1C1NA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1nA02
1SGPE 2A7CA 5A8ZA 2VVCA 1OWJA 1V2RT 4RN6A 2ZDVH 4Q2KA 1NO9H 2PWXA 2OD3B 4ABDA 1BTUA 4INHA 1HDTH 4OS6A 3SJ9A 1K1LA 5AHGH 1ZSJA 2ZFSA 1IAUA 3KQEA 2WPMS 3H5CB 2FI3E 3MH6A 4LXBH 1D6WA 1W7XH 2OC7A 1TGCA 2W5EA 1DFPA 1C4Y2 1S5SA 1RRKA 5FCRA 4ASHA 2OQUA 5EW1H 3MNXA 1V2WT 1S6FA 1WOFA 2NU0E 1N6XA 1GMDG 1V2MT 3NUMA 1THSH 3A82A 1QY6A 1C1TA 1BTWA 3ZZ6A 2GVFA 2ZO3H 1ZRKA 1EZUC 2W3KA 3EAJA 1KYNA 1GI3A 1SFQB 2V3HH 1O31A 1MBMA 4NA9H 1S85A 4INLA 5E0JA 3FP8E 1L1NA 1O2RA 1O2MA 1TGTA 1EZQA 4DT7B 3LGUA 1OSSA 1Y3UA 1ZTJA 1ELAA 1V3XA 4NZLA 2ODPA 1DWDH 3KL6A 2O8WA 3MMGA 4YESB 1HNEE 2VH0A 2TPIZ 4CR5A 1GMHG 1TPAE 3QGNB 1EZXC 3BTME 9ESTA 3QUMP 5DP8A 4JK6A 1EAXA 4O3TA 4UFDH 1ABIH 2OBQA 5FCKA 3CP7A 4B2CA 3GDUA 3TIUA 3M5MA 2F9UA 2ZCLP 4UEHH 4Y71A 3ZYEA 1YPJH 1C1WH 3PWCA 4LOYH 3TGJE 1YC0A 2GZ9A 2OINA 1C1RA 2F83A 2F3CE 2BD7A 2TRMA 5A8XA 1J9CH 1PPGE 1CHOF 3A7XA 4YM9A 1TNJA 4OS7A 1ZZZA 2YNBA 4Y0YE 3GY3A 2O8TA 5FX5A 4Y79A 3P8NA 5C1YA 4YT6H 3RC6A 1GI0A 1O2PA 1P01A 2GZ8A 5EQSA 1Y3XA 4YOIA 3SU3A 5JDUB 1UCYE 2H9HA 2VINA 2GT8A 1YPHE 3TJNA 3UOPA 1FAXA 1FZZA 1ORFA 3SQEE 3LGWA 3DT0H 2W7UA 2P95A 2BD9A 1LVMA 1YF4A 3OYPA 1B0FA 1ETSH 4QT8C 3KGPA 3RU4E 2FS8A 4K8YA 1CGJE 4UONA 1QBVH 1BTHH 1XMNB 3UWJH 1P3CA 1P2KA 2ANWA 1TE0A 3MNSA 3QWCH 2WUCA 1L4DA 4HZHA 1EZSC 2H9EH 1QB9A 3PMHB 4K8BA 1ZYOA 2BVXH 2HPPH 1TGBA 2J4IA 2VH6A 3RXSA 1VJ9U 2Z3EA 3K6YA 2QYIA 2R3YA 1DSUA 2FWWA 1NC6A 4UFGH 1LHGH 1Y5BT 2A1DB 2FI5E 3VB7A 4DW2U 2FX4A 1ANCA 3ZYDA 1MTSA 1W0YH 1QGFA 3BTFE 2H9TH 5EXNA 1AD8H 1KLIH 1BMAA 3TVJB 2EA3A 3SHAH 1O2VA 2B0FA 1GBTA 3SGBE 3U8OH 3S9AA 4UFEH 4WH8A 1S0QA 2PTCE 3LC3A 3LGIA 4MNWA 1NRQH 1C2GA 2PLXA 1SQAA 1FPCH 3ZVEA 1Y59T 3MYWA 1TGSZ 2Z9LA 1XVOA 1O3OA 2FXRA 1A0LA 4K3JA 4CH2B 4DIIH 2BQWB 2CMYA 2Y5HA 1HIAB 4H4FA 1GMCG 1F2SE 1GBHA 6LPRA 4X8UH 1SGIB 1XUFA 1BRUP 3RC4A 2BQ6B 3SU2A 3QTOH 1HAYB 2FODA 1TFXA 5F6MA 3LDXH 4J1YA 2B5TB 1UTLM 3A80A 1C5ZB 3GCTF 5GXPA 1K1JA 1QRXA 2XWAA 1FLEE 1SGQE 3OU0A 4KTUA 1UVSH 2J9NA 1JIRA 4MG3A 1TMUH 5TCCA 1BMNH 1SC8U 5A0CA 2R0KA 4DCDA 3L3TA 1UTMA 4SGAE 5A0BA 1GBCA 3NWUA 1HJAC 4I8HA 1PPFE 2B7DH 2FOEA 1VITF 1Q2WA 1AKSA 2AMDA 1D3PB 2AFQB 1V2PT 1ZMLA 3UR6A 4B71A 1UK3A 2CV3A 3TJUA 5FPYA 3SU4A 1ZJDA 3DUXH 2FP7B 2Y81A 1E35B 1G2MA 1QHRB 1GBLA 1EB2A 1QA0A 2WV4A 1A46H 4CBNA 1SGFA 1O3IA 1F5RA 3SNAA 4R0IA 1UTQA 2ZTYA 1IQLA 1GVZA 3P8OA 3SGQE 3SI3H 2UUKB 4AFSA 3PMBB 5EPYA 4BOHA 4D9QA 5F03A 3TJVA 2Z9JA 1HGTH 1JRTA 1K1PA 1UVTH 4Q80A 2GTBA 5A8YA 3VXEH 5JBTA 4O03A 2J38A 5FHTA 4ZUHA 4Y11E 1PFXC 3SOSA 2BB4A 2WYGA 2ZGHA 2QN5T 2XNIA 3NPSA 4I8KA 4NCYA 3TITA 3MH7A 1L4ZA 4RKOB 1P05A 1TBZH 3ZZCA 2AERH 1ELVA 1SGCA 2TGAA 3ZZ8A 4ZKOU 4NA7A 3VGCC 1DOJA 1S82A 2PV9B 1TPPA 1KDQA 1KXAA 3VEQB 1TX7A 2Z3CA 2SGDE 4GVUA 1T8MA 2ZC9H 3PMAB 4D7FA 2CJIA 2F91A 2A45B 4AG1A 1VITH 1ID5H 1D9IA 1BQYA 5EGMA 2FYQA 3T2NA 2ZECA 2ZZUH 1QBOA 1G3BA 1GJ5H 2QF3A 1TOMH 4GCHF 3SUEA 2BOKA 2O8LA 1C2MA 4INKA 1H1BA 4KGAA 1C5YB 1GCTC 4MNVA 5DKMA 3M35A 4I7YH 1QQ4A 4OGYA 1Z1IA 2ZNKH 1FNIA 2GGVB 3G01A 1GHAF 1P12E 3HKJB 3P92A 4ABIA 4CH8B 3A8CA 3LH1A 1FN6A 4Y10E 3HATH 3U1JB 1O2KA 4Y6DA 2EEKA 2C4FH 1TNLA 3ZVFA 1GBEA 3E0NB 1IHTH 1C9TA 3TGKE 5E8EH 1FUJA 1QJ7B 3AASA 3H7OA 1CU1A 3UUZA 4ESTE 1WAYB 5CHAC 1DE7H 1TNHA 4AGJA 3LU9B 2HLCA 1C1PA 4YO9A 4JMYA 5DK1A 1SGYE 3V3MA 1HUTH 1AE5A 1RGQA 1QR3E 1O33A 4ZXXH 3RXOA 1SHHB 1IQNA 1DUEA 4AGKA 2AYWA 4I32A 1GHBG 1GWAA 1SG8B 1XUGA 1O3PB 1GBKA 1ZMJA 1WTGH 2ZPSA 3S9BA 2ZGJA 1GI5A 1GI7B 3ZZAA 5L6NH 3MWIU 4X1RU 1BBRH 2NU1E 3F6UH 1O30A 2BLQA 2ZWLH 1W8BH 1KXBA 4A7IB 4X6NA 1B0EA 4WVPE 1BHXF 1C5TA 3S7HB 1HAOH 1C1OA 3GY2A 3ZZ4A 3KEEA 4IN2A 3DHKH 2C8WB 2V35A 5K0HA 3BTDE 1NESE 1TQ0B 3KHVA 2ANMH 2I6SA 1SQOA 2FOGA 2Z94A 1S83A 3ATKA 1X7AC 3ODDA 3RMLH 1HJAB 4X8SH 1F0TA 4ABBA 2FO9A 2BHGA 2VIPA 1YPHC 3KNXA 1ANEA 1P3EA 3CS7A 1YBWA 4OS5A 3KF2A 3QO6A 2DUCA 1NU9A 1HLTH 2UUFB 2VIOA 2QXHA 2BD2A 4WMEA 1MAYA 4K2YA 4IBLH 1O2SA 1ELDE 1PQ8A 4A5TS 5T6DA 1HPGA 2BX3A 2F9PA 2GDDA 3FANA 4ZKNU 4ZROA 1GHZA 3M3VA 1TIOA 4ZXYH 1SBWA 1HFDA 1AN1E 2P93A 2FZZA 4A1XA 4NIVA 3RXEA 3Q76A 5SGAE 3TLOA 3NCLA 3RXAA 1MAXA 1Q3XA 2PSXA 1K22H 3IG6B 4WMFA 1LPZB 1QIXB 3HGPA 1NROH 4AN7A 4TPIZ 1P11E 2STAE 1P2IA 3GY6A 4JCNA 5GWZA 4ISOA 3ZVGA 3A7VA 1OX1A 1C9PA 1Y5AT 2PKSC 5JPMH 3GOVB 3M3SA 5EQQA 1AWFH 3VGCB 1YM0A 1EAIA 3OSYA 3RXMA 1K9OE 1MTNC 1V2ST 1UVUH 3VXFH 5GIBA 1RJXB 1LHEH 5JBAS 1Z8IB 5DP4A 3FFGA 1CT2E 1QL7A 5C5OA 3A8AA 4RKJB 2Z9GA 3OY5U 5DP3A 3H7TA 2Z3DA 3U8RH 3LPRA 2UWPA 3PWBA 3MHWU 3C1KA 1YPMH 4GLYA 1UJ1A 3UNRA 5AFZH 1WQSA 4X2VA 1OWHA 1P9UA 1GCTB 2FEQH 4JZ1A 2FMJA 4OS2A 2AH4X 4JK5A 3RM2H 1MD8A 1ANBA 1C5XB 4TWWA 1F0SA 1LMWB 5EU8A 4ZH8A 3E0PB 1ZSKA 2FOMB 4JYUH 1ZPBA 2FLBH 3MOCA 2PGBB 1AMHA 1MTUA 3BTEE 1N1LA 3BTWE 1H9IE 3SUDA 2EI8A 2ZDLA 4OGXA 2C8ZB 4I31A 1PPBH 2ZPQA 1E0FD 5CHAB 3UY9A 3A86A 4BAMB 4NA8A 3GCHC 1A7SA 5EOKA 3UWIA 1F5LA 1MQ5A 3T27A 2BXUH 3B8JA 1KDQB 2C93B 3R3GB 5G4BA 3KQCA 3A7YA 3B9FH 5EPNA 3A83A 3LT3A 1VGCC 3RXIA 2XCFA 1J16A 1ZPCA 3IWMA 4WH6A 3VB6A 4TY7A 4UDWH 1BTXA 1NPMA 4AORA 3ZZBA 2G4TA 4YLUA 3I77A 3RXUA 3BF6H 1V2KT 5LH8A 3AVZA 3DA9B 1J17T 3F9EA 5F8TA 1SGNE 5E2OA 3ZV8A 2ODYB 2THFB 3RUOA 2OC8A 1C1SA 1O5AB 3QGJA 1ACBE 1EJAA 2ZA5A 1W7GH 3Q00A 1BCUH 4DJZB 1O2ZA 1SGRE 1K1OA 3LGTA 1V6DA 1BOQA 4CRDA 1HXFH 2XXLA 2Q6FA 1FDPA 2BQ7B 1XUKA 4GSOA 4ABHA 2H6MA 5JYIA 5HYOA 5FAHA 1SB1H 1SFIA 2BY9X 5J4QA 2QXIA 2ZU4A 3NKKA 1V2VT 2D26C 2QGRA 1IQJA 1CGHA 4X1PU 4AG2A 1DPOA 3BEFB 1YKTA 1DVAH 3K65B 1CVWH 1Z8JB 1KY9A 2Z6BD 1AO5A 4ABGA 2UUJB 4JZIA 2ZI2H 1ZSLA 3MFJA 3UREA 2RG3A 1ESAA 1HCGA 1NM6A 1OXGA 2QIQA 2BVSH 2BDIA 3STIA 1KLJH 1Y5UT 1V2QT 4FUBA 2FM2A 1IOEA 1YYY1 2STBE 1GJ6A 1HAHH 3U1IB 1SQTA 1SLVB 1ELGA 2VB0A 1C1VH 4D7GA 1TX6A 1IQFA 2C3SA 1L1JA 1QBNA 1GBJA 3SHCH 1FPHH 2ZCKP 2ZFRH 1JIMA 1LQEA 1CA8B 5LPRA 2F9OA 1KXEA 3BTTE 3I29A 2RDLA 1GI2A 1C5SA 1CBWC 1T8NA 1HAIH 4YOJA 2CGAA 4NWKA 1EATA 4AX9H 5T6GA 3EDXB 2IPHA 8GCHG 3MTYA 4NZQA 1O5CB 2A7HA 5HMAA 1XXDA 1DDJA 2GCTC 2ZHQH 2TIOA 1HB0B 3SJIA 2ZF0H 2C8YB 3O8BA 2D1JA 2AMQA 2V0BA 3FZZA 1NTPA 4CRBA 1DY9A 3URCA 3T28A 1EXFA 2PKSB 4BTIB 2NU3E 1A61H 1ZMNA 3NK8A 2QA9E 1EPTA 4KTCA 1NRSH 3L6PA 1DT2A 3QK1A 1MTNB 3GCOA 2OTVA 2OQ5A 2G00A 1TBRH 2GP9B 3ZVDA 1GHVH 3RXKA 2AEIH 1IHSH 2C90B 5EG4A 4AOQA 1SGFG 4E7RG 2TGTA 3WY8A 1QB1A 4ABAA 3P95A 1PYTC 3V13A 4UD9H 3A7WA 1AFQC 1VJAU 2ZGXH 5L2YH 2QCYA 4M7GA 4AB9A 2ILNA 3KQBA 4CRCA 4Y7BA 1A5HA 1GL1A 4MPUA 2PKAA 1Y3VA 1EOJA 2VGCC 3MI4A 5GCHG 1HAVA 3RXPA 5ETXA 1O3EA 3LONA 1DICA 4THNH 1VCWA 1WU1A 2OC0A 2OUAA 1O3JA 1OP2A 1GI1A 3AW1A 5T3HA 1N6YA 2G51A 3NZIA 3A7TA 1PPHE 3RM0H 3TH2H 3A89A 1O3LA 1AFEH 1GHBF 2XBXA 2G81E 2ZPRA 1XUIA 2O9QA 4CRAA 5EW2H 1TQ7B 1BDAA 2XC4A 1NY22 1AY6H 1WV7H 8LPRA 3GCHB 1Y3WA 1O3NA 3BTKE 3OTJE 1EPTC 3GCNA 2AGEX 2GCHG 1O35A 3UOUA 3SJKA 1VGCB 3LGYA 1LO6A 4TPYA 4H42U 1GBMA 1BTZA 3BTQE 4Y0ZE 3VFEA 3F9HA 1A5GH 4WY3A 1G3DA 5HXFA 1Z7KA 1FN8A 1C5LH 2VIWA 2LPRA 2SGAA 1GJ9B 3ESTA 1CO7E 1IQGA 2JH0D 1PYTD 1MU6B 4B2AA 3D23A 4ISLA 3RXBA 3SV2H 1H8DH 1P06A 3RXHA 1E36B 1C5NH 4J2YB 2BY5X 4U01A 1NT1A 2IJOB 1O2XA 1L0ZA 3B23B 2WV5A 1W10U 1W2KH 4JYTA 2AGGX 2P3UB 3HK3B 1C2KA 1EP6A 3QTVH 3ZZ7A 1LKAA 1Y3YA 4A6LA 3PO1C 3PLBA 1G3EA 1RTFB 3JZ1B 1ETTH 1G37A 1GG6C 1O3AA 3A8BA 2F9VA 2HPQH 1T4VH 3MNCA 5HM9A 1ELEE 3TU7H 4DIHH 3SV8A 1GJBB 3M7QA 5I25A 5HM2A 3LJOA 1MUEB 2J92A 3RMOH 2CHAC 1VR1H 4BTTB 1C5MD 3GYMA 2BDAA 3P8GA 1XKBC 5C1UA 2OCVB 1AIXH 1FIZA 2PUQH 5DJ7A 1YPEH 2VWNA 1CA0C 3KN2A 2AIQA 1LHFH 1CBWB 1UMAH 2JH6D 1G2LA 1O2LA 6GCHF 1JRSA 2GD4B 1MCVA 2GCTB 2P3FH 2VWMA 4F49A 5LPEA 3D65E 3UIRA 1GHYH 2HNTF 4DURA 4ZAEA 3F68H 1ZJKA 4K60A 4YOGA 1S84A 3ZV9A 3T29A 3MO9A 2W3IA 1O2NA 2CF9H 1MTWA 1NRNH 3M36A 4HFPB 4IS5A 3A7ZA 4WF8A 1TALA 6CHAC 3UPEA 2BDCA 1LQDB 3UNQA 2FIRH 1QB6A 1MMJN 3ATWA 4XBDA 4CRGA 3RXJA 2GZ7A 1B7XB 1CHOG 1UTOA 5E2PA 2XW9A 2PW8H 2GDEH 3S9CA 1DM4B 1MKWK 4FUDA 2Z9IA 2IN2A 1NRRH 3U69H 1BBRK 1LPKB 2Z7FE 1HJ8A 4K1SA 2ZHEH 1DSTA 4DVAU 1AFQB 1YLDA 3EA9A 1FMGA 3GICB 1ARCA 1HRTH 1P09A 4XE4A 1TLDA 4KP0A 1V2OT 1EASA 1TRMA 1HBTH 2VGCB 4NSVA 4Y8YA 4B2BA 1KXCA 1F92A 2FOFA 3SNEA 1FQ3A 1ELTA 1LVBA 1T31A 4U2WA 3RDZA 2H1UA 1AVXA 5FBIA 1FV9A 1GDUA 2HALA 3S69A 1GI9B 1P9SA 1G36A 4Y8XA 3RLWH 3RXQA 1QQUA 4H6TA 5JBCS 1C5QA 1XKAC 5EXMA 1MTVA 3N7OA 5A2MH 4U30A 5FPSA 1AZ8A 1UK2A 4NSYA 1NN6A 2ZU3A 1Z71A 1C2JA 4HGCA 1O32A 1O2WA 3HK6B 1A3BH 2FTMA 1AZZA 2G8TA 3PYHA 1EPTB 1CT0E 2QC2A 3BEIB 2BTCE 3SU1A 1THRH 1MKWH 2KAIA 2VU8E 5A0AE 3MU4A 3RXTA 1NFWA 1GMDF 1ZHRA 2ANYA 4NIWA 1O3CA 3ODFA 7ESTE 1G30B 1HAXB 3K6ZA 1P04A 2HNTE 1OP0A 1BBRE 1TBQH 1O2IA 1VCPA 1OWEA 4DOQA 1YLCA 3OY6U 4AYYB 3RXLA 2PKAB 3ZVBA 1HAVB 2HOBA 3UQOA 1RD3B 3M7TA 3BTGE 3VB3A 1OPHB 1WYKA 3TK9A 3QZRA 1UVPA 5JBBS 1G9IE 3ELAH 1O39A 1TWXB 4Z6AH 1TNGA 4WWYA 3CENA 3GY8A 3EGKH 3MO3A 2Y80A 1BHXB 3LJJA 1D4PB 2NU4E 1LVYA 3E90B 1HXEH 1ESBA 1PPCE 1DWEH 4IW4E 1TMBH 1S6HA 2SGFE 1HJ9A 1GMHF 4O3UA 4R8TB 1FJSA 3PO1B 3E91A 2HRVA 1O2QA 2XRCA 1XXFA 1W11U 2ZHDA 2F9NA 1GG6B 2ZEBA 2ZHWH 1TA2A 1IQMA 1MKXH 1O3GA 4OS4A 4WMDA 1A3EH 1OKXA 3QDZB 1QRZA 2SNVA 2XC0A 4MDSA 3SBKA 1BZXE 1O3MA 1HAGE 1QA7A 1S0RA 4Y8ZA 4ZKRU 1BMMH 2O8MA 4Y7AA 2VVVA 1KSNA 4GHTA 5BPEA 5DG6A 2G4UA 2J94A 3T5FH 4GHQA 1GJCB 4XBBA 3RP2A 3SJOA 1EX3A 2CHAB 5LPFA 3A84A 2BDYA 1DX5M 1IQKA 1WBGB 5BRRE 1C5UA 1EJMA 4NWLA 3KQDA 1A1RA 3Q77A 2FYRA 4ZHLU 1FY4A 3BSQA 1LHCH 1WTHD 3BG8A 1E38B 1CA0B 1XUJA 1ANDA 3BTHE 1FIWA 3OX7U 3URDA 1XUHA 4X0WU 2A4RA 1W12U 2RCEA 3SZNA 2P59A 5EXLA 1GBIA 2R9PA 4ISNA 4FUJA 1V2TT 2EC9H 1AKSB 1O0DH 1YCPH 1OP8A 1O2TA 1T8LA 1CHGA 3M5OA 1AB9C 5DP7A 1AUJA 4FU9A 1NZQH 2ZIQH 1KLTA 3F9GA 4A1VA 1LKBA 2ZHFH 2QAAA 1O34A 1D3QB 5TCAA 2WPJS 6CHAB 4Q7YA 1BMLA 5EQRA 2R2WU 1TMTH 2VJ1A 1EQ9A 1XX9A 2VWOA 3O8CA 3TNTA 1C5VA 1C2HA 5GCHF 5AF9H 1NS3A 3PV4A 2BXTH 1K1MA 2VVUA 2H2ZA 1C2LA 2BDBA 2ASUB 3SU5A 1P8VC 1FY3A 1Z8GA 2J2UA 1OS8A 3ZZ5A 1A5IA 2FTLE 2M5TA 1AI8H 4BAKB 4BTUB 3DD2H 1ZR0A 2RA0A 4IMQA 1O5BB 1ZOMA 3U8TH 2ZQ1A 1ESTA 4FUIA 2ZDNA 4FUFA 4TWYA 3SNCA 4NFEA 1SPJA 1AUTC 1SGTA 2V6NA 1CT4E 4I8GA 8KME2 2TGPZ 1K21H 2GV6A 2BLWA 1EOLA 2G55A 3GY4A 1W0ZU 1SR5C 1IQIA 3TH3H 3W95A 4ABFA 1GI4A 1GMCF 2JETC 2ALVA 2FX6A 1TPOA 2FOBA 4UFFH 3BIVH 1MZAA 2FOAA 2OBOA 2J34A 1KIGH 2Z9KA 4X6OA 5L30H 2PTNA 1FAKH 4X2WA 3EE0B 3HKIB 3MU5A 3SQHE 5E0GA 3FP7E 5GJ4B 2ZU2A 2Y6TA 4X1QU 5JB9S 1OWIA 4Y76A 1F7ZA 3PTNA 7GCHG 2DE8A 1AVWA 1G32B 1PPEE 1V2LT 1B5GH 1ZHMA 1ETRH 4FUHA 2WPIS 1KTSB 3SGAE 3TNSA 4AFZA 3E3TA 2A5KA 3EYDA 3FP6E 4I8LA 2BDHA 2BD4A 2BZAA 2XBWA 2OP9A 2NU2E 1QURH 1ELFA 1LPGB 1BJUA 4BXSA 1ELCA 1TNKA 3M3TA 1T8OA 4CBOA 4UE7H 2CXVA 3ATMA 3STJA 3SUFA 4JYVH 1IQEA 4MPVA 2WPKS 3S0NA 1JMOH 1TA6A 2SGQE 1P03A 4I33A 1TX8A 5ESTE 1TNIA 1DLKB 2A5IA 1DITH 1UK4A 2HGTH 1HYLA 1HV7A 5C5NA 4XBCA 5L2ZH 2UWLA 1ZHPA 1SLWB 2QXJA 4MNYA 4A1TA 4MPWA 2WUBA 5C67A 1SLXB 4X6PA 1SSXA 4XFQA 1AWHB 1GVLA 1YGCH 4XDEA 2B8OH 3S7KB 1EP5A 1O2HA 1GBBA 3VB4A 1BITA 2BM2A 3FAOA 2CF8H 1QJ1B 3U9AH 1C2EA 1UCYK 3GY5A 3T25A 1O36A 2G5NA 1BTYA 1EJNA 1SHYA 4CHAC 1O37A 3R0FA 1KXDA 1WQVH 3MNBA 1A4WH 1C5WB 2KAIB 1SOZA 4MTBA 1JXPA 2JKHA 3TPIZ 3V0XA 3W94A 3BN9A 4JZEH 2LNCA 1S81A 5C2ZA 1P02A 1SL3A 4B75A 3PB1E 2XBVA 5F8ZA 3PTBA 4BAQB 2Y82A 3BG4C 1EB1H 2XBYA 3E16B 3F1SB 3P17H 1BUIA 1YPLH 4KKDA 1YPGH 5ESBA 4FUGA 1SGEE 3UFAA 3Q3YA 4I8JA 1AHTH 4HTCH 1ARBA 4CRFA 5CE1A 1UTKA 1AB9B 3T26A 4X6MA 3RXFA 1GGDC 1PQAA 5DP5A 3SJ8A 2Y7ZA 4AFQA 3QN7A 4NG9H 1MU8B 2VIQA 5H4IB 1D3TB 1UCYH 2ZDAH 2HNTC 4IC6A 1DLEA 4BAHB 1C4V2 1G3CA 3PMJA 4GPGA 1OOKB 2WYJA 2H5DA 1SMFE 5TJXA 4YT7H 2FESH 1UHBA 2B9LA 3MU0A 4BANB 1W14U 3GY7A 1PQ5A 1P0SH 2PSYA 2PUXB 1T4UH 4AB8A 1ZTLA 1BT7A 3QZQA 4LZ4B 2D2DA 1P2JA 1BTPA 1QNJA 4VGCC 4X8VH 3M5NA 3JZ2B 2ESTE 4FUEA 4TYDA 1Z6EA 4Q7ZA 2BY8X 3SORA 1C2IA 1W13U 2ODQA 4ABJA 1GL0E 2RA3A 5A09A 4F4OC 2UWOA 2A32A 3MH5A 3ZZ3A 4E7NA 3MU1A 1JWTA 2P3TB 3TK6A 2G52A 4ZMAH 1H4WA 2BVRH 2ALPA 1TABE 1GHXH 1LVOA 3FZDA 2PGQB 3A85A 4ZHAA 3U98H 1V2JT 1NRPH 1SVPA 2TBSA 2ZG0H 5FPTA 1C4U2 1FY5A 2JETB 1GJAB 4FU8A 1GJ8B 3UQVA 4LZ1H 4YLQH 1GBFA 2A31A 4B73A 2CN0H 1DS2E 3IITA 5JB8S 1O2JA 1QCPA 1MZDA 3A81A 4IC5A 3SV6A 2R2MB 1UTPA 2AIPA 1UTNA 2R0LA 2JH5D 2V3OH 3I78A 3BV9B 1LDTT 3M61U 1AE8H 2AS9A 4MVNA 1L1GA 3AW0A 3SU6A 2A2XH 3ITIA 4HI3A 2W7SA 5AFYH 4FVBA 1LTOA 3SO3A 1BJVA 2ZDKA 3PROA 4OS1A 1NU7B 2GT7A 1SOTA 2BLOA 1AQ7A 1RS0A 4FUCA 3M5LA 4ABEA 1H8IH 2HWLB 4FXGH 4ISIH 1RTKA 3AAVA 3SV9A 3VB5A 1Y8TA 2NWNA 1TRYA 3A87A 3LIWA 3MU8A 3O8DA 2O8UA 1NFXA 1VCQA 2HVXA 5F8XA 1C5PA 1F0RA 3ZVAA 1SLUB 3L33A 1GVKB 2VIDA 1TONA 2DE9A 1FY1A 1DXWA 1V2NT 1XM1A 2A2QH 2Y5GA 2WPLS 3RXRA 2P94A 3DFJA 4O97A 1ZTKA 3A88A 2BY7X 3SU0A 1QFKH 4IN1A 1P10A 3Q3XA 1THPB 4K1TA 3RLYH 1AVGH 1O3HA 1K28D 1A2CH 3KCGH 4NFFA 3SW2B 5DPAA 5ABWA 3TJOA 4TY6A 4CHAB 1PJPA 4K5ZA 1P2NA 5T6FA 1TOCB 4AFUA 3SNDA 2BZ6H 1OYTH 4YZUA 4NIXA 1ELBA 2Y7XA 2ZTZA 1BB0B 2ZU5A 2UUYA 2ZFQH 4KELA 3M37A 5CMXH 2WINI 1FXYA 3RMMH 1UO6A 5E0HA 2OLGA 4IGDA 1H9LB 2OXSA 2W26A 3BG4B 1CSOE 2BD5A 1FONA 5PTPA 2Q1JA 2SNWA 4X2YA 1N8OC 3PLPA 2GKVE 3GDVA 4U32A 4WJG2 2Q6GA 3C27B 3VPKA 1BRAA 1J14A 1BA8B 1K2I1 3SUGA 4B1TA 3RC5A 2BD8A 1FY8E 4YTAA 3K9XB 1GDNA 4Z0KA 4KTSA 3BIUH 4Q7XA 1GGDB 3D49H 3RXDA 2XCNA 2A4OA 3ZVCA 1DXPA 1M9UA 2BYAX 2QV1A 3LC5A 2XWBI 3GISB 2SGEE 1EAWA 7KMEH 2I6QA 5FBEA 1CQQA 2TGDA 2FPZA 2ULLA 2GMTC 2A0QB 4BXWA 2A5AA 3P6ZB 1E37B 3ZZ9A 1C5RA 1T7CA 3KIDU 3M7UA 1LCYA 1GI8B 1K1NA 4AYVB 2GV7A 1ZGVA 3PM3A 3V7TA 2IOTA 1DY8A 4D76A 3K2UA 1O5DH 2FI4E 1UVOA 5C20A 3LH3A 1SI5H 4X1SU 4LK4A 4MPXA 2ZTXA 4X8TH 2P8OC 4VGCB 4D8NA 3TGIE 1KXFA 4RSPA 1O3DA 2AMPA 1RIWC 1EAUA 5LGOA 1QRWA 4ZHMU 4GUXA 4A92A 4O9VA 1V2UT 2XC5A 1C2FA 1UTJA 1C1NA 3FVFB 5FXLA 2XYAA 4MNXA 1DWCH 1EKBB 2P16A 5EODA 1ZRBA 1Z6JH 5C3NA 4JZDH 1E34B 4ISHH 1GCDA 4ZKSU 1WCZA 4D9RA 4FVDA 3ATLA 1A0HB 7GCHF 1F5KU 1MKXK 1Z8RA 3E6PH 2BLVA 4GAWA 1D6RA 3E8LA 3CS0A 1O2OA 1O3BA 1ZGIA 2FDAA 3LKWA 4DGJA 2C8XB 2ZKSA 1C1MA 1PPZA 2PHBA 1P57B 1DUAA 2A7JA 1RTLA 1NFUA 2ZQ2A 1PQ7A 1GJ4H 4DY7B 1H9HE 1TAWA 2VWLA 1UHBB 4SGBE 1MCTA 1WSSH 1WUNH 4H6SB 3LGVA 1ABJH 3EA8A 2F9BH 2YOLA 3EQ0H 2A4QA 3BEUA 2ZP0H 5DP9A 4BAOB 4DG4A 2BD3A 1ZPZA 3HGNA 2A4GA 3RMNH 3SN8A 1YPKH 3O8RA 2QXGA 1BIOA 2VIVA 5IDKA 1DWBH 3UNSA 7LPRA 1O2GH 1OYQA 1YCPK 3EA7A 3UTUH 4K1EA 4IMZA 5I46H 3E1XB 2ZFTA 3GCTG 2SGPE 1C1UH 1NFYA 2ZGBH 3SI4H 2G5VA 4BNRA 1TB6H 2ZFFH 2ZCHP 2ZFPH 2AGIX 2ANKH 8ESTE 1J8AA 4X1NU 5C1XA 1VITG 1O38A 3TK5A 1O2UA 1C1QA 1GDQA 1RXPA 1VZQH 2BX4A 4XOJA 2EI7A 1FI8A 4AZ2B 8GCHF 6ESTA 1GI6A 1TPSA 3AAUA 2H5CA 4K69A 3HPTB 3SV7A 4B76A 3NXPA 2PR3A 1INCA 2VNTA 1GHWH 1TGNA 2YNAA 1YCPM 1HAZB 1MD7A 3MH4A 2D8WA 2ZGCA 3MO6A 3GYLB 2QY0B 2Y5FA 3T62A 1OWKA 4MQAA 4WXIA 3A8DA 1O2YA 3LOXA 1O5FH 4JZFH 2PFEA 3DFLA 2Q6DA 1N8OB 1QJ6B 5FX6A 3P8FA 5GDSH 3QX5H 1T32A 1XVMA 1HAPH 1Z1JA 1C2DA 1W3CA 5DGJA 2BOHB 1P2OA 1KTTB 1SGDE 1MBQA 3RU4T 1P2MA 2ZU1A 5B6OA 5DO4H 3QLPH 1TRNA 3ATIA 2BY6X 4NIYA 2BDGA 1ZLRA 4CREA 3V12A 2WPHS 1BRBE 2XTTB 1QL9A 1MQ6A 2FLRH 1O3FA 9LPRA 1P2QA 6GCHG 4E06H 4B74A 1EUFA 5IYTA 3GDSA 5HGGA 2GMTB 3D62A 4PROA 1JBUH 3RU4D 1LHDH 1HIAA 1QTFA 1Q31A 1BRCE 1OWDA 2BMGB 1RFNA 2GX4A 1YP9A 1O5GH 1O5EH 1MH0A 2J95A 2K1QA 4X2XA 5J4SA 2P8OB 1AU8A 1J15A 1O3KA 3ENSB 2OC1A 1RIWB 1GJDB 2FS9A 4CR9A 1F0UA 5K7RA 1IQHA 2ZDMA 4GCHG 3Q3KA 3RXGA 2GCHF 1GPZA 1AGJA 1K1IA 4FU7A 1C5OH 1GBAA 1U6QA 2QF0A 4WXVA 3P70B 3TH4H 5AVDA 1A0JA 1CGIE 2FOCA 4MLFB 1JOUB 3F9FA 3SNBA 1D3DB 2EI6A 2SFAA 4XSKU 1GHAG 1TYNA 3ZZDA 4NGAH 1GJ7B 1DANH 5GPIB 1CE5A 2R3UA 1L2EA 1GBDA 4E05H 5DP6A 2FOHA 3RXCA 1QL8A 3UR9A 3PLKA 3RXVA
chains in the Genus database with same CATH superfamily
1SGPE 2A7CA 5A8ZA 4P00A 2VVCA 1OWJA 1V2RT 4RN6A 2WHXA 2ZDVH 4Q2KA 1NO9H 2PWXA 2OD3B 4ABDA 1BTUA 4INHA 1HDTH 4OS6A 3SJ9A 1K1LA 2CK3D 5AHGH 1ZSJA 2ZFSA 1IAUA 3KQEA 2WPMS 3H5CB 2FI3E 3MH6A 4LXBH 1D6WA 1W7XH 2OC7A 1TGCA 2W5EA 1DFPA 1C4Y2 1S5SA 1RRKA 5FCRA 4ASHA 2OQUA 5GNDA 5EW1H 3MNXA 1V2WT 1S6FA 1WOFA 2NU0E 1N6XA 1GMDG 1V2MT 3NUMA 1THSH 3A82A 1QY6A 1C1TA 3N99A 1BTWA 3ZZ6A 2GVFA 2ZO3H 1ZRKA 2PP6A 1EZUC 2W3KA 3EAJA 1KYNA 1GI3A 1SFQB 2V3HH 1O31A 1MBMA 4NA9H 1S85A 4INLA 5E0JA 3FP8E 1L1NA 1E1QD 1O2RA 1O2MA 1TGTA 1EZQA 4DT7B 3LGUA 1OSSA 1Y3UA 1ZTJA 4Q4LA 1ELAA 1V3XA 3CNRA 4NZLA 2ODPA 1DWDH 3KL6A 2O8WA 3MMGA 2IJD1 1HNEE 2VH0A 4YESB 2TPIZ 4CR5A 1GMHG 1TPAE 3QGNB 1EZXC 3BTME 9ESTA 4TSFD 3W1EA 3QUMP 5DP8A 4JK6A 3ZIAD 1EAXA 4O3TA 4UFDH 1ABIH 2OBQA 5FCKA 3CP7A 4B2CA 3GDUA 3TIUA 3M5MA 2F9UA 2ZCLP 4UEHH 4Y71A 3ZYEA 1YPJH 1C1WH 3PWCA 4LOYH 3TGJE 1YC0A 2GZ9A 1SKYE 2OINA 1C1RA 2F83A 2F3CE 2BD7A 2TRMA 5A8XA 1J9CH 1PPGE 1CHOF 3A7XA 4YM9A 1TNJA 4OS7A 1ZZZA 2YNBA 4Y0YE 3GY3A 2O8TA 5FX5A 4Y79A 3P8NA 5C1YA 4YT6H 3RC6A 1GI0A 1O2PA 1P01A 2GZ8A 4DT4A 5EQSA 1Y3XA 4YOIA 3SU3A 5JDUB 1UCYE 2H9HA 2VINA 2GT8A 1YPHE 3TJNA 3UOPA 1FAXA 1FZZA 1ORFA 3SQEE 3LGWA 3DT0H 2W7UA 2P95A 2BD9A 1LVMA 1YF4A 3OYPA 1B0FA 1ETSH 4QT8C 3KGPA 3RU4E 2FS8A 4K8YA 1CGJE 4UONA 1QBVH 1BTHH 1XMNB 3UWJH 1P3CA 1P2KA 2ANWA 1TE0A 3MNSA 3QWCH 2WUCA 1L4DA 4HZHA 1EZSC 2H9EH 1QB9A 3PMHB 4K8BA 1ZYOA 2BVXH 2HPPH 1TGBA 2J4IA 2F43B 2VH6A 3RXSA 1VJ9U 2Z3EA 3K6YA 2QYIA 2R3YA 1DSUA 2FWWA 1NC6A 4UFGH 1LHGH 1Y5BT 2A1DB 2FI5E 3VB7A 4DW2U 2FX4A 1ANCA 3ZYDA 1MTSA 1W0YH 1QGFA 3BTFE 2H9TH 5EXNA 1AD8H 1KLIH 1BMAA 3TVJB 2EA3A 3SHAH 1O2VA 2B0FA 1GBTA 3SGBE 3U8OH 3S9AA 4UFEH 4WH8A 1S0QA 2PTCE 3LC3A 2LP6A 3LGIA 4MNWA 1NRQH 1C2GA 2PLXA 1SQAA 1FPCH 3ZVEA 1Y59T 3MYWA 1TGSZ 2Z9LA 1XVOA 1O3OA 2FXRA 1A0LA 4K3JA 4CH2B 4DIIH 2BQWB 2CMYA 2Y5HA 1HIAB 4H4FA 1GMCG 4P02A 1F2SE 1GBHA 6LPRA 4X8UH 1SGIB 1XUFA 1BRUP 3RC4A 2BQ6B 3SU2A 3QTOH 1HAYB 2FODA 1TFXA 5F6MA 3LDXH 4J1YA 2B5TB 1UTLM 3A80A 1C5ZB 3GCTF 5GXPA 1K1JA 1QRXA 2XWAA 4Q63A 1FLEE 1SGQE 3OU0A 2W6ID 4KTUA 1UVSH 2J9NA 1JIRA 4MG3A 1TMUH 5TCCA 1BMNH 1SC8U 5A0CA 2R0KA 4DCDA 3L3TA 1UTMA 4SGAE 5A0BA 1GBCA 3NWUA 1HJAC 4I8HA 1UW7A 1PPFE 2B7DH 2FOEA 1VITF 1Q2WA 1AKSA 2AMDA 1D3PB 2AFQB 1V2PT 1ZMLA 3UR6A 4B71A 1UK3A 2CV3A 3TJUA 5FPYA 3SU4A 1ZJDA 3DUXH 2FP7B 2Y81A 1E35B 1G2MA 1QHRB 1GBLA 1EB2A 1QA0A 2WV4A 1A46H 4CBNA 1SGFA 1O3IA 1F5RA 3SNAA 4R0IA 1UTQA 2ZTYA 1IQLA 3OAAD 1GVZA 3P8OA 3SGQE 3SI3H 3UAIC 2UUKB 4AFSA 3PMBB 5EPYA 4BOHA 4D9QA 2L74A 5F03A 3TJVA 2Z9JA 1HGTH 1JRTA 1K1PA 1UVTH 4B6EA 4Q80A 2GTBA 2J97A 5A8YA 3VXEH 5JBTA 4O03A 2J38A 3PRBA 5FHTA 4ZUHA 4Y11E 1PFXC 1H8HD 3SOSA 2BB4A 2WYGA 2ZGHA 2QN5T 2XNIA 3NPSA 4I8KA 4NCYA 3TITA 3MH7A 1L4ZA 4RKOB 1P05A 1TBZH 3ZZCA 2AERH 1ELVA 1SGCA 2TGAA 3ZZ8A 4ZKOU 4NA7A 3VGCC 1DOJA 1S82A 2PV9B 1TPPA 4ACAA 1KDQA 1KXAA 3EE7A 3VEQB 1TX7A 2Z3CA 2SGDE 4GVUA 1T8MA 2ZC9H 3PMAB 4D7FA 2CJIA 2F91A 2A45B 4AG1A 1VITH 1ID5H 1D9IA 1BQYA 5EGMA 2FYQA 3T2NA 2ZECA 3KYFA 2ZZUH 1QBOA 1G3BA 1GJ5H 2QF3A 3PV5A 1TOMH 4GCHF 3OFND 3SUEA 2BOKA 2O8LA 4HG6A 1C2MA 4INKA 1H1BA 4KGAA 1C5YB 1GCTC 4MNVA 1W0JD 5DKMA 3M35A 4I7YH 1QQ4A 4OGYA 1Z1IA 2ZNKH 1FNIA 2GGVB 3G01A 1GHAF 1P12E 3HKJB 3P92A 4ABIA 4CH8B 3A8CA 3LH1A 1FN6A 4Y10E 3HATH 3U1JB 1O2KA 4Y6DA 2EEKA 2C4FH 1TNLA 3ZVFA 1GBEA 3E0NB 1IHTH 1C9TA 3TGKE 5E8EH 1FUJA 1QJ7B 3AASA 3H7OA 1CU1A 3UUZA 4ESTE 1WAYB 5CHAC 1DE7H 1TNHA 4AGJA 3LU9B 2HLCA 1C1PA 4YO9A 4JMYA 5DK1A 1SGYE 3V3MA 1HUTH 1AE5A 1RGQA 1QR3E 1O33A 4ZXXH 2OK5A 3RXOA 1SHHB 1IQNA 1DUEA 4AGKA 2AYWA 4I32A 1GHBG 2J98A 1GWAA 1SG8B 1XUGA 1O3PB 1GBKA 1ZMJA 1WTGH 2YMSD 2ZPSA 3S9BA 2ZGJA 1GI5A 1GI7B 3ZZAA 5L6NH 3MWIU 4X1RU 1BBRH 2NU1E 2HLDD 3F6UH 1O30A 2BLQA 2ZWLH 1W8BH 1KXBA 4A7IB 4X6NA 1B0EA 4WVPE 1BHXF 1NBMD 1C5TA 3S7HB 1HAOH 1C1OA 3GY2A 3ZZ4A 3KEEA 4IN2A 3DHKH 2C8WB 2V35A 5K0HA 3BTDE 3SZEA 1NESE 1TQ0B 3KHVA 3U28C 2ANMH 2I6SA 1SQOA 2FOGA 2Z94A 1S83A 3ATKA 1X7AC 3ODDA 3RMLH 1HJAB 4X8SH 1F0TA 4ABBA 2FO9A 2BHGA 2VIPA 1YPHC 2W6JD 3KNXA 4RI0A 1ANEA 1P3EA 3CS7A 1YBWA 4OS5A 3KF2A 3QO6A 2DUCA 3N7EA 1NU9A 1HLTH 2UUFB 2VIOA 2QXHA 4FETA 2BD2A 4WMEA 1MAYA 4K2YA 4IBLH 1O2SA 1ELDE 1PQ8A 1H8ED 4A5TS 5T6DA 1HPGA 5KGOA 2BX3A 2F9PA 2GDDA 3FANA 4ZKNU 4ZROA 1GHZA 3M3VA 1TIOA 4ZXYH 1SBWA 1HFDA 1AN1E 2P93A 2FZZA 4A1XA 4NIVA 3RXEA 3Q76A 5SGAE 3TLOA 3NCLA 3RXAA 1MAXA 1Q3XA 2PSXA 1K22H 3IG6B 4WMFA 1LPZB 1QIXB 3HGPA 1NROH 4AN7A 4TPIZ 1P11E 4M9FA 2STAE 1P2IA 3GY6A 4JCNA 5GWZA 4ISOA 3ZVGA 3A7VA 1OX1A 1C9PA 1Y5AT 2PKSC 5C0UA 5JPMH 3GOVB 3M3SA 5EQQA 1AWFH 3VGCB 1YM0A 3WWBA 1EAIA 3OSYA 3RXMA 1K9OE 1MTNC 1V2ST 5KEDA 1UVUH 3VXFH 5GIBA 1RJXB 1LHEH 5JBAS 1Z8IB 5DP4A 3FFGA 1CT2E 1QL7A 5C5OA 3A8AA 4RKJB 2Z9GA 3OY5U 5DP3A 3H7TA 2Z3DA 3U8RH 3LPRA 5CDFE 2UWPA 3PWBA 3MHWU 3C1KA 1YPMH 2XNDD 1UJ1A 4GLYA 3UNRA 5AFZH 1WQSA 4X2VA 1OWHA 1P9UA 1GCTB 2FEQH 4JZ1A 2FMJA 4OS2A 2AH4X 4JK5A 3RM2H 1MD8A 1ANBA 1VKYA 1C5XB 4TWWA 1F0SA 1LMWB 5EU8A 4ZH8A 3E0PB 1ZSKA 2FOMB 4JYUH 1ZPBA 2FLBH 3MOCA 2PGBB 5HIYA 1AMHA 1MTUA 3BTEE 1N1LA 3DSPA 3BTWE 1H9IE 3SUDA 2EI8A 2ZDLA 4OGXA 2C8ZB 4I31A 1PPBH 2ZPQA 1E0FD 5CHAB 3UY9A 3A86A 4BAMB 4NA8A 3GS9A 3GCHC 1A7SA 2L6OA 5EOKA 3UWIA 1F5LA 1MQ5A 3T27A 4Z1MD 2BXUH 3B8JA 1KDQB 2C93B 3R3GB 5G4BA 3KQCA 3A7YA 3B9FH 5EPNA 3A83A 3LT3A 1VGCC 3RXIA 2XCFA 1J16A 4ACBA 1ZPCA 3IWMA 4WH6A 3VB6A 4TY7A 4UDWH 1BTXA 1NPMA 5FL7D 4AORA 3ZZBA 2G4TA 4YLUA 3I77A 3RXUA 3BF6H 1V2KT 5LH8A 3AVZA 3DA9B 1J17T 3F9EA 5F8TA 1SGNE 5E2OA 3ZV8A 2ODYB 5EJ1A 2THFB 3RUOA 2OC8A 1C1SA 1O5AB 3QGJA 1ACBE 1EJAA 2ZA5A 1W7GH 2QF4A 3Q00A 1BCUH 4DJZB 1O2ZA 1SGRE 1K1OA 3LGTA 1V6DA 1BOQA 4CRDA 1HXFH 2XXLA 2Q6FA 1FDPA 4F55A 1NBME 2BQ7B 1XUKA 4GSOA 4ABHA 2H6MA 5JYIA 5HYOA 5FAHA 1SB1H 1SFIA 2BY9X 5J4QA 3N7DA 2QXIA 2ZU4A 3NKKA 1V2VT 2D26C 2QGRA 1IQJA 1CGHA 4X1PU 4AG2A 1DPOA 1YWUA 3BEFB 1YKTA 1DVAH 3K65B 1CVWH 1Z8JB 1KY9A 2Z6BD 1AO5A 4ABGA 2UUJB 4JZIA 2ZI2H 1ZSLA 3MFJA 3UREA 2RG3A 1ESAA 1HCGA 1NM6A 1OXGA 2QIQA 2BVSH 2BDIA 3STIA 1KLJH 1Y5UT 1V2QT 4FUBA 2FM2A 1IOEA 1YYY1 2STBE 1GJ6A 1HAHH 3U1IB 1SQTA 1SLVB 1ELGA 2VB0A 3OEED 1C1VH 2KFWA 4D7GA 1TX6A 1IQFA 2C3SA 1L1JA 2V7QD 2XOKD 1QBNA 1GBJA 3SHCH 1FPHH 2ZCKP 2ZFRH 2K0QA 1JIMA 1LQEA 1CA8B 5LPRA 2F9OA 1KXEA 3BTTE 3I29A 2RDLA 1GI2A 1C5SA 1CBWC 1T8NA 1HAIH 4YOJA 2CGAA 4NWKA 1EATA 4AX9H 5T6GA 3EDXB 2IPHA 8GCHG 3MTYA 4NZQA 1O5CB 2A7HA 5HMAA 1XXDA 1DDJA 2GCTC 2ZHQH 2TIOA 1HB0B 3SJIA 2ZF0H 2C8YB 3O8BA 2D1JA 2AMQA 2V0BA 3FZZA 1NTPA 4CRBA 1DY9A 3URCA 3PV2A 3T28A 1EXFA 2PKSB 4BTIB 2NU3E 1A61H 1ZMNA 3NK8A 2QA9E 1EPTA 4KTCA 1NRSH 3L6PA 1DT2A 3QK1A 1MTNB 3GCOA 2OTVA 2OQ5A 2G00A 1TBRH 2GP9B 3ZVDA 1GHVH 3RXKA 5C0TA 2AEIH 1IHSH 2C90B 5EG4A 4AOQA 1SGFG 4E7RG 2TGTA 3WY8A 1QB1A 4ABAA 3P95A 1PYTC 3V13A 4UD9H 3A7WA 1AFQC 1VJAU 2ZGXH 5L2YH 2QCYA 4M7GA 4AB9A 2ILNA 3KQBA 4CRCA 4Y7BA 1A5HA 1GL1A 4MPUA 2PKAA 1Y3VA 1EOJA 2VGCC 3MI4A 5GCHG 1HAVA 3F2FA 3RXPA 5ETXA 1O3EA 3LONA 1DICA 4THNH 1VCWA 1WU1A 2OC0A 2OUAA 1O3JA 1OP2A 1GI1A 3AW1A 5T3HA 1N6YA 2G51A 3NZIA 2WV9A 3A7TA 1PPHE 3RM0H 3TH2H 3A89A 1O3LA 1AFEH 1GHBF 2XBXA 2G81E 2ZPRA 1XUIA 2O9QA 4CRAA 5EW2H 1TQ7B 1BDAA 2XC4A 1NY22 1AY6H 1WV7H 8LPRA 3GCHB 1Y3WA 1O3NA 3BTKE 3OTJE 1EPTC 3GCNA 4RT0A 2AGEX 2GCHG 1O35A 3UOUA 3SJKA 1VGCB 2M2AA 3LGYA 5DN6D 1LO6A 4TPYA 4H42U 1GBMA 1BTZA 3BTQE 4Y0ZE 3VFEA 3F9HA 4YXWD 1A5GH 4WY3A 1G3DA 5HXFA 1Z7KA 1FN8A 1C5LH 2VIWA 2LPRA 2SGAA 1GJ9B 3ESTA 1CO7E 1IQGA 2JH0D 1PYTD 1MU6B 4B2AA 3D23A 4ISLA 3RXBA 3SV2H 1H8DH 1P06A 3RXHA 1E36B 1C5NH 4J2YB 2BY5X 4U01A 1NT1A 2IJOB 1O2XA 1L0ZA 3FN8A 3B23B 2WV5A 1W10U 2IPQX 1W2KH 4JYTA 2AGGX 2P3UB 3HK3B 1C2KA 1EP6A 3QTVH 3ZZ7A 1LKAA 1Y3YA 4A6LA 3PO1C 3PLBA 1G3EA 3OE7D 1RTFB 3JZ1B 1ETTH 1G37A 1GG6C 5EIYA 1O3AA 3A8BA 2F9VA 2HPQH 1T4VH 3MNCA 3FOAA 5HM9A 1ELEE 3TU7H 4DIHH 3SV8A 1GJBB 1E79D 1FX0B 3M7QA 5I25A 5HM2A 3LJOA 1MUEB 2J92A 3RMOH 2CHAC 1VR1H 4BTTB 1C5MD 3GYMA 2BDAA 3P8GA 1XKBC 5C1UA 2OCVB 1AIXH 1FIZA 2PUQH 5DJ7A 1YPEH 2VWNA 1CA0C 3KN2A 2AIQA 1LHFH 1CBWB 1UMAH 2JH6D 1G2LA 1O2LA 6GCHF 1JRSA 2GD4B 1MCVA 2GCTB 2P3FH 4AC9A 2VWMA 4F49A 5LPEA 3D65E 3UIRA 1GHYH 2HNTF 4DURA 4ZAEA 3F68H 1ZJKA 4K60A 4YOGA 1S84A 3ZV9A 2EY4C 3T29A 3MO9A 2W3IA 1O2NA 2CF9H 1MTWA 1NRNH 3M36A 4HFPB 4IS5A 3A7ZA 4WF8A 1TALA 6CHAC 1KMHB 3UPEA 2BDCA 1LQDB 2YMSC 3UNQA 2FIRH 1QB6A 1MMJN 3ATWA 4XBDA 4CRGA 3OEHD 3RXJA 2GZ7A 1B7XB 1CHOG 1UTOA 5E2PA 2XW9A 2PW8H 2GDEH 3S9CA 1DM4B 1MKWK 4FUDA 2Z9IA 2IN2A 1NRRH 3U69H 1BBRK 1LPKB 2Z7FE 1HJ8A 4K1SA 5KECA 2ZHEH 1DSTA 4DVAU 1AFQB 1YLDA 2KCYA 3EA9A 1FMGA 3GICB 1ARCA 1HRTH 1P09A 4XE4A 1TLDA 4KP0A 1V2OT 1EASA 1TRMA 1HBTH 3NRLA 2VGCB 4NSVA 4Y8YA 4XD7D 4B2BA 1KXCA 1F92A 2FOFA 3F2GA 3SNEA 1FQ3A 1ELTA 1LVBA 1T31A 4U2WA 1EFRD 3RDZA 2H1UA 1AVXA 5FBIA 1FV9A 1GDUA 2HALA 3S69A 1GI9B 1P9SA 1G36A 4Y8XA 3RLWH 3RXQA 1QQUA 4H6TA 5JBCS 1C5QA 1XKAC 5EXMA 1MTVA 3N7OA 5A2MH 4U30A 5FPSA 1AZ8A 1UK2A 4NSYA 1NN6A 2ZU3A 1Z71A 1C2JA 4HGCA 1O32A 1O2WA 3HK6B 1A3BH 2FTMA 1AZZA 2G8TA 3PYHA 1EPTB 1CT0E 2QC2A 3BEIB 2BTCE 3SU1A 4F48B 1THRH 1MKWH 2KAIA 2VU8E 5A0AE 2RFKC 3MU4A 3RXTA 1NFWA 1GMDF 1ZHRA 2ANYA 4NIWA 1O3CA 3ODFA 7ESTE 1G30B 1HAXB 3K6ZA 1P04A 2HNTE 1OP0A 1BBRE 1TBQH 1O2IA 1VCPA 1OWEA 4DOQA 1YLCA 3OY6U 4AYYB 3RXLA 2PKAB 3ZVBA 1HAVB 2HOBA 3UQOA 1RD3B 3M7TA 2EQNA 3BTGE 1OPHB 1WYKA 3TK9A 3VB3A 3QZRA 1UVPA 5JBBS 1G9IE 3ELAH 1O39A 1TWXB 3PRDA 4Z6AH 1TNGA 4WWYA 3CENA 3GY8A 3EGKH 3MO3A 2Y80A 2KCOA 1BHXB 3LJJA 1D4PB 2NU4E 1LVYA 3E90B 1HXEH 1ESBA 1PPCE 1DWEH 4IW4E 1TMBH 1S6HA 2SGFE 1HJ9A 1GMHF 4O3UA 4R8TB 1FJSA 3PO1B 3E91A 2HRVA 1O2QA 2XRCA 1XXFA 1W11U 2ZHDA 2F9NA 1GG6B 2ZEBA 2ZHWH 1TA2A 1IQMA 1MKXH 1O3GA 4OS4A 4WMDA 1A3EH 1OKXA 3QDZB 1QRZA 2SNVA 2XC0A 4MDSA 3SBKA 1BZXE 1O3MA 1HAGE 1QA7A 1S0RA 4Y8ZA 5IK2D 4ZKRU 1BMMH 2O8MA 4Y7AA 2VVVA 1KSNA 2J5UA 4GHTA 5BPEA 5DG6A 2G4UA 2J94A 3T5FH 4GHQA 1GJCB 4XBBA 3RP2A 3SJOA 2CHAB 1EX3A 5LPFA 3A84A 2BDYA 1DX5M 2JIZD 1IQKA 1WBGB 5BRRE 1C5UA 1EJMA 4NWLA 3KQDA 1A1RA 3Q77A 2FYRA 4ZHLU 1FY4A 5B6LA 3BSQA 1LHCH 1WTHD 3VG8A 3BG8A 1E38B 1CA0B 1XUJA 1ANDA 3BTHE 1FIWA 3OX7U 3URDA 1XUHA 2LELA 4X0WU 2A4RA 1W12U 2RCEA 3SZNA 2P59A 5EXLA 1GBIA 3SYJA 2R9PA 4ISNA 4FUJA 1V2TT 2KCAA 2EC9H 1AKSB 1O0DH 1YCPH 1OP8A 1O2TA 1T8LA 1CHGA 3M5OA 1AB9C 5DP7A 1AUJA 4FU9A 1NZQH 2ZIQH 1KLTA 3F9GA 4A1VA 1LKBA 2ZHFH 2QAAA 1O34A 1D3QB 5TCAA 2WPJS 6CHAB 4Q7YA 1BMLA 2YMSB 5EQRA 5HKKD 2R2WU 1TMTH 2VJ1A 1EQ9A 1XX9A 2VWOA 3O8CA 3UB0A 3TNTA 1C5VA 1C2HA 5GCHF 5AF9H 1NS3A 3PV4A 2BXTH 1K1MA 2VVUA 2H2ZA 1C2LA 2BDBA 2ASUB 3SU5A 1P8VC 1FY3A 1Z8GA 2J2UA 1OS8A 3ZZ5A 1A5IA 2FTLE 2M5TA 1AI8H 4BAKB 4BTUB 3DD2H 1ZR0A 2RA0A 1YY3A 1O5BB 1ZOMA 4IMQA 3U8TH 2ZQ1A 1ESTA 4FUIA 2ZDNA 4FUFA 4TWYA 3SNCA 4NFEA 1SPJA 1AUTC 1SGTA 2V6NA 1CT4E 4I8GA 8KME2 2TGPZ 1K0HA 1K21H 2GV6A 2BLWA 1EOLA 2G55A 3GY4A 1W0ZU 1SR5C 1IQIA 3OTPA 3TH3H 3W95A 4ABFA 1GI4A 1GMCF 2JETC 2ALVA 2FX6A 1TPOA 2FOBA 4UFFH 3BIVH 1MZAA 2F4LA 2FOAA 2OBOA 2J34A 1KIGH 2Z9KA 4X6OA 5L30H 2QF5A 2PTNA 1FAKH 4X2WA 3EE0B 3HKIB 3MU5A 3SQHE 5E0GA 2WZQA 5C94A 3FP7E 5GJ4B 2ZU2A 2Y6TA 4X1QU 5JB9S 1OWIA 4Y76A 1F7ZA 3PTNA 1E1RD 7GCHG 2DE8A 1AVWA 1G32B 1PPEE 1V2LT 1B5GH 1ZHMA 1ETRH 4FUHA 2WPIS 1KTSB 3SGAE 3TNSA 4AFZA 3E3TA 2A5KA 3EYDA 3FP6E 4I8LA 2BDHA 2BD4A 2BZAA 2XBWA 2OP9A 2NU2E 3F0PA 1QURH 1ELFA 1LPGB 1BJUA 2GJGA 4BXSA 1ELCA 1TNKA 3M3TA 1T8OA 4CBOA 4UE7H 2CXVA 3ATMA 3STJA 3SUFA 3WW7A 4JYVH 1IQEA 4MPVA 2WPKS 3S0NA 1JMOH 1TA6A 2SGQE 1P03A 4I33A 1TX8A 5ESTE 1TNIA 1DLKB 2A5IA 1DITH 1UK4A 2HGTH 1HYLA 1HV7A 5C5NA 4XBCA 5L2ZH 2UWLA 1ZHPA 1SLWB 2QXJA 4MNYA 4A1TA 4MPWA 2WUBA 5C67A 1SLXB 4X6PA 1SSXA 4XFQA 1AWHB 1GVLA 1YGCH 4XDEA 2B8OH 3S7KB 1EP5A 1O2HA 1GBBA 3VB4A 1BITA 2BM2A 3FAOA 2CF8H 1MABB 1QJ1B 1WDIA 3U9AH 1C2EA 2J98B 1UCYK 3GY5A 3T25A 1O36A 2G5NA 1BTYA 1EJNA 1SHYA 4CHAC 1O37A 3R0FA 4XRNA 1KXDA 1WQVH 3MNBA 1A4WH 1C5WB 2KAIB 1SOZA 4MTBA 1JXPA 2JKHA 3TPIZ 3V0XA 3W94A 3BN9A 4JZEH 2LNCA 1S81A 5C2ZA 1P02A 1SL3A 4B75A 3PB1E 2XBVA 2QE7D 5F8ZA 1W0KD 3PTBA 4BAQB 2Y82A 3BG4C 1EB1H 2XBYA 3E16B 3F1SB 3P17H 1BUIA 1YPLH 4KKDA 1YPGH 3F0OA 5ESBA 4FUGA 1SGEE 3UFAA 3Q3YA 4I8JA 1AHTH 4HTCH 2K8IA 1ARBA 4CRFA 2KX4A 1UTKA 5CE1A 1AB9B 3T26A 1SQRA 4X6MA 3RXFA 1GGDC 1PQAA 5DP5A 3SJ8A 2Y7ZA 4AFQA 3QN7A 4NG9H 1MU8B 2VIQA 5H4IB 5EJZA 1D3TB 1UCYH 2ZDAH 2HNTC 4IC6A 1DLEA 1BMFD 4BAHB 1C4V2 1G3CA 3PMJA 4GPGA 1OOKB 2WYJA 2H5DA 1SMFE 5TJXA 4YT7H 2FESH 1UHBA 2B9LA 3MU0A 4BANB 4TT3D 1W14U 3GY7A 1PQ5A 1P0SH 2PSYA 2PUXB 1T4UH 4AB8A 1ZTLA 1BT7A 3QZQA 4LZ4B 2D2DA 1P2JA 1BTPA 1QNJA 4VGCC 4X8VH 3M5NA 3JZ2B 2WPDD 2ESTE 4FUEA 4TYDA 1Z6EA 2KM0A 2BY8X 4Q7ZA 1C2IA 2V3MA 3SORA 1W13U 2ODQA 4ABJA 1GL0E 2RA3A 5A09A 4F4OC 2UWOA 2A32A 5EJLA 3MH5A 3ZZ3A 4E7NA 3MU1A 1JWTA 2P3TB 3TK6A 2G52A 4ZMAH 1H4WA 2BVRH 2ALPA 1TABE 1GHXH 1LVOA 2JJ1D 3FZDA 2PGQB 3A85A 4ZHAA 3U98H 1WXRA 1V2JT 1NRPH 1SVPA 2TBSA 2ZG0H 5FPTA 1C4U2 1FY5A 2JETB 1GJAB 4FU8A 1GJ8B 3UQVA 4LZ1H 4YLQH 1GBFA 2A31A 4B73A 2CN0H 1DS2E 2KR7A 3IITA 5JB8S 1O2JA 1QCPA 1MZDA 3A81A 4IC5A 3SV6A 2R2MB 1UTPA 2AIPA 1UTNA 2R0LA 2JH5D 2V3OH 3I78A 3BV9B 1LDTT 3M61U 1AE8H 2AS9A 4MVNA 1L1GA 3AW0A 3SU6A 2A2XH 3ITIA 4HI3A 2W7SA 5AFYH 4FVBA 1LTOA 3SO3A 1BJVA 2ZDKA 3PROA 4OS1A 1NU7B 2GT7A 1SOTA 2BLOA 1AQ7A 1RS0A 4FUCA 3DSOA 3M5LA 4ABEA 1H8IH 2HWLB 4FXGH 4ISIH 1RTKA 3AAVA 3SV9A 3VB5A 1Y8TA 2NWNA 1TRYA 1OHHD 3A87A 3LIWA 3MU8A 2O8UA 3O8DA 1NFXA 1VCQA 2HVXA 5F8XA 1C5PA 1F0RA 3ZVAA 1SLUB 3L33A 1GVKB 2VIDA 3KQ5A 1TONA 2DE9A 1FY1A 1DXWA 1V2NT 1XM1A 2JDID 2A2QH 4RT1A 2Y5GA 2WPLS 3RXRA 2P94A 3DFJA 3DCLA 4O97A 1ZTKA 3A88A 2BY7X 3SU0A 1QFKH 4IN1A 1P10A 3Q3XA 1THPB 4K1TA 3RLYH 3AK5A 1AVGH 1O3HA 1K28D 1A2CH 3KCGH 4NFFA 3SW2B 5DPAA 5ABWA 3TJOA 2KCPA 4TY6A 4CHAB 1PJPA 4K5ZA 1P2NA 5T6FA 1TOCB 4AFUA 3SNDA 2BZ6H 1OYTH 4YZUA 4NIXA 1ELBA 2Y7XA 2ZTZA 3F3BA 1BB0B 2ZU5A 2UUYA 2ZFQH 4KELA 3M37A 5CMXH 2WINI 1FXYA 3RMMH 1UO6A 5E0HA 2OLGA 4IGDA 1H9LB 2OXSA 2W26A 3BG4B 1CSOE 2BD5A 1FONA 5PTPA 2Q1JA 2SNWA 4X2YA 1N8OC 3PLPA 2GKVE 3GDVA 4U32A 4WJG2 2Q6GA 3C27B 3VPKA 1BRAA 1J14A 1BA8B 1K2I1 3SUGA 4B1TA 4OM9A 3RC5A 2BD8A 1FY8E 4YTAA 3K9XB 1GDNA 4Z0KA 4KTSA 3BIUH 4Q7XA 1GGDB 3D49H 3RXDA 2XCNA 2A4OA 3ZVCA 1DXPA 1M9UA 2BYAX 2QV1A 3LC5A 2XWBI 3FO8D 3GISB 2SGEE 1EAWA 7KMEH 1COWD 2I6QA 5FBEA 1CQQA 2TGDA 2FPZA 2ULLA 2GMTC 2A0QB 4BXWA 2A5AA 3P6ZB 2HVYB 1E37B 3ZZ9A 1C5RA 1T7CA 3KIDU 3M7UA 1LCYA 1GI8B 1K1NA 4AYVB 2GV7A 2VBCA 1ZGVA 3PM3A 3V7TA 2IOTA 1DY8A 4D76A 3K2UA 1O5DH 2FI4E 1UVOA 5C20A 3LH3A 1SI5H 4X1SU 4LK4A 2JJ2D 2ZTXA 4MPXA 4X8TH 2P8OC 4VGCB 4D8NA 3H09A 3TGIE 1KXFA 4RSPA 1O3DA 2AMPA 1RIWC 1EAUA 5LGOA 1QRWA 4ZHMU 4GUXA 4A92A 4O9VA 1V2UT 2XC5A 1C2FA 1UTJA 1C1NA 2RDEA 3FVFB 5FXLA 2XYAA 4MNXA 1DWCH 1EKBB 2P16A 3FKSD 2KZ4A 5EODA 1ZRBA 1Z6JH 5C3NA 4JZDH 1E34B 4ISHH 1GCDA 4ZKSU 1WCZA 4D9RA 4FVDA 3ATLA 1A0HB 7GCHF 1F5KU 1MKXK 1Z8RA 3E6PH 2BLVA 4GAWA 1D6RA 3E8LA 3CS0A 1O2OA 1O3BA 1ZGIA 2FDAA 3LKWA 4DGJA 2C8XB 2ZKSA 1C1MA 1PPZA 2PHBA 1P57B 1DUAA 2A7JA 1RTLA 1NFUA 2ZQ2A 1PQ7A 1GJ4H 4DY7B 1YLNA 1H9HE 1TAWA 2VWLA 5T1VA 1UHBB 4SGBE 1MCTA 1WSSH 1WUNH 4H6SB 3LGVA 1ABJH 3EA8A 2F9BH 4FOUC 2YOLA 3EQ0H 2A4QA 3BEUA 2ZP0H 5DP9A 4BAOB 4DG4A 2BD3A 1ZPZA 3HGNA 2A4GA 3RMNH 3SN8A 1YPKH 3O8RA 2QXGA 1BIOA 2VIVA 5IDKA 1DWBH 3UNSA 7LPRA 1O2GH 1OYQA 1YCPK 3EA7A 3UTUH 4K1EA 4IMZA 5I46H 3E1XB 2ZFTA 3GCTG 5CHBA 2SGPE 4ASUD 1C1UH 1NFYA 4I86A 2ZGBH 3SI4H 2G5VA 4BNRA 1TB6H 2ZFFH 2ZCHP 2ZFPH 2AGIX 2ANKH 8ESTE 1J8AA 4X1NU 5C1XA 1VITG 1O38A 3TK5A 1O2UA 1C1QA 1GDQA 1RXPA 3KYGA 1VZQH 2BX4A 4XOJA 2EI7A 1FI8A 1S6LA 4AZ2B 8GCHF 6ESTA 1GI6A 1TPSA 3AAUA 2H5CA 4K69A 5HIZA 3HPTB 3SV7A 4B76A 3NXPA 2PR3A 1INCA 2VNTA 1GHWH 1TGNA 2YNAA 1YCPM 1HAZB 1MD7A 3MH4A 2D8WA 2ZGCA 3MO6A 3GYLB 2QY0B 2Y5FA 3T62A 1OWKA 4MQAA 4WXIA 3A8DA 1O2YA 3LOXA 1O5FH 4JZFH 2PFEA 3DFLA 2Q6DA 1N8OB 2WSSD 1QJ6B 5FX6A 3P8FA 5GDSH 3QX5H 1T32A 1XVMA 1HAPH 1Z1JA 1C2DA 1W3CA 5DGJA 2BOHB 1P2OA 1KTTB 1SGDE 1MBQA 3RU4T 1P2MA 2ZU1A 5B6OA 5DO4H 3QLPH 1TRNA 3ATIA 2BY6X 3MQKC 3DSGA 4NIYA 2BDGA 1ZLRA 4CREA 3V12A 2WPHS 4B6FA 1BRBE 2XTTB 1QL9A 1MQ6A 2FLRH 1O3FA 1QZ8A 5F53A 9LPRA 1P2QA 6GCHG 4E06H 4B74A 1EUFA 5IYTA 3GDSA 5HGGA 2GMTB 3D62A 4PROA 1JBUH 3RU4D 1LHDH 1HIAA 1QTFA 1Q31A 3WWFA 3F2HA 4ZCNA 1BRCE 1OWDA 2BMGB 1RFNA 2GX4A 1YP9A 1O5GH 1O5EH 1MH0A 2J95A 2K1QA 4X2XA 5J4SA 2P8OB 1AU8A 1J15A 1O3KA 3ENSB 2OC1A 1RIWB 1GJDB 2FS9A 4CR9A 1F0UA 5K7RA 1IQHA 2ZDMA 4GCHG 3Q3KA 2AHME 3RXGA 2GCHF 1GPZA 1AGJA 1K1IA 4FU7A 1C5OH 1GBAA 1U6QA 2QF0A 4WXVA 3P70B 3TH4H 5AVDA 1A0JA 1CGIE 2FOCA 4MLFB 1JOUB 3F9FA 3SNBA 1D3DB 2EI6A 2SFAA 4XSKU 1GHAG 1TYNA 3ZZDA 4NGAH 5C17A 1GJ7B 1DANH 5GPIB 1CE5A 2R3UA 1L2EA 1GBDA 4E05H 5DP6A 2FOHA 3RXCA 1QL8A 3UR9A 3PLKA 3RXVA 5DSFA
chains in the Genus database with same CATH topology
1SGPE 2A7CA 5A8ZA 2VVCA 1OWJA 1V2RT 4RN6A 2ZDVH 4Q2KA 1NO9H 2PWXA 2OD3B 4ABDA 1BTUA 4INHA 1HDTH 4OS6A 3SJ9A 1K1LA 5AHGH 1ZSJA 2ZFSA 1IAUA 3KQEA 2WPMS 3H5CB 2FI3E 3MH6A 4LXBH 1D6WA 1W7XH 2OC7A 1TGCA 2W5EA 1DFPA 1C4Y2 1S5SA 1RRKA 5FCRA 4ASHA 2OQUA 5EW1H 3MNXA 1V2WT 1S6FA 1WOFA 2NU0E 1N6XA 1GMDG 1V2MT 3NUMA 1THSH 3A82A 1QY6A 1C1TA 1BTWA 3ZZ6A 2GVFA 2ZO3H 1ZRKA 1EZUC 2W3KA 3EAJA 1KYNA 1GI3A 1SFQB 2V3HH 1O31A 1MBMA 4NA9H 1S85A 4INLA 5E0JA 3FP8E 1L1NA 1O2RA 1O2MA 1TGTA 1EZQA 4DT7B 3LGUA 1OSSA 1Y3UA 1ZTJA 1ELAA 1V3XA 4NZLA 2ODPA 1DWDH 3KL6A 2O8WA 3MMGA 4YESB 1HNEE 2VH0A 2TPIZ 4CR5A 1GMHG 1TPAE 3QGNB 1EZXC 3BTME 9ESTA 3QUMP 5DP8A 4JK6A 1EAXA 4O3TA 4UFDH 1ABIH 2OBQA 5FCKA 3CP7A 4B2CA 3GDUA 3TIUA 3M5MA 2F9UA 2ZCLP 4UEHH 4Y71A 3ZYEA 1YPJH 1C1WH 3PWCA 4LOYH 3TGJE 1YC0A 2GZ9A 2OINA 1C1RA 2F83A 2F3CE 2BD7A 2TRMA 5A8XA 1J9CH 1PPGE 1CHOF 3A7XA 4YM9A 1TNJA 4OS7A 1ZZZA 2YNBA 4Y0YE 3GY3A 2O8TA 5FX5A 4Y79A 3P8NA 5C1YA 4YT6H 3RC6A 1GI0A 1O2PA 1P01A 2GZ8A 5EQSA 1Y3XA 4YOIA 3SU3A 5JDUB 1UCYE 2H9HA 2VINA 2GT8A 1YPHE 3TJNA 3UOPA 1FAXA 1FZZA 1ORFA 3SQEE 3LGWA 3DT0H 2W7UA 2P95A 2BD9A 1LVMA 1YF4A 3OYPA 1B0FA 1ETSH 4QT8C 3KGPA 3RU4E 2FS8A 4K8YA 1CGJE 4UONA 1QBVH 1BTHH 1XMNB 3UWJH 1P3CA 1P2KA 2ANWA 1TE0A 3MNSA 3QWCH 2WUCA 1L4DA 4HZHA 1EZSC 2H9EH 1QB9A 3PMHB 4K8BA 1ZYOA 2BVXH 2HPPH 1TGBA 2J4IA 2VH6A 3RXSA 1VJ9U 2Z3EA 3K6YA 2QYIA 2R3YA 1DSUA 2FWWA 1NC6A 4UFGH 1LHGH 1Y5BT 2A1DB 2FI5E 3VB7A 4DW2U 2FX4A 1ANCA 3ZYDA 1MTSA 1W0YH 1QGFA 3BTFE 2H9TH 5EXNA 1AD8H 1KLIH 1BMAA 3TVJB 2EA3A 3SHAH 1O2VA 2B0FA 1GBTA 3SGBE 3U8OH 3S9AA 4UFEH 4WH8A 1S0QA 2PTCE 3LC3A 3LGIA 4MNWA 1NRQH 1C2GA 2PLXA 1SQAA 1FPCH 3ZVEA 1Y59T 3MYWA 1TGSZ 2Z9LA 1XVOA 1O3OA 2FXRA 1A0LA 4K3JA 4CH2B 4DIIH 2BQWB 2CMYA 2Y5HA 1HIAB 4H4FA 1GMCG 1F2SE 1GBHA 6LPRA 4X8UH 1SGIB 1XUFA 1BRUP 3RC4A 2BQ6B 3SU2A 3QTOH 1HAYB 2FODA 1TFXA 5F6MA 3LDXH 4J1YA 2B5TB 1UTLM 3A80A 1C5ZB 3GCTF 5GXPA 1K1JA 1QRXA 2XWAA 1FLEE 1SGQE 3OU0A 4KTUA 1UVSH 2J9NA 1JIRA 4MG3A 1TMUH 5TCCA 1BMNH 1SC8U 5A0CA 2R0KA 4DCDA 3L3TA 1UTMA 4SGAE 5A0BA 1GBCA 3NWUA 1HJAC 4I8HA 1PPFE 2B7DH 2FOEA 1VITF 1Q2WA 1AKSA 2AMDA 1D3PB 2AFQB 1V2PT 1ZMLA 3UR6A 4B71A 1UK3A 2CV3A 3TJUA 5FPYA 3SU4A 1ZJDA 3DUXH 2FP7B 2Y81A 1E35B 1G2MA 1QHRB 1GBLA 1EB2A 1QA0A 2WV4A 1A46H 4CBNA 1SGFA 1O3IA 1F5RA 3SNAA 4R0IA 1UTQA 2ZTYA 1IQLA 1GVZA 3P8OA 3SGQE 3SI3H 2UUKB 4AFSA 3PMBB 5EPYA 4BOHA 4D9QA 5F03A 3TJVA 2Z9JA 1HGTH 1JRTA 1K1PA 1UVTH 4Q80A 2GTBA 5A8YA 3VXEH 5JBTA 4O03A 2J38A 5FHTA 4ZUHA 4Y11E 1PFXC 3SOSA 2BB4A 2WYGA 2ZGHA 2QN5T 2XNIA 3NPSA 4I8KA 4NCYA 3TITA 3MH7A 1L4ZA 4RKOB 1P05A 1TBZH 3ZZCA 2AERH 1ELVA 1SGCA 2TGAA 3ZZ8A 4ZKOU 4NA7A 3VGCC 1DOJA 1S82A 2PV9B 1TPPA 1KDQA 1KXAA 3VEQB 1TX7A 2Z3CA 2SGDE 4GVUA 1T8MA 2ZC9H 3PMAB 4D7FA 2CJIA 2F91A 2A45B 4AG1A 1VITH 1ID5H 1D9IA 1BQYA 5EGMA 2FYQA 3T2NA 2ZECA 2ZZUH 1QBOA 1G3BA 1GJ5H 2QF3A 1TOMH 4GCHF 3SUEA 2BOKA 2O8LA 1C2MA 4INKA 1H1BA 4KGAA 1C5YB 1GCTC 4MNVA 5DKMA 3M35A 4I7YH 1QQ4A 4OGYA 1Z1IA 2ZNKH 1FNIA 2GGVB 3G01A 1GHAF 1P12E 3HKJB 3P92A 4ABIA 4CH8B 3A8CA 3LH1A 1FN6A 4Y10E 3HATH 3U1JB 1O2KA 4Y6DA 2EEKA 2C4FH 1TNLA 3ZVFA 1GBEA 3E0NB 1IHTH 1C9TA 3TGKE 5E8EH 1FUJA 1QJ7B 3AASA 3H7OA 1CU1A 3UUZA 4ESTE 1WAYB 5CHAC 1DE7H 1TNHA 4AGJA 3LU9B 2HLCA 1C1PA 4YO9A 4JMYA 5DK1A 1SGYE 3V3MA 1HUTH 1AE5A 1RGQA 1QR3E 1O33A 4ZXXH 3RXOA 1SHHB 1IQNA 1DUEA 4AGKA 2AYWA 4I32A 1GHBG 1GWAA 1SG8B 1XUGA 1O3PB 1GBKA 1ZMJA 1WTGH 2ZPSA 3S9BA 2ZGJA 1GI5A 1GI7B 3ZZAA 5L6NH 3MWIU 4X1RU 1BBRH 2NU1E 3F6UH 1O30A 2BLQA 2ZWLH 1W8BH 1KXBA 4A7IB 4X6NA 1B0EA 4WVPE 1BHXF 1C5TA 3S7HB 1HAOH 1C1OA 3GY2A 3ZZ4A 3KEEA 4IN2A 3DHKH 2C8WB 2V35A 5K0HA 3BTDE 1NESE 1TQ0B 3KHVA 2ANMH 2I6SA 1SQOA 2FOGA 2Z94A 1S83A 3ATKA 1X7AC 3ODDA 3RMLH 1HJAB 4X8SH 1F0TA 4ABBA 2FO9A 2BHGA 2VIPA 1YPHC 3KNXA 1ANEA 1P3EA 3CS7A 1YBWA 4OS5A 3KF2A 3QO6A 2DUCA 1NU9A 1HLTH 2UUFB 2VIOA 2QXHA 2BD2A 4WMEA 1MAYA 4K2YA 4IBLH 1O2SA 1ELDE 1PQ8A 4A5TS 5T6DA 1HPGA 2BX3A 2F9PA 2GDDA 3FANA 4ZKNU 4ZROA 1GHZA 3M3VA 1TIOA 4ZXYH 1SBWA 1HFDA 1AN1E 2P93A 2FZZA 4A1XA 4NIVA 3RXEA 3Q76A 5SGAE 3TLOA 3NCLA 3RXAA 1MAXA 1Q3XA 2PSXA 1K22H 3IG6B 4WMFA 1LPZB 1QIXB 3HGPA 1NROH 4AN7A 4TPIZ 1P11E 2STAE 1P2IA 3GY6A 4JCNA 5GWZA 4ISOA 3ZVGA 3A7VA 1OX1A 1C9PA 1Y5AT 2PKSC 5JPMH 3GOVB 3M3SA 5EQQA 1AWFH 3VGCB 1YM0A 1EAIA 3OSYA 3RXMA 1K9OE 1MTNC 1V2ST 1UVUH 3VXFH 5GIBA 1RJXB 1LHEH 5JBAS 1Z8IB 5DP4A 3FFGA 1CT2E 1QL7A 5C5OA 3A8AA 4RKJB 2Z9GA 3OY5U 5DP3A 3H7TA 2Z3DA 3U8RH 3LPRA 2UWPA 3PWBA 3MHWU 3C1KA 1YPMH 4GLYA 1UJ1A 3UNRA 5AFZH 1WQSA 4X2VA 1OWHA 1P9UA 1GCTB 2FEQH 4JZ1A 2FMJA 4OS2A 2AH4X 4JK5A 3RM2H 1MD8A 1ANBA 1C5XB 4TWWA 1F0SA 1LMWB 5EU8A 4ZH8A 3E0PB 1ZSKA 2FOMB 4JYUH 1ZPBA 2FLBH 3MOCA 2PGBB 1AMHA 1MTUA 3BTEE 1N1LA 3BTWE 1H9IE 3SUDA 2EI8A 2ZDLA 4OGXA 2C8ZB 4I31A 1PPBH 2ZPQA 1E0FD 5CHAB 3UY9A 3A86A 4BAMB 4NA8A 3GCHC 1A7SA 5EOKA 3UWIA 1F5LA 1MQ5A 3T27A 2BXUH 3B8JA 1KDQB 2C93B 3R3GB 5G4BA 3KQCA 3A7YA 3B9FH 5EPNA 3A83A 3LT3A 1VGCC 3RXIA 2XCFA 1J16A 1ZPCA 3IWMA 4WH6A 3VB6A 4TY7A 4UDWH 1BTXA 1NPMA 4AORA 3ZZBA 2G4TA 4YLUA 3I77A 3RXUA 3BF6H 1V2KT 5LH8A 3AVZA 3DA9B 1J17T 3F9EA 5F8TA 1SGNE 5E2OA 3ZV8A 2ODYB 2THFB 3RUOA 2OC8A 1C1SA 1O5AB 3QGJA 1ACBE 1EJAA 2ZA5A 1W7GH 3Q00A 1BCUH 4DJZB 1O2ZA 1SGRE 1K1OA 3LGTA 1V6DA 1BOQA 4CRDA 1HXFH 2XXLA 2Q6FA 1FDPA 2BQ7B 1XUKA 4GSOA 4ABHA 2H6MA 5JYIA 5HYOA 5FAHA 1SB1H 1SFIA 2BY9X 5J4QA 2QXIA 2ZU4A 3NKKA 1V2VT 2D26C 2QGRA 1IQJA 1CGHA 4X1PU 4AG2A 1DPOA 3BEFB 1YKTA 1DVAH 3K65B 1CVWH 1Z8JB 1KY9A 2Z6BD 1AO5A 4ABGA 2UUJB 4JZIA 2ZI2H 1ZSLA 3MFJA 3UREA 2RG3A 1ESAA 1HCGA 1NM6A 1OXGA 2QIQA 2BVSH 2BDIA 3STIA 1KLJH 1Y5UT 1V2QT 4FUBA 2FM2A 1IOEA 1YYY1 2STBE 1GJ6A 1HAHH 3U1IB 1SQTA 1SLVB 1ELGA 2VB0A 1C1VH 4D7GA 1TX6A 1IQFA 2C3SA 1L1JA 1QBNA 1GBJA 3SHCH 1FPHH 2ZCKP 2ZFRH 1JIMA 1LQEA 1CA8B 5LPRA 2F9OA 1KXEA 3BTTE 3I29A 2RDLA 1GI2A 1C5SA 1CBWC 1T8NA 1HAIH 4YOJA 2CGAA 4NWKA 1EATA 4AX9H 5T6GA 3EDXB 2IPHA 8GCHG 3MTYA 4NZQA 1O5CB 2A7HA 5HMAA 1XXDA 1DDJA 2GCTC 2ZHQH 2TIOA 1HB0B 3SJIA 2ZF0H 2C8YB 3O8BA 2D1JA 2AMQA 2V0BA 3FZZA 1NTPA 4CRBA 1DY9A 3URCA 3T28A 1EXFA 2PKSB 4BTIB 2NU3E 1A61H 1ZMNA 3NK8A 2QA9E 1EPTA 4KTCA 1NRSH 3L6PA 1DT2A 3QK1A 1MTNB 3GCOA 2OTVA 2OQ5A 2G00A 1TBRH 2GP9B 3ZVDA 1GHVH 3RXKA 2AEIH 1IHSH 2C90B 5EG4A 4AOQA 1SGFG 4E7RG 2TGTA 3WY8A 1QB1A 4ABAA 3P95A 1PYTC 3V13A 4UD9H 3A7WA 1AFQC 1VJAU 2ZGXH 5L2YH 2QCYA 4M7GA 4AB9A 2ILNA 3KQBA 4CRCA 4Y7BA 1A5HA 1GL1A 4MPUA 2PKAA 1Y3VA 1EOJA 2VGCC 3MI4A 5GCHG 1HAVA 3RXPA 5ETXA 1O3EA 3LONA 1DICA 4THNH 1VCWA 1WU1A 2OC0A 2OUAA 1O3JA 1OP2A 1GI1A 3AW1A 5T3HA 1N6YA 2G51A 3NZIA 3A7TA 1PPHE 3RM0H 3TH2H 3A89A 1O3LA 1AFEH 1GHBF 2XBXA 2G81E 2ZPRA 1XUIA 2O9QA 4CRAA 5EW2H 1TQ7B 1BDAA 2XC4A 1NY22 1AY6H 1WV7H 8LPRA 3GCHB 1Y3WA 1O3NA 3BTKE 3OTJE 1EPTC 3GCNA 2AGEX 2GCHG 1O35A 3UOUA 3SJKA 1VGCB 3LGYA 1LO6A 4TPYA 4H42U 1GBMA 1BTZA 3BTQE 4Y0ZE 3VFEA 3F9HA 1A5GH 4WY3A 1G3DA 5HXFA 1Z7KA 1FN8A 1C5LH 2VIWA 2LPRA 2SGAA 1GJ9B 3ESTA 1CO7E 1IQGA 2JH0D 1PYTD 1MU6B 4B2AA 3D23A 4ISLA 3RXBA 3SV2H 1H8DH 1P06A 3RXHA 1E36B 1C5NH 4J2YB 2BY5X 4U01A 1NT1A 2IJOB 1O2XA 1L0ZA 3B23B 2WV5A 1W10U 1W2KH 4JYTA 2AGGX 2P3UB 3HK3B 1C2KA 1EP6A 3QTVH 3ZZ7A 1LKAA 1Y3YA 4A6LA 3PO1C 3PLBA 1G3EA 1RTFB 3JZ1B 1ETTH 1G37A 1GG6C 1O3AA 3A8BA 2F9VA 2HPQH 1T4VH 3MNCA 5HM9A 1ELEE 3TU7H 4DIHH 3SV8A 1GJBB 3M7QA 5I25A 5HM2A 3LJOA 1MUEB 2J92A 3RMOH 2CHAC 1VR1H 4BTTB 1C5MD 3GYMA 2BDAA 3P8GA 1XKBC 5C1UA 2OCVB 1AIXH 1FIZA 2PUQH 5DJ7A 1YPEH 2VWNA 1CA0C 3KN2A 2AIQA 1LHFH 1CBWB 1UMAH 2JH6D 1G2LA 1O2LA 6GCHF 1JRSA 2GD4B 1MCVA 2GCTB 2P3FH 2VWMA 4F49A 5LPEA 3D65E 3UIRA 1GHYH 2HNTF 4DURA 4ZAEA 3F68H 1ZJKA 4K60A 4YOGA 1S84A 3ZV9A 3T29A 3MO9A 2W3IA 1O2NA 2CF9H 1MTWA 1NRNH 3M36A 4HFPB 4IS5A 3A7ZA 4WF8A 1TALA 6CHAC 3UPEA 2BDCA 1LQDB 3UNQA 2FIRH 1QB6A 1MMJN 3ATWA 4XBDA 4CRGA 3RXJA 2GZ7A 1B7XB 1CHOG 1UTOA 5E2PA 2XW9A 2PW8H 2GDEH 3S9CA 1DM4B 1MKWK 4FUDA 2Z9IA 2IN2A 1NRRH 3U69H 1BBRK 1LPKB 2Z7FE 1HJ8A 4K1SA 2ZHEH 1DSTA 4DVAU