1C1HA

Crystal structure of bacillus subtilis ferrochelatase in complex with n-methyl mesoporphyrin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
306
structure length
306
Chain Sequence
KMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic basis of porphyrin metallation by ferrochelatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords FERROCHELATASE
total genus 121
structure length 306
sequence length 306
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c1hA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c1hA02
3HCOA 2XVZA 1C1HA 2Q2OA 2AC4A 2Q2NA 3W1WA 2H1VA 1AK1A 2H1WA 4CCSA 1QGOA 2QD3A 3AQIA 2PNJA 2HRCA 2HK6A 2AC2A 4KLAA 4MK4A 2PO7A 2QD4A 1HRKA 4KLRA 1C9EA 2PO5A 2XWPA 2XVYA 3LYHA 1L8XA 3HCNA 3M4ZA 4KMMA 1N0IA 2QD1A 3HCPA 2XWQA 2Q3JA 1LBQA 1LD3A 2XWSA 2HREA 3HCRA 2QD2A 1TJNA 4KLCA 3GOQA 2C8JA 2QD5A 1DOZA 2JH3A 2DJ5A 2XVXA 4F4DA
chains in the Genus database with same CATH superfamily
1XZAA 1QXSA 4CQNA 2RAVA 1NG9A 3FMOB 2CEAA 3GOHA 4MUKA 4O3MA 4MWTA 5I45A 3DYIA 1V3QE 4CM9D 3JSAA 3IEUA 3HDHA 4AYTA 1IMOA 1M2JA 2J0VA 2XE6A 3H4TA 3MWLA 3MBIA 3P0EA 4UFNA 5DGTA 4ZV4A 2CSXA 1Z8DA 5A62A 1RJEA 1IXSB 1A9XA 4DMCA 4QGAA 2C96A 2PMCA 1UKBA 1GPAA 1D9ZA 4LN1A 1IVSA 3LBNA 4OA8A 1HA3A 1F14A 2DUMA 1CQXA 2TMGA 5FI1B 3K0FB 4F4HA 1NP6A 4K9KA 4IF6A 1OA0A 4R54A 1UFOA 5CVTA 4XIFA 1FFBA 4IVNA 4NQZA 3UH1A 4CCYA 3UO8B 1FDTA 1JXOA 1N2GA 1DIAA 1ZMRA 3O8LA 4N5LA 4OM8A 6YASA 5JZSA 1N9KA 2FWNA 3ZUGA 3E9RA 1E9SA 4W6ZA 3MTDA 5CPBA 3S5UA 2VZEA 3BJRA 3EVNA 4LF5B 1BXGB 2ZZKA 1US8B 2G40A 3HY4A 3M1YA 4FDAA 3VPFA 2J3LA 1TZMA 1FJXA 2YXEA 3VO2A 2AG6A 4LJRA 1LJUA 3AVOA 1TCVA 3NV9A 4MV0A 1SCUA 2CXTA 2GM4A 1B8UA 4D3YA 4YJ3A 2Z1MA 4NZPA 16PKA 1X8LA 1C7RA 4TS3A 4K03A 4BGIA 1NXQA 1OYWA 3U26A 2FOIA 4YAGA 2GVZC 2LCIA 3EEYA 3GU3A 3GRYA 2GZ3A 3JWPA 3PSHA 4GEGA 1EK1A 1HOTA 1GKKA 3I45A 1I1HA 1XQ6A 1PKEA 2P5UA 5AKJA 4YUYA 5JXGA 5KNBH 2YWJA 1CY0A 1V16B 4U8HA 4ANFA 1E60A 1KRWA 1GUYA 2KX7A 2QT1A 1B1AA 1YE5A 2WC1A 2Z58A 1CHDA 5KHAA 4MUHA 3H6HA 1IQRA 2E6UX 4ZZ1A 3FCOA 5CK5A 6NULA 5LOVB 1OH6A 4PXYA 4JLWA 1IE3A 1SN7A 4NG5A 5IXJA 3G0BA 4DGQA 3L2OB 2ZG6A 3TOXA 5B3JC 3H8VA 5DRTA 1ZVKA 1M76A 3NP7A 1IBMB 5GV7A 2I7TA 4EMUA 1KKLA 1O8BA 5CNJA 3Q0IA 2NQTA 1NKTA 2QMUA 2RHLA 3FHLA 1J4AA 6ABPA 4KSBA 2H06A 1F8XA 2Y05A 3FOAA 4I5FA 4D3XA 1JTEA 2B20A 4JYZA 4OB6A 1I2AA 1QQ7A 1O6ZA 1CY2A 2HAEA 4FDMA 2GK6A 1BVYF 3E27A 4CEIA 3AVUA 2JI4A 5D5PA 2BLLA 2FWAA 4I5DA 4QBIA 3O4FA 5L51A 1JI3A 3VGPA 4TMKA 1X7ZA 5AKHA 1AH2A 2CNBA 3N53A 3KELA 2QHXA 3IKLA 3K1AA 4GVPA 5HBGA 3RYFA 3OQNA 5FA6A 1QPZA 2ZYSA 5KVCA 2PUCA 2Y0BA 4ZZ3A 3QHAA 4D96A 1QMPA 1IQPA 2W2KB 2X2OA 1PBNA 3ZWPA 1M0WA 3AJRA 2V4UA 4E5MA 4TSKA 4ZYTA 5CX4A 3BJEA 3PS9A 4JOSA 3GAZA 4IOKA 3F3SA 3SJCA 3FNIA 2FKAA 1KF0A 2V7GA 2Y2VA 5IAEA 1ZSNA 3T8YA 5GVSA 2HSZA 1XTBA 3NZEA 4IIVA 5CDSA 3FSEA 2EP7A 3GLGB 1D5WA 1R5BA 3H5TA 1Z4JA 1NVTA 1OF1A 3LLSA 4XQ9A 3RJ9A 1E32A 1KIFA 4KJXA 4C7VA 2GK3A 4R0VA 5K0LA 4JVOA 1O6BA 4INJA 2BEUA 3OQMA 5CU7A 4FT2A 4GQBA 2WDZA 3A10A 1KDOA 3TKLA 3OZWA 4P82A 4F6RA 1O5TA 1QHGA 3TLBA 2D5CA 1N8TA 3V7FA 3F6BX 3PQ3A 1VSUA 3HO6A 4UHFA 4P92A 1VG9B 4UXHA 2R6ZA 3PQEA 4LYGA 4XVQA 4MMYB 4JOCA 5CLQA 1ENPA 1F0PA 2FPGA 1CQIB 3O82A 2OBFA 2EGGA 2YW9A 2CMDA 2XCLA 3W06A 2JATA 1SRQA 1WUKS 3X3HA 3PUYA 5B1SA 2LCQA 1U94A 1E6UA 4BQOA 3RVNA 4ER0A 3C24A 3PXDA 4I1YA 5JR3A 2C9YA 5FUVA 3EGEA 1PP4A 3O3CA 3B70A 5AM2A 4W8HA 4UUAA 3HU1A 4JB8A 3B7GA 2CFCA 3C3YA 4FFWA 1E2LA 4RWEA 1PU2A 3QENA 4YJHB 3QSGA 2H3HA 3T9EA 2GEUA 1DBVO 1H2ZA 3KX2A 1T0BA 2C7VA 1KO1A 4AKEA 3IUYA 4XVHA 3BGOS 4Q9IA 2YOHA 3V4VB 4DC9A 3OZTA 3BD6A 5U9CA 4O3FA 4E33A 1J42A 1XCGB 4G0QA 5CT4A 3V4LA 4ALIA 1CYDA 2WJZB 4R2MA 2YC2C 2Q0SA 2V8BA 2UUOA 5ENVA 4NCKA 1E1QD 2K5UA 4W5WA 2VPQA 4BV9A 4WY2A 1Z75A 4FHFA 2PL3A 1ML3A 2QYTA 3E7FA 4QICA 4M9XA 4RJKA 3KQQA 1Z2EA 4YQEA 1XZCA 3D3JA 1NBOA 2RDMA 5B6IA 1ATZA 4DMHA 5CYGA 1Z33A 4JYBA 5KSOA 1QIGA 3QBVA 1N5MA 4GQAA 4UVDA 4QPNA 1UMKA 3HFRA 2JGRA 4BLWA 1XRNA 3RSGA 3T4PA 4EUHA 5HQ3B 3MJTA 4IJWA 1ZCJA 1CB0A 1KDPA 3WMWA 4CKBB 3L40A 1AY0A 4NBNA 4EVQA 1R0XA 3D3NA 2OBYA 3FI0A 1JKXA 3BCSA 1IIBA 2P3OA 7MHTA 2VP5A 1TGVA 2MIIA 3CLSC 4N7MA 4B1FA 5HM6A 1F9AA 1H66A 3GUZA 3R44A 2WJ3A 1I2BA 2O2JA 4LJAA 7MDHA 3TF5A 2PT5A 4E07A 2OWEA 1R6AA 1W76A 5TMEA 1RXVA 3RYFB 1JF8A 1E1CB 3ZOZA 1IXRC 3ODGA 2ZYHA 4UVEA 4BFXA 5TS3A 2ISCA 1BU8A 1IOVA 1ZH2A 2CLKB 2Z2ZA 3FPJA 4HGRA 4L9RA 1KXZA 1OLOA 3EUFA 2BYTA 2UUCB 3IP9A 1GTRA 2EHJA 1UBLS 5JCOA 1UFKA 2ZJ2A 1P3Y1 3T5GA 4H6WA 5DNAA 1GZ3A 1TXGA 4BP3A 5K8VA 5CNKA 2R2AA 2J5BA 4RQUA 1IBSA 3M6AA 4EATA 4ZU3A 1T36B 1VLZA 2A1TS 4FC7A 4YGYA 3T99A 4JB2A 1K8QA 2V74B 4GDMA 4L4UA 4M9UA 4EQ6A 4KO1S 4DG5A 1JG6A 5AUPB 5IVIA 2V0NA 1DC4A 3LQRA 3BIOA 2IXTA 1SBIA 4Q3DA 1XNQB 1VRCA 4BZXA 4AUMA 3WBFA 1BVRA 1MV8A 3PLNA 2ZIZA 3KDSE 1OYOA 3DZDA 1E94E 3FGNA 4GSYA 2JIRA 4LXHA 4BRUA 4EI2A 1TEZA 1SHZA 2ZJ3A 1EWQA 3IL2A 2J48A 2JD0A 2VK8A 2WIFA 3OEHA 4J1TA 5DWVA 2H1VA 5EE9A 4XVCA 1I7DA 3KYIB 2OORA 3TM5A 4FUTA 3GVCA 4OA5A 2HK6A 5JCPA 4PX3A 3U3RA 3TB6A 3K8QA 3UGKA 3UN1A 3DL4A 4QO8A 2G9VA 2V7PA 3FIUA 3H5VA 3JTEA 2ORYA 3AKYA 3MILA 2FLVA 3UJPA 5C9ZA 5D3QA 3P9ZA 1WD5A 2IP1A 3EFOB 3EH1A 5G4KA 1L4UA 3W3AA 5MHTA 4DNPA 1RYYA 2C5GA 3L41A 1D6JA 4G89A 3RUIA 1ZD1A 4YAJA 1IBCA 2WOJA 3QX9A 1XIVA 3UPDA 4IZ6A 2I4TA 1PJ3A 2GN2A 2Z8XA 1EBUA 5JMWA 5JV5A 1ACMA 3AEUA 1A7JA 1R12A 3NGLA 1EXDA 5C5DA 2OENG 2XCQA 4MP3A 2EU8A 3E9MA 2WJIA 4WHMA 3DOOA 3KB6A 1XUOA 2Z5VA 4K9DA 4IUYA 1VCOA 4X1KA 4BFYA 4RTJA 5IYZA 3EEOA 1HQDA 2Y0CA 3F2IA 3R76A 1J99A 2I4OA 3LE8A 1TM7E 1NRWA 2YWBA 1J0AA 4IV8A 3QZUA 1G3RA 5JFGA 4N82A 3U4CA 1Z26A 2WLTA 3R77A 4MO2A 1ST3A 4XM2A 2H4JA 4AMGA 1JKJB 3VXKA 1L5FA 2NO6A 4ZP1A 5JAHA 3EXG1 2SKEA 1KZ1A 3I0NA 4ZIRB 4FR5A 2HU7A 3QJYA 1ZGHA 5FWYB 4CKZA 3BXFA 2NAFA 5CLIA 3RLFA 1UP7A 1YR6A 2Q2OA 3OHMA 1OILA 5EWMA 2O06A 1NX9A 1N7IA 2FPOA 4I6GA 3WYNA 3HJGA 3ZWWA 1G20B 2HPHA 3AVVA 1QRRA 2EL9A 1TZKA 1YJAA 1GZSA 2GEKA 3WYAA 2CFRA 5LZ8A 3DG9A 3RVBA 2NZWA 2IU0A 3VSDA 4EW6A 4DJEC 5DSTA 1FS5A 1LX7A 1WKCA 1U2QA 1JJIA 4MW1A 1ESEA 4TL7A 2OCGA 4LX0A 1RYFA 4NJEB 5K01A 1TT5A 3UW1A 4FYWA 3V6LA 1RQNA 1U9JA 2DVMA 1E6EA 1QKKA 1SH7A 3IIMA 5CX1B 3PICA 2UZ3A 1NASA 1DNPA 1E1LA 1Y7TA 2QN9A 3R2JA 4OEHA 1F6DA 3DBIA 3R7WA 3HNRA 4WOKA 1U7TA 2R6HA 1ZDMA 3RVSA 2ORED 3PENA 4NRDA 4JELA 2B98A 5A06A 4ND1A 5K6TA 4L28A 5REQA 1XZQA 2C5LA 2DJIA 1N7HA 5M2QA 1NULA 3ANNA 1YQTA 2GJ4A 1W581 1A27A 3F7MA 8MHTA 3O2JA 1JU4A 5FUWA 4CF7A 4QKQA 1GNQA 4LCBA 5KI6A 1QR2A 1RJ9B 1CUSA 1VKRA 2QLNA 2HV9A 3OA0A 3B2QA 4WZAB 3TM4A 3HP4A 1H94A 2M6KA 5J5VA 1TKBA 4J1QA 4BV8A 1GPNA 4KR0A 1ZIXA 4B48A 4F4JA 3ROTA 1ZA2A 3VTFA 1YDFA 1GHTA 5CLHA 3ROZA 2V6MA 1YL7A 3LYLA 1JAXA 4UJ5A 4BN5A 1XD9A 1X39A 2DTXA 4L5JA 2Y1DA 4PAMA 4C2BA 2J9FB 3WB1A 2WYVA 3QFRA 3WBKA 3V4ZA 3QBDA 1BE0A 4HNVA 1RXSA 3KQWA 2Y27A 4P98A 1ZU5A 2B25A 3RHZA 4RKYA 2G08A 1LV7A 1JJVA 2PS1A 3MCAA 4PVCA 4F8EA 4LG1A 3JASB 3ZGVA 3OJFA 3B9BA 5D8DA 2O19A 4RA9A 1QVRA 5IH3A 4V1CA 3AY6A 5B1IA 1NZJA 3AI7A 1UKAA 3GMTA 1A8HA 1SZDA 1T6BY 1UIMA 2W7TA 3TRKA 2C7QA 3MUEA 2Q6KA 3L8ZA 2Q8QA 3V8PA 2HIMA 3WIOA 2A4KA 3PXGA 1RPNA 4EL5A 1MJGA 3OX3A 2L82A 2X3YA 1EX7A 1LV8A 4FU0A 4FDTA 5CT5A 3RVJA 2I7DA 2XNSA 4J7CA 3ZXIA 1R0SA 4YUZA 4RH3A 3K70D 2VHJA 3CZCA 4GE0A 2HIGA 4PV7A 4CM3A 4C5AA 1NUTA 3KL2A 4YRZA 3ANXA 3GW8A 5JXIA 4U02A 1SBHA 3NIDB 1PEKE 5U4QA 3W5HA 4RENA 3JWEA 2GDJA 2QZ9A 3EK2A 3MD0A 3T7AA 1QANA 2XWQA 3K2IA 2CFTA 2VATA 3UK1A 3R1IA 2X3UA 4AZ3A 1BQEA 1N7GA 2P9ZA 4PZYA 2YYYA 4LZLA 1SIOA 3KLOA 2Z2JA 1DGQA 1Y6QA 3KK0A 4ZMBA 3F74A 3OIDA 4NJMA 1MO4A 3FPFA 4L1KA 3V7YA 1Z29A 4R2LA 1Z0JA 1XPJA 4RLFA 1WP4A 4J91A 3M3HA 4Y1GA 3TZBA 4CKCB 2XEXA 2H2WA 3NT2A 5H4HA 5FBKA 2F9FA 4CHGA 5J63A 2VH1A 1HNNA 1X3SA 2QRQA 1ECBA 4HWGA 2XBMA 3TNFA 4C0KA 5I6DA 4LKOA 3TPZA 5DTMA 2CVOA 5I7UA 5EJ8A 3EZXA 2IHZA 3KAPA 2ZS8A 4WXHA 5HWSA 4LNUB 5DTRA 3WSWA 4EX6A 2H0RA 3JQAB 2FNAA 5KIAA 1BVUA 3CLRC 3FLBA 4QM6A 3V42A 2WWVD 5KINB 1P72A 4N18A 3DE5X 2VLBA 1QV9A 1ZGJA 1P7VA 3HN7A 3NRCA 3P2IA 4HFMA 1QV6A 4PWZA 1PVOA 2UZ1A 4FGLA 1QO9A 4X6UA 3ISVA 3NB0A 3ZQ4A 4F3KA 2AQIA 3K9NA 1GSOA 1SUDA 3ITKA 2VTKA 3ZHXA 4AUKA 1VJ0A 1YC2A 4G4SO 3UCXA 3VR1A 4E5NA 1DUVG 1L7XA 3DMRA 4OI2A 3NTOA 2DQKA 2AZTA 4WFQA 3W4IA 1WSAA 1CW2B 4GOMD 5L53A 1E1NA 1Z6AA 1WXWA 4HAYA 3G5TA 4QQ8A 4C43A 3JQ7B 4FZ5A 3GMIA 1YVDA 4ZCSA 3KEGA 3BWXA 3PDIB 4LRUA 5LJIA 3AF1A 1H6BA 1HX7A 2JLWA 3I3SR 1UMBA 2ILVA 3PRYA 4CV0A 1ZISA 2ZRMA 1CR4A 1EVZA 3BBLA 3ZDRA 1QOPB 3CNOA 4X66B 1I4OA 1U6IA 4HHEA 3DOHA 2W98A 1MO2A 2N47A 2REQA 3VNVA 2LKCA 5DTIA 5BRJA 4OB8A 4KVGA 5D5HA 4ZC8A 4FM9A 3N2GA 3LF2A 1RACA 1BMDA 1AD2A 3OBIA 1PT8A 1T2FA 1CZNA 3DWGA 3VPAA 3W3AH 2JRCA 1XK6A 1B6SA 3A6PC 5FWNA 2P6RA 3C6YA 2WKQA 4Q00A 1T9GS 1PSZA 5E6SB 2FPMA 2H2HA 4NIMA 1ODSA 3ND5A 1YE3A 2WMOB 4NBWA 2GJSA 4YRCA 1MUUA 2VT2A 1C2YA 1Q7CA 2C9OA 3EZGA 1L5NA 4AU1A 4CR8A 4F1KA 3GPLA 2FRDC 2O07A 3HXKA 3PNYA 1SXJD 1NFFA 1C29B 3FPLA 2AX3A 2G5GX 3R6TA 4UZEA 2PUGA 3W3AD 3L82B 3WMGA 4D9HA 2R2GA 3ZZNA 1T13A 2HMWA 2C88A 1G38A 4JJZA 3N8NA 2C2GA 2Y4OA 2ZWMA 2OQRA 5KX5B 1CUHA 3I30X 3B6MA 4BQFA 2I2CA 3HB5X 1OOEA 3ZHCA 2AXNA 4HWTA 4LBWA 4K87A 1MRSA 1DCMA 3PQ7A 4QJ3A 1YVUA 2NTEA 2FR8C 1S96A 2GZSA 4RLQA 1QH8A 1I0ZA 1RAFA 1RYHA 3GFSA 3NBAA 4PC6A 3RJZA 1VMIA 3ZYZA 4IIBA 1CJCA 3RC9A 3H2GA 1SEVA 3FUVA 1R4AA 1O94D 3VI4B 1C9EA 1E79D 2IK8A 5JFTA 2WG1A 3KAJA 4NBKA 4P34A 2Q4EA 4AS3A 1S9HA 2BKXA 2GF9A 1D3AA 1DB3A 4YCDA 1AG9A 4A36A 2HDOA 2QI9C 1Z6TA 1PFGA 3DMYA 3LX8A 5EMLA 1L3IA 3V46A 3ZK9A 3N7TA 4EELA 4QT4A 3AHJA 2XX3A 1UKYA 4HQLA 2FDCA 3SD7A 5JWOA 2UXBB 3IT0A 4FP9A 5LMZA 4YS6A 2K2WA 1IAQA 1XHEA 1G4AE 2NLOA 2NVWA 2QM3A 2R65A 4RPHA 4KWTA 5HTOA 1PJ8A 1N2EA 2ZWOA 5KMGB 4GS5A 4DM7A 1CK4A 1YRBA 1ZNWA 3TECE 4DA0A 1SQ5A 4HN9A 3M9XA 4MCIA 5EKSA 5T67A 4YRBA 2O2IA 4NPHA 1W4LA 3ENZA 4YHBA 4ZI7A 4YXWA 3S1SA 4YIKA 2KJQA 1YIOA 2IWHA 1TO6A 1A8UA 1MKYA 3OM1A 5JEDA 5K8TA 2P7IA 1IFXA 1GN8A 1NF8A 2WTXA 3PFBA 1QAOA 4E7OA 1RLTA 2ZWVA 2UUAB 4XYBA 1Y8QA 4MX8A 4OHCA 2XWSA 5HIJA 3PVZA 4H59A 5TRTA 1HFEL 2E1RA 1JR4A 2H5EA 4D8VA 3GRRA 4Q4AA 5KC8A 1C5KA 1N6OA 3PUHA 4S1WA 3SM9A 2Z2KA 5DBFA 1A7KA 1KJQA 4A5OA 1B73A 1E92A 2O57A 3GLHE 5HF9A 3BUSA 3L1VA 3UAZA 5EWMB 3KJXA 1MAUA 1CRWG 2NU9A 1TTPB 2RC5A 5SZIA 1D04A 3SJBA 3ZXUB 4B3SB 2JIPA 2BN4A 4I5EA 3EZNA 1E3JA 3KT6A 1Z56C 1H2EA 1S01A 2ZYDA 3AY7A 4ZZ0A 5AYVA 4ZMSA 4GKBA 9ABPA 4BRZA 4ZOLB 1CG6A 4KUHA 3I92A 2ZUSA 3MIIA 1CX9B 4JLUA 3PRJA 3G49A 5T57A 5TQJA 1SVWA 5K09A 1GM5A 1QJCA 4URZR 3IEVA 3EFHA 4R6WA 3EQ7A 2F43A 1BXKA 3PGA1 4BQRA 4CM6A 1VMDA 3Q3IA 2EJVA 1EZZA 1Z0AA 2C0CA 3TRIA 4NOKA 3LG2A 2WJAA 3OIUA 5C4GB 3H3XA 1M5UA 4YY3B 1U0SY 1JKIA 1KQ3A 3AHDA 3K5WA 5AJZA 5CDFA 1MW9X 1F4LA 5IDXA 3VKGA 1HKHA 2EYQA 4LYAA 1R0BA 2YY6A 1R27A 3L7JA 3OJ0A 2FQYA 3WAGA 1VGRA 4TTSA 3D3WB 3J80A 3VKHA 4M9RA 4LGYA 1ZVMA 3O9MA 3K30A 2A84A 2PUAA 2JJ1A 1OA1A 1QSGA 2D7CA 1WG8A 1J9EA 2PKQO 3DB2A 5F76A 3LY9A 5F7XA 1XDUA 1RC1A 4L5CA 1NE7A 2Z98A 3B89A 5EIOA 3WL7A 4OFBA 2C61A 3AY3A 5F78A 4RIHA 1W8DA 3EYWA 4MLDA 3V9PA 3AWIA 3GQBB 2IE8A 4Z4FA 1MF7A 2OZLA 4FD3A 4Y2GA 4W1RA 3PI6A 2QY9A 1VP3A 5DPMA 3TLMA 4YAIA 1KQFA 1JWAB 3R8CA 3B9QA 2EZTA 1OVMA 2Q62A 2UZIR 3GIDA 2J33A 4ZVTA 4TLCA 5AM4A 2FEPA 4GOOD 4I1UA 4E1AA 1C9YA 3EXFB 3EDCA 2Y1OA 5LP1A 1QIDA 1YO6A 4ARZB 4A8JA 5IK2D 3FH0A 3K05A 3U60B 1NVGA 2E85A 5IULC 1KHHA 1ZOOA 4N76A 4W5RA 5KTTA 2B0CA 3H2JA 3AYXB 4YMGA 2C3UA 4PO8A 4EY6A 3OOEA 3ANSA 3U3OA 1UBKS 4NENA 4EMBA 5LDDC 1QVAA 4OQYA 1YONA 3PUJA 3VKFA 2HPZA 1NHWA 3TW0A 5T8KA 5JC1A 5BSFA 3ZV6A 1J1UA 3NC4A 3NMUF 1GADO 4DKXA 2QPAA 2CWWA 2NXWA 1S02A 3O8DA 4C7MA 2II6A 3G9XA 5L7WA 2CDNA 5JVDF 4Z0PA 5ES3A 4IX1A 1C1DA 2BH9A 2DHQA 3QRWA 4DQKA 4IOLA 1Z18A 3BPSA 4RUKA 4CCAA 2RHCA 1UP4A 4G0WA 4CDMA 4CF4A 3O3OB 4PHGA 3B1JA 3WL4A 3RT1A 3QXHA 2O20A 1YIDA 2X4IA 4C4RA 5JALA 1JSLA 5FI0B 4ABTA 1YL6A 4BE7B 5JH7A 2GO1A 3ZGLA 4NICA 4KSCA 1VYTA 3V8QA 2CBGA 3H83A 1MMFB 1G3MA 4KOAA 1FRZA 3AEKB 3MJRA 5I9NA 4JI7B 2B0JA 3ZWBA 2NTVA 3LRTA 4LJYA 1FUIA 4MQLA 5JANA 1SQ6A 4MUJA 5EWJB 2BKEA 2O2SA 1U5BB 3TN7A 5BW5A 4DMUB 1UFRA 4GYYA 1UJBA 3HCWA 5WRFA 1W4ZA 3RAFC 1KFJB 2W4QA 1J9GA 1SWVA 2HIHA 4BN4A 1KAMA 4ZV7A 4UTNA 1OXMA 3EVCA 1P9RA 3ZIAA 2X6TA 3AJDA 2B9EA 5CPFA 4D9CA 5K0NA 4EHLA 2EOAA 2TSYB 2ZU0C 3FFBA 4I66A 4XQEA 1WOMA 3CWZA 5FLYA 5FTLA 4AZWA 1QWSA 5JAOA 1DRWA 2R5FA 2Z9BA 2IP4A 1T9HA 3L7YA 4XH9B 4JL8A 4RPLA 3TCXB 2AZMA 1ESDA 4UATA 1H9BA 1TW3A 1DJPA 1ULUA 2HU5A 1YZVA 2XYQA 2O8CA 3Q0TA 2V5AA 4RJJA 3VPGA 2VWGA 5T4BA 1CJKC 1BX0A 4L85A 3MWYW 4PC7A 4CM5A 4HEQA 3UAVA 5LP6B 4JJKA 4UTPA 4H16A 1K7FB 3INGA 3FNRA 4W99A 4HCJA 4M54A 1GNVA 2D5AA 2A9FA 3N1UA 4HNRA 5EINA 1ID1A 2ZTHA 2XRZA 2C92A 3GF4A 4N6NA 1OLXB 4NFSA 3DH0A 1SVIA 1OXUA 5KNCH 5E0KB 1B76A 2C7PA 2PBZA 4WBNB 3R23A 3MOSA 3CRVA 5JAUA 1ZN7A 4BX3A 4CG0A 1EZ1A 1T9CA 2GEDA 3MUFA 3ZWNA 5C81A 2DH5A 2AW3A 5TMPA 2JJ2A 4KMRA 2CMKA 3NWPA 4E14A 1D2NA 1Y6ZA 2ZCVA 4QPJC 4UDYX 4TKVA 5A5EA 1LJLA 4Z4HA 2PKXA 2VA8A 1HZZA 4CM9A 2JIZD 1UZAA 3L7OA 4YAEA 1M1YB 2AOTB 1DIRA 1WETA 3NTLA 4WADA 2X8LA 3Q1LA 2OG1A 2HQRA 3T3NA 1BAPA 1M5RA 2PWPA 2JLUA 1JGTA 1JE0A 1L7MA 3D8NA 3KUCA 2H17A 4J29A 5IM4A 1XNGA 5BUQA 3BGVA 2BGUA 3G2JA 4IDPA 4X7RA 5JDIA 3OAAA 3PHBE 5CXQA 1RQ7A 5KTSA 3HWX1 3RGWS 4DAEA 4H4DA 3H9EO 1IWOA 2FPIA 2FYTA 4HXEB 2G6BA 1PQWA 1UXGA 4M0DA 1XNRB 4RM3A 1A4XA 3IQEA 1UFQA 4L7QA 1KPIA 4JSRA 3A1SA 4WCFC 1A4UA 2NTNA 3GLSA 3U3KA 5DGIA 4M1QA 1U2PA 5E9JA 1C3LA 4WZAA 3P4UA 1O94A 3ONDA 1LBTA 3KKLA 1NBWB 1UJMA 2YKGA 2E82A 3MJCA 4MV8A 2FUKA 5A4FS 2B92A 3ELYA 2AOUA 2IV7A 3RYIA 4H3SA 5K0BA 3DDWA 4AW9A 1KZGB 4R3NA 4HLNA 2UZ1B 4F4IA 5A9RA 3KEFA 3QYAA 3H11A 3B3FA 3EXEB 3Q9NA 1QK3A 4KQMA 4E5SA 1K7XB 1RI3A 2HHAA 2YY5A 1B74A 2YWEA 4R98A 3ES9A 5E1BA 3ZDFA 1Z7EA 4EK9A 4R83A 1ADBA 3URMA 3I6IA 2AJ8A 1F9EA 2G80A 1JU3A 2F1RA 5IDYA 3KOWA 2X7XA 2ZI9A 4HDKB 5HF5A 4KQ2A 2O7RA 3BJZA 2IQ5A 2J08A 3Q7EA 3BICA 1J8MF 1TL7C 2GSWA 3OJLA 2AFIB 4MIYA 1PJ4A 2FSIA 3E61A 4O5OA 4TYWA 1GGKA 5IN5A 1TQ6A 1W44A 1WP9A 3B6ZA 3CUSA 5AKIA 1HEYA 2ZTSA 3BERA 4P7FA 3U4GA 2VHWA 4GNRA 3V7NA 3RYIB 1JR6A 3IUPA 3R3JA 1KVUA 2QNBA 4KN8A 1UK9A 4S0ZA 1U90A 2J6CA 3EY9A 3NIFB 1SXJE 1VLVA 2YJ4A 4QPPA 3SQLA 5JS2A 2ODEA 2XOXA 3IEKA 1Y5RA 2DHCA 2V7QD 1B3BA 3T3MB 3ZX5A 4DPKA 4EA8A 4HLCA 3EIQA 4KL8S 1ONBA 4WZBB 1Q50A 4YBZA 5F77A 3ESYA 1SY7A 4JBIA 2VHVA 4JDUA 1K7SN 2BGNA 4L73A 1U8XX 3NR2A 4X1IA 5LLSA 2BJWA 3NIWA 1QDUA 3ABRB 4F5EA 5KNLA 5KYXB 1CP3A 2W8BA 1ESMA 2OYCA 1CE8A 3HN6A 3TAXA 4DLWA 2FPPB 2UUBB 2I66A 2H92A 4MS4A 3ZQ6A 4D4GA 2XD4A 4R2WA 2R8PA 4JLSA 4O2AB 5LPNA 4QM7A 1EE1A 2W4MA 1ZUHA 5C80A 5IF9A 1INLA 2B61A 2WU1A 1THGA 5K0FA 2BFDB 1NVAA 4GX1A 1IN5A 4GC9A 3SS8A 4J0GA 4GKKB 4XARA 3U3DA 4EJFA 4ZXFA 4QREA 1GWNA 4EO9A 5JSZA 4Y6OA 2IXAA 3IQGX 3KT3A 3UVEA 3C7CB 3U1BA 1NYRA 1N4DA 1FRQA 4ZEOA 3B1YA 3HBMA 1AK1A 1A8QA 1ORIA 1YH3A 5CA0F 5GJWC 1GDTA 3AR4A 3OTGA 2FP4B 4GIBA 1A2OA 2CN1A 3AGQA 3QXSA 4AJ1A 2Z5LA 4GP9A 1KFKB 1AS0A 4K40A 3QQPA 4XFDA 1GV1A 1L5HB 4GX5A 4OXQA 4UC0A 4RTNA 3KQHA 2JK0A 3AKZA 3W04A 4XQ0A 5ILGA 3GUCA 4K26A 1C1YA 2FUG6 4JBWA 2EGHA 3CKYA 1YSCA 3X43A 4MTLA 4I6EA 1TJNA 1YDEA 3AIKA 5L3ZA 2OHOA 2BHRA 5KTMA 3IULA 1N5IA 1HDRA 2IYRA 4J3JA 421PA 2CKDA 2OV2A 3JRWA 2IZOA 3OZIA 4ENWA 3VISA 3ZGOA 3GRFA 3TI9A 5BUZA 2RGCA 3OZEA 4ERNA 4Q7KA 5CD1A 4OQLA 3JALA 3HJCA 2IOFK 2G5TA 4M89A 4GGMX 4ITVA 3RS0A 4RTOA 1O57A 1F20A 1X7HA 5EWLB 3D2CA 1B8VA 4WSOA 3ROFA 3O31A 3NBZC 4YROA 3UMGA 3V8RA 3GP8A 5A4IS 4B6RA 2Z8YM 4MKGA 5CHEA 3ZZUA 5HMLA 5IBPA 3WJ7A 1SBQA 3BQ9A 5D2CA 5ELXA 1UL1X 2A9OA 3LV8A 5HG0A 1I7PA 3F49S 4RVNA 4Z8YA 3IGFA 5JPDA 1UANA 4NJOA 1DTWA 2ZROA 4IJQA 3ZWQA 1Y48E 3DV0B 4C7JA 3IEIA 3RUCA 4D26A 5EIBD 2NVBA 1R37A 1WKVA 4RVSA 5B3KA 3U7GA 2XZDA 4BMPB 3WWDA 2SBTA 1BQ4A 2KI5A 2D0DA 3FPGA 4QPCA 3RH0A 4BAGA 4MAFA 5A9SA 2CZCA 2V4ZA 1E3WB 1ZPDA 2ST1A 4M0FA 4JB0A 1JEAA 2G0AA 2C3PA 3DTVD 2ZRQA 1RHQA 2VHEA 2Z43A 4PRZA 1NHGA 4ZDWA 5MDHA 1CUZA 3IESA 4ZVOA 1PD0A 2A3RA 3KD3A 3LLVA 4CKCA 5JAZA 1H2YA 2COKA 1H3FA 4FKBA 4FZRA 5FOTA 1MT3A 3FRJA 3SX4A 2JA2A 1OZFA 1U0HC 3HE3A 4X0EA 1TVCA 2CF6A 2X7HA 2WYIA 4WACA 5HGJA 1IJBA 1L5ZA 1P2TA 5KREA 2ZSDA 4IH1A 1WDWB 5FL3A 1G5TA 3T9FA 3WHKA 3ZR4B 4KDCA 4OMFG 2IHYA 3CJQA 5B57C 1HNZB 5ALZA 4BNHA 1YS9A 4IUCS 4KQWA 4WL0A 5CP8A 3QPVA 2D59A 3FCYA 3H9BA 5HUQA 1O9HA 1VCNA 3DAFA 3N6VA 4RVFA 1TRKA 5EEHA 5JROA 4QARA 3M6LA 1W36C 1ZN8A 3NUQA 4IIYA 1P0IA 3N07A 4KHZA 3ZJYA 2CLFB 5ERGB 3UT0A 4G24A 4X94A 5BXQC 3GX1A 2Y1WA 1P2UA 2AN9A 2GZHA 3AEKA 1JQLB 2GYYA 2BW0A 4OGGA 1IB0A 5ALHA 2VUTA 3TNJA 4EM6A 2IOHA 1G8PA 4G5GA 2WWXA 2PH7A 1N3LA 3N76A 4HPJB 4Z8XA 1LZLA 3K0CC 4LSGA 1P2VA 3ZK7A 1PR9A 4BMVA 2YNMA 2BI4A 5A4MS 5D6NA 4DEXA 3QKIA 5B3JA 3L0DA 3COSA 3EQ9A 3W2GA 3E9YA 1SUPA 5HE8A 1OZ0A 1W94A 1V6SA 3OT4A 3QEJA 4LYHA 1KR5A 1DAHA 1LBSA 4NKRA 1Z5OA 5DFAA 5JBIA 5LP6F 4LDPA 3UMJA 3WOHA 3LGSA 3WX0A 1JHAA 2WYOA 4OIMA 4TTTS 1HDCA 2VT7A 2J5XA 3CEJA 4FJ0A 1L5HA 1F2TA 2G4CA 3HJRA 1ZIOA 2V8OA 2PWBA 4ZVPA 1GOTA 1LDBA 1LH0A 3C1TA 2HSEA 4KRYA 4TMYA 4D99A 4DR3B 1JEOA 3OHSX 2VT6A 2WAMA 3K35A 5BSVA 4J1SA 1IL0A 3SS9X 2W6IA 3N58A 3GNQA 4JJ6A 4KFUA 2JLQA 3I5MA 2JBAA 4NYMR 2O2XA 2AF3C 2H3EA 2QU8A 2Y66A 3JPWA 5EMNA 4DQXA 4EG5A 1XNHA 4ZO8A 2I7VA 3CT6A 2PLAA 4HJRA 5IXSA 2F8LA 2ZQYA 4R05A 3KQPA 3O83A 4OL9A 4PLVA 2Q8PA 5EESA 4RSHA 3JQ8A 3V48A 5BYJA 2YICA 4EG6A 3LHKA 5BQ5A 2P2YA 3UB4A 3AHFA 4V3BA 3UWOA 4R1UA 2BFFB 1HXHA 3PX2A 2B7CA 3E2IA 1E6CA 2PLFA 4C4YA 5BV1A 2NNLD 5E1DA 3HMQA 3OKPA 2I1VB 3N0VA 1JQEA 3NHBA 2ZBDA 3CB4A 1GG9A 3COZA 3N75A 1V8BA 1WTAA 1R6UA 5TVKA 2O7NA 2VP3A 3T4XA 4Q47A 1PT6A 1RHJA 1RJFA 3O1HB 4MEBA 4ZAGA 4G0UA 1H4SA 4YACA 3DVQX 4AD8A 4UTOA 1RZRA 1DJOA 3X1XA 3QEMA 3P9KA 2HMSA 4XEUA 3VPBA 1SUSA 2OAGA 2C2ZA 1FK8A 3ZHOA 3HSYA 3LKZA 2VJYA 2HCFA 2ZYWX 3M6FA 5IWCA 3ZU4A 3L8HA 3IQFA 3SZOA 1R10A 1E2GA 4N5HX 4KO4S 5CDFE 1WF3A 4Q05A 4P0QB 4KK4A 4BEJA 4BUJA 5L3QA 1DO0A 5P21A 4DY4A 5L4NA 2I03A 2IP2A 3O94A 4UHHA 3OY7A 2JLZA 3AFGA 5DLEA 3X1YA 2C29D 1GARA 4YMVA 4CEJA 2OB1A 3WG9A 4XFKA 5EVCA 1COWA 4KTTE 4NBSA 1RC8A 1SUFA 1Q6ZA 3KZ1E 4RL4A 3KJQA 4IINA 3VR3D 2P77A 1E18A 1L1RA 4V38A 3OEHD 3TVDA 1Q2XA 4RHXA 2DXIA 4OHYA 2KBFA 5BW6B 5LBTA 4RFSA 4EGFA 1OWOA 4XGKA 1C0IA 4YP9A 1QG6A 4DJJA 3IS3A 3JQ9C 2VF4X 4KMOA 3C3BA 4HQRA 5JJIA 2Y0PA 3M89A 3KYDB 2ZATA 3CRZA 1SOAA 4MRNA 3T3EA 1S7CA 3PITA 1XA4A 1M74A 2ZR9A 3DE7X 1PTJA 4G5SA 3I2FA 1NM5A 3IP6A 4Q6BA 3T6KA 3C7KA 3TBKA 3U81A 4BNZA 4OKSA 5FPTA 4DM3A 1CPYA 1DUSA 3GO4A 2Q0XA 4ZK6A 2OGWA 2VSFA 4MRRA 1QU2A 2QTTA 1NI4B 2Q7DA 1TAGA 1H22A 1PN3A 3JD3A 2XMQA 4FFVA 5KQPA 3KE8A 4RZUA 2VYVD 3ZV7A 1X0VA 4MDYA 2Q07A 3HI4A 2EEPA 4OL0A 4ZJYA 5BR7A 3I5YA 2DY1A 2RD2A 1AB5A 1XDGA 5L3RA 2YV1A 1ZC3A 1OV4A 2JHCA 3ZXYA 1T3ZA 1QCYA 2IHJA 2OCXA 2CHGA 4G0PA 2FJ0A 1UDWA 5G2OA 1OI2A 1GYPA 2Q2NA 3NEPX 3H5LA 1CSEE 5H5JA 1N2XA 4X92A 3TTUA 4WXEA 1I3KA 2YRWA 4UM7A 2OD9A 2Z2YA 4UZFA 2QUHA 3AOEA 1CVRA 1EJ0A 4KLRA 3BXZA 3CJTA 1EHYA 1TJ5A 2IPXA 3T06B 1WMFA 1AN9A 3HWWA 4ND8A 2H9IA 1DARA 4Z9FA 5HF6A 4EGQA 5KVSA 5KHOC 1QE3A 3F6EX 2J0UB 4LY9A 3SC2A 1M8GA 1U8AA 3IAM6 4RQBA 5EZ6B 2BTQA 2JGEA 1SD1A 2R68A 2QTAA 1XL0A 2VDLB 3JASA 4YT4A 3WMXA 1N7JA 3O1LA 1DAOA 1OE0A 4Z9AA 2KB0A 5J4KA 3ACCA 3HR7A 2EP8A 5KTRA 2NZVG 3LOQA 1QBKC 1C14A 4N65A 1PUJA 3LUDA 5TB5A 3MYRA 3UY4A 4PM4A 2F3PA 4QSMA 3K0AA 3PUWA 2R7MA 2BM9A 1FU7A 4UXJA 2H0AA 1RABA 3A31A 2DHEA 1AQLA 4IO1A 5EMKA 4R71A 2O54A 2CF5A 3KZVA 1Y3HA 4Q4HA 4HYTA 1X8KA 1D09A 3SM3A 1GG5A 3BE6A 2AJLI 3GJ5A 4AP9A 5G1PA 1QORA 5CHYA 2BM0A 4HUTA 5A3QA 2FMHA 1UWLA 3TQIA 1FNMA 3K8ZA 4OHBA 2EX1A 4HAZA 4PYNA 4IGKA 1XPUA 3DBRA 4Y7CA 4F91B 1IEWA 3TLCA 4FUQA 4FKZA 1XCPA 4J1TC 4KRXA 2VQSA 2R8YA 4OU4A 4MSUA 1JH8A 5BR1A 3SIRA 5K7SA 2EQBA 3R7SA 2N75A 3V2IA 1TAQA 2IA5A 1EVQA 2QMOA 5H3HA 2F1KA 3AKDA 4G1MB 4MVYA 5EXXA 2HSJA 4U2KA 1MPXA 1PDOA 1R0KA 2AUNA 1ZJ4A 1TM1E 3D8RA 4OJKA 1QM5A 3T1HB 2CCGA 5CFQA 2PX2A 2YJTD 2INGX 7ADHA 5JTUA 3QUCA 3ZWMA 4IKPA 2Q3FA 2RHMA 3QNUA 4MLPA 1W2GA 4QJIA 1UPTA 4FX5A 4R68A 2HRZA 3AI3A 4X60A 3LP6A 3AF0A 2DWQA 4TKMA 1OR8A 2FA9A 4QFBA 1XAGA 4GYJA 3WHIA 4F46A 2JLVA 2WF6A 2I99A 5D85A 2MSEB 1SG6A 1U9CA 2G9ZA 1KI2A 2QAJA 4J9UE 3PWSA 4UOEA 3LYHA 2J7PD 2J9RA 2JVIA 2F1OA 1BYIA 1H1DA 3JQRA 4IFIA 3Q7RA 3TLJA 2FOXA 3K2BA 4H2DA 3GZJA 3PRKE 5EJ2A 1ICIA 4WI1A 1ISMA 3KSRA 4LPKA 521PA 1Y8ZA 2BGRA 4U7WA 5BNTA 2IU3A 3ONEA 1WHTA 5KQRA 1Y6GA 2Q6OA 1DX4A 3L7CA 5IMBA 4BGUA 3OQ6A 4FWBA 4HRXA 5DLDA 2ZI3A 2RH8A 1KZ9A 1XYGA 4KNVA 5I7FA 1SULA 2W6JD 4D4MA 1GL6A 1XXLA 1GYRA 3ETNA 4IDQA 3UXYA 5AHWA 2DAPA 3GDWA 2Z3WA 1AB6A 4N3CA 1QC5B 2Q29A 1N75A 4AUNA 3CH4B 2XNKA 4BGDA 1M1UA 1PBTA 2B4TO 5T64A 1WVGA 1H6CA 4ND2A 3HO8A 3ZDYB 5TARA 2D7DA 1IAVA 2A1UA 3AR7A 5K0ZA 4JNCA 2I7XA 3U49A 2ZB7A 4CODB 1J6UA 3LL4A 2WMDA 1YNOA 4FWIB 1KYYA 1QK4A 4E30A 1PTKA 1ENYA 4DOMA 6GPBA 1N8SA 3KLBA 2FR0A 3A6ZA 1M3SA 3ICWA 5EERA 2UVPA 1H0HA 2FP4A 2WPNA 2X6QA 4ARCA 2G17A 5CUQA 5UKDA 1NGSA 1JEDA 4K8OA 3ST7A 3V2UA 1NW3A 5IJWA 4MH0R 5KNDH 3TZKA 5T3UA 2P9TA 4BFUA 4CMBA 5FTWA 2GN1A 2QSUA 2GTIA 1SUEA 5K99A 2PX3A 3T35A 2ADFA 3OOJA 1E2DA 4DDUA 4C2TA 2AC7A 4UE3S 3SHTA 1FVHA 2I6SA 3M0EA 4F9GA 4TMFA 2BKAA 1KY4A 3U5ZB 1OZGA 3THXA 5ER6A 4KEAA 2A86A 2DE0X 2JVKA 5EHZA 1GKLA 3R0ZA 2Y68A 3WK8A 4CR6A 5AICA 3HFSA 2Q5EA 3C7AA 1PFVA 1RE0A 3DTVA 1BFUA 2JFXA 3ENKA 4FOTA 4UBLA 5CXXA 3ROKA 4IWYA 2FK7A 3AL2A 2HDWA 4XOUA 3UAOA 3TAUA 3V55A 2WMNB 3W8FA 4EYQA 2V7VA 4IZIA 4RVHA 1IRXA 4IM7A 5F5LA 1NF9A 1QQ6A 1F12A 5E1MA 4C88A 2I78A 5MGBA 4OHMA 1QAMA 3C6QA 1T9ZA 2C9ZA 2Z1DA 1K6JA 1WZ2A 3CIOA 3FW1A 2ODNA 3LYAA 3RHTA 4CUZA 5EGNA 4P35A 3EULA 4DSNA 1WV0A 1TM5E 2IC5A 1QYXA 1RZVA 2I67A 3Q7PA 4J4BA 2PXCA 3A9CA 4Q1BA 4A6DA 4PRKA 3OZBA 1IQUA 1DOHA 3U56A 2AMYA 3QVGA 3VDRA 4KH0A 3QF4B 5IHXA 1CLEA 2QTGA 4RA9B 1BA2A 1PGPA 3QG1A 3AR2A 1B6GA 3MJDA 3KYDA 4OGFA 2I55A 4TV9B 2C4NA 5B58C 3OMXA 2OFPA 5MF6A 2CDRA 5K8IA 2YHIB 3C3MA 4DHEA 3Q6IA 4RC9A 3QFFA 1P8AA 2QMZA 3O4IA 3UYKA 3VH4A 2OXCA 3AETB 3B48A 3I6MA 4GYWA 4RPIA 4RTPA 2IZ0A 3OUZA 1WXIA 3DZ8A 1IZ7A 1XK7A 2ZJOA 2AJCA 3OPQA 4WLNA 1XPOA 3FNEA 1SQ0A 2ATCA 4XIJA 1POXA 3CR8A 1PFYA 2YHUA 3H1AA 4JJAA 4TRNA 4U3JB 5LZ4A 2MTBA 1G55A 2LE0A 4ZPXA 2C83A 1GTZA 2G1JA 4BMNA 3V33A 3NLLA 1G8JA 1QHHB 3KAQA 4DDKA 4OJMX 4Q37A 3ELWA 2GAFA 1TUBB 1N92A 5EIHA 1MD9A 1NVMB 3EMKA 5DSZA 4FBMA 4XA8A 1DIHA 4TLDA 1TPYA 1ZIDA 1Q57A 4QBKA 4R1TA 4B4OA 3IMGA 2Q1UA 2YWGA 4R5MA 1YBVA 3T9DA 1CF4A 2G28A 1V8FA 2G72A 4PBSA 4KXXA 2EBFX 5EPUA 2YDYA 4N8SA 3QLJA 4ZAWA 3EW7A 2V45A 1DZ3A 2Q3EA 3DVSX 1GUFA 1TLLA 1QU3A 2QEQA 2PMWB 4R40A 1MAVA 4HRAA 4YLYA 5ECWA 4S1TA 3MWGA 1OXXK 1W0CA 2VUIB 3P2JA 4BLUA 3AL0C 2IE0A 5DHPA 2XQVA 2AMFA 1M75A 3DPUA 3A7EA 4PYMA 3EMVA 3MINA 1CXZA 4MYUA 1YFKA 3E9CA 4RYLA 3W5AA 4L78A 1JBKA 4X1KB 2D1RA 3C87A 2YYSA 1KERA 2QX9A 5A7FA 2ECKA 3DEIA 3GROA 1N1MA 4RHCA 4QQFA 5KOJB 2HB6A 2C4MA 2ZB4A 1J33A 2RCYA 1YBFA 1G6HA 5DX1A 3UT5A 3ZVMA 1CJTC 4U5QA 1C4OA 1JMVA 2LR0A 1OX5A 4AQ7A 1DFGA 2JPDA 5B3AA 4PG4A 2UZAA 4JFAA 1EDBA 2JI8A 2VPWA 1HRDA 3EGVA 1X7XA 3TQOA 1DP4A 4UEOA 1PFUA 3ZW9A 3O8QB 4QPDA 1SBNE 2ZBUA 2Q99A 2XUOA 4H27A 4R1LA 5IVPA 4EA9A 4JXXA 2G67A 4ZOAA 3P45A 3L0PA 1WIWA 2DG2A 4R0MA 2IYTA 2DECA 4HADA 1MQ9A 3DTYA 5KDOA 5M34A 1KK0A 4TYPA 4CTKA 4KR2A 3SEQA 1AXRA 2P9YA 3T3OA 2DQZA 1KEPA 2C04A 2C0QA 3H9UA 5JECA 3C98A 5IBQA 4I1RA 1A50B 2F3QA 3HUEA 5E3JA 4QGSA 3UOWA 1TEXA 4JU8A 4D4KA 2RGEA 4MW4A 4LGCA 3TOZA 4CEIB 2IYLD 3BGDA 4E4RA 3PFCA 4PAQA 1QKIA 7YASA 4QU5A 1X1CA 4Q39A 4ZGWA 4AX4A 3WK6A 1NLMA 4F9FA 3C85A 1ZBQA 1GGMA 1P9LA 1EIZA 3FIJA 3LPLA 4FYKA 4NX2A 3VU0A 5LFAA 2VL7A 3LQYA 2YWHA 2GD2A 3BJMA 2JJQA 2DULA 3EGXB 2CV2A 1Z5ZA 4XZ3A 2H2IA 3RE1A 4AKSA 4BO3A 3JQCA 2WWRA 3U40A 4HWKA 1T1JA 1I6KA 5CB4F 3U9TA 2EQ5A 3P7MA 1TM2A 2F3TA 2HLNA 2RHJA 1I1NA 1V7QA 4Y6QA 4MJ3A 4L0DA 4ALKA 1YB2A 3IMKA 3THWA 2I1WA 3BREA 1JMKC 4NYIQ 1Z5GA 4JLBA 1KMQA 4QDXA 2XCTB 1QVZA 3VV2A 3P0JA 1WA5A 3D5EA 4ZV9A 4CIBA 2AS0A 3LK7A 4ZHQB 1L4FA 3QKWA 4ENUA 2TRSB 3U0VA 3URKA 4DSZA 3NM4A 3HCPA 4C0XA 2NYRA 2CZQA 1RWXA 4LC0A 4E6PA 3OF2A 1XEFA 2VPIA 1S2OA 2GBCA 4JHLA 4DLYA 1GPWB 2IY7A 3M9LA 5AW4A 4D6YA 2ADOA 3Q5EA 1NYQA 4HF7A 4TWZA 1UBCA 4HN2A 1VL1A 5ESXA 4IDCA 1N5DA 3G59A 3QFHA 3EIWA 2Y3IA 4UQOA 5DXFA 4EPVA 2PMEA 5CIQA 3IAXA 3I62A 1RBMA 1PT9A 4H17A 3HVIA 3Q3HA 2RFLA 3MWEA 3W9YA 1XQVA 1KI9A 5IZ4A 2OWDA 2YCBA 2RGWA 1EFHA 1W34A 2FFJA 3FN4A 1WBJB 4NZZA 4XYGA 1GG8A 2FDXA 3DNFA 1Q19A 4CF6A 2HI0A 4BO0A 1VSTA 1JHUA 3F90A 2DBQA 3NYRA 5HIIA 3TIVA 2X0NA 4AN4A 4J49A 1AK2A 1E9CA 1B0UA 4G56A 5HUHA 1H65A 5FQOA 3RREA 2X0IA 3EIFA 3JAKB 4DZZA 2WD9A 3X1MA 4EUKA 1CY6A 3C3PA 4DCOA 3LZDA 3S2ZA 3OP1A 1OXVA 4YAFA 5AUOB 1V25A 1RQRA 4MB6A 4C5CA 2ZVPX 4FGJA 1G16A 4DV0B 2AH5A 3HK2A 1Z7BA 4UUOA 3CNBA 5C46F 2P3LA 3G5AA 3S8EA 4S05A 2WYHA 4GPD1 5G4KB 3IBTA 4UASA 1GPDG 5D01A 2PIDA 4JI6B 2Z0MA 3D6VA 2OMEA 3DMPA 1XTPA 4D7AA 4OLBA 3EQ2A 3OWHA 4MLZA 4JI5B 4AT1A 4EVSA 1ABBA 5IVHA 2FE4A 1ZXLA 1I2DA 2CD7A 3BMQA 3IAHA 4R5HA 1FFAA 3DFZA 4EECA 1NT2A 5GADl 1JDSA 3SXUA 1DG3A 1ZGZA 5ESRA 1ZGBA 1ZITA 2MR6A 1E4VA 3VSEA 4DIDA 4FLEA 3DJYA 5ECYA 4NK5A 1TZ2A 2BF7A 2FPXA 3LUCA 5CW1A 2GZRA 2BM1A 3QQ5A 1HYHA 1X8XA 1L4YA 1YZUA 1Z9BA 2PANA 1J7KA 1KAGA 3C48A 3DHEA 3EWNA 2JBHA 3HNOA 1PG0A 4GZ6A 4IFBA 3WAKA 5A6VA 3HH8A 5H02A 1HSZA 2XIJA 3W5VA 3QELA 1QP7A 4F84A 4QOHA 3UUWA 1JB1A 3ETDA 3I2YX 2BE9A 3PLRA 5EZYF 1EUCA 4E2XA 1MOZA 5HQTA 1WXXA 4OGWA 1Y7IA 2GR9A 1T0JB 2PS3A 4B7AA 4BZQA 1UAGA 5BR8B 2QZPA 1AM4D 5H80A 5TVGA 2WHXA 4ZVRA 4DF3A 2P62A 3UIEA 4RKWA 5KWIA 2Z6VA 2BHSA 4DUZB 1JFFA 3HB1A 3OCXA 4N48A 1VC2A 4O08A 3ZHSA 1N5KA 2DWOA 4G8DA 3K5IA 3L1HA 5AK0A 1OLXA 4Z7OB 1P9NA 1QFXA 1XZLA 1YV9A 3HYCA 3MWJA 1P0CA 4RNDB 1W25A 4UJ3A 3ZXSA 1KOFA 4DLPA 2BBSA 3RB8A 3TQRA 1EB9A 4BVKA 1ZKDA 3KT0A 4O4IA 1YK1A 1JIUA 1XDSA 3CC8A 3LU1A 1IUNA 4M2LA 4X54A 1TCBA 1AE1A 4DARA 4HC4A 3HU5A 4F04A 3R41A 1Q0QA 3DAPA 4FYXA 1V8OA 4MWZA 3JAWA 4WGFA 3W7VA 3HJTA 5IRCD 2QRMA 5JNVA 1VBMA 4H7KA 3KV1A 4I3GA 1JLMA 4H0CA 2BFFA 2QVCA 2VDJA 5GM2A 1M7BA 3GJTA 2ZBEA 1LPMA 3CTPA 4RF3A 1DQSA 3TW8A 1THMA 3E3NA 4IXMA 4P8RA 1NNSA 2E9SA 1NXOA 3SKVA 3VR2A 3AQIA 5BSGA 3WYBA 2KWIA 2ZJ5A 1XRLA 3NGMA 4YB8A 3HZRA 4NFLA 4RZIA 1X14A 5B7PA 4NMHA 3RRJA 1U3DA 1O97D 2J4CA 4IEIA 2V98A 3JRNA 1YMUA 4EB3A 1VFPA 2YV3A 2NU9B 4BVJA 3DCYA 3ICEA 4MI3A 1EVLA 1K8ZB 4TV9F 3A27A 2A9KA 2NP6A 4P5PA 1H2XA 1NN1A 1XTRA 2JGNA 3UKOA 2Z30A 3JVVA 2NO0A 2A5FA 4CHTA 1ISJA 4HB3A 5F9MA 4ZYZA 4YRPA 4I9GA 4L08A 1MX3A 1UT5A 2X3FA 3O2SB 2PFSA 5DSXA 5FPQA 2I0FA 2WHYA 3M4NA 3IB6A 2BGJA 3OC0A 3IIEA 3SYLA 4RGYA 3T7SA 1M8JA 2R44A 3BKWA 3QJGA 1FP4A 3QE4A 4BATA 2RGBA 3K6RA 5THKA 1Z7GA 4BQPA 5LA6B 1A69A 2NTJA 1XSEA 2NU6A 4G26A 4R1NA 4V0LA 3IE0A 4XDHA 4Y6LA 5CXUA 5B36A 4MVXA 4PN7A 5JLAA 3DLHA 3U4QB 1EHCA 5CDTA 4GKJB 1H5NA 3KCNA 1U8UA 1S2NA 3KQSA 3OI7A 5F51A 3TXYA 5AVRA 5JD4A 1U3UA 4RXTA 4FFBB 4YC7A 5GGXA 3TH5A 4R6XA 4M1ZA 5GONA 2PYIA 3UV7A 1ZO8A 1N2IA 2XUGA 4GLBA 4TXJA 4Q1FA 4UARA 3WKBA 2YMPA 1DAKA 2AMVA 2AFIA 2XMSA 2VQ6A 3TI7A 1FX0A 2AV6A 3DDZX 1TI7A 4MGEA 1AN0A 2DUWA 4AF8A 1TCUA 3WLIA 4GOLD 1LLUA 3DO8A 4OYRA 4BXOB 4G1BA 1IYZA 2YX1A 2ZI6A 3WWEA 1PJQA 1XQ9A 2OESA 2FCRA 2I6FA 2X8AA 1G4HA 5HOEA 1AZLA 2FWBA 1I6WA 5A02A 4XDZA 1JDNA 5BN4A 3EH2A 1U7PA 3DD5A 2IT1A 1O2DA 5KYUB 3TD6A 1W0KD 2A94A 3H11B 1AUPA 4EYEA 4REQA 3UV6A 9ATCA 1SU7A 3BSWA 3K9WA 5F21A 3M1AA 5CFNA 1F0NA 1GU0A 2ONKA 4OCZA 3ABIA 2HD4A 3TE7A 3RJMA 4WDQA 2GEFA 5E7JA 1N77A 1V0JA 3A8TA 2Y1XA 2ZXEA 1YR2A 1UPBA 3NEJA 4UU8A 3ZTTA 4YXWD 5IJ9B 4Q4JB 1H9AA 2VDKB 3DZFA 2P11A 3AUYA 1KAOA 4K9MA 4GGPA 5JD5A 1SCIA 1JZSA 3IV6A 1XF9A 4IXTA 3RU3A 1T2NA 4BX0A 3CUTA 2BH2A 4RACA 1EXVA 3QMVA 3BXOA 1F5SA 1NN3A 1QDLB 2A4MA 3ZE1B 3R0QA 5TMBA 2GAOA 3HY3A 4GMXA 4I46A 4Q4LA 1RWOA 1UT8A 1X7YA 3DHYA 3GZTB 1KZHA 1HYBA 4UHDA 1JSXA 3BK2A 2IW1A 4MV4A 3VYWA 2DGDA 2FZ4A 2WV9A 1GO2A 2K6GA 5AKEA 5A5DA 1T5HX 1CRQA 1N2CE 2W2VA 1KYZA 2J3KA 1MJFA 2ZSUA 4FFDA 4N8EA 2ERXA 4JGGA 3NBQA 4GXNA 2EP5A 2WHPA 3MJHA 2IDZA 2RIRA 3N2IA 2F59A 3KQKA 4E2YA 2AXEA 3CLHA 1L8QA 3IUJA 3L0ZA 4LYFA 3OZUA 3V8NA 5H81A 5JNSA 1RP7A 4IUBS 1O4WA 1RWNA 5LUAA 1Z5PA 1O8CA 1V16A 1U28A 2C5SA 3OA2A 1NZDA 1GNSA 3JD2A 4Q4JA 4B6OA 3EDOA 4DLBA 3R9XB 3OCWA 4G6ZA 3GGDA 3VR3A 2PZMA 4L76A 4DT1B 2HF8A 2AMJA 4UBOA 5F35A 5C8DA 1RJ9A 2EKPA 4XQGA 4PY2A 3BC1A 4B87A 1T24A 2CY0A 5E7IA 2CZGA 1L5SA 1J0DA 2B5VA 2BKLA 4BXOA 4YV7A 3T3HA 3X2EA 4W5TA 5JAMA 1G1MA 5F7JA 1DKQA 3HXPA 4LF8B 4Q9HA 3OO1A 3MJ4A 4KXMA 1WSBA 4WOCA 3UV3A 1HYGA 2XQJA 4BAZA 4EKGA 2IHUA 4YECA 3FYCA 3O7WA 5MN6A 5AP9A 1HQYE 3AP2A 3CG4A 3HCEA 3WNDA 3GQVA 3CZAA 4EHJA 2X5OA 1Z4MA 2VHCA 4KXLA 3INRA 1Y8RA 1MGOA 2W6QA 2A88A 1UJ4A 3V1YA 4WKBA 5BSMA 2OXRA 4J6FA 4CMIB 4D0NA 1H0KA 4AG5A 1E1RA 3BZUA 5F2EA 1WS6A 4FNMA 1DAMA 1DQRA 2BJVA 2R8EA 1E6WA 4JUIA 1QH1B 4Z0HO 1WJGA 2FSHA 4WK6A 5K0JA 4CETA 1NIPA 1QONA 3I09A 4JT4A 2DBZA 2E7ZA 4ZVSA 5EG5A 2JFYA 4G0OA 4A03A 1C41A 2XQGA 2P9GA 5EMJA 2AD5A 2ABWA 1J8DA 4QOJA 5H8WA 2CNKA 1QX4A 3FR7A 1VB5A 1KGDA 2XYVA 2PRZA 3L43A 5DHTA 1U1DA 3N7UA 3OEYA 3IHKA 1OFIA 3FG9A 3P2KA 5CLGA 3JWHA 5K0CA 2IH5A 4MS1A 1F0YA 2IHTA 3IVCA 5G1NA 3SBOA 3WLOA 1CEYA 4LHYA 1WAMA 3SIWA 5AVSA 1O87A 4YCAA 1Z0SA 1P1CA 2D1SA 1UOOA 1DIBA 3H1GA 4JLNA 3VYRB 4DR6B 1F8YA 1OFVA 4G9EA 2CXHA 3L9WA 4GLOA 3VHRA 4CMCA 2DWCA 3M4JA 3Q9SA 3BMCB 1BCSA 3KXIA 4JEMA 4RYDA 3B6KA 4MRAA 4BNDB 4K2AA 1KL7A 3FD8A 4C6HA 3I9NA 2QG4A 4Q0MA 4C0WA 4O4JB 1M2WA 1K9SA 1WU8A 4P4SA 4DAOA 5JRDS 1ULTA 1D07A 4HGQA 2Z09A 4JR0A 3HYRA 3C8ZA 5I4KA 2FQXA 3QUTA 2IPNA 2B82A 4JC4A 3JD4A 3DDOA 5IYZF 3VJMA 4UEJA 2IXFA 1W29A 2B8EA 5B1YA 2UAGA 3DO6A 1RU3A 2CJXA 4IEEA 5LB2A 4GL2A 2PYZA 2YWCA 1BFDA 3WL5A 2CLCX 3LVQE 3I6BA 5LZ9A 3S40A 3FMGA 5JT1A 4BV2A 4AQYB 4P36A 3RWBA 2M1ZA 1LF0A 4GO1A 2GHTA 4OP2A 4BMYA 4HLDA 4ND8B 3SMVA 2VJOA 5EZYB 5IKOA 4FHGA 2NIPA 2AE2A 3H42B 4TTQA 2CLEB 4BMZA 5CLJA 5JXHA 1Q0TA 1XDBA 2Q9CA 1J0EA 1X1RA 3VDXA 1EJ2A 1DXQA 2D74A 4IKOA 4AS2A 4MHTA 1UAYA 4BVEA 3I4LA 4F72A 3BM5A 1QV7A 1UPXA 2G9NA 4EHIA 4I19A 4KNYA 3HQ4O 1PLLA 4R51A 3EXIA 3L3BA 3JATA 1LPPA 2HRRA 4IJVA 5HKKA 1GKUB 4AZVA 2B5OA 3NOOA 3LFHA 1Y3IA 2BC9A 3D64A 1EFDN 3EEFA 4JQYA 4CN8A 3NAGA 4IDOA 4WA8A 1QZXA 3G9ZA 5FNZA 4DDVA 8ABPA 2YJ3A 3TLEA 3N70A 5DM70 5CVUA 1I1QB 5B5SA 5FLXA 1QS0B 3JYQA 4JC8A 1M54A 4LIPD 5SICE 3TOSA 4MIKA 3V1TC 5EUCA 3PEEA 2QN3A 4OMUA 2FFBA 1Y5IA 5ED4A 1RWKA 3B12A 4JK3A 1ZC4A 1KJJA 4JODA 3V80A 3P2EA 2WVAA 2JNWA 1D2EA 3GGOA 2ZCUA 4IKEA 3IB3A 3VTZA 2ZBFA 5HHTA 1EQ2A 3NWBA 1ODIA 3H9JA 1WO8A 4UEQA 4P1ZA 3DFFA 2P1DA 3OQIA 2ESRA 3H0EA 4HBZA 1BD3A 2Y77A 3DEAA 4PCVA 4X45A 1N36B 2O1WA 3JZMA 2BGLA 4HGYA 2OZEA 4LKRA 1XRPA 3AR8A 1REQB 3P20A 3MRXA 1MX9A 4BVLA 3BSFA 2OD2A 1FMLA 2WTNA 4M9ZA 5BWMA 1Z0ZA 1D6SA 1R6TA 1SIWA 1SIUA 1P7WA 1A3CA 2CBXA 1TEHA 1J25A 1W5FA 3PQ6A 2GHIA 2W2QA 4JUBA 4RIIA 4YMIA 4AYXA 4E94A 4IXDA 4JEIA 4Y2JA 3WRVA 4CTMA 4S35A 2ZP1A 3CLTC 1SHKA 2XRMA 2QX7A 2P68A 4WESB 2HTEA 3AL3A 4TWBA 4U8GA 3BBPA 3WWOA 2AKEA 2QI9F 2ZRPA 3KU1A 2PUVA 4X8OA 2WT4A 4K9SA 3RC7A 4V0RA 3NETA 4I14A 4KYTA 1PS8A 5EA2A 3FCCA 4CQMD 1P0QA 2JJYA 1CUIA 1ULHA 2REOA 1C8LA 1YR8A 3MT0A 4HX9A 4Q16A 3TLYA 3T0GA 4F3CA 1V5EA 2AG5A 1HOXA 3PXUA 5F5NA 2QRVA 1DWOA 1ZOSA 1EFKA 2A1UB 2OGUA 3DQZA 4LZZA 1BMQA 4PYLA 4QNRA 1Q1EA 1DKMA 2B94A 1K4MA 4J8PA 4G0MA 4DRYA 1BRMA 4J07A 1P5ZB 5GOTA 4DWOA 5DTJA 4RSMA 3HGQA 3N05A 3NATA 3GFRA 1MU0A 3QP9A 1R6VA 1Q3KA 3COVA 3HKCA 4HDSA 3QLVA 3TTWA 1EDDA 1K66A 3EWAA 3ANLA 3GUUA 5J2UB 5ICFA 2XNCA 3TNYA 4BMCA 4FGKA 4ZO9A 2PJDA 4F92B 3JYNA 1GIAA 2ZKIA 4KQEA 4KIWA 1IY2A 5IASA 2VQ3A 1VSBA 4TQAA 2JGAA 3BA6A 1M0SA 1HBJA 1I80A 2WG2A 2X0KA 3HA7A 3TFOA 4KPEC 3HKBB 4WFKA 1UEIA 3LIPA 3DDCA 3CZ9A 4HL6A 4AWBA 1OFGA 1Y80A 1AHHA 5LKRA 1I30A 4DCNA 2WWYA 2AC4A 4LYJA 4L4XA 4MW6A 4C4TA 3DMGA 1ISHA 2LUOA 1FEZA 3GL9A 2ZRCA 3K09C 3C41J 1EFPA 1RADA 4MXDA 3UH0A 3N6XA 5JASA 1FNNA 1N8KA 5I7RA 2G0TA 3LMKA 2V0GA 4BX2A 2BD0A 1QCZA 1X3LA 3KYCB 3PGJA 4JBHA 4Y6PA 3WXMA 1N6LA 8OHMA 3TGLA 2V7TA 1CDDA 1FTNA 2XYHA 3KQMA 3IAS1 5E1OA 2FN4A 2GARA 2O3RA 2A33A 4FC6A 2P91A 4OBWA 3OU6A 5TDHA 1FSFA 2NUPA 3FXAA 2AIRA 3U3MA 3K2EA 2Q5LA 4NU6A 3IBGA 3IVRA 3WSVA 4CI9A 2RGUA 3I61A 3F3YA 4X64B 4QDJA 5HJ5A 2Q0QA 1R8YA 4OJYA 3EZLA 2GH1A 2HMAA 4W82A 1KMNA 5KU1A 4PHTA 3LC7O 4QO7A 3ZTWA 2W6NA 1Q17A 1T35A 4A6EA 4EJ0A 3REOA 3EXHA 4FJ1A 5I3ZA 2AXPA 3NVKI 4F60A 4ESEA 1W59A 2AVDA 2FN3A 4WKPA 3IKVA 1NFRA 2RI6A 2WG0A 3KB2A 1CWUA 3HTXA 3E5RA 1VRVA 1XZHA 1QE0A 5K3EA 3A1CA 1C0EA 4AZSA 1J97A 1D1QA 5EHIA 3S1AB 4PPNA 4YIHA 2HJSA 4BC1A 3QWFA 2P3SA 4ISBA 3SN6A 4BNUA 2O7SA 5C0OE 2VP2A 4H3KB 3AM3A 4D6XA 5CDUA 2PMBA 2RHTA 3EB9A 4TKUA 4LVCA 3H5AA 2H5IA 3GRVA 4YCNA 3BMNB 4KV9A 2MU1A 3UQYS 4LC1A 2CW5A 3EQ8A 3C3KA 5FI5A 4JN6B 4AZ0A 3RTBA 1DEAA 3GRKA 3HLTA 1S1CA 3L0SA 1XFDA 3ZD6A 3K32A 1NVEA 4LAFA 4RPGA 4Y7DA 5LXTB 2JCSA 2QUIA 2ZWAA 4ER3A 1UODA 2RKWA 3E8XA 4JJ8A 5IT5A 4CMIA 1E5TA 4ENRA 4QU9A 4R2JA 1OC4A 1BSVA 1Z62A 4KXFB 4PF1A 4XGQA 2A30A 5YASA 2BFWA 5SYMA 1JPNA 2OV4A 3TRJA 5A4DA 2YOGA 1PV4A 2GRUA 3FHCB 2JGMA 3KB1A 1C3XA 4MUYA 1GAXA 3CBQA 1MPTA 4I50A 1L7DA 1LSSA 4O2AF 2AWOA 3DEZA 1GAEO 1T3TA 1VP9A 3DVAB 3MHPA 4WLOA 1J8QA 3UJ8A 4WZZA 4P33A 3B2EA 3QBTA 1MORA 4COOA 4CV3A 2A2ZA 3D5TA 1CFZA 2Z3VA 4L6AA 5CCEA 1VMEA 4HGNA 3ZXXA 4ZQIA 4Q1VA 2VBIA 3JQ6A 5ETJA 4A6PA 1CJBA 1YZLA 3P1JA 4DIUA 2PSDA 1A0OA 1DQPA 1V8PA 1BX3A 5BQPA 1KI4A 1U5AA 1G8HA 1QRTA 4AY6A 4WCDA 1SUBA 4ZAZA 5HDQA 4AY3A 2B8TA 2LXNA 3HC7A 2W93A 4RVDA 4W9NC 5CA0B 1TZBA 3IAM1 4OUDA 4QUHA 3BH7A 1BHSA 3MUOA 3ZDEA 3ONNA 4I4TF 1XZBA 5IJXA 2RI1A 2SCUA 3KYJB 3VH1A 1YQ9A 2OO7A 3N0WA 4HDOB 1E1QA 4KFCA 3QKRB 3ZHTA 4QLOA 1GZVA 1ADCA 1JDVA 4C22A 2XRFA 1IHXA 2Q50A 3VZPA 4UULA 2JFNA 4PSDA 2DJ5A 2VKTA 2ZT7A 5AKZA 3ED1A 3D43A 4G07A 1Q7RA 3T5TA 3ZY5A 1DCTA 3QF4A 3WO1A 3ICOA 1Y1PA 1XKXA 2AF4C 1P33A 2CJWB 3QKSA 2H31A 4ETMA 1ZCAA 4BNGA 3K6SB 4D46A 3QLUA 3SMQA 3LBYA 3MBKA 1QVWA 3QXCA 4ZI7F 4KC0A 5JBQA 2IGTA 4DJDC 2HBZA 2FZKA 2CFOA 4GXQA 3L7IA 4DTCA 1WD7A 4IGIA 3WLAA 2ZUBA 3GFVA 3GJ3A 1BD4A 3E22A 5AO9A 1PZMA 3K09A 1YJ5A 3WQSB 3OECA 5DLPA 3DLBA 3CBGA 4LA4A 4G01B 4NEHB 2ZJYA 2BMWA 2CK3D 2EX4A 5DHSA 2R8XA 5DGDA 1K86A 1R4ZA 1AGYA 2ZKLA 1WMSA 4UBIA 1EVEA 4HG2A 2VPYA 2B8NA 2GAAA 4BNXA 5EE5B 3A6KA 1P31A 5G02A 1SZCA 1LY1A 2OHJA 1I7LA 3JR7A 4X3PA 4GMHA 4B7XA 4YV2A 4L16A 5K3FA 3GJZA 4FEEA 4QUJA 1VYHA 4HKTA 1DIGA 1A97A 1DC7A 3KTAA 4X7PA 4FB5A 1OB2A 2O8BB 2QQ5A 1YKFA 2UKDA 2VTEA 4WXMA 5FBHA 4YPOA 2IDMA 1NJFA 1I4EB 2Y0EA 3ZNPA 2UV8A 3NJRA 4EEXA 5CFPA 3TJZA 2VZ9A 2CXPA 3R0VA 3L0OA 3NHKA 2QM8A 1CNMA 3TSWA 3TYXA 4PLCA 3KJZA 4BPBA 4WPGA 1HL7A 2YV4A 1XZMA 1Y81A 5K2MA 2BGIA 4E2ZA 2O8DB 1EGHA 2PGXA 1B2LA 1R9GA 3AH8A 3NJ8A 4H9GA 3L1IA 4HYYA 3BD7A 4K2HA 2XXJA 4NY1A 3TKAA 3A3YA 2J59A 4F3NA 4PZZA 1GP2A 2H65A 1F2TB 1XQWA 4CLOB 2NSDA 3DOEA 4DCJA 2W2LD 2WKRA 4PLZA 4XM1A 1Z6YA 1R6BX 1F60A 3GLUA 3N86A 1HNXB 1O6CA 4KFRA 1KYWA 5BVGA 5JHHB 5I9IA 3CEHA 3I9JA 3UHAA 4A0SA 3A9RA 2P2ZA 3RK4A 2FMIA 3UT5B 3EBOA 4NATA 2XE7A 5HUJA 3V8BA 1FMJA 4V39A 3BH6A 4GMKA 2C5FA 4MR8A 1DU4A 4MGYR 1U1FA 2H54A 1IH8A 3CE6A 1K8XB 4ZQFA 3E5HA 3GAAA 3OQHA 5KQSA 1U8EA 2RC6A 4MICA 4L4SA 4LJ4A 1J1ZA 3ZE6A 2G63A 1RYBA 3L4SO 5EP4A 1Z45A 4BFWA 2EG9A 3FWNA 5F23A 1VI2A 3PFKA 4R2HA 4H0FA 4MUNA 3Q41A 2BEVA 4Y9TA 3USZA 2OXFA 4KE8A 1OZHA 1Q3TA 4R2IA 1K5GA 3UBMA 2BEUB 2JANA 1GYQA 1QRDA 3NFYA 4FZVA 2XIQA 4IIHA 4W4TA 1X1EA 3OCZA 5G53C 4J3FA 4TTVA 2H1SA 2K4MA 1T0PA 2KBEA 3LLUA 4C4XA 2DPHA 4MW9A 3A36A 4W7HA 2ECPA 2H4WA 4GEKA 3O8OA 1Y1KE 4UE2A 1KFBB 1TQ8A 4CIDA 4NXMB 1KWGA 5TGTA 5KJEA 3HZZA 3UM9A 3C6ZA 3DEHA 1FJHA 3D6FA 5THXA 1ZMBA 4ARSA 1W85A 1E1DA 2MSDB 5AI6A 3NW9A 1XEWX 2FG7C 3E8SA 3FPKA 4R31A 2ECQA 2HC9A 2IFTA 2I6GA 5I9TA 2YC4C 3JZDA 2KS6A 3QVUA 4PSCA 5CB6A 5JVDA 3S81A 3COWA 3O26A 1G21E 4Q34A 5H9WA 2AFHA 2P4SA 3RSLA 3WFJA 1II0A 4MUFA 4ZAYA 1ETHA 1CUVA 1Z17A 1M83A 4G81A 4DFDA 4AG6A 4A1FA 2HF9A 4TZ6A 3RR2A 2AKYA 1Q7EA 1ZHHA 3E5NA 2ACKA 3GLVA 1DKUA 4II7A 1TUGA 1RKQA 3RSZA 2YUIA 3WWCA 4LVNA 4QG3A 2HMTA 4JR1A 1GITA 5FT9A 3P2YA 3C3JA 4IDBA 1VTKA 1VJ5A 3E82A 4PVDA 4Q7LA 4UUNA 1Z7YA 1U3TA 3EY4A 3EAQA 1I3LA 2R6JA 3LA6A 4NHEA 3R9IA 4QUBA 4HDCA 4OYYA 4FGUA 4ZT5A 4M0UA 3RIYA 4MQMA 3ELBA 4QATA 1B26A 1TX4B 4EHNA 2HSGA 3L1JA 1F1BA 4B3IA 1COZA 2B1GA 1TM4E 4I4LA 3TXAA 5B55A 3ETLA 3CLRD 1TT7A 1YZHA 3O75A 2FMUA 4PSUA 4RA6B 1R0ZA 1ZN2A 3CWCA 2GSDA 3CGWA 3WK9A 2Q2WA 4YJDA 1T8UA 4JBNA 3LPCA 3G23A 1XHFA 4D8XA 1KK2A 4W5OA 1TA9A 1XL1A 4DIFA 3RTEA 3VPDA 2R6AA 3FRHA 3IDZA 2ZSEA 4U7PB 1IHDA 4IS3A 1NW4A 2CVZA 3FBGA 1K2WA 1AQ6A 4AZ0B 3FROA 3HDTA 1J24A 5JO0A 2Q2QA 3K9BA 1FDRA 3A7DA 3JR3A 3KKEA 2ZRLA 3R0XA 4A8TA 3IQDB 1HUQA 2NO1A 3ELDA 1Z25A 2QP4A 4JIGA 3TIXB 3NDJA 1N5JA 3AKEA 2BFPA 1YTUA 2ZEJA 3NDRA 4G5QA 4UNNA 3E15A 3RNLA 4B5LA 2PD3A 1SAYA 4MWSA 4I9FA 4A8PA 3N39C 4LDZA 4AZTA 5LQSA 1A9PA 5FUBA 1TYZA 3TNLA 4FBLA 5AJWA 5LD2B 1XOIA 2QG9A 4JWTA 3HLYA 4FFMA 2V3CC 5FXMA 3EXHB 3GCZA 4H60A 3ZLJA 2O5EA 1U1GA 3C4JA 3I39X 2AFIE 4F5WA 4Q66C 3WK7A 2MJLA 4B3FX 4E1VA 1U2DA 3FF1A 3G2QA 1RM3A 4HSEA 4B6PA 4REOA 3WYCA 2ZUVA 1Q22A 4V2IA 2WWTA 1EDEA 3VI3B 4QSHA 4W7SA 4O2AA 4DYDA 5C8XA 1SKUA 1XZJA 5AM1A 4BL5A 1UWKA 2Z95A 3LWBA 1C3JA 3KXDA 4BJ5A 5EE3A 1NBMA 3O8RA 1MGPA 2D3WA 2HF7A 5AMXA 3TTTA 1SOMA 1JE1A 4JI0B 2YJ6A 3FZYA 1PSDA 1OXSC 1TK2A 2W43A 1ATIA 3FCXA 3FYUB 2RHRA 4RD0A 1MIOB 2HWYA 5K8UA 5IVKA 4GZ3A 3I34X 4N1AA 4NJEA 1E5LA 4KGXA 3B1WA 1V41E 4GZ5A 3TQFA 1B7GO 4WXYB 5CT6A 4M55A 4RADA 3B36A 4DLSA 1YQXA 2YIVX 1Z8FA 2ZXFA 3ZJVA 4I4TA 1VSVA 2GNOA 5ALTA 4AG3A 2NUAB 5H3CA 1V9LA 3ZCRA 4L50A 2A9PA 2YZNA 2MINA 3RS4A 3U7JA 1I0IA 4M3NA 3D3EA 3F5SA 4ZOCA 5KPDA 3F1LA 1MHPA 4C7KA 4MULA 1LDMA 4TOIA 3TD9A 4EY8A 3KJGA 3TEJA 4RF5A 3TSAA 4R41A 1Q92A 5CDGA 4DA4A 1L4LA 2QTVA 1C1XB 1CETA 1P1FA 4TSFD 4N5NA 2ET6A 2OYRA 4DR1B 3LWDA 5HGXA 4J76A 1O96B 4KDFA 4OXNA 1CFJA 1AGNA 4LV8B 1YA6A 5BPFA 2IEYA 3IAFA 1FS4A 2WAYA 4EBBA 2XDYA 1KH2A 3CISA 1Y3FE 1AHIA 1DDIA 2WJ4A 3ECSA 3QYPA 1E7SA 5EJ5A 5JHGB 4NDNE 4PR3A 4R1MA 5EVJA 1NSYA 4FZ3A 2IZ1A 1Q3HA 4ODIA 2YOFA 3D1LA 4ZANA 5E3HA 1NLYA 1MT0A 3TCKA 1TUEA 5K4GA 1P44A 2JEYA 4DY6A 3IAUA 3CHYA 3P0HA 2PX8A 1L7VC 2YTZA 1S8NA 3PBKA 2W0MA 4YK7A 2OMKA 2HTFA 1PIWA 3NH9A 1EVYA 1PG2A 5G0UA 5M3BA 4OOEA 5BUSA 1BGWA 3HDYA 2JGJA 4DNXA 3KU4A 3IAAA 3GXOA 2Y67A 1FQJA 4YP0A 3HCFA 4P81A 2NUTA 2W42A 3DR5A 2I6TA 3R3ZA 3VPHA 5I5EA 1X7DA 3TIIA 3ROEA 3E6AA 1T4CB 2JZOA 3DXXA 4TVBA 3RLIA 1Z4LA 4QAJA 3ETJA 3QLTA 1T1RA 1PNRA 1P4RA 1FQWA 5IAKA 4E1BA 1GNLA 2FXVA 3PGMA 2FG6C 2PBLA 2V7UA 3NRJA 2DPXA 2X2FA 3PTZA 1PDVA 2PU7A 1BROA 4PE5B 4E7PA 1O9BA 5DISB 2WHPB 4JAVC 5BYKA 2ZDGA 3OF3A 5BOVA 5IG2A 5HILA 1J56A 2OAQ1 4GGOA 1DEOA 4I5IA 4EOGA 2D2IA 3OPYB 3E0QA 3TPCA 3PC3A 2XZOA 1VA4A 2ATEA 1GRCA 2X6RA 4GLLA 4HXGA 4QXOA 1N5RA 3WP0A 4BBAA 1BWQA 1YDGA 2X4GA 3ZS9A 4FPXA 4Y3UA 3PT9A 1X94A 4GOKA 1RYNA 1QRSA 3PQ8A 1MHTA 5H82A 3PNBA 5LSAA 1E2MA 2W8BB 4ZQEA 1E8MA 4Y2PA 1XVLA 5DGCA 4NZOA 2CUTA 4O0MA 4HFNA 4CMHA 1DXHA 1LVHA 2X8JB 1TQ2A 3E2MA 5HP4A 3SQXA 5CA0A 1ZWKA 2GQ0A 3INTA 3D31A 3FRIA 3NWOA 3A2MA 2ISSD 4J7UA 5KMGA 4ENVA 3DJFA 2RONA 3LX5A 2NV6A 1DLIA 3Q5GA 1PR5A 5L3SA 1R8XA 3OQPA 3RWMB 1JPVA 1E9FA 2PVSA 4LUCA 4IWNA 3N6RA 3ITNA 3WJ2A 4NS4A 3W4JA 4XGRA 4TL8A 5LQUA 1LDYA 1RHUA 4XJXA 2WSBA 2FWRA 3BF8A 3TR6A 2P1RA 2YZKA 3TRHA 1FTGA 1P80A 4G36A 3CLUC 4I1PA 1QTQA 3MCZA 1UBOS 2QRLA 3KFXA 3SFZA 1Y98A 1I2MA 2W37A 2W90A 3TK1A 2HRDA 5DNEA 3GZNB 1POWA 3VDMA 3FKJA 4V0OA 5DNDA 1VKZA 3BK7A 5KSZA 3W7AA 3VUFA 1ZD8A 4JVNA 4RKRA 1AIPA 3TAHA 3ZE0B 4HZGA 2VG8A 3LBHA 3U7HB 1EA5A 4PLHA 3HJHA 3KRTA 2WD7A 5KNCA 3VC2A 1KJYA 1SHTX 4X5OA 1FU8A 1T2EA 3KTOA 2EXXA 3ZKWB 2PHZA 1CQJA 2V6FA 5B53A 4BKUA 1GUBA 2QUBA 2G9UA 4OQ4A 3DE6X 1ESCA 3NM6B 5ALYA 1ZH0A 4EMTA 4II2A 2B2NA 5HIKA 1OFUA 1DJMA 2DFPA 5AUQA 2PGJA 4QDZA 4AJLA 1LUAA 3HZHA 4QWMA 3Q7SA 5B1HA 3ZU5A 1EX1A 1GCIA 3EODA 1A8SA 4IMJB 2GS9A 3UBTA 3F8SA 2ZSBA 3QVGB 1ISPA 5FB3A 4YPFA 5JJBA 2V7EA 3GWGA 5JNWA 3IUQA 2V6IA 1PRYA 3PPXA 3VZSA 1T4DA 3D6AA 3D7RA 4EY3A 1IPEA 2E5WA 2A6PA 3RUHA 3ZKAA 2AK3A 3F9CA 4RGBA 3NBUA 3KJHA 3WLPA 2A0YA 4K6FA 3PTLA 3AJEA 4HAUA 1QYRA 2VIIA 1FZQA 3AI1A 1E9BA 2EDCA 5EQJB 4B6FA 4IJ6A 3GJSA 2IV3A 2WAXA 3Q9UA 1MO5A 1RTKA 4K0KB 3PDHA 1FDIA 1RZ3A 3GR6A 1M6VB 2CLIB 1G6KA 1ISSA 4MWBA 1MVNA 2C42A 2VH2A 3QE0A 4CMEA 4KWIA 4MYTA 3KQVA 3NTQA 3VA7A 4RJ2A 1DTEA 3FBWA 4URXR 1I36A 2B1JA 3T4UA 2FGJA 1JVSA 3IODA 2ZZNA 2XT6A 1CULC 1QWOA 3RC2A 4DLLA 1H0RA 4G0ZA 5C34B 2W2XA 2Z4TA 3DDNA 2COUA 3GGGA 4FMCF 4D1YA 2FWMX 4UHBA 4BJ1A 1WXHA 4F3TA 4L3WA 1S3GA 1UUFA 3JY6A 2O2GA 3CYFA 3P8ZA 1KJ8A 1T9BA 2CFSA 2H7XA 2K2QB 2PG3A 2CFIA 2CHFA 4WK2B 1A9SA 1TADA 3HPRA 1WMEA 2E4ZA 1FF9A 4NECA 5K2OA 5AOVA 4GL4A 2C97A 3IELA 3SC3A 1SOUA 2MOKA 3WWYA 3PGLA 2G1KA 2XITA 1FPMA 1DRUA 2C1EA 1M6HA 5EJGA 3IEPA 4YQYA 2NP7A 4H18A 3S3TA 1KO5A 3W5CA 2BDTA 4WERA 5JBNA 3M6WA 3I64A 2ZI7A 1SG9A 3OQBA 2CNOA 3WNZA 4KSYA