A 2GNDA 1XSQA 1OKOA 4IEQA 2LUWA 1NZIA 4RS5C 1NOVA 3M70A 1UD1A 1W8WA 1QQP2 3PVOA 4QB1A 3IN9A 4FOYA 4B1MA 5C4WA 4E4HA 1K5MC 2Q1FA 4P5HA 3T30A 1W6PB 1DGRN 3IMNA 4GALA 1GP6A 1VRH3 5BNPB 3HT2A 3AKSA 3WG3A 4YZ2A 2G9FA 5KXEA 3W5NA 1AUYA 5KXBA 1IOAA 2BU9A 5IK4A 1QOTA 1RIRA 1NA1A 2EIDA 2VECA 4JGYB 3WP4A 3MW4A 2VNGA 3HWJA 5A1FA 4XFHA 4IEXA 1W3XA 5JWPA 1JZ8A 1W39A 1MQTC 2ZEZA 3O0WA 4NR1A 4Z82A 3I8TA 1VBD2 1YFYA 4YGBA 5HI0A 1S0IA 2W87A 2CYFA 5ERLA 5A1AA 1GFF2 3M3OA 3ZXGA 4XF4A 1CESA 4R9DA 2JEMA 1MVEA 5FTTC 1UOFA 4TXWA 2Y64A 3OD4A 4NIIA 1KDMA 1X50A 2PLV2 4BB3A 4CCCA 2YZ4A 4XW3A 4M3CF 1KJLA 4RHV2 2P5BA 1ULDA 2HWB1 1IKPA 1KFXL 3B00A 3BTZA 1RUNA 1PMHX 2WDBA 5FO8B 1RUOA 2RS11 5JXIA 1RMU3 1AZDA 4L2NA 3AMHA 4GMP3 1XNCA 2FDHA 3KF5A 3U10A 2BOJA 2HWC3 4UW3A 1FOD2 2VZVA 3T2TA 3VBSC 3WG1A 3NJXA 4YW1A 5FMOS 5IUQA 3JD71 1NE6A 1R1A1 1C4RA 1GWMA 1VAVA 1UZZA 2GC3A 2PAKA 1FMD2 1RHI1 1YFWA 4QPGB 3GBGA 1S0GA 4DUXA 3B02A 4YVSC 1TMF2 1ZYBA 3A0NA 1WBFA 4Q1RA 1GZWB 1WUVA 3DPRA 1FV2A 2MPFA 1AL22 3EQEA 2Q8DA 3PTRB 2EXHA 4LE3A 3BVCA 2FDIA 4LBQB 4CTEA 1NCRA 4KWLA 3O1PA 3IDBB 4HG6B 2OVUA 3OBZA 3WY6A 4X6QB 2Q30A 4AHXA 4Q0SA 1VP6A 2JDAA 3DYOA 3MYXA 1BBT3 4QPYA 4K9SA 4RR3B 4D0QA 3D6EA 4N53A 2D6OX 2R30A 1ND2B 5F5IA 3IAPA 1ULCA 4Y33A 4GAZA 4XTMA 5JDBA 4NIGA 1COV3 4E4SA 1ONAA 2A3XA 1WW6A 3VHOA 3S7IA 2AENA 4ZU4A 4QDQA 1VBC1 2Y6FA 3HQUA 4I3PA 4AOCA 5DZEA 3OUHA 1ZNPA 3T3YA 3WNOA 2ZX1A 2ZGUA 4EJRA 2P3KA 3KB5A 4RGKA 5L19A 2A3YA 2R062 1ENSA 3KT1A 1LOCA 1D4VB 1LEMA 1NLRA 5CA6A 2DTYA 4XIKA 1G9AA 1S55A 1A8MA 2FDGA 2NLRA 2QQJA 4HVQA 1PZ8A 4KGQA 1GOHA 3PJYA 4BK5A 1OPMA 3JBG1 4QX1A 4P08A 4P9JA 3OCPA 2G4IA 4K8RB 5AFBA 4KL1A 3ZFEC 2A6ZA 4MGQA 4K3UA 5FO7B 3HOBA 5T5PA 4LOTA 3EXUA 3TBDA 3VKFC 4ARYA 5ANQA 1RUG1 4FXKB 4JTOA 2D7FA 1PZ7A 4Q4X1 1PVXA 5J48A 1GZ9A 2GC1A 1C5HA 1XNTA 2R1DA 5LCWL 1URXA 2AH2A 2WR9A 2E9QA 5F5AA 2IWGB 2ZHNA 4XYXA 3THDA 3V64A 2RS13 5DN2A 4ZY9A 3WLUA 1TNFA 3ZN6B 3K48A 1XB9A 1RUH1 2OQ6A 2J7MA 3OGRA 4CDWB 2WN2A 1G9BA 1G6NA 4OHYA 5IWFA 2DBIA 2WYSA 4LOSA 2BVBA 3PLQA 1H4HA 2CHHA 1RUE3 4LIUA 3ZN4A 5CFDB 1W8HA 1O3RA 4ITCA 3A0KA 4IDZA 2P6CA 1R082 3VD5A 3B9CA 3DUIA 1HB2A 1ENXA 1PNGA 3EHKA 1YRZA 4JKKA 4Q2FA 5HV4A 5DUXA 4YVSB 5TSWA 1WZXA 5C71A 1DLLA 3JZVA 2RMU1 5CYYA 3FN9A 4JGZC 3ZSEA 3WX5A 5F32A 1YLLA 2XJPA 5GLTA 3PTYA 2J22A 2JDYA 3MZHA 3B5LB 2FMDA 4FPFA 4D7YA 1EPZA 3VBHA 3C3VA 4SLIA 1AR71 4HKOA 4QGMA 3WDVA 5DAQA 1QJY3 4JX0A 4CEYB 3MDPA 1C8M2 3K51A 3AK0A 1W0OA 3SHRA 1H2MA 4AVSA 3WF1A 5A3PA 1H8TC 1N3OA 2ZPXA 1F9KA 3AZZA 2W95A 3J7LA 3JQWA 3ZXDA 4DXSA 1AR63 1SACA 3MGUA 1T2XA 1AHSA 2GZWA 2R7EB 1UW8A 5T52A 1G9DA 4X6RB 4DY5A 2W2IA 4B1LA 4OYUA 1OH3A 4I0AA 1XYPA 3AFGA 5A7NA 1JUIA 5K7PA 2HWB3 2WYFA 3ZPOA 4FOQA 2QE3A 5FQ0B 1UU6A 3DCQA 1X9TA 5IK8A 4Q26A 4K21A 2GALA 4IW3A 1FV3A 1MACA 4IXLA 2RJLA 4YW4A 3POJA 1LRHA 2A6WA 4HK9A 3POWA 1PGL1 4H3WA 3KLSA 4XVHA 1OKQA 1NLQA 3LFIA 1I6XA 1R1A3 3K2OA 3OEBA 1MEC2 3HNBM 1VAKA 4HVRA 4ZKTB 4P9GA 3O5SA 3L2HA 2V09A 3O1SA 4CDQB 3GZEA 3KCYA 1ALYA 1V0AA 5FY0A 1QDOA 4LUKA 4O9EA 1O8SA 4QQHA 3IIIA
chains in the Genus database with same CATH topology
4PDWC 1WLTA 2PYTA 5IK5A 1AR62 3VBFA 2D3PA 4EN7B 1AYN3 3NV4A 3TNQA 4FPLA 3S6PA 1AX1A 2E7AA 2A71A 4PIZA 4QX5A 1J58A 1NCRB 1N47A 5CG8A 2XJVA 4YZ3A 5KHKA 2FZ2A 5AC91 1F31A 3JQXA 3RRDA 1XYOA 2BNOA 2ZKNA 2RJKA 1REFA 2LTNA 3CJIC 3H1YA 4XJ8A 3BU7A 4U36A 4AGGA 3LZZA 1O3SA 2ZMKA 2X5IC 1BCXA 5H9RA 2WNUB 3QBQA 1D2QA 1ZZ9A 1JH5A 4HVOA 2RM22 4E2GA 1OOPA 2VVFA 3KCCA 2ZCWA 2HJIA 4OULA 2RM23 5ABJA 2KA3A 1WLCA 3RSJA 5BNNC 4LHNA 4OHXA 3ZYPA 2WFF2 1QXJA 3E6CC 1AR83 3ZYGA 1FNYA 2WWSA 1TME1 4R9AA 2XL9A 5BYNA 2N7GA 4XFBA 5E88A 4F3JA 1GQGA 2DU0A 4AEDB 3J26N 1AR92 4XF1A 5GKAC 3TWIA 1COV1 1VBB1 2BGCA 2WS92 3H8UA 4XMAA 3WW1A 5FQ0A 5CFCB 1KITA 4GB33 2A75A 4LTAA 1CAVA 5A33A 1RITA 4JGYA 2PHTA 4RS5A 1DFQA 1AYM2 1KS5A 4HK8A 4K1YA 3ASIA 1MZFA 1GNZA 1HRI2 2GMEA 1HQNA 4BIOA 4YW2A 3NL1A 3MI8A 1Y9QA 4XFCA 2JXAA 2UU8A 1Q56A 4JGZB 1QXPA 1O3QA 4N43A 3AXDA 3AM2A 4Z8BA 5EWSA 5KXCA 2VPVA 5JI9A 2VMHA 4YYOA 4BWOA 3DL3A 1WGPA 5C9AC 4MGIE 2BPA2 1DBNA 1QDCA 3U07A 1V6LA 1KRIA 2OUJA 3KZ4C 4EN0A 4YVSA 1I1EA 1S0DA 1ZM1A 4LEJA 2OPKA 1V9U2 2TBVA 1KS4A 3GF6A 3PNAA 3WG2A 2W39A 1S0CA 5GJ6A 4WZCA 4IEOA 1W2UA 4KG0A 1QH6A 3J8F2 4XFAA 4BH9A 1BEV1 3WHUA 4DZGA 3OBRA 3ZDSA 4YM3A 5CFDA 2WNUA 2GNTA 4L11A 3E5XA 3ZFGA 5JSRA 4RS5B 5FBZA 2O1QA 4Y4YA 1Q43A 4YZ1A 1LGBA 3HT1A 3PVEA 2ZGOA 4OZXA 5KXDA 3WCSA 5F6KA 4X8NA 2B7YA 4K8FA 1NCQC 1TE1B 4DB5A 1OMIA 3ILFA 1ASJ3 1PIV1 1YIPA 2P34A 2R32A 2WKKA 4I30A 4P14A 4QU2A 4COVA 4Z07A 3EJKA 1A6CA 1VBD1 1QNWA 1YFUA 4IV3A 1RVF1 4NPRA 5JZGC 1FMD3 2IXKA 3N3HA 3ZMOA 1CPMA 3JD73 2K9ZA 1D2SA 4CYDA 2WC2A 1X7NA 4AFCA 4COZA 1OFNA 1V70A 4WM7C 1ULEA 1VBE2 2PHWA 5I91A 5LEJA 2EAAA 4JTNA 1VBE3 1U5XA 1OHFA 3LGRA 1FOD1 2VW2A 3WW2A 1AYN1 1RUG3 4NOTA 4PBOA 2NZ9A 1XU1A 4IL7A 4YW5A 1VAMA 4E2QA 4Z1VA 1QF3A 3RMXA 2BWAA 2QCSB 5FPZA 3EO6A 3OYWA 1POV3 1AL21 1NCQB 4BQ1A 1I5ZA 5DDJ1 4IESA 4HBNA 5JLVA 1SDWA 1BVVA 4HL0A 1R092 1AR61 3D0SA 2BQPA 2WFF3 4GWNA 5C4WB 3H3ZA 3JB4C 5FCCA 4GMP0 2I2SA 4Q29A 3NAPC 4WVVA 4M0NA 3THPA 5LK5A 3VKMA 4N7IA 2RS53 1DGWA 4AQ2A 2WNVA 4FP3A 1ZBA2 4RD7A 4DS0A 4FTSA 4GKXA 2YXSA 2NYYA 2PHXA 4FAGA 2R6QA 3VBHB 1XNKA 3E5QA 3I59B 3ZVXA 4CDUB 4M0HA 1V6IA 3OGGA 3AMMA 3TNPB 4E4ZA 4A3XA 5BNOA 1OOPB 2PHUA 5DZFA 1AR73 2PAMA 1O3TA 2RM21 1RUI1 1RUD2 4FXGB 3QH7A 4PQ9A 5JMCA 4RQPB 3AYDA 3JBG2 2FMYA 1RC6A 2QZ2A 3FUOA 2PN5A 3QOPA 1DGLA 2MNGA 4YZ5A 1RJ7A 2ZX2A 2WFF1 4G9SB 2E6VA 4K7JA 4QM8A 2XJQA 1V6OA 1B09A 3MIEA 4AEDC 1H8TA 3SCHA 3ZN6A 1JYIA 1RGSA 3N7LA 3FMGA 1JOJA 2EALA 4AEKA 3ZPYA 4CEWA 3KSCA 1RHI3 2XUMA 4XFFA 4YVWB 2QJVA 2XJTA 4OI4A 4OVEA 3B69A 4XIOA 3LOIA 5J36A 3JBG3 5CU1A 1N3PA 3MW2A 3RWNA 1E57A 4DINB 1AL23 3D4KA 3FC0A 5I8YA 1H2NA 4N9HA 3VBFC 2RMU2 4IV1B 1C8NA 1UL9A 2CAVA 1RVF3 2YHJA 4LBLA 4B4PA 1C57A 1LU1A 1HXS1 3OGJA 4MUVA 3ZXLA 5EFUA 2GU9A 5LRRA 1NXD1 3Q9OA 4AQSA 3E6BA 5GZGA 4QGLA 4LBMA 1UU5A 1ASJ1 1PIV3 3W59A 5SV5A 4EWAA 1S0JA 5AVAA 4D3WA 1G9FA 1QNYA 2BYVE 1H4GA 1XNBA 5ABJC 1OQEA 1DQ0A 2WL1A 4P9LA 4JDMA 1SBEA 5CNAA 3MPPG 1B35C 2VOXA 4OI1A 2PFWA 4LHKA 5EYXA 3N7JA 4AVCA 4FPYA 4LO7A 3CLPA 2HEYF 1H0BA 3LKJA 4FPJA 4B3NA 4N9IA 1CONA 1QMJA 2RMU3 3RQ0A 3W9AA 2ZHKA 1VLNA 1HV1A 3WOGA 1GZWA 4MLOA 2VMGA 1MEC1 1D4M2 4PIYA 2QNKA 2VULA 4HKWA 4Q4W3 4JGYC 1OPOA 1DHKB 1LENA 4LO6B 2EAKA 1S2KA 3PJQA 2UY9A 4D7SA 1RUF2 1LOAA 2ZGNA 1MS8A 2NMOA 4RR3A 1LHUA 4H14A 1HKDA 3WNXA 3AP9A 4XILA 5L36A 2Y38A 1XRUA 4BHPA 4XE9A 1D0GA 3QD6A 4OUSA 4YLZA 4N90A 1DQ5A 4GH4A 3MIFA 3VBOB 1YCIA 4AWDA 1S0EA 3ES4A 1I9RA 3QH6A 4I2OA 3VBUC 1RMU2 4GIQA 2FZ1A 4XZPA 4WVMA 3R4SA 1UX6A 5FLHA 1ULGA 5C6CA 2WNVB 4QQLA 5D8AC 5JOZA 4BE3A 4URTA 2X8KA 5C9AA 4Y5Z0 4LLOA 2IZWA 5D8AB 4Q27A 3E97A 1EV12 4I0WB 3BOPA 4HETA 4AVBA 5GZDA 4YM0A 3AP7A 1VBD3 5T5LA 3H7JA 4FPEA 4MXWA 2ZX4A 3OY8B 3M4FA 1Q3EA 1RUC2 5F9TA 5J3UA 5JVVA 1DU3D 5DDJ2 2IXCA 1AVBA 3INAA 1U5ZA 3FBYA 1NQJA 1IS4A 1ND2C 5L7OA 3ZYRA 2A70A 2DUQA 1AR91 3ILNA 3IT8A 3NV3A 5JIUA 1COV2 4LBQD 3HN1A 4AEJA 1DF0A 4XJZA 4DNYA 1OA4A 1Y43B 5CBLA 1PO13 2PLV1 2BFUS 4RGGA 3A4UA 1UN1A 4JDOA 4E2SA 3AFKA 4FBFA 1KQRA 1WD3A 1H2KA 2NM1A 4LBQA 2ZGQA 5JPNB 5DUWA 4AEMA 4DQAA 3ZYJB 2Q8OA 3DPRC 2EIGA 2VW1A 4JRLA 3ZFGC 3LCPA 4XXAA 1C28A 3VDDA 4YFWA 2BTVC 5BUVA 1W6NB 4ATEA 4WM7A 5C8CA 1R1A2 4ZU7A 4CRQA 3MEPA 5B2GB 4FOVA 2VQ0A 3JCIA 3ROUA 3SCGA 2K0GA 4C0HA 3N4MA 5AC93 2ARXA 4R9CA 1VR3A 3DGTA 1FPN3 2X53S 2MHFA 3ZSKA 1HRV2 4FQZA 2XVKA 1CAUA 3PVNA 2BFUL 2WS93 1QXRA 4KNCA 3UK9A 4KU7A 2D93A 5E89A 4XFIA 3X29B 4HPKB 1ZA4A 3UKVA 2AYHA 3NSTA 4EN9B 4MXVA 3WP6A 1RUE2 4PIXA 3VZMA 5J09A 1CX4A 4KWKA 3V0BB 5I8TA 3RMYA 3ZFEA 4ONUA 3VHNA 3AXEA 4FP2A 1KDKA 1V00A 1ZBE2 2YGMA 2OYZA 1IS3A 3FWEA 2RS31 3MF6A 4HLTA 3ELNA 3PMSA 1ZRDA 1SLIA 2PA7A 2JJ6A 4L97A 2XLAA 3LA7A 5KBFA 1AJOA 4XEZA 3ATGA 1GV9A 1LOGA 2E7TA 3RNSA 1AR82 3FFZA 5GALA 5K9YA 5J7MA 5JOWA 2WINB 2Y26A 3WP3A 4M01A 4YM1A 2DCZA 4N7UA 2BVVA 4W6WA 5FAXA 3TB0A 2CWSA 4YFZA 1FXZA 4UW6A 2YROA 4N43B 1KXGA 3QLQA 1OA3A 5CB7A 2YC0A 3AYAA 1LB2A 2WNVC 1VBE1 2G9GA 3D8CA 1Q8VA 4XOGA 1XXNA 2D6LX 3VZKA 4RQPC 2MEV3 2PHRA 1LULA 2UWCA 4PF5A 3RJRA 4B4QA 2JKBA 5BNOC 4QQ2A 1PO22 1LHVA 4MGZE 1QJX3 1PK6C 2VGDA 4TWTA 3RYKA 3CF6E 4Y22A 2GDFA 3M3CA 1F8VA 1R091 1U12A 3G6JB 4I02A 1HRI3 1XYNA 1AR72 5DZGA 3S0MA 1LHWA 5C4WC 1SMVA 4EROA 3M3EA 5BPXA 1IGOA 3W58A 5A33B 3ZFFB 3D0JA 2W52A 4RHV1 4COUA 3N7KA 4TLFA 4BPZA 5ABJB 4AFBA 2D43A 2WFPA 4KWJA 1MVQA 4U2AA 2WNEA 4B7KA 4WM7B 3WT3A 2AZ5A 4QQOA 3UKTA 1LJ7A 2EXKA 1GKBA 1MQTA 3ZFGB 4YVWC 1J3PA 2PQQA 2YDEA 1Q8SA 3AZYA 3AJYA 3G7DA 1RUI2 3JUUA 4JVAA 3VBSB 2VOWA 3RYRA 4AI0A 1QKQA 4OI0A 3IKWA 1IKQA 2C9AA 5JCTA 3THTA 1WMDA 3JU9A 3NVCA 2BNNA 2HYKA 5J37A 1ZRFA 3CEWA 4KQ7A 1QJU3 3POSA 2TNFA 1AR93 2X5IA 1W6QA 5JZGB 1OFSA 5GZEA 4LO4B 1GLHA 2DU1A 3KM5A 3O14A 3SLIA 3WQ1A 2W0XA 1UKGA 5KHJA 4P9XA 1MS0A 3WP5A 2O8OA 2YV8A 3MLLA 4NHLA 1PHMA 4J1WA 3S7EA 3VUOA 5KHHA 1PVC3 4Q4X3 2HWD3 4BOWA 5JSPA 4QM9A 5I0UA 4KU8A 3WR0A 4R8HA 2D6MA 1K5MA 2XVGA 3WDWA 3V0AB 2BW8A 5BXXA 3VBFB 1HXS2 3MLJA 2B42B 3BCWA 4AF9A 3UL2A 3GZUC 4YNIA 1REEA 4AGVA 4P9YA 1LODA 1JXNA 1OI6A 1VBC3 4GMP1 3MPBA 2XB6C 2PAEA 1BVP1 4OHZA 4D7TA 4XJAA 1IS6A 1PZ9A 2GAUA 1NA1B 3VBUA 1N1VA 1TME2 2D3RA 3WD5A 1W6MA 3VL8A 1LGCA 4EWDA 4LO5B 2GSYA 3DF0A 3FUQA 3L9JT 4PBPA 1EPWA 4GA9A 3FLTA 3ZXFA 3CJXA 3BB6A 3ACLA 5L7OC 2ZGTA 1IHMA 5A3MA 4IEUA 1UCXA 2HEWF 1EP0A 4I01A 2R073 2JICA 1VBA2 2A73B 2ZS6B 2W68A 2EXIA 2AREA 3KT7A 3VBUB 4LBJA 3USUB 4Q0VA 4DRRA 1PGW1 2Z69A 1OSGA 2R1BA 1SLCA 3ZIXA 2VOKA 3O12A 2RS52 3MW3A 2EVXA 2VUJA 4KH9A 2WLPA 4WM8C 1IQAA 3GBWA 1QJX2 1NYWA 4W65A 4AVTA 4LHLA 2CAUA 2ZHLA 1WCDJ 1F5JA 1SLLA 1C8M1 1WW5A 2ZMNA 3NO8A 5BV6A 4MH0E 4GH4B 3ALQA 2XJRA 1RUD3 1LESA 3FX3A 3HAGA 2BEOA 4QXKA 3N35A 4DMIA 1JBCA 3VBRA 4EN8B 1UAIA 3ILRA 2HWF2 1RTVA 2VVEA 3IM0A 3OYWB 2RR12 4Q0UA 2GH8A 1BEV2 2X29A 1IZ3A 1VIWB 1YXWA 3PMEA 5FLJA 3VDDC 1A8DA 4WZFA 4IV3C 2OIIA 2B46X 1X8MA 1EV11 1FNZA 1PO12 4GB31 5T55A 3WDTA 3SXWA 1W6OB 1PGSA 1PO21 2X5IB 1FPN1 4H55A 5CADA 4CDWA 4IV1C 1AJKA 3UKNA 1DG6A 5C8WA 4YGEA 3VKOA 4FPCA 2QKDA 2WT1A 4XF9A 2ZHMA 3R6SA 2ERFA 2Q1MA 2DURA 2JG8B 2ZGMA 4Q4Y2 3URFA 4NN0A 3M7AA 3R05A 4K40A 3CL1A 3LB9A 4F8AA 3TN91 4GXLA 2ZMLA 1R1ZA 2YMZA 4RL7A 2UURA 3ZFFC 5I0SA 2RS33 1H1IA 4FTEA 1HRV3 4JDNA 1BKZA 4AQTA 5IT6A 1V6JA 3TOJA 1QHDA 1J3RA 1WLDA 1HW5A 2PELA 4XFGA 4AI2A 3AP4A 1LOEA 1CAXA 4NVPA 1SLTA 2DF7A 5BY5A 3WHTA 4INDA 2IXIA 2B9UA 4W6XA 4IEYA 3ZO0B 1C1LA 1OQDA 2IFRA 3OPZA 4YG3A 4N53B 5J98B 4R4ZA 3ZMNA 2GC0A 4CDUA 4EWEA 1SLAA 4ZXKA 1BMV2 1T6GC 1UZYA 5E1RA 1PMIA 3AMPA 3NKTA 2YY1A 4XHBA 5E8AA 5K0UA 3VBRB 1FT9A 4M3CA 2VMIA 1ZREA 3LA3A 3N7MA 2R043 5I0TA 2WQZC 3S30A 3VBOC 3CNAA 1LCLA 3WG4A 5I8SA 3LSDA 5CFCA 1VJ2A 1VRH2 2IXLA 4HANA 3WW3A 4BA6A 3ZX7A 1WW4A 4DXZA 3C2UA 4YM2A 2NQYA 1K5MB 1X36A 4OUMA 2TUNA 4WVZA 1FOD3