1C1SA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Recruiting Zn2+ to mediate potent, specific inhibition of serine proteases.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1sA02
2VVVA 2Z9IA 5FPYA 1AVWA 4KELA 5A09A 1IQEA 2VB0A 4ESTE 3SU4A 4A5TS 1HAZB 2G52A 3F6UH 2A45B 1KXFA 2FOEA 5C3NA 4X1RU 5JBCS 1TGNA 1DVAH 1ZLRA 1ABJH 3MU4A 1IQMA 3FZZA 3IG6B 2GD4B 1FI8A 3UUZA 1BRCE 1EP6A 9ESTA 4XBDA 1HGTH 1QIXB 6GCHF 4NIYA 2R3UA 1NS3A 2CF8H 5C1XA 3RMMH 1VGCC 2G00A 2Z3CA 4AOQA 2J34A 5DP6A 3KQBA 1BMMH 1ARBA 3BIVH 1YPJH 3GY7A 3TIUA 1PYTD 2BLQA 5EW2H 3URDA 3QN7A 4CREA 2PR3A 3VB4A 4JMYA 1AVGH 1CU1A 3B23B 5E8EH 2C8XB 1GVLA 1SGDE 3RDZA 2GV6A 5FXLA 2QXJA 1GJ9B 1CGIE 2BDCA 2Y5FA 1A3BH 3OY6U 1O2VA 4X8VH 2PTCE 3BIUH 1NC6A 3AW0A 3BN9A 4R0IA 3A8BA 1C1NA 1FMGA 3PB1E 4U30A 5EG4A 4B1TA 1GGDB 3D49H 1GI6A 4INHA 3RXHA 2D8WA 2ZGHA 3UY9A 1Z6JH 1XUKA 1WBGB 1JWTA 2ZGJA 3LGTA 1SHHB 3GY5A 1XX9A 2ZU1A 3MH7A 2Q1JA 2ILNA 5CHAC 4BAQB 1SGYE 2CJIA 4PROA 5GIBA 3RM2H 1O3KA 1C2DA 1DE7H 1K1IA 3A81A 1F0TA 1AI8H 2FLBH 2Z9LA 2H9HA 5HMAA 4IC6A 2H5CA 8GCHG 4NGAH 1YPLH 3RLYH 2VWMA 5EXMA 1PQAA 2XBVA 1LQDB 2FDAA 1ZRBA 1J8AA 2BDAA 1PQ8A 1DOJA 1KSNA 3M5NA 4ABAA 4AG1A 1ELCA 1D6WA 2UUFB 2PTNA 2UWLA 4KP0A 2PFEA 2HNTE 2ZQ1A 4DURA 1TE0A 1THPB 3D23A 1YYY1 3M7QA 1LHDH 1GBMA 1WU1A 3T5FH 3P95A 1INCA 1QJ1B 1YPGH 1HIAA 5C1UA 2GCHF 3RXBA 4K3JA 1UTNA 2HNTC 1UVSH 2ZECA 1GI5A 1QR3E 3SORA 1Z1IA 2PKAB 1V2ST 4RN6A 6GCHG 3C27B 3UFAA 1L2EA 1C1QA 3RC5A 3M7UA 3RC4A 2ZI2H 3UPEA 2EA3A 1MTNC 4B73A 1SGRE 2BQWB 1MCTA 2VIQA 3SOSA 1YC0A 2AEIH 2AIPA 3UNSA 4NIWA 1W2KH 1TMTH 2XC0A 1KLIH 2J9NA 2BX4A 1EXFA 4GLYA 3CENA 3TNTA 1DFPA 4MQAA 1S6HA 1O2QA 2BZ6H 3SNCA 2ZDMA 2GP9B 1DS2E 1V2TT 5TJXA 5GPIB 1TGTA 3SNDA 5E0JA 2C90B 2KAIB 3RU4T 4HFPB 1MTSA 5EGMA 3BTHE 2NU0E 4ABHA 2A7HA 2IOTA 1QB6A 3PTNA 1B0FA 1G9IE 3T25A 3ZZ4A 4JZIA 1ZSKA 2D2DA 1O35A 3S9CA 1LPGB 2HNTF 1V2LT 4IN1A 4AZ2B 4E7RG 2XRCA 1C1WH 2Q6DA 1O5BB 3ZYDA 1KLJH 4NFEA 4B2AA 3SUEA 5LPRA 3TH3H 2F83A 3LKWA 1EZQA 1SL3A 3D65E 1ZHRA 3ATWA 1G3DA 1O3AA 7ESTE 1BUIA 3TPIZ 1L4DA 1HDTH 1NRPH 1ZOMA 2R0LA 1CO7E 2QXGA 4NZLA 5HYOA 1SFIA 2A0QB 5C5OA 4LZ1H 4O3TA 1TNLA 1TPPA 2BDBA 2PGBB 2P16A 2ZDKA 1BDAA 1GJAB 3LDXH 2GZ9A 3A8AA 3VB7A 1YPEH 1HJAB 1WTGH 4KKDA 3S7HB 1SLUB 1UVOA 2VIVA 3L6PA 4WH8A 1XUIA 1P2JA 2F9VA 3BTQE 2JKHA 4QT8C 2CGAA 3O8BA 1C5OH 1ZTLA 1C5YB 1NY22 1KXDA 1OYTH 4ZKRU 2FXRA 3FVFB 2GX4A 4GUXA 1MKWK 1CA8B 4FUHA 1PPFE 1YF4A 1SG8B 1PPHE 1P12E 4X1SU 2DUCA 2GCHG 2ZA5A 1C2LA 3DHKH 3M36A 1J16A 1C5RA 3SUDA 3KL6A 1CT2E 4WMFA 4YOJA 2ZFSA 5DPAA 1KIGH 1OWJA 3ODFA 2ZDLA 4D9RA 1O34A 1CE5A 1MKWH 2P93A 4D76A 1GJ5H 4O97A 1RJXB 3CP7A 2WYJA 1FNIA 2BY9X 1S83A 1A46H 2QA9E 1ESBA 3PYHA 1BTZA 2ZCHP 4B76A 6CHAB 3U1JB 4DIIH 1OP2A 1EP5A 1Z8RA 3RXLA 4A6LA 3BTTE 2BMGB 1C4Y2 1GHAF 4J2YB 3NUMA 1S6FA 4ABBA 1P2NA 1CHOF 3SNBA 3HKIB 1CGJE 1HJ8A 3RM0H 2A7CA 1RIWC 3JZ2B 1G30B 2F9PA 4YOIA 4E05H 2PSYA 4RSPA 3SU5A 3UQVA 3GDSA 3E0NB 3OTJE 1ELFA 3TK6A 2VGCB 1TLDA 1SR5C 4AFZA 2F9NA 4BXSA 1HFDA 1A0LA 1TPOA 1FN8A 2F9OA 4LOYH 3RXKA 2BD4A 1UTPA 3D62A 1GGDC 4WY3A 4ZHAA 1O2LA 1V2MT 3SI3H 3MU5A 1N8OB 4K60A 1V2UT 3QGNB 3RXAA 4Q7XA 1K1PA 3E0PB 2WPMS 1LVMA 1C1OA 1O3OA 2CV3A 4BTTB 4Y7AA 4ISNA 1EJNA 4D9QA 1GBEA 1Y3XA 1CBWB 2GT8A 1EAWA 1AKSB 4OS4A 1HAXB 5DKMA 4BTIB 2QF3A 4ZXYH 1HAPH 3GDUA 4AORA 1C5UA 1BRAA 1CT4E 5ETXA 1RFNA 2G51A 5AF9H 2GTBA 3KN2A 1JRSA 4AG2A 1ORFA 4DIHH 1ABIH 1AO5A 3E1XB 1H9HE 2FM2A 3MH4A 4O03A 1P2KA 2VIWA 1L1JA 3ZZCA 1VITF 1RGQA 4ZMAH 1F0SA 4DCDA 2SGDE 1W10U 1MZAA 1G32B 1LPZB 2CN0H 1JBUH 4A92A 4K5ZA 1DWBH 4JZFH 1ZJKA 3ATKA 3SUFA 1SQTA 3SJIA 4AB8A 2ZFTA 1O5DH 4X2XA 2FS9A 3ZVGA 1V2PT 5GDSH 1V2NT 2FI5E 2G55A 4WJG2 1T8NA 2BY6X 1QRZA 2BD2A 3SO3A 2M5TA 3M7TA 2YNBA 1LHCH 1P2IA 2BOKA 2WPLS 5EPYA 2DE8A 4MTBA 2FIRH 1RTFB 1WQSA 1QJ6B 1Y5AT 1LCYA 1GI3A 1ELAA 3MH6A 3TGJE 3A84A 1SGFG 1AU8A 3GOVB 2ZIQH 2QXHA 2ZPRA 2BTCE 1C5LH 4CRBA 2GVFA 4Y0YE 1HLTH 1GHAG 2ULLA 1UVPA 4KTCA 2AERH 1CHOG 4YTAA 3ZZ3A 1E38B 3O8RA 1GCDA 3RU4D 3KEEA 1GBJA 2OINA 2ZTYA 2P3TB 3UR6A 2CMYA 4HTCH 1AY6H 1MD8A 1PFXC 3VB6A 5HXFA 2ALPA 3E6PH 3ZZ6A 3OY5U 2UWOA 4UFGH 5ESTE 3GISB 3SN8A 2THFB 4A7IB 3LGYA 4D8NA 3L3TA 1A5IA 2BD3A 1DITH 2BB4A 1ELGA 3PM3A 1ZHPA 2OP9A 5HM2A 3M3SA 1C1TA 1O31A 1GHYH 1TWXB 1XUFA 8ESTE 5AHGH 1GJCB 1O36A 1BZXE 2BY8X 2BYAX 1O5GH 2Y7XA 1O2XA 4AYVB 1K1JA 2BZAA 1W13U 3BEUA 1FIZA 4JZEH 1P03A 1RTLA 2ZHWH 4TPYA 2W7SA 1CVWH 1AUJA 2Z9JA 1CA0B 1SB1H 1O3GA 1CHGA 1ELVA 1P8VC 1BTPA 4MNVA 1YKTA 4F4OC 2RG3A 1W14U 8LPRA 7LPRA 1O3CA 1VITG 1XUGA 1IQJA 4AFSA 1K1OA 3AASA 3T29A 5GJ4B 1HAVB 1BCUH 1ZMNA 2PKSB 2VVUA 3M3VA 4GHTA 1FLEE 3JZ1B 4BANB 1O3EA 2A5AA 8KME2 1O2IA 4Y8XA 4HGCA 1X7AC 1W12U 2Y7ZA 1DSTA 3SJKA 1QCPA 2ZDAH 2ANYA 5I25A 1UHBB 2VNTA 4ASHA 3PLBA 4O3UA 4X1PU 3OU0A 2FTMA 2A4QA 1QY6A 4FU9A 3E16B 5AFYH 3SV9A 5JPMH 3PV4A 3VGCB 1A3EH 2SGAA 1TPAE 2FX6A 3SQHE 3SI4H 2C3SA 1UTKA 4OGYA 3KQCA 2VH0A 4ISOA 2A31A 5EPNA 2GDDA 1EPTB 1G2LA 1O2SA 2O8MA 2QIQA 4K8YA 4ABFA 1LVBA 7KMEH 2BDGA 1O2TA 1UVUH 3P8FA 4F49A 2RCEA 3S0NA 1IQLA 1MQ5A 2VWLA 5DP7A 2SGFE 4DVAU 1DICA 1OSSA 3Q3XA 2ZGCA 2ZHEH 2PV9B 1G3CA 3DFLA 1BBRE 1Q3XA 1QNJA 1EX3A 1ELBA 5TCCA 4BXWA 1QHRB 1VCPA 5DP3A 2SNWA 2P95A 2OBOA 3EQ0H 3QZQA 4ZHLU 1A1RA 1P11E 3MNCA 3PMBB 4CRDA 1VJ9U 1O3JA 1SGTA 4BAMB 2BQ7B 1QBVH 1D3TB 2XBXA 3TJVA 4NWLA 1UCYK 2XCFA 3MO9A 1XXFA 3EA7A 2XW9A 4K69A 5A8XA 3SV6A 1MTWA 3RXIA 4ISIH 2WINI 3TLOA 4K1EA 2G5VA 4A1VA 4TYDA 1QQUA 1O38A 1UMAH 4X2WA 1ZMJA 4UDWH 5DP4A 1Y3VA 1TA2A 2OLGA 1ZRKA 2GZ8A 1UCYH 2ZU4A 2OTVA 2XWBI 3ESTA 4MPXA 2SGEE 1LTOA 1IQIA 3UTUH 4UE7H 1IQHA 4XE4A 3U8OH 3TNSA 5FHTA 4OS7A 5A0BA 1O0DH 1YPHE 2HGTH 3ZZ9A 1O32A 1QURH 1O2NA 1M9UA 1TABE 1C4U2 1F0RA 1BBRH 2VIOA 4ZKOU 4CHAC 3KGPA 2WV4A 4ABEA 1FPHH 3KHVA 1UTMA 1GMDF 3SBKA 3GYMA 1HYLA 3LIWA 2ZPSA 1VR1H 1YPHC 4E06H 1FJSA 2XNIA 2VWNA 1JXPA 1GHXH 4JK5A 1UTLM 2HPPH 1C2IA 2BM2A 1NU7B 1IHSH 2FYRA 1PPGE 5BPEA 2J95A 4X2VA 3MHWU 1KXBA 4IN2A 1V2KT 1PQ7A 3FAOA 1JIRA 2FZZA 3P70B 3P17H 2G81E 3RXMA 1A4WH 1DXPA 1OWDA 1XUJA 1W0ZU 2BVSH 1ZGIA 3EE0B 3MO6A 3P8OA 4DG4A 4J1YA 1K22H 4AFUA 3UWIA 2BLOA 3NWUA 2GGVB 1QGFA 5EQSA 3NCLA 3KF2A 4FVBA 3K6ZA 1P3EA 1TGCA 2PKAA 3QK1A 3V3MA 4ZHMU 2A2XH 2C8YB 4WMEA 1RXPA 2EC9H 1J9CH 4ABIA 4JZ1A 2GV7A 4I8HA 2PGQB 1D3QB 1F5KU 4X2YA 5A8ZA 2A5KA 3LGWA 1B0EA 2P59A 1AZZA 1TRMA 3LT3A 1JOUB 2ZHQH 1DT2A 3BTGE 5GWZA 1O30A 3SU3A 3I77A 4UFDH 3RXDA 3A83A 1GHBF 1GBHA 2O9QA 1FY8E 5T6GA 1ZSJA 3BTEE 2WUBA 4TY6A 1WCZA 1O2OA 2KAIA 2HALA 4NZQA 4CH2B 1BJVA 1L1NA 2ZKSA 3GCHB 2ODPA 3TH4H 1TX7A 3GY3A 1L1GA 1WAYB 1CA0C 1P2QA 1TBQH 1S0RA 2A4OA 2ZF0H 1S81A 2VIDA 4YESB 5EXLA 1TNKA 1AGJA 1HXEH 5EXNA 1EAXA 4Q7YA 4ZXXH 3SJ9A 2FTLE 1FZZA 2TGTA 4B74A 3U1IB 1C5WB 2QCYA 3ELAH 4X1NU 3KQEA 3VPKA 3RP2A 2W26A 1NFWA 1Q31A 2AGGX 1LHFH 1GCTB 1H8DH 3BSQA 3W95A 3T62A 3OSYA 1GMDG 2ZZUH 1TB6H 4BOHA 2H5DA 3RXGA 1VJAU 1QL9A 2FOMB 2XXLA 2O8TA 1C2EA 3Q3YA 5EW1H 3LGUA 2J92A 1J17T 2ZHDA 2EEKA 5T6FA 3PMAB 4RKOB 2I6SA 2PUQH 5H4IB 4BNRA 3TJNA 5FCKA 4FUGA 1NTPA 5A8YA 4UEHH 2Z7FE 1AN1E 3ZZ5A 4Q7ZA 2TGDA 1DM4B 1ZTJA 3PROA 1D4PB 1QFKH 4I8LA 1GG6B 1GMHF 1YLCA 3K2UA 1C5ZB 1F5LA 2OXSA 4GCHG 3RUOA 1QBNA 1QBOA 5AVDA 1GBBA 3DUXH 3O8DA 1HCGA 1J14A 2QF0A 1C2KA 1GI4A 1GHWH 1BQYA 1JIMA 1SFQB 1E0FD 5J4QA 1PJPA 2FLRH 3PMJA 1YM0A 2FP7B 1GBFA 5DG6A 1Z6EA 4ABJA 1AFQB 2LNCA 1O3NA 3GCOA 1XUHA 4NG9H 1ELDE 4ZROA 3RU4E 2PLXA 4WWYA 5CE1A 1GHBG 3ZZ8A 1C9PA 4NCYA 1C2FA 3KCGH 2B9LA 4ZH8A 4BAOB 2QGRA 5LPEA 5JBTA 3TU7H 1C5QA 5EQRA 3A89A 3SGQE 1RTKA 1H1BA 1TBZH 3ZZAA 4Z0KA 3G01A 1FY1A 5JDUB 1IQFA 2F9UA 1P04A 1LVYA 2OUAA 1IHTH 4Q2KA 2IJOB 2UUKB 1FUJA 3QTVH 2HVXA 2ESTE 3QO6A 3M5OA 1MD7A 1MH0A 1O2GH 2ZWLH 2ZTXA 5I46H 2ZEBA 2XBWA 3A7ZA 3GICB 4H42U 4I32A 1OKXA 1KDQA 3STIA 1ANEA 1TNJA 1VCWA 2ZDNA 2WPKS 3ZZDA 3E8LA 4AB9A 4CBOA 3RC6A 4UONA 4X8TH 1QRXA 3TJOA 3PLKA 1WQVH 1V2JT 4X6MA 1THRH 2ANMH 2H1UA 1AE5A 1S0QA 1P02A 1UTOA 2A7JA 3RXTA 1Y8TA 1C2JA 4NA8A 1AD8H 4WMDA 5E0GA 5FX5A 1DY8A 3S69A 2P3UB 3W94A 2Y5HA 3MOCA 1JMOH 1HJ9A 1MMJN 4NIXA 4H6TA 3RXRA 2RDLA 1UJ1A 3ZVFA 2TBSA 1D6RA 4AX9H 2GDEH 1XMNB 3FFGA 3NK8A 1GI9B 2GMTB 4X6OA 1B7XB 2QY0B 4B75A 2BHGA 1GMHG 3U98H 4Y7BA 4HI3A 2FMJA 4XDEA 3BF6H 4O9VA 1YPMH 5T3HA 1SC8U 1P2MA 2TPIZ 2J4IA 1VITH 1O3LA 4Y11E 2Q6FA 2FOFA 1Q2WA 3I29A 1HBTH 1BMAA 1O2WA 2BD9A 2J38A 1GJBB 2H6MA 2OD3B 1AB9B 1SHYA 4OS1A 2AGIX 1NN6A 1DDJA 4YLUA 1PQ5A 1PPCE 1TNGA 1V2WT 2B5TB 4MG3A 5L30H 4MVNA 3VXFH 1FAXA 2C4FH 1O5CB 1PPZA 1DWDH 2STAE 1GBKA 1NFYA 4Y6DA 6ESTA 1RRKA 3A80A 2DE9A 3PO1B 3HGNA 2AMDA 3B8JA 3BG8A 3BTDE 2BY5X 3FANA 1QTFA 4Y79A 4FXGH 1MBQA 1MU8B 1SLWB 3TGKE 2B8OH 1SGPE 3M35A 5EU8A 2QAAA 5EODA 2AS9A 2ZU5A 3UWJH 3AW1A 3UREA 1LKAA 3BTWE 4GHQA 3GCHC 4IGDA 1SGIB 2AGEX 1T4VH 2C93B 1MQ6A 1ZPBA 3GYLB 5IYTA 1Y3WA 3SHCH 1KYNA 1TX8A 4Y71A 2FO9A 1O2MA 3GDVA 4Y8ZA 2VH6A 2VU8E 2WUCA 4XBCA 4I8JA 2JH0D 1CSOE 3V0XA 3MYWA 1OS8A 2ZHFH 5CHAB 3VB3A 2AFQB 2R2MB 1NRQH 3V12A 4FU8A 2EI7A 3T28A 1O2HA 3LH3A 2K1QA 2QXIA 2F91A 3SU0A 4YO9A 3STJA 1NO9H 3T26A 3TVJB 4Y76A 2ZQ2A 5L2YH 4D7FA 3BEIB 3UOUA 3SV2H 3EAJA 3TJUA 1N1LA 5FBEA 4DY7B 3PWBA 4K1TA 3ZZ7A 1SSXA 4UFEH 4VGCB 4IMQA 1GL0E 5DP5A 1BHXF 1BT7A 1RS0A 1NU9A 1PPBH 1GWAA 2ZO3H 3S9AA 4KGAA 3ZVEA 1DUAA 4Y8YA 5AFZH 4GSOA 1UO6A 3L33A 1DUEA 2BVRH 5B6OA 3EA9A 1Y5UT 1FONA 1AFEH 1HAVA 5FCRA 4XFQA 1BJUA 1HAOH 4R8TB 3A86A 2C8WB 5DO4H 2W7UA 4D7GA 1EJAA 1HJAC 5DJ7A 1UHBA 2O8WA 2Y82A 3AAVA 3R3GB 1WTHD 3GY4A 1WYKA 5HGGA 1DY9A 1F7ZA 1GI1A 1FY4A 4MNXA 2ZU3A 4B2BA 2XC5A 3A8DA 2G4TA 1EB1H 2W3KA 1Z1JA 2SFAA 1A5HA 1GBLA 5EOKA 4Y10E 3TGIE 3DT0H 1OP0A 3UIRA 2O8LA 4FUFA 1ETRH 4FUEA 1A0JA 1DWEH 1O2UA 1QB9A 1TNHA 1C1RA 1XKBC 3O8CA 4DT7B 3LONA 1SGFA 2OQ5A 1BOQA 3A7VA 4B71A 1TFXA 4IW4E 1YPKH 4XOJA 5PTPA 4CR9A 1P06A 1EQ9A 1O2JA 2RA0A 2HWLB 1K2I1 4CRAA 1BRBE 3KNXA 3RMLH 5JYIA 3UQOA 1QL8A 1TMUH 2BLVA 4ABGA 1CQQA 4X8SH 1HRTH 4YT6H 5E0HA 1MCVA 1NROH 3LJJA 3R0FA 2FWWA 4GPGA 6CHAC 1TGBA 1C5TA 1G3BA 2OCVB 3FP6E 4XBBA 1EJMA 4AYYB 1E37B 2FESH 1W7GH 3ATLA 1HAYB 4ZKSU 2RA3A 1TA6A 3NZIA 1FXYA 1TX6A 3TH2H 4TWWA 2FPZA 2A2QH 2NU1E 2TGPZ 1NFUA 3CS0A 4BAKB 1FPCH 3BV9B 4X6PA 2J2UA 1C1UH 2VGCC 2ZNKH 2AH4X 2FYQA 1J15A 4FUJA 3T27A 4GVUA 4X8UH 1C5VA 5JB8S 1T31A 2R3YA 4JYUH 1SGQE 4U01A 1N8OC 1DX5M 1OWEA 1TAWA 3LC5A 1Y3UA 1ANBA 4H6SB 3SHAH 1H9IE 4E7NA 5EQQA 4LXBH 1HPGA 4YOGA 4INKA 1P05A 3GY8A 3K6YA 1HNEE 1CBWC 4FUDA 4KTSA 3EGKH 1O2ZA 5HM9A 1A5GH 2GMTC 4MPUA 1ZGVA 3MMGA 2UWPA 1FY3A 1KTTB 1AWFH 1SGNE 1YCPK 2BY7X 1OXGA 1BBRK 1RD3B 6LPRA 2XYAA 1GBAA 1BA8B 1KY9A 1T7CA 5C2ZA 4M7GA 3P92A 1O2KA 3VXEH 4LK4A 1AWHB 2ANWA 3QLPH 4WXVA 3UOPA 2FS8A 1NFXA 4FUBA 1HAIH 1O3HA 3Q76A 1AB9C 1PPEE 3VEQB 1MAXA 1Z71A 1GI2A 1YCPH 1O2RA 1P2OA 4AFQA 1H4WA 2ZFRH 1BTYA 2NWNA 3RXOA 1LKBA 1LHEH 4IC5A 3RXCA 1E36B 4WH6A 1GDUA 3P8GA 4NSVA 1VCQA 2BXUH 3A7XA 3ZVAA 2H9EH 1RIWB 2Z3EA 3LC3A 3PO1C 1UK2A 2F9BH 3U69H 5SGAE 1V6DA 1LQEA 3SQEE 1GI7B 3F1SB 1N6XA 3M3TA 3E3TA 1IQGA 4SGBE 3MU8A 4I8KA 2OC7A 2B7DH 1D3PB 1BTWA 1BIOA 3ENSB 2ZFQH 1MAYA 3MO3A 1GBCA 1C9TA 1EZXC 3B9FH 2UUJB 3N7OA 3LPRA 4SGAE 2AMQA 4YM9A 2SGQE 1G3EA 1XXDA 1YLDA 4TWYA 1P0SH 1GJ4H 2CHAB 2SGPE 4X6NA 2QV1A 4AN7A 2NU2E 1V2QT 2HLCA 4GCHF 1DLKB 1Y3YA 3PTBA 1ETSH 3MFJA 1EATA 3MNSA 4B2CA 1DXWA 1K1MA 1C5XB 2YOLA 3TITA 2Y80A 1V2OT 1ZPCA 1HXFH 2HPQH 1TIOA 4MPWA 1O3IA 3QX5H 3F9EA 1ETTH 2OC0A 4UFFH 2ALVA 3H5CB 3ATIA 2G5NA 3NPSA 1Y5BT 1ARCA 2ZGXH 4H4FA 1KXEA 1OWKA 1Z7KA 2BQ6B 5JBAS 4VGCC 2A1DB 3I78A 1EASA 3BG4B 3RMNH 2FODA 2ZDVH 1ELEE 3MI4A 3Q3KA 7GCHF 5ESBA 1BHXB 2BD7A 2SNVA 3OX7U 5FX6A 2A4RA 3PMHB 3IWMA 1SGCA 2GT7A 1SLXB 3LGVA 1H8IH 1GDQA 3M5MA 2Z9GA 2AYWA 1FY5A 1GHZA 3T2NA 1O2PA 5A0CA 3SNAA 1XVOA 5C67A 1ZJDA 5CMXH 3F68H 2ZTZA 4I7YH 3EDXB 1IAUA 4FU7A 5J4SA 1HUTH 3BTFE 3EA8A 4INLA 1EZUC 1CGHA 1LHGH 1AQ7A 1HIAB 2PKSC 3F9FA 1MBMA 1TMBH 1BTHH 2BDYA 3A7YA 1AHTH 2ZFPH 4TY7A 1WV7H 1V2VT 2FOAA 5A0AE 3SU6A 2R2WU 2WV5A 1QB1A 4THNH 2FX4A 3HGPA 3U9AH 1GL1A 3LOXA 1L0ZA 2ZGBH 4GAWA 4CRCA 2FOCA 3GCTF 1DPOA 1S85A 1A7SA 3P6ZB 1DLEA 1E35B 1LPKB 3U8TH 3MH5A 2ZFFH 1O3BA 1WUNH 4WXIA 1TONA 2FI4E 4YT7H 1O2YA 4JK6A 1ESAA 3VFEA 3VGCC 4JYTA 5JB9S 2ZP0H 5G4BA 5TCAA 4MPVA 2GCTB 1O39A 1O3MA 4K2YA 2P94A 3A8CA 2A32A 1GPZA 5F03A 3FP7E 3AVZA 3E90B 1C2HA 1C5MD 3OYPA 2V0BA 1EPTC 3GY2A 2Z9KA 1K9OE 2EI8A 4Z6AH 1FDPA 5FBIA 1JRTA 1QJ7B 1O33A 1A61H 5DGJA 1MKXK 2W5EA 1C5SA 3LJOA 5F8XA 1SQOA 4Q80A 2JH5D 1P9UA 1LMWB 2CXVA 1ID5H 1DANH 3KQDA 3UR9A 4OS6A 1NRSH 3RXFA 4ZUHA 1QL7A 1ZSLA 3SGBE 2PWXA 1D9IA 3ODDA 3MNXA 2P8OB 1EAUA 1GJDB 3GY6A 4MNWA 1MKXH 2R0KA 1TNIA 1ZHMA 2OQUA 5A2MH 5L2ZH 1TGSZ 3ZVDA 2ODQA 2VIPA 1W11U 1NRRH 2QN5T 3HK3B 1MU6B 2XC4A 1MUEB 3ZZBA 1H9LB 2D26C 4FVDA 3S7KB 7GCHG 4NIVA 1GJ7B 3A85A 2ZPQA 4OGXA 4JYVH 3TK9A 1UTJA 2A5IA 2BD5A 1AVXA 3RMOH 1P01A 1C1VH 5L6NH 4FUIA 1OP8A 3A7TA 1GVZA 1O5AB 2G4UA 3DFJA 1V2RT 3LGIA 1OWIA 2BDHA 1W3CA 2AIQA 1O3FA 2JETB 5E2PA 1TQ0B 1Y59T 4I8GA 2AMPA 3ZYEA 3SGAE 1P3CA 4KTUA 3MU1A 1G37A 1GI8B 1YGCH 3BTME 2BLWA 1ZMLA 3QDZB 2HRVA 4NWKA 2BDIA 2H2ZA 3FZDA 4DGJA 2ZC9H 1DSUA 1NPMA 3IITA 5DK1A 1AZ8A 1C1PA 4X0WU 5C1YA 1S82A 2ZCKP 4IS5A 1F2SE 1AKSA 4XSKU 3CS7A 3GCTG 1AMHA 1QA0A 1QQ4A 2EI6A 1KTSB 5F8ZA 3MWIU 4BAHB 2BX3A 5BRRE 2IN2A 5C20A 3RXEA 4BTUB 3F9GA 4ISLA 1ESTA 4ZKNU 1ANDA 2Z94A 5C5NA 1GBIA 3RXSA 1P9SA 3M37A 4RKJB 5IDKA 1FV9A 1CT0E 4UD9H 2WPIS 3NKKA 1GMCF 1EB2A 2GKVE 1KDQB 1K28D 4CRGA 1GJ8B 3HK6B 1SOZA 5GCHF 4U32A 1LO6A 4WF8A 3A88A 2Y5GA 1Z8JB 1W8BH 3ZVBA 2STBE 4IBLH 1ZTKA 1XM1A 3SU1A 2H9TH 1A2CH 1SGEE 2V3HH 2TIOA 2CHAC 2LPRA 3C1KA 3RLWH 5K7RA 3ITIA 3ZVCA 2PSXA 1GHVH 4X1QU 1HAGE 1TRNA 1MZDA 1O3PB 3RXQA 1BRUP 1BTXA 1O3DA 4OS2A 5ABWA 1EZSC 1VGCB 2QC2A 2F3CE 3H7TA 4MNYA 3K9XB 4ISHH 2PHBA 1A0HB 3MTYA 3SZNA 1THSH 2ZCLP 2BOHB 1LDTT 2UUYA 5DP9A 1YCPM 3H7OA 3F9HA 1AUTC 1O5FH 1SOTA 1GVKB 1WOFA 1GJ6A 1T8MA 2GZ7A 1O5EH 3V13A 1C5NH 1EKBB 1V3XA 1W7XH 1F92A 2FOHA 1BITA 3EYDA 4YZUA 1YBWA 1SBWA 1ELTA 3BG4C 1SLVB 3SJ8A 1MTUA 2D1JA 2P3FH 2J94A 2XCNA 3Q77A 4CHAB 3TK5A 5GXPA 1ACBE 3SU2A 3RXJA 1C1SA 1FIWA 1NT1A 3VB5A 1GBDA 3QWCH 3UNRA 1HV7A 1N6YA 1C4V2 1NESE 4A1XA 1QA7A 1TBRH 3SV7A 1UVTH 4U2WA 1TQ7B 3QUMP 1C2GA 3RXUA 3Q00A 1QRWA 3A82A 3FP8E 1AE8H 1BB0B 1EUFA 1EOLA 2YNAA 4Y0ZE 2VINA 3V7TA 1DWCH 1VZQH 2Z6BD 2JH6D 3SNEA 4CR5A 1C5PA 3M5LA 3ATMA 1U6QA 2OC1A 3HKJB 3RXPA 1F0UA 1GCTC 2TGAA 5LPFA 3A7WA 1BTUA 1G2MA 1XVMA 5FAHA 1P09A 1HAHH 1UTQA 4JCNA 1SQAA 4ABDA 1KXCA 3E91A 1ANCA 4A1TA 2VJ1A 1K1LA 2Q6GA 2PUXB 3M61U 4I31A 4MDSA 2BVXH 1G36A 2OC8A 2Y6TA 1SI5H 2WPHS 1GMCG 1OPHB 3WY8A 1T4UH 5FPSA 4DW2U 3KIDU 2A4GA 5GCHG 1P57B 1UK4A 3BEFB 1TOMH 2FEQH 2GCTC 9LPRA 2V3OH 3SJOA 2CF9H 2V6NA 4IMZA 1FN6A 2ASUB 2IPHA 2B0FA 3NXPA 2OBQA 1GG6C 4DOQA 1F5RA 5LGOA 2WYGA 3PWCA 1PYTC 1KXAA 3U8RH 4ZAEA 4LZ4B 2ZU2A 1MTNB 1OYQA 1WSSH 1AIXH 1TALA 3QTOH 4MLFB 1KLTA 1LVOA 5DP8A 2C8ZB 1T32A 5F6MA 1ZYOA 2O8UA 3URCA 1W0YH 1IQNA 1Z8IB 2QYIA 2P8OC 5T6DA 1HB0B 5K0HA 1OX1A 1ZPZA 4K1SA 2WPJS 2XWAA 1AFQC 1NZQH 1B5GH 4CRFA 1NM6A 4WVPE 1EPTA 4DJZB 1SVPA 3ZV8A 1OOKB 2FOBA 1BMNH 1TOCB 2NU4E 2PW8H 3DD2H 2FOGA 2BXTH 1GDNA 1S5SA 1FQ3A 3BTKE 5FPTA 3LU9B 1OWHA 1ZZZA 2Y81A 1IOEA 1K21H 1YP9A 3MU0A 3PLPA 3UNQA 3GCNA 4TPIZ 4CBNA 2R9PA 2ANKH 1SPJA 2ODYB 1C2MA 1D3DB 1TYNA 4HZHA 4FUCA 2V35A 1IQKA 2JETC 1BMLA 5LH8A 1FAKH 3RXVA 4NSYA 3P8NA 2NU3E 4I33A 1TRYA 2ZG0H 3LH1A 2G8TA 2VVCA 3HATH 1NRNH 1L4ZA 3HPTB 1K1NA 5F8TA 1GBTA 4NFFA 1EAIA 4YLQH 2XBYA 1GI0A 1MTVA 4OS5A 1UCYE 2W3IA 1XKAC 3QZRA 5JBBS 3SW2B 4NA9H 4K8BA 2I6QA 1S84A 4AGJA 2XTTB 2VWOA 2Z3DA 3DA9B 3A87A 2TRMA 8GCHF 3QGJA 4AGKA 5E2OA 3AAUA 1P10A 1EOJA 1C1MA 1O37A 4JZDH 3ZV9A 1SMFE 4CH8B 3MNBA 1UK3A 1Z8GA 1ZR0A 3K65B 3SUGA 3S9BA 1E34B 1T8LA 4NA7A 2BD8A 3SV8A 2HOBA 1T8OA 2FI3E 1TPSA
chains in the Genus database with same CATH superfamily
2VVVA 2Z9IA 5EIYA 5FPYA 1AVWA 4KELA 5A09A 1IQEA 5F53A 2VB0A 4ESTE 3SU4A 4A5TS 1HAZB 2G52A 3F6UH 2A45B 1KXFA 2FOEA 5C3NA 4X1RU 5JBCS 1TGNA 1DVAH 1ZLRA 1ABJH 3MU4A 1IQMA 3FZZA 3IG6B 2GD4B 1FI8A 3UUZA 1BRCE 1EP6A 2EQNA 9ESTA 4XBDA 1HGTH 1QIXB 6GCHF 4NIYA 2R3UA 1NS3A 2CF8H 5C1XA 3RMMH 1VGCC 2G00A 2Z3CA 4AOQA 1VKYA 2J34A 5DP6A 3KQBA 1BMMH 1ARBA 3BIVH 1YPJH 3GY7A 3TIUA 1PYTD 2BLQA 3OTPA 3URDA 5EW2H 3F0OA 3QN7A 4CREA 2PR3A 3VB4A 4JMYA 1AVGH 1CU1A 3B23B 5E8EH 2C8XB 1GVLA 1SGDE 3RDZA 2GV6A 5FXLA 2QXJA 1GJ9B 1CGIE 2BDCA 2Y5FA 1A3BH 3OY6U 1O2VA 4X8VH 2PTCE 3BIUH 1NC6A 3AW0A 3BN9A 4R0IA 3A8BA 1C1NA 1FMGA 3PB1E 4U30A 5EG4A 4B1TA 1GGDB 2J5UA 3D49H 1GI6A 4INHA 3RXHA 2D8WA 2ZGHA 3UY9A 1Z6JH 1XUKA 1WBGB 1JWTA 2ZGJA 3LGTA 1SHHB 3GY5A 1XX9A 2ZU1A 3MH7A 2Q1JA 2ILNA 5CHAC 4BAQB 3F3BA 1SGYE 2CJIA 4PROA 5GIBA 3RM2H 1O3KA 1C2DA 1DE7H 1K1IA 3A81A 1F0TA 1AI8H 2FLBH 2Z9LA 2H9HA 5HMAA 4IC6A 2H5CA 8GCHG 4NGAH 1YPLH 3DSPA 3RLYH 2VWMA 5EXMA 1PQAA 2XBVA 1LQDB 2FDAA 1ZRBA 1J8AA 2BDAA 1PQ8A 1DOJA 1KSNA 3M5NA 4ABAA 4AG1A 1ELCA 1D6WA 2UUFB 2PTNA 3H09A 2KCPA 2UWLA 4KP0A 2PFEA 2HNTE 2ZQ1A 4DURA 1TE0A 1THPB 3D23A 1YYY1 2QE7D 2KX4A 3M7QA 1LHDH 1GBMA 1WU1A 3T5FH 3P95A 1INCA 1QJ1B 1BMFD 1YPGH 1HIAA 5C1UA 2GCHF 3RXBA 4K3JA 1UTNA 2HNTC 1UVSH 2ZECA 1GI5A 1QR3E 3SORA 1Z1IA 2PKAB 1V2ST 1WDIA 4RN6A 6GCHG 3C27B 3UFAA 1L2EA 1C1QA 3RC5A 3M7UA 3RC4A 2ZI2H 3UPEA 2EA3A 1MTNC 4B73A 1SGRE 2BQWB 1MCTA 2VIQA 3SOSA 4Q4LA 1YC0A 2AEIH 2AIPA 3UNSA 4NIWA 1K0HA 1W2KH 2OK5A 1TMTH 2XC0A 1KLIH 2J9NA 2BX4A 1EXFA 4GLYA 3CENA 3TNTA 1DFPA 4MQAA 1S6HA 1O2QA 2BZ6H 3KYFA 3SNCA 2ZDMA 3PRBA 2GP9B 1DS2E 1V2TT 5TJXA 5GPIB 1TGTA 3SNDA 5E0JA 2C90B 2KAIB 3RU4T 4HFPB 1MTSA 5EGMA 3BTHE 2NU0E 4ABHA 2A7HA 2IOTA 1QB6A 3PTNA 1B0FA 1G9IE 3NRLA 3T25A 3ZZ4A 4JZIA 1ZSKA 2D2DA 1O35A 3S9CA 1LPGB 2HNTF 1V2LT 4IN1A 4AZ2B 4E7RG 2XRCA 1C1WH 2Q6DA 1O5BB 3ZYDA 1KLJH 4NFEA 4B2AA 3SUEA 5LPRA 3TH3H 2F83A 3LKWA 1EZQA 1SL3A 3D65E 1ZHRA 3ATWA 1G3DA 1O3AA 7ESTE 1BUIA 3TPIZ 1L4DA 1HDTH 1NRPH 1ZOMA 2R0LA 1CO7E 1YLNA 2QXGA 4NZLA 5HYOA 1SFIA 2A0QB 5C5OA 4LZ1H 4O3TA 1TNLA 1TPPA 2BDBA 2PGBB 2P16A 2ZDKA 2YMSC 3W1EA 1BDAA 1GJAB 3LDXH 2GZ9A 3A8AA 3VB7A 1YPEH 1HJAB 1WTGH 4KKDA 3S7HB 1SLUB 1UVOA 2VIVA 2KCAA 3L6PA 4WH8A 1XUIA 1P2JA 2F9VA 3BTQE 2JKHA 2V7QD 4QT8C 2CGAA 3O8BA 1C5OH 1ZTLA 1C5YB 1NY22 1KXDA 1OYTH 5HIZA 4ZKRU 2FXRA 3FVFB 2GX4A 4GUXA 1MKWK 1CA8B 4FUHA 1PPFE 1YF4A 1SG8B 1PPHE 1P12E 4X1SU 2DUCA 2GCHG 2ZA5A 1C2LA 3DHKH 3M36A 1J16A 1C5RA 3SUDA 1H8HD 3KL6A 1CT2E 4WMFA 4YOJA 3FO8D 2ZFSA 2IPQX 5DPAA 1KIGH 1OWJA 3ODFA 2ZDLA 4D9RA 3KQ5A 1O34A 1CE5A 1MKWH 2P93A 4D76A 1GJ5H 4O97A 1RJXB 3CP7A 2WYJA 1FNIA 2BY9X 1S83A 1A46H 2QA9E 1ESBA 3PYHA 1BTZA 2ZCHP 4B76A 6CHAB 3U1JB 4DIIH 3OAAD 1OP2A 1EP5A 1Z8RA 3RXLA 3EE7A 4A6LA 3BTTE 2BMGB 1C4Y2 1GHAF 4J2YB 1NBME 1S6FA 3NUMA 4ABBA 1P2NA 1CHOF 3SNBA 3HKIB 1CGJE 1HJ8A 3RM0H 2A7CA 1RIWC 3JZ2B 1G30B 2F9PA 4YOIA 4E05H 2PSYA 4RSPA 3SU5A 3UQVA 3GDSA 3E0NB 3OTJE 1ELFA 3TK6A 2VGCB 1TLDA 1SR5C 2XNDD 4AFZA 2F9NA 4BXSA 1HFDA 1A0LA 2WPDD 1TPOA 1FN8A 2F9OA 4XRNA 4LOYH 3WWBA 3RXKA 2BD4A 1UTPA 3D62A 1GGDC 4WY3A 4ZHAA 1O2LA 1QZ8A 1V2MT 3SI3H 3MU5A 1N8OB 4K60A 1V2UT 3QGNB 3RXAA 4Q7XA 1K1PA 3E0PB 2WPMS 1LVMA 1C1OA 1O3OA 2CV3A 4BTTB 4Y7AA 4B6EA 4ISNA 1EJNA 4D9QA 1GBEA 1Y3XA 1CBWB 2GT8A 1EAWA 3F2GA 3FKSD 1AKSB 4OS4A 1HAXB 5DKMA 4BTIB 2QF3A 4ZXYH 1HAPH 3GDUA 4AORA 1C5UA 1BRAA 1CT4E 3U28C 5ETXA 1RFNA 2G51A 2KFWA 5AF9H 2GTBA 3KN2A 1JRSA 4AG2A 1ORFA 4DIHH 1ABIH 1AO5A 3E1XB 1H9HE 2FM2A 3MH4A 4YXWD 4O03A 1P2KA 2VIWA 1L1JA 3ZZCA 1VITF 1RGQA 4ZMAH 1F0SA 4DCDA 2SGDE 1W10U 1MZAA 1G32B 1LPZB 2CN0H 1JBUH 4A92A 4K5ZA 1DWBH 4JZFH 1ZJKA 3ATKA 3SUFA 1SQTA 3SJIA 4AB8A 2ZFTA 1O5DH 4X2XA 2FS9A 3ZVGA 1V2PT 5GDSH 1V2NT 2FI5E 2G55A 4WJG2 1T8NA 2BY6X 1QRZA 2BD2A 2WHXA 3SO3A 2M5TA 3M7TA 2YNBA 1LHCH 1P2IA 2BOKA 2WPLS 5EPYA 2DE8A 4MTBA 2FIRH 1RTFB 1WQSA 1QJ6B 4M9FA 1Y5AT 1LCYA 1GI3A 1ELAA 3MH6A 5B6LA 4OM9A 3TGJE 3A84A 1SGFG 1AU8A 3GOVB 2ZIQH 2CK3D 2QXHA 2BTCE 1C5LH 2ZPRA 4CRBA 2GVFA 4Y0YE 1HLTH 1GHAG 2ULLA 1UVPA 4KTCA 2AERH 1CHOG 4YTAA 3ZZ3A 1E38B 3O8RA 1GCDA 3RU4D 3KEEA 1GBJA 3SYJA 2OINA 4ASUD 2ZTYA 2P3TB 3UR6A 2CMYA 4HTCH 1AY6H 1MD8A 1PFXC 3VB6A 5HXFA 2ALPA 3E6PH 3ZZ6A 3OY5U 2UWOA 4UFGH 5ESTE 3GISB 3SN8A 2THFB 1YWUA 4A7IB 3LGYA 4D8NA 3L3TA 1A5IA 2BD3A 1DITH 2BB4A 1ELGA 3PM3A 1ZHPA 2OP9A 5HM2A 3M3SA 1C1TA 1O31A 1GHYH 1NBMD 1TWXB 1XUFA 8ESTE 5AHGH 1GJCB 1O36A 1BZXE 2BY8X 2BYAX 3FN8A 1O5GH 2Y7XA 1O2XA 4AYVB 1K1JA 2BZAA 1W13U 3BEUA 1FIZA 4JZEH 1P03A 2HLDD 1RTLA 3DSGA 2ZHWH 4TPYA 2W7SA 1CVWH 1AUJA 2Z9JA 1CA0B 1SB1H 1O3GA 1CHGA 1ELVA 1P8VC 1BTPA 4MNVA 1YKTA 4F4OC 2RG3A 1W14U 8LPRA 7LPRA 1O3CA 1VITG 1XUGA 1IQJA 4AFSA 1K1OA 1MABB 3AASA 3T29A 5GJ4B 1HAVB 1BCUH 1ZMNA 2PKSB 2VVUA 3M3VA 4GHTA 1FLEE 3JZ1B 4BANB 1O3EA 2A5AA 8KME2 1O2IA 4Y8XA 4HGCA 1X7AC 1W12U 2Y7ZA 1DSTA 3SJKA 1QCPA 2ZDAH 2ANYA 5I25A 1UHBB 2VNTA 4ASHA 3PLBA 4O3UA 4X1PU 3OU0A 2FTMA 2A4QA 1QY6A 5IK2D 4FU9A 3E16B 1H8ED 5AFYH 5CHBA 3SV9A 2J98A 5JPMH 2M2AA 3PV4A 3VGCB 1A3EH 2SGAA 1TPAE 2FX6A 3SQHE 3SI4H 2C3SA 1UTKA 4OGYA 3KQCA 2VH0A 4ISOA 2A31A 5EPNA 2GDDA 1EPTB 1G2LA 1O2SA 2O8MA 2QIQA 1FX0B 4K8YA 4ABFA 1LVBA 7KMEH 2BDGA 1O2TA 1UVUH 3P8FA 4F49A 2RCEA 3S0NA 1IQLA 1MQ5A 2VWLA 5DP7A 2SGFE 4DVAU 1DICA 1OSSA 3Q3XA 2ZGCA 2ZHEH 2PV9B 1G3CA 3DFLA 1BBRE 1Q3XA 1QNJA 1EX3A 1ELBA 5TCCA 4BXWA 1QHRB 1VCPA 5DP3A 2SNWA 5HKKD 2P95A 2OBOA 3EQ0H 3QZQA 4ZHLU 1A1RA 1P11E 3MNCA 3PMBB 4CRDA 1VJ9U 1O3JA 1SGTA 4BAMB 2BQ7B 1QBVH 1D3TB 2XBXA 3TJVA 2WSSD 4NWLA 1UCYK 5C0TA 2XCFA 3MO9A 1XXFA 3EA7A 2XW9A 4K69A 5A8XA 3SV6A 1MTWA 3RXIA 4ISIH 2WINI 3TLOA 4K1EA 2G5VA 4A1VA 2KM0A 4TYDA 1QQUA 1O38A 4P02A 1UMAH 4X2WA 1ZMJA 4UDWH 5DP4A 1Y3VA 1TA2A 2OLGA 1ZRKA 2GZ8A 1UCYH 2ZU4A 2OTVA 2XWBI 3ESTA 4MPXA 2SGEE 1LTOA 1IQIA 3UTUH 2W6JD 4UE7H 1IQHA 4XE4A 3CNRA 3U8OH 3TNSA 5FHTA 4OS7A 5A0BA 1O0DH 1YPHE 2HGTH 5C94A 3ZZ9A 1O32A 1QURH 1O2NA 1M9UA 1TABE 1C4U2 1F0RA 1BBRH 2VIOA 4ZKOU 4CHAC 3KGPA 2WV4A 4ABEA 1FPHH 3KHVA 1UTMA 1GMDF 3SBKA 3GYMA 1HYLA 3LIWA 2ZPSA 1VR1H 1YPHC 4E06H 1FJSA 2XNIA 2VWNA 3GS9A 1JXPA 1GHXH 4JK5A 1UTLM 2HPPH 1C2IA 2BM2A 1NU7B 1IHSH 2FYRA 1PPGE 5BPEA 2J95A 2W6ID 4X2VA 3MHWU 1KXBA 4IN2A 1V2KT 1PQ7A 3FAOA 1JIRA 2FZZA 3P70B 3P17H 2G81E 3RXMA 1A4WH 1DXPA 1SKYE 1OWDA 1XUJA 1W0ZU 2BVSH 1ZGIA 3UB0A 3EE0B 3MO6A 3P8OA 4DG4A 4J1YA 1K22H 4AFUA 3UWIA 2BLOA 3NWUA 2GGVB 1QGFA 1UW7A 5EQSA 3NCLA 3KF2A 4FVBA 3K6ZA 1P3EA 1TGCA 2PKAA 3QK1A 3V3MA 4ZHMU 2A2XH 2C8YB 2PP6A 4WMEA 1RXPA 2EC9H 1J9CH 4ABIA 4JZ1A 2GV7A 4I8HA 2PGQB 1D3QB 1F5KU 4X2YA 5A8ZA 2A5KA 3LGWA 1B0EA 2P59A 1AZZA 1TRMA 3LT3A 1JOUB 2ZHQH 1DT2A 2KR7A 3BTGE 1O30A 3SU3A 5GWZA 3I77A 4UFDH 3RXDA 3A83A 1GHBF 1GBHA 2O9QA 1FY8E 5T6GA 1ZSJA 3BTEE 2WUBA 4TY6A 1WCZA 1O2OA 2KAIA 2HALA 4NZQA 4CH2B 1BJVA 2JJ2D 1L1NA 2ZKSA 3GCHB 2ODPA 3TH4H 1TX7A 3GY3A 1L1GA 1WAYB 1CA0C 1P2QA 1TBQH 1S0RA 2A4OA 2ZF0H 1S81A 2VIDA 2JDID 4YESB 5EXLA 1TNKA 1AGJA 1HXEH 5EXNA 1EAXA 4Q7YA 4ZXXH 3SJ9A 2FTLE 1FZZA 2TGTA 4B74A 3U1IB 1C5WB 2KCYA 2QCYA 3ELAH 3KQEA 4X1NU 3VPKA 3RP2A 2W26A 1NFWA 1Q31A 2AGGX 1LHFH 1GCTB 1H8DH 3BSQA 3W95A 3T62A 3OSYA 1GMDG 2ZZUH 1TB6H 4BOHA 2H5DA 3RXGA 3OEED 1VJAU 1QL9A 2FOMB 2XXLA 1C2EA 2O8TA 3Q3YA 5EW1H 3LGUA 2J92A 1J17T 2ZHDA 2EEKA 5T6FA 3PMAB 4RKOB 2I6SA 2PUQH 5H4IB 4BNRA 3TJNA 5FCKA 4FUGA 1NTPA 5A8YA 4UEHH 2Z7FE 1AN1E 3ZZ5A 3FOAA 4Q7ZA 2TGDA 1DM4B 1ZTJA 3PROA 1D4PB 1QFKH 4I86A 4I8LA 1GG6B 1GMHF 1YLCA 3K2UA 1C5ZB 1F5LA 2OXSA 4GCHG 3RUOA 1QBNA 1QBOA 5AVDA 1GBBA 3DUXH 3O8DA 1E1RD 1HCGA 1J14A 2QF0A 1C2KA 1GI4A 1GHWH 1BQYA 1JIMA 4RT0A 1SFQB 1E0FD 5J4QA 1PJPA 2FLRH 3PMJA 1YM0A 2FP7B 1GBFA 5DG6A 1Z6EA 4ABJA 1AFQB 2LNCA 1O3NA 3GCOA 1XUHA 4NG9H 1ELDE 4ZROA 3RU4E 2PLXA 4WWYA 5CE1A 1GHBG 3ZZ8A 1C9PA 4NCYA 1C2FA 3KCGH 2B9LA 4ZH8A 4BAOB 2QGRA 4RT1A 5LPEA 5JBTA 3TU7H 1C5QA 5EQRA 1COWD 3A89A 4Z1MD 3SGQE 1RTKA 1H1BA 1TBZH 1E1QD 3F2FA 3ZZAA 4Z0KA 3G01A 1FY1A 5JDUB 1IQFA 2F9UA 1P04A 1LVYA 2OUAA 1IHTH 5GNDA 4Q2KA 2IJOB 2UUKB 1FUJA 3QTVH 2HVXA 2ESTE 3DCLA 3QO6A 4P00A 3M5OA 1MD7A 1MH0A 1O2GH 2ZWLH 2ZTXA 5I46H 2ZEBA 2XBWA 3A7ZA 3GICB 4H42U 4I32A 1OKXA 1KDQA 3STIA 1ANEA 1TNJA 1VCWA 2ZDNA 2WPKS 3ZZDA 3E8LA 4AB9A 4CBOA 3RC6A 4UONA 4X8TH 1QRXA 3TJOA 3PLKA 1WQVH 1V2JT 4X6MA 1THRH 2ANMH 2H1UA 1AE5A 1S0QA 1P02A 1UTOA 2A7JA 3RXTA 1Y8TA 1C2JA 5EJZA 4NA8A 1AD8H 4WMDA 5E0GA 5FX5A 1DY8A 3S69A 2P3UB 3W94A 2Y5HA 3MOCA 1JMOH 1HJ9A 1MMJN 4NIXA 4H6TA 3RXRA 2RDLA 1UJ1A 3ZVFA 2TBSA 1D6RA 4AX9H 2GDEH 1XMNB 3FFGA 3NK8A 1GI9B 2GMTB 4X6OA 1B7XB 2QY0B 4B75A 2BHGA 1GMHG 3U98H 4Y7BA 4HI3A 2XOKD 2FMJA 4XDEA 3BF6H 4O9VA 1YPMH 5T3HA 1SC8U 1P2MA 2TPIZ 5C0UA 2J4IA 1VITH 1O3LA 4Y11E 5DN6D 2Q6FA 2FOFA 4HG6A 1Q2WA 3I29A 1HBTH 1BMAA 1O2WA 2BD9A 2J38A 1GJBB 2H6MA 2OD3B 1AB9B 1SHYA 4OS1A 2AGIX 4F55A 1NN6A 1DDJA 3MQKC 4YLUA 1PQ5A 1PPCE 1TNGA 1V2WT 2B5TB 4MG3A 5L30H 4MVNA 3VXFH 1FAXA 2C4FH 1O5CB 1PPZA 1DWDH 2STAE 1GBKA 1NFYA 4Y6DA 6ESTA 1RRKA 3A80A 2DE9A 3PO1B 3HGNA 1EFRD 2AMDA 3B8JA 3BG8A 3BTDE 2BY5X 3FANA 1QTFA 4Y79A 4FXGH 1MBQA 1MU8B 1SLWB 3TGKE 2B8OH 1SGPE 3M35A 5EU8A 2QAAA 5EODA 2AS9A 2ZU5A 3UWJH 3AW1A 3UREA 1LKAA 3BTWE 4GHQA 3GCHC 4IGDA 1SGIB 2AGEX 1T4VH 2C93B 1MQ6A 1ZPBA 3GYLB 5IYTA 2F4LA 1Y3WA 3SHCH 1KYNA 1TX8A 4Y71A 2FO9A 1O2MA 3GDVA 4Y8ZA 2VH6A 2VU8E 2WUCA 4XBCA 4I8JA 2JH0D 1CSOE 3V0XA 3MYWA 1OS8A 2ZHFH 5CHAB 3VB3A 2AFQB 2R2MB 1NRQH 3V12A 4FU8A 2EI7A 3T28A 1O2HA 3LH3A 2K1QA 2QXIA 2F91A 3SU0A 4YO9A 3STJA 1NO9H 3T26A 3TVJB 4Y76A 2ZQ2A 5L2YH 4D7FA 3BEIB 3UOUA 3SV2H 3EAJA 3TJUA 3PRDA 1N1LA 5FBEA 4DY7B 5KECA 4ACAA 3PWBA 4K1TA 3ZZ7A 2HVYB 1SSXA 4UFEH 4VGCB 4IMQA 1GL0E 5DP5A 1BHXF 3WW7A 1BT7A 1RS0A 1NU9A 1PPBH 1GWAA 2ZO3H 3S9AA 2WZQA 1E79D 4KGAA 3ZVEA 1DUAA 4Y8YA 5AFZH 4GSOA 1UO6A 3L33A 1DUEA 2BVRH 5B6OA 3EA9A 1Y5UT 1FONA 1AFEH 1HAVA 5FCRA 4XFQA 1BJUA 1HAOH 4R8TB 3A86A 2C8WB 3N7DA 5DO4H 2W7UA 4D7GA 2QF5A 1EJAA 1HJAC 5DJ7A 1UHBA 2O8WA 2Y82A 3AAVA 3R3GB 1WTHD 3GY4A 1WYKA 5HGGA 1DY9A 1F7ZA 1GI1A 1FY4A 4MNXA 2ZU3A 4B2BA 2XC5A 3A8DA 2G4TA 1EB1H 2W3KA 1Z1JA 2GJGA 2SFAA 1A5HA 1GBLA 5EOKA 2J97A 4Y10E 3TGIE 3DT0H 1OP0A 3UIRA 2O8LA 4FUFA 1ETRH 4FUEA 1A0JA 1DWEH 1O2UA 2K8IA 1QB9A 1TNHA 1C1RA 1XKBC 3O8CA 4DT7B 3LONA 1SGFA 2OQ5A 1BOQA 3A7VA 4B71A 1TFXA 4IW4E 1YPKH 4XOJA 5PTPA 4CR9A 1P06A 1EQ9A 1O2JA 2RA0A 2HWLB 1K2I1 4CRAA 1BRBE 3KNXA 3RMLH 5JYIA 3UQOA 1QL8A 1TMUH 2BLVA 4ABGA 1CQQA 4X8SH 1HRTH 4YT6H 5E0HA 1MCVA 1NROH 3LJJA 4DT4A 3OE7D 3R0FA 2FWWA 4GPGA 6CHAC 1TGBA 1C5TA 1G3BA 2OCVB 3FP6E 4XBBA 1EJMA 4AYYB 1E37B 2FESH 1W7GH 2JIZD 3ATLA 1HAYB 4ZKSU 2RA3A 1TA6A 3NZIA 1FXYA 1TX6A 3PV5A 2YMSB 3TH2H 2QF4A 4TWWA 2FPZA 2A2QH 2NU1E 2TGPZ 1NFUA 3CS0A 4BAKB 1FPCH 3BV9B 4X6PA 2J2UA 1C1UH 2KCOA 2VGCC 2ZNKH 2AH4X 2FYQA 1J15A 4FUJA 5CDFE 3T27A 2J98B 4GVUA 4X8UH 1C5VA 5JB8S 1T31A 2R3YA 4JYUH 1SGQE 4U01A 1N8OC 1DX5M 1OWEA 1TAWA 3LC5A 1Y3UA 1ANBA 4H6SB 3SHAH 1H9IE 4E7NA 3VG8A 5EQQA 4LXBH 1HPGA 4YOGA 4INKA 1P05A 3GY8A 3K6YA 4FETA 1HNEE 1CBWC 4FUDA 4KTSA 3EGKH 1O2ZA 5HM9A 1A5GH 2GMTC 4MPUA 1ZGVA 3MMGA 2UWPA 1FY3A 1KTTB 1AWFH 3UAIC 1SGNE 1YCPK 2BY7X 1OXGA 1BBRK 1RD3B 6LPRA 2XYAA 1GBAA 1BA8B 1KY9A 1T7CA 5C2ZA 4M7GA 3P92A 1O2KA 3VXEH 4LK4A 1AWHB 2ANWA 3QLPH 4WXVA 3UOPA 2FS8A 1NFXA 4FUBA 1HAIH 1O3HA 3Q76A 1AB9C 1PPEE 3VEQB 1MAXA 1Z71A 1GI2A 1YCPH 1O2RA 1P2OA 4AFQA 1H4WA 2ZFRH 1BTYA 2NWNA 1OHHD 1LKBA 3RXOA 1LHEH 4IC5A 3RXCA 1E36B 4ZCNA 4WH6A 1GDUA 3P8GA 4NSVA 1WXRA 1VCQA 2BXUH 3A7XA 3ZVAA 2H9EH 1RIWB 2Z3EA 3LC3A 3PO1C 1UK2A 2F9BH 3U69H 5SGAE 1V6DA 1LQEA 3SQEE 1GI7B 3F1SB 1N6XA 3M3TA 3E3TA 1IQGA 4SGBE 3MU8A 2LELA 4I8KA 2OC7A 2B7DH 1D3PB 1BTWA 1BIOA 3ENSB 2ZFQH 1MAYA 3MO3A 1GBCA 1C9TA 1EZXC 3B9FH 2UUJB 3N7OA 3LPRA 4SGAE 2AMQA 4AC9A 4YM9A 2WV9A 2SGQE 1G3EA 1XXDA 1YLDA 4TWYA 1P0SH 1GJ4H 2CHAB 2SGPE 4X6NA 2QV1A 4AN7A 2NU2E 1V2QT 2HLCA 4GCHF 1DLKB 1Y3YA 3PTBA 1ETSH 3MFJA 1EATA 3MNSA 4FOUC 4B2CA 1DXWA 1K1MA 1C5XB 2YOLA 3TITA 2Y80A 1V2OT 1ZPCA 1HXFH 2HPQH 2L6OA 1TIOA 4MPWA 1O3IA 3QX5H 3KYGA 3F9EA 1ETTH 2OC0A 4UFFH 2ALVA 3H5CB 3ATIA 2G5NA 3NPSA 3N7EA 2IJD1 1Y5BT 1ARCA 2ZGXH 4H4FA 1KXEA 1OWKA 1Z7KA 2RDEA 2RFKC 2BQ6B 5JBAS 4VGCC 2A1DB 3I78A 1EASA 3BG4B 3RMNH 2FODA 2ZDVH 1ELEE 3MI4A 3Q3KA 7GCHF 5ESBA 1BHXB 2BD7A 2SNVA 3OX7U 5FX6A 3WWFA 2A4RA 3PMHB 3IWMA 1SGCA 2GT7A 1SLXB 3LGVA 1H8IH 1GDQA 3M5MA 2Z9GA 2AYWA 1FY5A 1GHZA 3T2NA 1O2PA 5A0CA 3SNAA 1XVOA 5C67A 1ZJDA 5CMXH 3F68H 2ZTZA 4I7YH 3EDXB 1IAUA 4FU7A 5J4SA 2KZ4A 1HUTH 3BTFE 3EA8A 1KMHB 4INLA 1EZUC 1CGHA 1LHGH 1AQ7A 1HIAB 2PKSC 3F9FA 1MBMA 1TMBH 1BTHH 2BDYA 3A7YA 1AHTH 2ZFPH 4TY7A 1WV7H 1SQRA 1V2VT 2FOAA 5A0AE 3SU6A 2R2WU 2WV5A 1QB1A 4THNH 2FX4A 3HGPA 3U9AH 1GL1A 3LOXA 1L0ZA 2ZGBH 4GAWA 4CRCA 2FOCA 3GCTF 1DPOA 1S85A 1A7SA 3P6ZB 1W0JD 1DLEA 1E35B 1LPKB 3U8TH 3MH5A 2ZFFH 1O3BA 1WUNH 4WXIA 1TONA 2FI4E 5FL7D 1O2YA 4JK6A 4YT7H 1ESAA 3VFEA 3VGCC 4JYTA 5JB9S 2ZP0H 5G4BA 5TCAA 4MPVA 3F2HA 2GCTB 1O39A 1O3MA 4K2YA 2P94A 3A8CA 2A32A 1GPZA 5F03A 3FP7E 3AVZA 3E90B 1C2HA 1C5MD 3OYPA 2V0BA 1EPTC 3GY2A 2Z9KA 1K9OE 2EI8A 4Z6AH 1FDPA 5FBIA 1JRTA 1QJ7B 1O33A 1A61H 5DGJA 1MKXK 2W5EA 1C5SA 3LJOA 5F8XA 1SQOA 4Q80A 2JH5D 1P9UA 1LMWB 2CXVA 1ID5H 1DANH 3KQDA 3UR9A 4OS6A 1NRSH 3RXFA 4Q63A 4ZUHA 1QL7A 1ZSLA 3SGBE 2PWXA 1D9IA 3ODDA 3MNXA 2P8OB 1EAUA 1GJDB 3GY6A 4MNWA 1MKXH 2R0KA 1TNIA 4RI0A 1ZHMA 2OQUA 5A2MH 5L2ZH 1TGSZ 3ZVDA 2ODQA 2VIPA 1W11U 1NRRH 2QN5T 3HK3B 1MU6B 2XC4A 1MUEB 3ZZBA 1H9LB 2F43B 2D26C 4FVDA 3S7KB 3OFND 7GCHG 4NIVA 1GJ7B 3A85A 2ZPQA 4OGXA 4JYVH 3TK9A 1UTJA 2A5IA 2BD5A 1AVXA 3RMOH 1P01A 1C1VH 5L6NH 4FUIA 1OP8A 3A7TA 1GVZA 1O5AB 2G4UA 3DFJA 1V2RT 3LGIA 5KGOA 1OWIA 2LP6A 2BDHA 1W3CA 2AIQA 1O3FA 2JETB 2JJ1D 5E2PA 1TQ0B 1Y59T 4I8GA 2AMPA 3ZYEA 3SGAE 1P3CA 4KTUA 3MU1A 1G37A 1GI8B 1YGCH 3BTME 2BLWA 1ZMLA 3QDZB 2HRVA 4NWKA 2BDIA 2H2ZA 3FZDA 4DGJA 2ZC9H 1DSUA 1NPMA 3IITA 5DK1A 1AZ8A 1C1PA 4X0WU 1W0KD 5C1YA 1S82A 2ZCKP 4IS5A 2AHME 1F2SE 1AKSA 4XSKU 3CS7A 3GCTG 1AMHA 1QA0A 4ACBA 1QQ4A 2EI6A 1KTSB 5F8ZA 3N99A 5EJ1A 3MWIU 4BAHB 2BX3A 2V3MA 5BRRE 2IN2A 5C20A 3RXEA 4BTUB 3F9GA 4ISLA 1ESTA 4ZKNU 1ANDA 2Z94A 5C5NA 1GBIA 3RXSA 1P9SA 3M37A 4RKJB 5IDKA 1FV9A 1CT0E 4UD9H 2WPIS 3NKKA 1GMCF 4B6FA 1EB2A 2GKVE 1KDQB 1K28D 4CRGA 1GJ8B 3HK6B 1SOZA 5GCHF 4U32A 1LO6A 4WF8A 3A88A 2Y5GA 1Z8JB 1W8BH 3ZVBA 2STBE 4IBLH 1ZTKA 1XM1A 3SU1A 2H9TH 1A2CH 1SGEE 2V3HH 2TIOA 2CHAC 2LPRA 3C1KA 3RLWH 5K7RA 3ITIA 3ZVCA 2PSXA 1GHVH 4X1QU 1HAGE 1TRNA 1MZDA 1O3PB 3RXQA 1BRUP 1BTXA 1O3DA 2L74A 4OS2A 5ABWA 1EZSC 1VGCB 2QC2A 2F3CE 3H7TA 4MNYA 3K9XB 4ISHH 2PHBA 1A0HB 3DSOA 3MTYA 3SZNA 1THSH 2ZCLP 2BOHB 1LDTT 2UUYA 5DP9A 1YCPM 3H7OA 3AK5A 3F9HA 1AUTC 1O5FH 1SOTA 1GVKB 1WOFA 5HIYA 1GJ6A 1T8MA 2GZ7A 2YMSD 1O5EH 3V13A 3SZEA 1C5NH 1EKBB 1V3XA 1W7XH 1F92A 2FOHA 1BITA 3EYDA 4YZUA 1YBWA 1SBWA 4XD7D 1ELTA 3PV2A 3BG4C 1SLVB 3SJ8A 1MTUA 2D1JA 2P3FH 2J94A 2XCNA 3Q77A 4CHAB 3TK5A 5GXPA 1ACBE 3SU2A 3RXJA 1C1SA 1FIWA 1NT1A 3VB5A 1GBDA 3QWCH 3UNRA 1HV7A 1N6YA 1C4V2 1NESE 4A1XA 1QA7A 1TBRH 3SV7A 1UVTH 4U2WA 1TQ7B 3QUMP 1C2GA 3RXUA 3Q00A 1QRWA 3A82A 3FP8E 1AE8H 1BB0B 1EUFA 1EOLA 2YNAA 4Y0ZE 2VINA 3V7TA 1DWCH 1VZQH 2Z6BD 2JH6D 3SNEA 4CR5A 1C5PA 3M5LA 3ATMA 1U6QA 2OC1A 3HKJB 3RXPA 1F0UA 1GCTC 2TGAA 5LPFA 3A7WA 1BTUA 1G2MA 1XVMA 5FAHA 1P09A 1HAHH 1UTQA 4JCNA 1SQAA 4ABDA 1KXCA 3E91A 1ANCA 4A1TA 2VJ1A 1K1LA 2Q6GA 2PUXB 3M61U 4I31A 4MDSA 2BVXH 1G36A 2OC8A 2Y6TA 1SI5H 2WPHS 1GMCG 1OPHB 3WY8A 1T4UH 5FPSA 4DW2U 3KIDU 2A4GA 5GCHG 1P57B 1UK4A 3BEFB 1TOMH 2FEQH 2GCTC 9LPRA 2V3OH 3SJOA 3OEHD 5KEDA 2CF9H 2V6NA 4IMZA 1FN6A 2ASUB 2IPHA 2B0FA 3NXPA 2OBQA 1GG6C 4DOQA 4TSFD 1F5RA 5LGOA 2WYGA 3PWCA 1PYTC 1KXAA 3U8RH 4ZAEA 4LZ4B 2ZU2A 1MTNB 1YY3A 1OYQA 1WSSH 1AIXH 1TALA 3QTOH 4MLFB 1KLTA 1LVOA 5DP8A 2C8ZB 1T32A 5F6MA 1ZYOA 2O8UA 5T1VA 3URCA 1W0YH 1IQNA 1Z8IB 2QYIA 2P8OC 5T6DA 1HB0B 5EJLA 5K0HA 1OX1A 1ZPZA 4K1SA 2WPJS 2XWAA 1AFQC 1NZQH 1B5GH 4CRFA 1NM6A 4WVPE 1EPTA 4DJZB 1SVPA 3ZV8A 1OOKB 2FOBA 1BMNH 1TOCB 2NU4E 2PW8H 4F48B 3DD2H 2FOGA 2BXTH 1GDNA 1S5SA 1FQ3A 2VBCA 3BTKE 5FPTA 3LU9B 1OWHA 1ZZZA 2Y81A 1IOEA 1K21H 1YP9A 3MU0A 3PLPA 3ZIAD 3UNQA 3GCNA 4TPIZ 4CBNA 2R9PA 2ANKH 1SPJA 2ODYB 1C2MA 1D3DB 1TYNA 4HZHA 4FUCA 2V35A 1IQKA 2JETC 1BMLA 5LH8A 1FAKH 3RXVA 4NSYA 3P8NA 2NU3E 4I33A 1TRYA 4TT3D 2ZG0H 5C17A 3LH1A 2G8TA 1S6LA 2VVCA 3HATH 1NRNH 1L4ZA 3HPTB 2K0QA 1K1NA 5F8TA 1GBTA 4NFFA 1EAIA 4YLQH 2XBYA 1GI0A 1MTVA 4OS5A 1UCYE 2W3IA 1XKAC 3QZRA 5JBBS 3SW2B 4NA9H 4K8BA 2I6QA 1S84A 4AGJA 2EY4C 2XTTB 2VWOA 2Z3DA 3DA9B 3A87A 2TRMA 8GCHF 3QGJA 4AGKA 5E2OA 3AAUA 1P10A 1EOJA 1C1MA 3F0PA 1O37A 4JZDH 3ZV9A 1SMFE 4CH8B 3MNBA 1UK3A 1Z8GA 1ZR0A 3K65B 3SUGA 3S9BA 1E34B 1T8LA 4NA7A 5DSFA 2BD8A 3SV8A 2HOBA 1T8OA 2FI3E 1TPSA
chains in the Genus database with same CATH topology
2VVVA 2Z9IA 5FPYA 1AVWA 4KELA 5A09A 1IQEA 2VB0A 4ESTE 3SU4A 4A5TS 1HAZB 2G52A 3F6UH 2A45B 1KXFA 2FOEA 5C3NA 4X1RU 5JBCS 1TGNA 1DVAH 1ZLRA 1ABJH 3MU4A 1IQMA 3FZZA 3IG6B 2GD4B 1FI8A 3UUZA 1BRCE 1EP6A 9ESTA 4XBDA 1HGTH 1QIXB 6GCHF 4NIYA 2R3UA 1NS3A 2CF8H 5C1XA 3RMMH 1VGCC 2G00A 2Z3CA 4AOQA 2J34A 5DP6A 3KQBA 1BMMH 1ARBA 3BIVH 1YPJH 3GY7A 3TIUA 1PYTD 2BLQA 5EW2H 3URDA 3QN7A 4CREA 2PR3A 3VB4A 4JMYA 1AVGH 1CU1A 3B23B 5E8EH 2C8XB 1GVLA 1SGDE 3RDZA 2GV6A 5FXLA 2QXJA 1GJ9B 1CGIE 2BDCA 2Y5FA 1A3BH 3OY6U 1O2VA 4X8VH 2PTCE 3BIUH 1NC6A 3AW0A 3BN9A 4R0IA 3A8BA 1C1NA 1FMGA 3PB1E 4U30A 5EG4A 4B1TA 1GGDB 3D49H 1GI6A 4INHA 3RXHA 2D8WA 2ZGHA 3UY9A 1Z6JH 1XUKA 1WBGB 1JWTA 2ZGJA 3LGTA 1SHHB 3GY5A 1XX9A 2ZU1A 3MH7A 2Q1JA 2ILNA 5CHAC 4BAQB 1SGYE 2CJIA 4PROA 5GIBA 3RM2H 1O3KA 1C2DA 1DE7H 1K1IA 3A81A 1F0TA 1AI8H 2FLBH 2Z9LA 2H9HA 5HMAA 4IC6A 2H5CA 8GCHG 4NGAH 1YPLH 3RLYH 2VWMA 5EXMA 1PQAA 2XBVA 1LQDB 2FDAA 1ZRBA 1J8AA 2BDAA 1PQ8A 1DOJA 1KSNA 3M5NA 4ABAA 4AG1A 1ELCA 1D6WA 2UUFB 2PTNA 2UWLA 4KP0A 2PFEA 2HNTE 2ZQ1A 4DURA 1TE0A 1THPB 3D23A 1YYY1 3M7QA 1LHDH 1GBMA 1WU1A 3T5FH 3P95A 1INCA 1QJ1B 1YPGH 1HIAA 5C1UA 2GCHF 3RXBA 4K3JA 1UTNA 2HNTC 1UVSH 2ZECA 1GI5A 1QR3E 3SORA 1Z1IA 2PKAB 1V2ST 4RN6A 6GCHG 3C27B 3UFAA 1L2EA 1C1QA 3RC5A 3M7UA 3RC4A 2ZI2H 3UPEA 2EA3A 1MTNC 4B73A 1SGRE 2BQWB 1MCTA 2VIQA 3SOSA 1YC0A 2AEIH 2AIPA 3UNSA 4NIWA 1W2KH 1TMTH 2XC0A 1KLIH 2J9NA 2BX4A 1EXFA 4GLYA 3CENA 3TNTA 1DFPA 4MQAA 1S6HA 1O2QA 2BZ6H 3SNCA 2ZDMA 2GP9B 1DS2E 1V2TT 5TJXA 5GPIB 1TGTA 3SNDA 5E0JA 2C90B 2KAIB 3RU4T 4HFPB 1MTSA 5EGMA 3BTHE 2NU0E 4ABHA 2A7HA 2IOTA 1QB6A 3PTNA 1B0FA 1G9IE 3T25A 3ZZ4A 4JZIA 1ZSKA 2D2DA 1O35A 3S9CA 1LPGB 2HNTF 1V2LT 4IN1A 4AZ2B 4E7RG 2XRCA 1C1WH 2Q6DA 1O5BB 3ZYDA 1KLJH 4NFEA 4B2AA 3SUEA 5LPRA 3TH3H 2F83A 3LKWA 1EZQA 1SL3A 3D65E 1ZHRA 3ATWA 1G3DA 1O3AA 7ESTE 1BUIA 3TPIZ 1L4DA 1HDTH 1NRPH 1ZOMA 2R0LA 1CO7E 2QXGA 4NZLA 5HYOA 1SFIA 2A0QB 5C5OA 4LZ1H 4O3TA 1TNLA 1TPPA 2BDBA 2PGBB 2P16A 2ZDKA 1BDAA 1GJAB 3LDXH 2GZ9A 3A8AA 3VB7A 1YPEH 1HJAB 1WTGH 4KKDA 3S7HB 1SLUB 1UVOA 2VIVA 3L6PA 4WH8A 1XUIA 1P2JA 2F9VA 3BTQE 2JKHA 4QT8C 2CGAA 3O8BA 1C5OH 1ZTLA 1C5YB 1NY22 1KXDA 1OYTH 4ZKRU 2FXRA 3FVFB 2GX4A 4GUXA 1MKWK 1CA8B 4FUHA 1PPFE 1YF4A 1SG8B 1PPHE 1P12E 4X1SU 2DUCA 2GCHG 2ZA5A 1C2LA 3DHKH 3M36A 1J16A 1C5RA 3SUDA 3KL6A 1CT2E 4WMFA 4YOJA 2ZFSA 5DPAA 1KIGH 1OWJA 3ODFA 2ZDLA 4D9RA 1O34A 1CE5A 1MKWH 2P93A 4D76A 1GJ5H 4O97A 1RJXB 3CP7A 2WYJA 1FNIA 2BY9X 1S83A 1A46H 2QA9E 1ESBA 3PYHA 1BTZA 2ZCHP 4B76A 6CHAB 3U1JB 4DIIH 1OP2A 1EP5A 1Z8RA 3RXLA 4A6LA 3BTTE 2BMGB 1C4Y2 1GHAF 4J2YB 3NUMA 1S6FA 4ABBA 1P2NA 1CHOF 3SNBA 3HKIB 1CGJE 1HJ8A 3RM0H 2A7CA 1RIWC 3JZ2B 1G30B 2F9PA 4YOIA 4E05H 2PSYA 4RSPA 3SU5A 3UQVA 3GDSA 3E0NB 3OTJE 1ELFA 3TK6A 2VGCB 1TLDA 1SR5C 4AFZA 2F9NA 4BXSA 1HFDA 1A0LA 1TPOA 1FN8A 2F9OA 4LOYH 3RXKA 2BD4A 1UTPA 3D62A 1GGDC 4WY3A 4ZHAA 1O2LA 1V2MT 3SI3H 3MU5A 1N8OB 4K60A 1V2UT 3QGNB 3RXAA 4Q7XA 1K1PA 3E0PB 2WPMS 1LVMA 1C1OA 1O3OA 2CV3A 4BTTB 4Y7AA 4ISNA 1EJNA 4D9QA 1GBEA 1Y3XA 1CBWB 2GT8A 1EAWA 1AKSB 4OS4A 1HAXB 5DKMA 4BTIB 2QF3A 4ZXYH 1HAPH 3GDUA 4AORA 1C5UA 1BRAA 1CT4E 5ETXA 1RFNA 2G51A 5AF9H 2GTBA 3KN2A 1JRSA 4AG2A 1ORFA 4DIHH 1ABIH 1AO5A 3E1XB 1H9HE 2FM2A 3MH4A 4O03A 1P2KA 2VIWA 1L1JA 3ZZCA 1VITF 1RGQA 4ZMAH 1F0SA 4DCDA 2SGDE 1W10U 1MZAA 1G32B 1LPZB 2CN0H 1JBUH 4A92A 4K5ZA 1DWBH 4JZFH 1ZJKA 3ATKA 3SUFA 1SQTA 3SJIA 4AB8A 2ZFTA 1O5DH 4X2XA 2FS9A 3ZVGA 1V2PT 5GDSH 1V2NT 2FI5E 2G55A 4WJG2 1T8NA 2BY6X 1QRZA 2BD2A 3SO3A 2M5TA 3M7TA 2YNBA 1LHCH 1P2IA 2BOKA 2WPLS 5EPYA 2DE8A 4MTBA 2FIRH 1RTFB 1WQSA 1QJ6B 1Y5AT 1LCYA 1GI3A 1ELAA 3MH6A 3TGJE 3A84A 1SGFG 1AU8A 3GOVB 2ZIQH 2QXHA 2ZPRA 2BTCE 1C5LH 4CRBA 2GVFA 4Y0YE 1HLTH 1GHAG 2ULLA 1UVPA 4KTCA 2AERH 1CHOG 4YTAA 3ZZ3A 1E38B 3O8RA 1GCDA 3RU4D 3KEEA 1GBJA 2OINA 2ZTYA 2P3TB 3UR6A 2CMYA 4HTCH 1AY6H 1MD8A 1PFXC 3VB6A 5HXFA 2ALPA 3E6PH 3ZZ6A 3OY5U 2UWOA 4UFGH 5ESTE 3GISB 3SN8A 2THFB 4A7IB 3LGYA 4D8NA 3L3TA 1A5IA 2BD3A 1DITH 2BB4A 1ELGA 3PM3A 1ZHPA 2OP9A 5HM2A 3M3SA 1C1TA 1O31A 1GHYH 1TWXB 1XUFA 8ESTE 5AHGH 1GJCB 1O36A 1BZXE 2BY8X 2BYAX 1O5GH 2Y7XA 1O2XA 4AYVB 1K1JA 2BZAA 1W13U 3BEUA 1FIZA 4JZEH 1P03A 1RTLA 2ZHWH 4TPYA 2W7SA 1CVWH 1AUJA 2Z9JA 1CA0B 1SB1H 1O3GA 1CHGA 1ELVA 1P8VC 1BTPA 4MNVA 1YKTA 4F4OC 2RG3A 1W14U 8LPRA 7LPRA 1O3CA 1VITG 1XUGA 1IQJA 4AFSA 1K1OA 3AASA 3T29A 5GJ4B 1HAVB 1BCUH 1ZMNA 2PKSB 2VVUA 3M3VA 4GHTA 1FLEE 3JZ1B 4BANB 1O3EA 2A5AA 8KME2 1O2IA 4Y8XA 4HGCA 1X7AC 1W12U 2Y7ZA 1DSTA 3SJKA 1QCPA 2ZDAH 2ANYA 5I25A 1UHBB 2VNTA 4ASHA 3PLBA 4O3UA 4X1PU 3OU0A 2FTMA 2A4QA 1QY6A 4FU9A 3E16B 5AFYH 3SV9A 5JPMH 3PV4A 3VGCB 1A3EH 2SGAA 1TPAE 2FX6A 3SQHE 3SI4H 2C3SA 1UTKA 4OGYA 3KQCA 2VH0A 4ISOA 2A31A 5EPNA 2GDDA 1EPTB 1G2LA 1O2SA 2O8MA 2QIQA 4K8YA 4ABFA 1LVBA 7KMEH 2BDGA 1O2TA 1UVUH 3P8FA 4F49A 2RCEA 3S0NA 1IQLA 1MQ5A 2VWLA 5DP7A 2SGFE 4DVAU 1DICA 1OSSA 3Q3XA 2ZGCA 2ZHEH 2PV9B 1G3CA 3DFLA 1BBRE 1Q3XA 1QNJA 1EX3A 1ELBA 5TCCA 4BXWA 1QHRB 1VCPA 5DP3A 2SNWA 2P95A 2OBOA 3EQ0H 3QZQA 4ZHLU 1A1RA 1P11E 3MNCA 3PMBB 4CRDA 1VJ9U 1O3JA 1SGTA 4BAMB 2BQ7B 1QBVH 1D3TB 2XBXA 3TJVA 4NWLA 1UCYK 2XCFA 3MO9A 1XXFA 3EA7A 2XW9A 4K69A 5A8XA 3SV6A 1MTWA 3RXIA 4ISIH 2WINI 3TLOA 4K1EA 2G5VA 4A1VA 4TYDA 1QQUA 1O38A 1UMAH 4X2WA 1ZMJA 4UDWH 5DP4A 1Y3VA 1TA2A 2OLGA 1ZRKA 2GZ8A 1UCYH 2ZU4A 2OTVA 2XWBI 3ESTA 4MPXA 2SGEE 1LTOA 1IQIA 3UTUH 4UE7H 1IQHA 4XE4A 3U8OH 3TNSA 5FHTA 4OS7A 5A0BA 1O0DH 1YPHE 2HGTH 3ZZ9A 1O32A 1QURH 1O2NA 1M9UA 1TABE 1C4U2 1F0RA 1BBRH 2VIOA 4ZKOU 4CHAC 3KGPA 2WV4A 4ABEA 1FPHH 3KHVA 1UTMA 1GMDF 3SBKA 3GYMA 1HYLA 3LIWA 2ZPSA 1VR1H 1YPHC 4E06H 1FJSA 2XNIA 2VWNA 1JXPA 1GHXH 4JK5A 1UTLM 2HPPH 1C2IA 2BM2A 1NU7B 1IHSH 2FYRA 1PPGE 5BPEA 2J95A 4X2VA 3MHWU 1KXBA 4IN2A 1V2KT 1PQ7A 3FAOA 1JIRA 2FZZA 3P70B 3P17H 2G81E 3RXMA 1A4WH 1DXPA 1OWDA 1XUJA 1W0ZU 2BVSH 1ZGIA 3EE0B 3MO6A 3P8OA 4DG4A 4J1YA 1K22H 4AFUA 3UWIA 2BLOA 3NWUA 2GGVB 1QGFA 5EQSA 3NCLA 3KF2A 4FVBA 3K6ZA 1P3EA 1TGCA 2PKAA 3QK1A 3V3MA 4ZHMU 2A2XH 2C8YB 4WMEA 1RXPA 2EC9H 1J9CH 4ABIA 4JZ1A 2GV7A 4I8HA 2PGQB 1D3QB 1F5KU 4X2YA 5A8ZA 2A5KA 3LGWA 1B0EA 2P59A 1AZZA 1TRMA 3LT3A 1JOUB 2ZHQH 1DT2A 3BTGE 5GWZA 1O30A 3SU3A 3I77A 4UFDH 3RXDA 3A83A 1GHBF 1GBHA 2O9QA 1FY8E 5T6GA 1ZSJA 3BTEE 2WUBA 4TY6A 1WCZA 1O2OA 2KAIA 2HALA 4NZQA 4CH2B 1BJVA 1L1NA 2ZKSA 3GCHB 2ODPA 3TH4H 1TX7A 3GY3A 1L1GA 1WAYB 1CA0C 1P2QA 1TBQH 1S0RA 2A4OA 2ZF0H 1S81A 2VIDA 4YESB 5EXLA 1TNKA 1AGJA 1HXEH 5EXNA 1EAXA 4Q7YA 4ZXXH 3SJ9A 2FTLE 1FZZA 2TGTA 4B74A 3U1IB 1C5WB 2QCYA 3ELAH 4X1NU 3KQEA 3VPKA 3RP2A 2W26A 1NFWA 1Q31A 2AGGX 1LHFH 1GCTB 1H8DH 3BSQA 3W95A 3T62A 3OSYA 1GMDG 2ZZUH 1TB6H 4BOHA 2H5DA 3RXGA 1VJAU 1QL9A 2FOMB 2XXLA 2O8TA 1C2EA 3Q3YA 5EW1H 3LGUA 2J92A 1J17T 2ZHDA 2EEKA 5T6FA 3PMAB 4RKOB 2I6SA 2PUQH 5H4IB 4BNRA 3TJNA 5FCKA 4FUGA 1NTPA 5A8YA 4UEHH 2Z7FE 1AN1E 3ZZ5A 4Q7ZA 2TGDA 1DM4B 1ZTJA 3PROA 1D4PB 1QFKH 4I8LA 1GG6B 1GMHF 1YLCA 3K2UA 1C5ZB 1F5LA 2OXSA 4GCHG 3RUOA 1QBNA 1QBOA 5AVDA 1GBBA 3DUXH 3O8DA 1HCGA 1J14A 2QF0A 1C2KA 1GI4A 1GHWH 1BQYA 1JIMA 1SFQB 1E0FD 5J4QA 1PJPA 2FLRH 3PMJA 1YM0A 2FP7B 1GBFA 5DG6A 1Z6EA 4ABJA 1AFQB 2LNCA 1O3NA 3GCOA 1XUHA 4NG9H 1ELDE 4ZROA 3RU4E 2PLXA 4WWYA 5CE1A 1GHBG 3ZZ8A 1C9PA 4NCYA 1C2FA 3KCGH 2B9LA 4ZH8A 4BAOB 2QGRA 5LPEA 5JBTA 3TU7H 1C5QA 5EQRA 3A89A 3SGQE 1RTKA 1H1BA 1TBZH 3ZZAA 4Z0KA 3G01A 1FY1A 5JDUB 1IQFA 2F9UA 1P04A 1LVYA 2OUAA 1IHTH 4Q2KA 2IJOB 2UUKB 1FUJA 3QTVH 2HVXA 2ESTE 3QO6A 3M5OA 1MD7A 1MH0A 1O2GH 2ZWLH 2ZTXA 5I46H 2ZEBA 2XBWA 3A7ZA 3GICB 4H42U 4I32A 1OKXA 1KDQA 3STIA 1ANEA 1TNJA 1VCWA 2ZDNA 2WPKS 3ZZDA 3E8LA 4AB9A 4CBOA 3RC6A 4UONA 4X8TH 1QRXA 3TJOA 3PLKA 1WQVH 1V2JT 4X6MA 1THRH 2ANMH 2H1UA 1AE5A 1S0QA 1P02A 1UTOA 2A7JA 3RXTA 1Y8TA 1C2JA 4NA8A 1AD8H 4WMDA 5E0GA 5FX5A 1DY8A 3S69A 2P3UB 3W94A 2Y5HA 3MOCA 1JMOH 1HJ9A 1MMJN 4NIXA 4H6TA 3RXRA 2RDLA 1UJ1A 3ZVFA 2TBSA 1D6RA 4AX9H 2GDEH 1XMNB 3FFGA 3NK8A 1GI9B 2GMTB 4X6OA 1B7XB