1C1SA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Recruiting Zn2+ to mediate potent, specific inhibition of serine proteases.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1sA02
1ANEA 1ZPCA 3NZIA 2XBVA 1PYTD 3T29A 1SOZA 3SZNA 1CT0E 4MVNA 3MWIU 1C5RA 1LDTT 1C2DA 2FEQH 1GBKA 1K9OE 3SBKA 2BX4A 5A0BA 3RLWH 2F9OA 1HAIH 2FOFA 1OYTH 1AHTH 3K2UA 1TYNA 2GDDA 3GY5A 1HYLA 1MD8A 1IHTH 3MU5A 3OY5U 3TJVA 4O3TA 2H2ZA 3RXAA 4K60A 2WYGA 1VITH 1ANDA 2Z3DA 5EXNA 1HAHH 4BANB 3SI4H 2J95A 1CT2E 1O3FA 3CS0A 9LPRA 1YPEH 2OBQA 4OGXA 4E7NA 4GAWA 4VGCC 2A2QH 2EI8A 2O8WA 2PUXB 2FDAA 3RUOA 2C8ZB 2XRCA 3SO3A 3MTYA 1MMJN 1BITA 1S0QA 2C4FH 2ILNA 2FYRA 5J4QA 2D2DA 3CP7A 1TBRH 3HKIB 1AUTC 3RXRA 1BTUA 1IQJA 1HXEH 1ID5H 3DA9B 3EA7A 1V2QT 3H7OA 2FOAA 3PO1C 1SGNE 3FP6E 1UVOA 2J38A 1D6RA 1B5GH 1PPGE 3BTKE 3S9BA 1EOJA 1TQ0B 1TPAE 2BOKA 3LH1A 1UVUH 2W7SA 5T6FA 2G81E 1W0ZU 2UWOA 2OUAA 1C9PA 1A5GH 4JCNA 3S69A 2V0BA 4JYTA 1Y3XA 3PO1B 5C1YA 2Y5FA 3ZYDA 2G4TA 3MH7A 4ISIH 1AMHA 1Z8GA 1XUHA 2ESTE 4Z6AH 5EW2H 2BY9X 2AGEX 4WMEA 1GMCF 4ISHH 2ZHDA 1DITH 2HNTF 4FUJA 1O3IA 2FOHA 2PR3A 3ATLA 1YPHC 1J15A 3BIVH 1FAXA 1S85A 3BTTE 3TNSA 3GCTF 3RXUA 3PMJA 2GTBA 2TGPZ 1PQAA 4JYVH 1KXAA 2QGRA 3SI3H 1UHBA 3M5NA 3GDVA 3BIUH 1O34A 4YESB 1MU8B 1W14U 3EA8A 1WAYB 1C5WB 1TNJA 1DUAA 2C8WB 3EYDA 4WMDA 1BMNH 2Y80A 4LXBH 3M61U 1TABE 4AGJA 1Y3YA 5F6MA 1XVOA 5HM9A 3UTUH 1GMDG 1TE0A 1SFIA 1AU8A 2FYQA 2ZGHA 1GMCG 3VPKA 3R0FA 5FBIA 3SQHE 3TJOA 4H42U 3GCNA 2BVXH 3M37A 1W12U 1TFXA 3KN2A 1GI8B 5FPYA 1HJAB 2BZ6H 2P94A 1BRBE 4IBLH 3GCTG 3STIA 2ALVA 2PWXA 1HLTH 1GBFA 2FM2A 1BA8B 5JYIA 3AAVA 5C5OA 1BMAA 4CRDA 1LPGB 1NRNH 5I25A 1EJAA 3TH3H 1FJSA 1NRQH 1EPTA 2YNBA 3UNQA 1HXFH 1V2OT 2Z94A 3A84A 3BEUA 2ZECA 1FZZA 2P3TB 3WY8A 1JBUH 4XOJA 2GZ7A 4NWKA 1KLIH 5BPEA 1UCYK 1NU7B 2Y82A 3SOSA 2BM2A 2C8XB 2G55A 1WUNH 2C8YB 4UFEH 2ANWA 1FPCH 4FVDA 2QXGA 3T26A 1H9LB 1GL0E 1KXBA 1C1PA 1NS3A 3MNXA 3QZRA 3LGWA 4Y8XA 1VITF 3FAOA 1MKXH 1O2YA 1FY8E 5L2ZH 1X7AC 3MNBA 2BLVA 4HTCH 1LVBA 4YT6H 1AZZA 1RTKA 1SLUB 4I8LA 3U1IB 2IN2A 3E0PB 3ELAH 1N6YA 1SG8B 4QT8C 1SGDE 4Y0YE 1GI5A 1THRH 1YC0A 2SGPE 3GY8A 2A4GA 1JWTA 4MNYA 3GCHB 5LPFA 1SB1H 2WPJS 3O8RA 4ABBA 2GDEH 1G36A 2FX4A 1OP8A 2ZFPH 1UK4A 1GI2A 2TPIZ 1BDAA 1OWJA 1GCDA 3BTDE 2A0QB 2QF0A 3EA9A 1GBTA 1O3DA 3ENSB 4NG9H 1D3PB 1VITG 1O2RA 1BJVA 1LHFH 2XWBI 4MLFB 1UHBB 1TMTH 2NU4E 2ZP0H 3BSQA 4K1EA 4Y8ZA 5ETXA 1GI7B 3RXJA 1CGIE 4Q7ZA 1VGCB 1PQ8A 3UQVA 1TB6H 3QN7A 1HV7A 4YM9A 1GJ4H 1DX5M 5A8XA 1LVOA 2CXVA 3PTNA 2B8OH 5AF9H 4RN6A 4ZMAH 1YCPM 3O8DA 1NU9A 5IYTA 1ZGVA 3LGUA 2F9NA 4NFFA 2O8LA 2ODPA 1F2SE 1LVYA 1C4U2 4HFPB 1GGDC 1IQHA 3A81A 2VH0A 1O2PA 2ZCKP 1AN1E 3AW0A 1DPOA 1XUFA 3QX5H 2GGVB 1GDQA 3VEQB 1CE5A 1P2NA 3SW2B 1GBLA 1V2WT 3A7VA 4DURA 1JRSA 1J17T 1DM4B 2V3OH 3E1XB 2FI3E 1KXCA 3SGBE 1S83A 2HOBA 3V7TA 4X1PU 4AFSA 4CRFA 1YPLH 3UOUA 2H6MA 1GVLA 1KTTB 1QBNA 3A7TA 2HPQH 3GYMA 1RFNA 1MU6B 1Y3WA 3MU8A 1RS0A 1C1VH 3SU6A 5JDUB 4ABDA 2ZCLP 5L2YH 2PKAA 3VXFH 1NFWA 1KLTA 1D9IA 1HIAB 4GPGA 1UTMA 1A5HA 3QTVH 3U1JB 1Z8RA 1MBMA 1O2WA 5FX5A 2PKSC 1HRTH 3VB5A 1T31A 2OD3B 3KQDA 4R8TB 3S0NA 4TWYA 1KXDA 1FAKH 1S6FA 2Y5HA 3RMNH 3GY7A 2D1JA 1GHXH 3RM0H 5TCAA 1A0HB 1SPJA 4WF8A 4IN2A 1P09A 3PV4A 1C1MA 1KY9A 2PKSB 3LJOA 4LZ4B 2FPZA 1P3CA 1QB1A 3UR9A 1C1NA 1CA8B 4Q7XA 2ZF0H 2WYJA 1NRRH 2QYIA 1O2MA 1QY6A 3SHAH 1SGYE 1LMWB 5F8XA 2QCYA 3GOVB 1QJ7B 4F49A 1OX1A 3SORA 4BXSA 2ZU3A 2THFB 3RC5A 2Z9LA 2ZGXH 4FU7A 2GD4B 1CO7E 2QXIA 1GCTB 1Z71A 5PTPA 4BAQB 1C5NH 1FY3A 2VIPA 3S9CA 1C5ZB 3PM3A 4TY7A 2A32A 1C5MD 1LVMA 2A45B 1UVPA 1BBRE 4Y71A 1Q2WA 1O33A 2OQ5A 5GIBA 1E36B 1FXYA 1UTOA 1WQVH 2Q6DA 1GHWH 3LKWA 3ZVFA 1LPZB 1ZYOA 1OOKB 6LPRA 1LQDB 4DIHH 2C93B 3M7QA 2AMQA 1C2EA 1PPEE 2QC2A 3KGPA 3A83A 2JH6D 1O5CB 1VCQA 2ZO3H 4H6SB 3ZZ3A 1C5OH 4ZKOU 1SGPE 4THNH 4J2YB 1E38B 3KF2A 2ZPQA 1DXPA 3BTFE 3MO6A 3ITIA 2M5TA 1GI6A 3BN9A 4BAMB 3PWCA 3JZ2B 1QHRB 1UMAH 3ZZ7A 4ABAA 1ELFA 1RJXB 4HI3A 4X6PA 2H9HA 4JMYA 2SNWA 1O2IA 1DLEA 3A80A 2XNIA 3NPSA 1P05A 2TIOA 1N1LA 7KMEH 3P6ZB 4AG2A 1XUGA 5JB8S 2BZAA 1O2OA 1O2UA 1TALA 1W2KH 2ZDAH 2OXSA 2DUCA 2UUYA 2PKAB 2H5DA 3T2NA 3VB7A 1O3HA 3RXOA 3MO3A 1D4PB 1EXFA 1WBGB 4FXGH 2BQWB 1IQFA 1O5DH 2RDLA 1A3BH 1LQEA 1C5XB 2FS8A 2BOHB 2W7UA 4E05H 1C2KA 4ZXYH 1BCUH 1MQ5A 2R2WU 1P02A 2ZPRA 2G5NA 1N8OC 2FIRH 2CMYA 2WPHS 5CMXH 1EKBB 4BTUB 1SOTA 1LPKB 1QJ1B 3TK9A 1P57B 2BVRH 4D76A 2ZFSA 2XC0A 3AVZA 3ZZ5A 2FOGA 2GT7A 2V3HH 2WUCA 4OS1A 3B8JA 4WXIA 2IJOB 4ZH8A 2XC5A 3CENA 4XBCA 1KDQA 1V2MT 1TNLA 1XX9A 5JBBS 3UREA 2A4RA 2VIOA 3TIUA 1GVKB 4ZKRU 4SGBE 3C27B 2OC8A 1F5LA 1K1IA 1K22H 1D3QB 2ZIQH 4NGAH 3E91A 3HK6B 4SGAE 3RLYH 1L4ZA 1ZJKA 3TJUA 1ACBE 1YPJH 2C90B 3SV8A 1AVGH 1XXDA 1LCYA 3NCLA 2BQ6B 4WY3A 2OC0A 2F9BH 3P95A 1Y59T 5B6OA 2BX3A 4X1NU 1MCVA 1OP2A 4DW2U 2BDIA 1S81A 3RXBA 1XUIA 1G3BA 1C5LH 2CN0H 1ETSH 1V2LT 4XBBA 1HAOH 2TGTA 2RCEA 3SGAE 2XW9A 2XCFA 3HGNA 4CRAA 1PJPA 1EAWA 1SGFA 1S0RA 3BF6H 4ZKNU 3LC5A 1ABIH 3MU0A 2FP7B 3LJJA 5E2PA 1LHDH 4U2WA 1C5SA 1O2SA 4NFEA 4FUHA 2IOTA 4X0WU 4ZAEA 2PFEA 4UD9H 1O3JA 4WJG2 4A5TS 1O5GH 1H8IH 2WPLS 3BTME 2NU0E 4MPWA 1ESAA 2ZU2A 1L1GA 1BQYA 3Q3YA 1Z7KA 4GUXA 3OTJE 1TNIA 1TPPA 2GVFA 1XUKA 1XM1A 4FUDA 3VB4A 3H7TA 1IQIA 3M5MA 2QIQA 1UK3A 1ELDE 3D65E 2A31A 1BBRH 1YM0A 3EDXB 1DFPA 1BTWA 1K1NA 4AZ2B 3MU4A 3CS7A 3BEIB 3K65B 2K1QA 1E34B 4AG1A 2Y7XA 4H6TA 5DP7A 2UUFB 3ZVBA 2FX6A 1D3TB 3N7OA 1BMLA 3PB1E 1YCPH 2BY7X 1IQGA 1DSUA 3PLBA 5A09A 1GDUA 1CGJE 1V2NT 1P01A 1V3XA 3I29A 3UWIA 1Y5AT 1CBWC 2VJ1A 3MYWA 3A7WA 5AFYH 5FPSA 4DGJA 5BRRE 1C1UH 1ELVA 1BOQA 4B71A 2HGTH 3P92A 4IS5A 1GHYH 2UUJB 1B0FA 1GI1A 1C1QA 3RXEA 5AHGH 1DWDH 2Y7ZA 3DFLA 3ZVAA 2HLCA 1CBWB 3SUGA 2F91A 2QA9E 1UTKA 1TGSZ 4DT7B 1C5PA 1PQ5A 1P2KA 4GSOA 1O2JA 2QXHA 4X1RU 1E0FD 1EAIA 2XCNA 1NROH 3GY4A 3HKJB 3SU1A 1MBQA 2ZU1A 5DP6A 1UCYE 1SLXB 1Z6EA 2SGEE 3SUFA 3RXHA 1Q31A 2F9UA 1A3EH 1SQOA 4I7YH 1JRTA 1C2JA 1L1NA 2Y6TA 4JZIA 3AAUA 3KL6A 4FUGA 3P8NA 4KGAA 1E37B 1GBBA 3U8RH 1TONA 1C1WH 4JZEH 2XC4A 3ZZ8A 2AYWA 1ZRBA 2BD9A 1TBQH 1AFQC 3KEEA 2JETC 2ALPA 1O2ZA 3TH2H 4CH2B 3W95A 1ZTLA 1MTNB 4X8VH 1IHSH 5FXLA 1O3OA 1TOMH 3ZVEA 1TA6A 1SHYA 3TJNA 1OWHA 3T27A 4ISNA 1FNIA 2ZDKA 3RU4T 1ELGA 4ABGA 1DWEH 5EG4A 3Q77A 1AFQB 3LGVA 5E0HA 5HYOA 2JETB 3VGCB 1GWAA 1P9SA 4A92A 1GHBF 2J2UA 3SV2H 2BDGA 1Q3XA 2PV9B 3M36A 2BLQA 4YLQH 3BTGE 4K8YA 4Y7BA 4O03A 4BTIB 1Y5BT 2DE9A 4LK4A 1EZSC 3ODFA 1ZHRA 3E16B 2WPKS 1Y5UT 1EAXA 1AIXH 3P70B 5A8YA 3L3TA 1HJAC 2G4UA 4AFZA 2PSXA 2FZZA 2AMPA 1ZOMA 1T4VH 2V6NA 2PW8H 1JMOH 4MDSA 5ESBA 2XBWA 3SJIA 1OP0A 3GDUA 1AI8H 2Z9JA 1P10A 5DG6A 2ZDVH 2EI6A 3UIRA 1FLEE 4A1VA 2ZG0H 3ZYEA 1GHBG 3E3TA 3KCGH 2TGAA 3K9XB 2NU3E 1MKWK 1ZPBA 3A88A 3D23A 2I6QA 1BZXE 3ATIA 1ARCA 1QB9A 2ANYA 1OS8A 4I31A 4YO9A 1TBZH 1AQ7A 1BMMH 2A2XH 1NRSH 1SLVB 8ESTE 1DWBH 2HNTC 4ESTE 1GVZA 3E8LA 2D8WA 1YP9A 3KQCA 4X2YA 1GBMA 5C3NA 1O3AA 2ZU4A 4KELA 1GI4A 2BD8A 1BRAA 4CH8B 1T8NA 4UE7H 2R2MB 1MTSA 1EASA 5EQSA 4D9QA 1QL8A 2BD7A 4YTAA 2G51A 2BXTH 3MH5A 2XBYA 3LONA 4IW4E 1GBIA 1ZLRA 3C1KA 5T3HA 2PTNA 4ISOA 4LZ1H 4XBDA 2R0KA 4IGDA 5J4SA 4FVBA 3SJ9A 2ASUB 1GJDB 1TGBA 3RU4E 3GCHC 1ZMLA 5EPNA 4AYYB 1UTLM 1AGJA 1OKXA 2VIDA 4X8UH 3QUMP 4AGKA 1OWIA 1QL9A 1S82A 4IMZA 3SV7A 1V2JT 2TGDA 4ZHMU 2G52A 1BB0B 2RA0A 5E0JA 5EQQA 4ZUHA 5LH8A 1QR3E 2BD2A 5F8TA 2ZNKH 2EI7A 5EXLA 3F9HA 4OS2A 3RXKA 2XTTB 1SGQE 1MCTA 2R9PA 5L30H 5ABWA 4JYUH 2P95A 2JH5D 2FOCA 1VGCC 5EPYA 1EZXC 1H1BA 2CGAA 1AKSA 1H9IE 1JIMA 5DO4H 6CHAB 1PPBH 2CV3A 2BYAX 4AB8A 1TNKA 1A2CH 2Z7FE 3GY6A 3SQEE 4AN7A 2VWMA 5A8ZA 3JZ1B 4K69A 1EUFA 1WQSA 1G2LA 2R3UA 4IMQA 1ZZZA 1UCYH 4KKDA 2BB4A 3QLPH 2SGFE 1W7GH 3MNCA 1BT7A 1GHAF 2BDAA 1Y3UA 4FUIA 3TVJB 1AE8H 1OWKA 1V2ST 1HAZB 1QL7A 2BDCA 1WTHD 2ZWLH 4WH6A 2ODQA 2OC7A 2ODYB 1SGEE 1UVTH 1UJ1A 2SFAA 1PQ7A 5AVDA 1A4WH 3GY2A 3FZDA 1F7ZA 2ZZUH 1NT1A 1O3LA 1QRWA 3I77A 1FMGA 2UUKB 1GG6C 1A7SA 2EEKA 1CGHA 1EPTC 1HAVA 1D6WA 1FUJA 1AY6H 2CHAC 1XMNB 3A8DA 5EW1H 5DGJA 4DIIH 1NM6A 3S9AA 1TNGA 3ZV9A 2A7JA 1C4Y2 3QK1A 1GPZA 4GHTA 3DHKH 2BDHA 4CHAB 1GG6B 2BY5X 4UEHH 1P11E 3GISB 1EPTB 4NIWA 2CHAB 1TRNA 4Y0ZE 3LOXA 2RG3A 2AS9A 3VFEA 5DKMA 5CHAB 5TJXA 2VGCC 3BTQE 2H9EH 1YF4A 3ZVDA 2ZI2H 1XUJA 4AX9H 1W11U 3A82A 3NWUA 1HPGA 4M7GA 4GVUA 1S5SA 2VGCB 3E6PH 3SU2A 1YBWA 2FS9A 4DY7B 5A2MH 3BG8A 4YZUA 2HPPH 2VVUA 2YNAA 1SBWA 4BAKB 5FX6A 1EOLA 3F6UH 3RM2H 1L2EA 3IITA 3T5FH 1F0TA 1TGNA 3PLKA 3U8TH 1TQ7B 2P16A 3RXPA 1SGCA 1YLDA 4KTUA 1GCTC 4MNXA 1LHCH 3M35A 1Y3VA 4YLUA 1BTYA 3MU1A 4O9VA 4JZDH 3U9AH 1AVXA 3V12A 3ESTA 2WPMS 2OLGA 3F68H 5DP5A 4NIVA 1C1RA 4NSYA 4X8TH 1KXFA 4Y7AA 1QJ6B 5FBEA 1P03A 1FV9A 4O97A 3SU3A 2PGQB 3SU5A 4ASHA 3ZZ4A 3UQOA 1VCPA 2IPHA 4JZ1A 4PROA 1K2I1 1NO9H 2YOLA 2STAE 1EX3A 2ZGJA 4MG3A 3RXTA 3V0XA 5LPEA 5JBAS 1F92A 1DXWA 5FCKA 4DOQA 4X2XA 1Y8TA 4CBOA 1P9UA 1CU1A 3HATH 2O8UA 1RD3B 4O3UA 3MHWU 4OS4A 2A7HA 4MPUA 3F9EA 4B73A 2ZTXA 2A4QA 1YGCH 2ZA5A 1EJNA 1TOCB 3ATKA 4I8GA 4ABEA 5A0AE 1J8AA 1MQ6A 1ZHMA 2R3YA 2Q6GA 1P2JA 1P2IA 3EE0B 1BHXF 4NA7A 3ODDA 2W3KA 2FMJA 2P93A 3M3SA 1HAVB 4FUEA 1SI5H 2GCTB 4WMFA 2AGIX 3BEFB 5DP4A 4AOQA 4X1SU 1YYY1 1FN6A 4CRCA 2XBXA 3SHCH 1QFKH 1QURH 1H9HE 3QZQA 2GZ8A 1GI3A 2R0LA 3TNTA 3VXEH 1GJ6A 1WCZA 3A7ZA 2QF3A 1O39A 1O2KA 1VJ9U 3STJA 3A8AA 4A1TA 1GJBB 3RXDA 1RTFB 1G32B 3Q76A 1TX6A 2QN5T 4JZFH 1PPCE 1KTSB 1V2VT 2FWWA 3FP8E 1K1JA 4X6OA 3TGIE 2PLXA 3A7XA 2VVVA 1C5UA 3RMMH 3RXMA 2AH4X 5HMAA 1J14A 4A6LA 1ZR0A 1TLDA 3SNEA 2B5TB 3RC6A 1K1MA 2EA3A 2LNCA 1C1TA 1CT4E 3L33A 5GJ4B 2NU2E 3FZZA 1MTWA 1GJ8B 1V2RT 2BLOA 1ELCA 2FESH 2FI5E 4I8HA 1ELAA 1GBCA 1DY8A 1C2FA 3KQEA 4FUFA 5G4BA 1UTQA 3RP2A 1PFXC 5AFZH 1TX8A 4K3JA 2AERH 2ZGBH 1AUJA 1O3PB 1ZMNA 4I32A 4D7GA 4U01A 4D7FA 4JK5A 4B2AA 4MQAA 1EZQA 5E0GA 1OWDA 3PWBA 4MNVA 2GV6A 2SGAA 1CQQA 3BTWE 3PLPA 1O38A 2Y5GA 1C1SA 4NIYA 1TMUH 4INLA 1IQNA 4Q2KA 5E8EH 3SNDA 4DCDA 1BHXB 2W5EA 1O2HA 1DOJA 4XFQA 1XKBC 2ANMH 4CBNA 1PPHE 1GBAA 1H8DH 4Y79A 1O5EH 5C1XA 2D26C 1QB6A 1F5KU 4GCHF 2PSYA 2FOEA 4D8NA 2WV5A 2BTCE 5LGOA 3GDSA 1V2KT 1P06A 1SMFE 1QRZA 1C2LA 1LO6A 4DVAU 1DUEA 1O31A 1UO6A 4INKA 4MPVA 2ZHFH 1TRMA 5GWZA 1C2HA 1P3EA 3P8OA 5F03A 2LPRA 1DVAH 1ZSKA 4Z0KA 2ANKH 1TNHA 3B9FH 4K8BA 1AO5A 1B0EA 2ZC9H 4I8JA 3W94A 1O3MA 3Q00A 3TK5A 2AGGX 2QV1A 1UVSH 3EGKH 2VH6A 1SQAA 4NA8A 1TGTA 2VWOA 4B1TA 7GCHF 5L6NH 3MO9A 1GJCB 1CVWH 1LKBA 1Z1IA 2ZTZA 4MNWA 1ELEE 1O2LA 3SNCA 2F3CE 1KXEA 4Y76A 1HDTH 4UFFH 3UOPA 5EOKA 1GI9B 2B9LA 3IG6B 4D9RA 3LIWA 1LHGH 2ZFFH 3NUMA 1THSH 3RXFA 2QXJA 4AFQA 3M7UA 4HGCA 2ZKSA 5DP3A 1UTPA 7LPRA 2AEIH 4ZHLU 3V13A 3FANA 3ZV8A 5HXFA 1AFEH 8LPRA 1WOFA 1P8VC 3A87A 1PPZA 2J4IA 5SGAE 1AD8H 3KIDU 5C67A 5K7RA 1SC8U 3DD2H 7GCHG 2ZQ2A 3ZZ6A 1MZDA 2P8OC 1F0UA 3KNXA 1WYKA 1DDJA 5DJ7A 1CA0C 2UWLA 1EB2A 1VZQH 2J94A 2BMGB 4X6MA 2EC9H 1GMHF 1J16A 2GMTC 1AB9B 2O8TA 2O8MA 1SGFG 1O2TA 1O5AB 1QA7A 3FP7E 1KDQB 2VWNA 2P8OB 2FOMB 3NK8A 1TPOA 5DPAA 1TAWA 1GJ7B 1CA0B 3TITA 3GCOA 3B23B 3RXSA 5DP9A 4U30A 1K1LA 4JK6A 3TU7H 1ESBA 1FIZA 1BRCE 2OTVA 2GMTB 1O2XA 1MAXA 3AW1A 3MH4A 3TLOA 4BOHA 3ZZCA 5ESTE 3D49H 1ZSJA 4FU9A 2Y81A 3UUZA 1YLCA 2A5IA 3KQBA 1THPB 2SNVA 1P0SH 1P04A 2OC1A 1BTXA 2OCVB 1MTNC 2PTCE 2Z3EA 1K1OA 3SV6A 4FUBA 1IQEA 2ZHWH 3M3VA 1GMHG 4MPXA 1IAUA 2XYAA 3LU9B 3DT0H 1K21H 2BHGA 4VGCB 4E06H 1V6DA 1RIWC 3URCA 4Q7YA 3VGCC 4WXVA 4I33A 1HBTH 1ESTA 2GX4A 1C2IA 1FQ3A 3RMOH 1B7XB 4INHA 1OYQA 1GL1A 1F0SA 1EQ9A 1PPFE 3A89A 1ZPZA 1GBDA 4YOGA 4DJZB 2C3SA 1ANCA 1RIWB 1AZ8A 1AE5A 4CR5A 2ZU5A 4B75A 1BIOA 2GCHF 1HAXB 5FHTA 2GZ9A 1BRUP 1FDPA 1W13U 1GMDF 4XSKU 1A1RA 1V2PT 2RA3A 2GKVE 1TPSA 1C5QA 1INCA 1SLWB 1DICA 1Z6JH 1OPHB 1TA2A 2BD3A 3L6PA 4A7IB 5DP8A 1GBHA 2ZGCA 2Z6BD 2ZFTA 1NFXA 1SQTA 2VB0A 3NXPA 2VWLA 3TGKE 3GY3A 1BJUA 3SU0A 1HAGE 1XXFA 2WINI 8KME2 2SGQE 4I8KA 4Y6DA 1G9IE 3H5CB 2I6SA 4UDWH 1FY5A 3P17H 3F9FA 1S6HA 1M9UA 2XWAA 3HGPA 5EU8A 5EQRA 3A86A 5T6GA 2GCHG 1MKXK 4HZHA 1DWCH 3HPTB 2PHBA 4BXWA 1G3EA 3RXCA 4TWWA 3QGNB 2GT8A 6ESTA 2ZDMA 1ETRH 1EJMA 1SL3A 1Z8IB 2A5KA 2G5VA 1QTFA 2F83A 4X2WA 3P8GA 1NFYA 2OP9A 1C9TA 2Z9IA 3LC3A 1PYTC 3S7KB 2Z9GA 1K1PA 3NKKA 1IQLA 4GHQA 3URDA 2FI4E 1FPHH 3QGJA 2W26A 1HAYB 1O35A 4AFUA 1VCWA 2P3UB 1BTZA 3RXIA 1MTVA 1O2QA 3M7TA 4BNRA 1A46H 1BUIA 3V3MA 4ABHA 1U6QA 2FO9A 3UWJH 3T28A 1RXPA 1KLJH 2B0FA 1RTLA 2KAIA 4OGYA 4WH8A 1C1OA 2VIQA 4OS7A 3E0NB 3DUXH 9ESTA 4FUCA 1ELTA 1ZRKA 2AFQB 4ZROA 4Q80A 1O3KA 4UFGH 1UTJA 1S84A 3RMLH 3PTBA 1JIRA 1HIAA 2Q6FA 1G3CA 4IC5A 3UR6A 1IQMA 3PMAB 5C5NA 4Y8YA 1KSNA 2P3FH 1FI8A 3SJ8A 1HB0B 3QWCH 6CHAC 3RXVA 1MKWH 1RRKA 1SR5C 5EGMA 5C2ZA 1DS2E 1EP5A 4X2VA 2F9PA 3PMHB 1T8MA 2VINA 1A0JA 1O2VA 1ZHPA 4UONA 1P12E 1W3CA 2BLWA 2XXLA 2GV7A 3F9GA 3M5OA 3TGJE 4ABJA 3PYHA 2BY8X 3TH4H 3E90B 1NTPA 1BTPA 4TY6A 1MD7A 3BV9B 4X8SH 5K0HA 4NZLA 4K1SA 4U32A 1WTGH 2WV4A 1DT2A 2FXRA 3U69H 3VB3A 2O9QA 1EAUA 1O2NA 2F9VA 5DK1A 1LKAA 2JH0D 1P2QA 1ELBA 3A85A 3F1SB 4BTTB 2HRVA 1ZTKA 3SUDA 1HCGA 1F5RA 1CHGA 3U98H 3PMBB 1IQKA 1O3BA 1NZQH 3T25A 2ZQ1A 3UNSA 1NPMA 4CRGA 1JXPA 2ZHEH 1NRPH 2VU8E 3BTHE 2CJIA 1YPHE 4BAHB 3LGTA 2PGBB 2QAAA 4YT7H 4R0IA 4CHAC 1QIXB 5JB9S 1DE7H 1G37A 2NU1E 1H4WA 3SU4A 1XVMA 2GP9B 3SN8A 1ZSLA 3FFGA 2AMDA 3OU0A 1YPGH 2J9NA 4YOJA 1HAPH 4ABIA 5CHAC 1NY22 1TGCA 1WV7H 4BAOB 4CRBA 1GHAG 1EP6A 3LGIA 3QTOH 2ZPSA 3M5LA 1J9CH 3OY6U 5IDKA 4Y10E 1MUEB 1A5IA 1T32A 2HALA 1QQUA 1TIOA 3ZVGA 2ZDNA 1DY9A 1UK2A 2FTMA 3OYPA 5EODA 1ANBA 3KHVA 4ZKSU 4B2BA 4WVPE 5JBCS 2UWPA 1GHVH 1GGDB 1ETTH 4ZHAA 5C1UA 1DSTA 1RGQA 1LHEH 2WUBA 1C2MA 2ZHQH 2KAIB 1O3CA 1TX7A 1O3GA 1T4UH 1A0LA 3BTEE 1O5FH 3SNBA 1DLKB 2J92A 2VNTA 2HWLB 4OS5A 3ZZAA 3ZZ9A 1NFUA 3TPIZ 4B74A 2BDYA 2HNTE 3U8OH 1AVWA 4A1XA 1L4DA 3O8BA 7ESTE 1C4V2 5GXPA 5FAHA 3S7HB 2SGDE 1WSSH 1T7CA 4TPIZ 5GCHF 1SHHB 1C5YB 3FVFB 1G2MA 1GHZA 3LH3A 1C5VA 3R3GB 3VB6A 2W3IA 4TYDA 4KTCA 5LPRA 1AKSB 4CREA 1T8LA 4MTBA 4Y11E 1QBOA 1QBVH 2FTLE 1FY1A 2BDBA 4LOYH 3RDZA 2V35A 3I78A 1SGRE 5FCRA 3G01A 1KYNA 1JOUB 4GLYA 1HJ9A 1GBEA 2FOBA 3HK3B 2A7CA 4WWYA 3LGYA 3RXGA 1E35B 5EXMA 2BD4A 1QGFA 2CF8H 1ABJH 1D3DB 1QRXA 3EQ0H 3TK6A 1OSSA 5GCHG 2ZDLA 1UTNA 2ZTYA 3A8BA 1MAYA 2JKHA 1QQ4A 1MTUA 2GCTC 5A0CA 1W10U 1HNEE 1QA0A 2BVSH 1ZJDA 4K2YA 1QNJA 1O32A 1GJ5H 3O8CA 1OWEA 2QY0B 3Q3KA 1W0YH 1O0DH 1W7XH 2OINA 4K5ZA 8GCHF 1GDNA 3UFAA 1CHOF 1BTHH 1GBJA 3QO6A 1XKAC 3MNSA 3ZZBA 3SJKA 3UNRA 2STBE 3OSYA 4H4FA 3GICB 1TMBH 2AIQA 1F0RA 1SSXA 4J1YA 4XE4A 2BD5A 3MMGA 5H4IB 1VR1H 1NN6A 2G00A 1GJ9B 2VVCA 2PUQH 4FU8A 1G3DA 5CE1A 1SFQB 1GJAB 2ZFRH 2H9TH 5C20A 5E2OA 4DG4A 3A7YA 2ZFQH 5GPIB 2BXUH 8GCHG 1SGIB 1CSOE 1MH0A 2VIVA 3P8FA 1CHOG 5JBTA 1Z1JA 1HGTH 4NA9H 2ULLA 4AYVB 1O36A 3IWMA 2OQUA 5GDSH 3SUEA 3A8CA 5HGGA 3RXLA 2Q1JA 4F4OC 2Z3CA 3PROA 1C2GA 2H1UA 1K28D 1V2UT 3SV9A 1FIWA 1NESE 4TPYA 2ZEBA 3K6YA 4XDEA 3SGQE 3UY9A 1HUTH 1FONA 1IOEA 1HJ8A 3MI4A 1P2OA 4KP0A 4K1TA 2B7DH 1GI0A 1YPKH 3RU4D 4E7RG 1ZGIA 5JPMH 6GCHF 2A5AA 2WPIS 1T8OA 1O2GH 4X6NA 1L1JA 1A61H 2AIPA 2HVXA 4KTSA 2J34A 1O3NA 1Z8JB 4B2CA 2Z9KA 1W8BH 1L0ZA 2BY6X 1WU1A 1EZUC 2DE8A 3ATWA 3LPRA 4UFDH 4RSPA 1N8OB 2FLBH 2TRMA 1ARBA 1O3EA 3ZVCA 3D62A 2TBSA 1EATA 5I46H 4AORA 1SGTA 1BBRK 2OBOA 1AWHB 2FODA 5T6DA 5F8ZA 2FLRH 1ZTJA 4RKOB 3M3TA 6GCHG 3SJOA 1OXGA 3RC4A 4OS6A 1SVPA 1YPMH 3LT3A 3AASA 3T62A 2NWNA 1ZMJA 4YOIA 3MFJA 3MH6A 4B76A 1V2TT 1TRYA 1VJAU 3OX7U 4RKJB 1YCPK 3UPEA 1LTOA 2BQ7B 1KIGH 5HM2A 1HFDA 1N6XA 2H5CA 1G30B 2CF9H 1MZAA 4X1QU 4IN1A 4ZXXH 1O5BB 4NWLA 4GCHG 3LDXH 4ABFA 3K6ZA 3RXQA 2A1DB 3EAJA 1FY4A 1TWXB 3Q3XA 1NC6A 1AWFH 1ORFA 2A4OA 3BG4C 2P59A 3GYLB 5TCCA 1C5TA 3MOCA 3QDZB 4ISLA 5FPTA 1O37A 1P2MA 3ATMA 2ZCHP 3DFJA 4AB9A 4NSVA 4NZQA 3BG4B 1FN8A 4NCYA 4IC6A 1O30A 2VIWA 2G8TA 3SNAA 1AB9C 4CR9A 1EB1H 1YKTA 1DANH 1QCPA 4NIXA 3ZZDA
chains in the Genus database with same CATH superfamily
1ANEA 1ZPCA 3NZIA 2XBVA 1PYTD 3T29A 1SOZA 3SZNA 1CT0E 4MVNA 3MWIU 1C5RA 1LDTT 1C2DA 2FEQH 1GBKA 1K9OE 1H8ED 3U28C 3SBKA 2BX4A 5A0BA 3RLWH 2F9OA 1HAIH 2FOFA 2HLDD 1OYTH 2F4LA 1AHTH 4TT3D 3K2UA 1TYNA 2GDDA 3GY5A 1HYLA 1MD8A 1IHTH 3MU5A 3OY5U 3TJVA 4O3TA 2H2ZA 3RXAA 4K60A 2WYGA 1VITH 1ANDA 2Z3DA 5EXNA 5DN6D 1HAHH 4BANB 3SI4H 2J95A 1CT2E 1O3FA 3CS0A 9LPRA 1YPEH 2OBQA 4OGXA 4E7NA 4GAWA 4VGCC 2A2QH 2EI8A 2O8WA 2PUXB 2FDAA 3RUOA 2C8ZB 2XRCA 3SO3A 3MTYA 1MMJN 1BITA 1S0QA 2C4FH 2ILNA 2FYRA 5J4QA 2D2DA 3CP7A 1TBRH 3HKIB 1AUTC 3RXRA 1BTUA 1IQJA 1HXEH 1ID5H 3DA9B 3EA7A 1V2QT 3H7OA 2FOAA 3PO1C 1SGNE 3FP6E 1UVOA 2J38A 1D6RA 3F0PA 1B5GH 1PPGE 3BTKE 2M2AA 3S9BA 1EOJA 1TQ0B 3VG8A 5C0UA 1TPAE 2BOKA 3LH1A 1UVUH 2W7SA 5T6FA 2G81E 1W0ZU 2UWOA 2OUAA 2YMSC 1C9PA 1A5GH 4JCNA 5IK2D 3S69A 2V0BA 4JYTA 2RFKC 1Y3XA 3PO1B 5C1YA 2XNDD 2Y5FA 3ZYDA 2G4TA 3MH7A 4ISIH 3UAIC 1AMHA 1Z8GA 1XUHA 2ESTE 4Z6AH 5EW2H 2BY9X 2AGEX 4WMEA 1GMCF 4ISHH 4FOUC 2ZHDA 1DITH 2HNTF 4FUJA 1O3IA 2FOHA 2PR3A 3ATLA 1YPHC 1J15A 3BIVH 1FAXA 1S85A 3BTTE 3TNSA 3GCTF 3RXUA 3PMJA 1OHHD 1EFRD 2GTBA 2TGPZ 1COWD 1PQAA 4JYVH 1KXAA 2QGRA 4DT4A 3SI3H 1UHBA 3M5NA 3GDVA 3BIUH 1O34A 4YESB 1MU8B 1W14U 3EA8A 1WAYB 1C5WB 1TNJA 1DUAA 2C8WB 3EYDA 4WMDA 1SQRA 1BMNH 2Y80A 4LXBH 3M61U 1TABE 4AGJA 1Y3YA 5F6MA 1XVOA 5HM9A 3UTUH 1GMDG 1TE0A 1SFIA 1AU8A 2FYQA 2ZGHA 1GMCG 3VPKA 3R0FA 5FBIA 3SQHE 3TJOA 4H42U 3GCNA 2BVXH 3M37A 1W12U 1TFXA 3KN2A 1GI8B 4I86A 5FPYA 1HJAB 2BZ6H 2P94A 1BRBE 3OFND 4IBLH 3GCTG 2WV9A 3STIA 2ALVA 2PWXA 1HLTH 1GBFA 2FM2A 1BA8B 5JYIA 3AAVA 5C5OA 3KYGA 1BMAA 4CRDA 1LPGB 1NRNH 5I25A 3EE7A 1EJAA 2WPDD 3TH3H 1FJSA 1NRQH 1EPTA 2YNBA 3UNQA 1HXFH 1V2OT 2Z94A 3A84A 3BEUA 2ZECA 1FZZA 2P3TB 3WY8A 1JBUH 4XOJA 2GZ7A 4NWKA 1KLIH 5BPEA 1UCYK 1NU7B 2Y82A 3SOSA 5C94A 2BM2A 2C8XB 2G55A 1WUNH 2C8YB 4UFEH 2ANWA 1FPCH 4FVDA 2QXGA 3T26A 1H9LB 1GL0E 1KXBA 1C1PA 1NS3A 4ACBA 3MNXA 3QZRA 3LGWA 4Y8XA 1VITF 3FAOA 1MKXH 1O2YA 1FY8E 5L2ZH 1X7AC 3MNBA 2BLVA 4HTCH 1LVBA 4YT6H 1AZZA 1RTKA 1SLUB 3NRLA 4I8LA 3U1IB 2IN2A 3E0PB 3ELAH 1N6YA 1SG8B 5DSFA 4QT8C 1SGDE 4Q63A 4Y0YE 1GI5A 1THRH 1YC0A 2SGPE 1YY3A 3GY8A 2A4GA 1JWTA 4MNYA 3GCHB 5LPFA 1SB1H 3PRDA 2WPJS 3O8RA 4ABBA 2GDEH 1G36A 2FX4A 1OP8A 2ZFPH 1UK4A 1GI2A 2TPIZ 1BDAA 1OWJA 1GCDA 3BTDE 2J97A 2A0QB 2QF0A 3EA9A 1GBTA 1O3DA 3ENSB 4NG9H 1D3PB 1VITG 1O2RA 1BJVA 1LHFH 2XWBI 4MLFB 1UHBB 1TMTH 2NU4E 2ZP0H 3BSQA 4K1EA 4Y8ZA 5ETXA 1GI7B 3RXJA 1CGIE 4Q7ZA 1VGCB 1PQ8A 3UQVA 1TB6H 3QN7A 1HV7A 4YM9A 1GJ4H 1DX5M 2L6OA 5A8XA 1LVOA 3UB0A 2CXVA 3PTNA 2B8OH 5AF9H 4RN6A 4ZMAH 1YCPM 3O8DA 1NU9A 5IYTA 1ZGVA 3LGUA 2F9NA 4NFFA 2O8LA 2ODPA 1F2SE 1LVYA 1C4U2 4HFPB 1GGDC 1IQHA 3A81A 2VH0A 1O2PA 2ZCKP 1AN1E 3AW0A 1DPOA 1XUFA 3QX5H 2GGVB 1GDQA 3VEQB 1CE5A 1P2NA 3SW2B 1GBLA 1V2WT 3A7VA 4DURA 1JRSA 1J17T 1DM4B 2V3OH 3E1XB 2FI3E 1KXCA 3SGBE 1S83A 2HOBA 3V7TA 4X1PU 4AFSA 4CRFA 1YPLH 3UOUA 2H6MA 1GVLA 1KTTB 2EY4C 1QBNA 3A7TA 2HPQH 3GYMA 1RFNA 1MU6B 1Y3WA 3MU8A 5EJZA 1RS0A 1C1VH 3SU6A 4RT1A 5JDUB 4ABDA 2ZCLP 5L2YH 2PKAA 3VXFH 1NFWA 1KLTA 1D9IA 1HIAB 4GPGA 1UTMA 1A5HA 3QTVH 3U1JB 1Z8RA 1MBMA 1O2WA 5FX5A 2PKSC 1HRTH 3VB5A 1T31A 2OD3B 3KQDA 4R8TB 3S0NA 4TWYA 1KXDA 1FAKH 1S6FA 2Y5HA 2KR7A 3RMNH 3GY7A 2D1JA 1GHXH 3RM0H 5TCAA 1A0HB 1SPJA 4WF8A 4IN2A 1P09A 3PV4A 1C1MA 1KY9A 2PKSB 3LJOA 4LZ4B 2FPZA 1P3CA 1QB1A 3UR9A 1C1NA 1CA8B 4Q7XA 2ZF0H 2WYJA 1NRRH 2QYIA 1O2MA 1QY6A 3SHAH 1SGYE 1LMWB 5F8XA 2QCYA 3GOVB 1QJ7B 4F49A 1OX1A 3SORA 4BXSA 2ZU3A 2THFB 3RC5A 2Z9LA 2ZGXH 4FU7A 2GD4B 1CO7E 2JJ1D 2QXIA 1GCTB 1Z71A 5PTPA 4BAQB 1C5NH 1FY3A 2VIPA 3S9CA 1C5ZB 3PM3A 4TY7A 2A32A 1C5MD 1LVMA 2A45B 1UVPA 1BBRE 4Y71A 3OEED 1Q2WA 1O33A 2OQ5A 5GIBA 4ACAA 1E36B 1FXYA 1UTOA 1WQVH 2Q6DA 1GHWH 3LKWA 3ZVFA 1LPZB 1ZYOA 1OOKB 6LPRA 2KCPA 1LQDB 4DIHH 2C93B 5EIYA 3M7QA 2AMQA 1C2EA 1PPEE 2QC2A 3KGPA 3A83A 2JH6D 1O5CB 1VCQA 2ZO3H 4H6SB 3ZZ3A 1C5OH 4ZKOU 1S6LA 1SGPE 4THNH 4J2YB 1E38B 3KF2A 2ZPQA 1DXPA 3BTFE 3MO6A 3ITIA 2M5TA 1GI6A 3WW7A 3BN9A 4BAMB 3PWCA 3JZ2B 1QHRB 1UMAH 3ZZ7A 4ABAA 1ELFA 1RJXB 4HI3A 4X6PA 2H9HA 3WWBA 4JMYA 2SNWA 1O2IA 1DLEA 3A80A 2XNIA 3NPSA 1P05A 2TIOA 1N1LA 7KMEH 3P6ZB 4AG2A 1XUGA 5JB8S 2BZAA 1O2OA 1O2UA 1TALA 1W2KH 2ZDAH 2OXSA 2DUCA 2UUYA 2PKAB 2H5DA 3T2NA 3VB7A 1O3HA 3RXOA 5C0TA 3MO3A 1D4PB 1EXFA 1WBGB 4FXGH 2BQWB 1IQFA 2WZQA 1O5DH 2RDLA 1A3BH 1LQEA 1C5XB 2FS8A 2BOHB 1SKYE 2W7UA 4E05H 1C2KA 4ZXYH 1BCUH 1MQ5A 2R2WU 1P02A 2ZPRA 2G5NA 3OTPA 1N8OC 2FIRH 2CMYA 2WPHS 2WHXA 5CMXH 1EKBB 4BTUB 1SOTA 1LPKB 1QJ1B 3TK9A 1P57B 2BVRH 4D76A 2ZFSA 2IPQX 2XC0A 3AVZA 3ZZ5A 2FOGA 2GT7A 2V3HH 2WUCA 4OS1A 3B8JA 4WXIA 2IJOB 4ZH8A 3MQKC 2XC5A 3CENA 4XBCA 1KDQA 1V2MT 1TNLA 1XX9A 5JBBS 3UREA 2A4RA 2VIOA 4OM9A 3TIUA 5EJ1A 1GVKB 4ZKRU 4SGBE 3C27B 2OC8A 1F5LA 1K1IA 1K22H 1D3QB 2ZIQH 4NGAH 3E91A 3HK6B 4SGAE 3RLYH 1L4ZA 1ZJKA 3TJUA 1ACBE 5CDFE 1YPJH 2C90B 3SV8A 1AVGH 1XXDA 1LCYA 3NCLA 2BQ6B 4WY3A 2OC0A 2F9BH 3P95A 1Y59T 5B6OA 2BX3A 4X1NU 1MCVA 2YMSD 1OP2A 4DW2U 2BDIA 1S81A 3RXBA 1XUIA 3DSOA 1G3BA 1C5LH 2CN0H 1ETSH 1V2LT 4XBBA 1HAOH 2TGTA 3F0OA 2RCEA 4XRNA 3SGAE 2XW9A 3F2FA 2XCFA 3HGNA 4CRAA 1PJPA 1EAWA 1SGFA 1S0RA 3BF6H 4ZKNU 3LC5A 1ABIH 3MU0A 2FP7B 3LJJA 5E2PA 1LHDH 4U2WA 1C5SA 1O2SA 4NFEA 4FUHA 2IOTA 4X0WU 4ZAEA 2PFEA 4UD9H 1O3JA 4WJG2 4A5TS 1O5GH 1H8IH 2WPLS 3BTME 2NU0E 3DCLA 4MPWA 1ESAA 2ZU2A 1L1GA 1BQYA 3Q3YA 1Z7KA 4GUXA 3OTJE 1TNIA 1TPPA 2GVFA 1XUKA 1XM1A 4FUDA 3VB4A 3H7TA 1IQIA 3M5MA 2QIQA 1UK3A 1ELDE 3D65E 2A31A 1BBRH 1YM0A 3EDXB 1DFPA 1BTWA 1K1NA 4Q4LA 4AZ2B 3MU4A 3CS7A 3PV5A 3BEIB 3K65B 2K1QA 1E34B 4AG1A 2Y7XA 4H6TA 5DP7A 2UUFB 3ZVBA 2FX6A 1D3TB 3N7OA 1BMLA 3PB1E 1YCPH 2BY7X 1IQGA 1DSUA 3PLBA 2K8IA 5A09A 1GDUA 1CGJE 1V2NT 1P01A 1V3XA 3I29A 3UWIA 1Y5AT 1CBWC 2VJ1A 3MYWA 3A7WA 5AFYH 5FPSA 4DGJA 5BRRE 1C1UH 1ELVA 1BOQA 2KCAA 4B71A 2HGTH 3P92A 4IS5A 3OE7D 1GHYH 2UUJB 1B0FA 1GI1A 1C1QA 1WDIA 3RXEA 5AHGH 1DWDH 2Y7ZA 3DFLA 3ZVAA 2HLCA 1CBWB 3SUGA 2F91A 2QA9E 1UTKA 1TGSZ 4DT7B 1C5PA 3F2HA 1PQ5A 1P2KA 4GSOA 1O2JA 2QXHA 4X1RU 1E0FD 1EAIA 2XCNA 1NROH 3GY4A 3HKJB 3SU1A 4YXWD 1MBQA 2ZU1A 5DP6A 1UCYE 1SLXB 1Z6EA 2SGEE 3N7DA 3SUFA 3RXHA 1Q31A 2F9UA 1A3EH 1SQOA 4I7YH 1JRTA 1C2JA 3F3BA 1KMHB 1L1NA 2Y6TA 4JZIA 3AAUA 3KL6A 4FUGA 3P8NA 4KGAA 1E37B 1GBBA 3U8RH 1TONA 1C1WH 4JZEH 2XC4A 3ZZ8A 2AYWA 1ZRBA 2BD9A 1TBQH 1AFQC 3KEEA 2JETC 2ALPA 1O2ZA 3TH2H 4CH2B 3W95A 1ZTLA 1MTNB 4X8VH 1IHSH 5FXLA 4P02A 1O3OA 1TOMH 3ZVEA 1TA6A 1SHYA 3TJNA 1OWHA 3T27A 4ISNA 1FNIA 2ZDKA 3RU4T 3WWFA 5B6LA 1ELGA 4ABGA 1DWEH 5EG4A 3Q77A 1AFQB 3LGVA 5E0HA 5HYOA 2JETB 3VGCB 1GWAA 1P9SA 2JDID 2LELA 4A92A 1GHBF 2GJGA 2J2UA 3SV2H 2BDGA 1Q3XA 2PV9B 3M36A 2BLQA 4YLQH 3BTGE 4K8YA 4Y7BA 4O03A 4BTIB 1Y5BT 2DE9A 4LK4A 1EZSC 3ODFA 1ZHRA 3E16B 2WPKS 1Y5UT 1EAXA 1AIXH 3P70B 5A8YA 3L3TA 1HJAC 2G4UA 4AFZA 2PSXA 2FZZA 2AMPA 1ZOMA 1T4VH 2V6NA 2PW8H 1JMOH 2V7QD 4MDSA 5ESBA 2XBWA 3SJIA 1OP0A 3GDUA 1AI8H 2Z9JA 1P10A 5DG6A 2ZDVH 2EI6A 3UIRA 1FLEE 4A1VA 2ZG0H 3OAAD 3ZYEA 1GHBG 3E3TA 3KCGH 2TGAA 3K9XB 2NU3E 3F2GA 1MKWK 1ZPBA 3A88A 3D23A 2I6QA 2XOKD 4ASUD 1BZXE 3ATIA 1ARCA 1QB9A 2ANYA 4F55A 1OS8A 4I31A 4YO9A 1TBZH 1AQ7A 1BMMH 2A2XH 1NRSH 1SLVB 8ESTE 1DWBH 2HNTC 4ESTE 1GVZA 3E8LA 2D8WA 1YP9A 3KQCA 4X2YA 1GBMA 5C3NA 1O3AA 2ZU4A 4KELA 1GI4A 2BD8A 1BRAA 4CH8B 2KM0A 1T8NA 4UE7H 5C17A 2R2MB 1MTSA 1EASA 5EQSA 4D9QA 1QL8A 2J5UA 2BD7A 4YTAA 2G51A 2BXTH 3MH5A 2XBYA 3LONA 4IW4E 1GBIA 1ZLRA 2PP6A 3C1KA 5T3HA 2PTNA 4ISOA 4LZ1H 4XBDA 2R0KA 4IGDA 5J4SA 4FVBA 3SJ9A 2ASUB 1GJDB 1TGBA 3RU4E 3GCHC 1ZMLA 5EPNA 4AYYB 1UTLM 1AGJA 1OKXA 2VIDA 4X8UH 3QUMP 4AGKA 1OWIA 1QL9A 1S82A 4IMZA 3SV7A 1V2JT 2TGDA 4ZHMU 2G52A 1BB0B 2RA0A 5E0JA 5EQQA 4ZUHA 5LH8A 1QR3E 2BD2A 5F8TA 2ZNKH 2EI7A 5EXLA 3F9HA 4OS2A 3RXKA 2XTTB 1SGQE 1MCTA 2R9PA 5L30H 5ABWA 4JYUH 2P95A 2JH5D 2FOCA 1VGCC 5EJLA 5EPYA 1EZXC 1H1BA 2CGAA 1K0HA 1AKSA 1H9IE 1JIMA 5DO4H 6CHAB 1PPBH 2CV3A 2BYAX 4AB8A 1TNKA 1A2CH 2Z7FE 3GY6A 3SQEE 4AN7A 2VWMA 5A8ZA 3JZ1B 4K69A 1EUFA 1WQSA 1G2LA 2R3UA 4IMQA 1ZZZA 1UCYH 4KKDA 2BB4A 3QLPH 2SGFE 1W7GH 3MNCA 1BT7A 1GHAF 2BDAA 1Y3UA 4FUIA 3TVJB 1AE8H 1OWKA 1V2ST 1HAZB 1QL7A 2BDCA 1WTHD 2ZWLH 4WH6A 2ODQA 2OC7A 2ODYB 1SGEE 1UVTH 4RT0A 1UJ1A 2SFAA 1PQ7A 5AVDA 1A4WH 3GY2A 3FZDA 1F7ZA 2ZZUH 1H8HD 1NT1A 1O3LA 3W1EA 1QRWA 3I77A 1FMGA 2UUKB 1GG6C 1A7SA 2EEKA 2KX4A 1CGHA 1EPTC 1HAVA 1D6WA 1FUJA 1AY6H 2CHAC 3N99A 1XMNB 3A8DA 5EW1H 5DGJA 4DIIH 1NM6A 3S9AA 1TNGA 3ZV9A 2A7JA 1C4Y2 3QK1A 1GPZA 4GHTA 3DHKH 2BDHA 4CHAB 1GG6B 2BY5X 4UEHH 1P11E 3GISB 2HVYB 1EPTB 4NIWA 2CHAB 1TRNA 4Y0ZE 3LOXA 2RG3A 2AS9A 3VFEA 5DKMA 5CHAB 5TJXA 2VGCC 3BTQE 2H9EH 1YF4A 3ZVDA 2ZI2H 1XUJA 4AX9H 1W11U 3A82A 3NWUA 1HPGA 4M7GA 4GVUA 3PRBA 1S5SA 2VGCB 3E6PH 3SU2A 1YBWA 2W6ID 2FS9A 4DY7B 5A2MH 3BG8A 4YZUA 2HPPH 2VVUA 2YNAA 1SBWA 4BAKB 5FX6A 1EOLA 3F6UH 3RM2H 1L2EA 2QF5A 3IITA 3T5FH 1F0TA 1TGNA 2QF4A 3PLKA 3U8TH 1TQ7B 2P16A 3RXPA 1SGCA 1YLDA 4KTUA 1GCTC 4MNXA 1LHCH 3M35A 1Y3VA 4YLUA 1BTYA 3MU1A 4O9VA 4JZDH 3U9AH 1AVXA 3V12A 3ESTA 2WPMS 2OLGA 3F68H 5DP5A 4NIVA 1C1RA 2EQNA 4NSYA 4X8TH 1KXFA 3H09A 4Y7AA 1QJ6B 5FBEA 1P03A 1FV9A 4O97A 3SU3A 2PGQB 3DSPA 3SU5A 4ASHA 3ZZ4A 3UQOA 1VCPA 2IPHA 4JZ1A 4PROA 1K2I1 1NO9H 2YOLA 2STAE 1EX3A 2ZGJA 4MG3A 3RXTA 3V0XA 5LPEA 5JBAS 1F92A 1DXWA 5FCKA 4DOQA 4X2XA 1Y8TA 4CBOA 1P9UA 1CU1A 3HATH 2O8UA 1RD3B 4O3UA 3MHWU 4OS4A 2A7HA 4MPUA 3F9EA 4B73A 2ZTXA 2A4QA 2W6JD 1YGCH 2ZA5A 1EJNA 1TOCB 3ATKA 4I8GA 4ABEA 5A0AE 1YWUA 1J8AA 1MQ6A 1ZHMA 2R3YA 2Q6GA 4P00A 1P2JA 1P2IA 3EE0B 1BHXF 4NA7A 3ODDA 2W3KA 2FMJA 2P93A 3M3SA 1HAVB 4FUEA 2CK3D 1SI5H 2GCTB 4WMFA 2AGIX 3BEFB 3FOAA 5DP4A 4AOQA 4X1SU 4TSFD 1YYY1 1FN6A 4CRCA 2XBXA 3SHCH 1QFKH 1QURH 1H9HE 3QZQA 2GZ8A 1GI3A 2R0LA 3TNTA 3VXEH 1GJ6A 1WCZA 3A7ZA 2QF3A 1O39A 1O2KA 1VJ9U 2KFWA 3STJA 3A8AA 4A1TA 1GJBB 3RXDA 1RTFB 1G32B 3Q76A 1TX6A 2QN5T 4JZFH 1PPCE 1KTSB 1V2VT 2FWWA 3FP8E 3N7EA 1K1JA 4X6OA 3TGIE 2PLXA 3A7XA 2VVVA 1C5UA 3RMMH 3RXMA 2AH4X 5HMAA 1J14A 4A6LA 1ZR0A 1TLDA 2RDEA 2B5TB 3RC6A 3SNEA 1K1MA 2EA3A 2LNCA 1C1TA 1CT4E 3L33A 5GJ4B 2AHME 2NU2E 3FZZA 1MTWA 1GJ8B 1V2RT 2BLOA 1ELCA 2FESH 2FI5E 4I8HA 1ELAA 1GBCA 1DY8A 1C2FA 3KQEA 4FUFA 5G4BA 1UTQA 3RP2A 1PFXC 5AFZH 1TX8A 4K3JA 2AERH 2ZGBH 1AUJA 1O3PB 1ZMNA 4I32A 4D7GA 4U01A 4D7FA 4JK5A 4B2AA 4MQAA 1EZQA 5E0GA 1OWDA 3PWBA 4MNVA 2GV6A 2SGAA 1CQQA 3BTWE 3PLPA 1O38A 2Y5GA 1C1SA 4NIYA 1TMUH 4INLA 1IQNA 4Q2KA 5E8EH 3SNDA 4DCDA 1BHXB 2W5EA 1O2HA 1WXRA 1DOJA 4XFQA 1XKBC 2ANMH 4CBNA 1PPHE 1GBAA 1H8DH 4Y79A 1O5EH 5C1XA 2D26C 1QB6A 1F5KU 4GCHF 2PSYA 3SZEA 5GNDA 2FOEA 1NBMD 2WV5A 2BTCE 4D8NA 5LGOA 3GDSA 1V2KT 1P06A 1SMFE 4XD7D 1QRZA 1C2LA 1LO6A 4DVAU 1DUEA 1O31A 1UO6A 2WSSD 4INKA 4MPVA 2ZHFH 1TRMA 5GWZA 1C2HA 1P3EA 3P8OA 5F03A 2LPRA 1DVAH 1ZSKA 4Z0KA 2ANKH 1TNHA 3B9FH 4K8BA 1AO5A 1B0EA 2ZC9H 4I8JA 3W94A 1O3MA 3Q00A 3TK5A 2AGGX 2QV1A 1UVSH 3EGKH 2VH6A 1SQAA 4NA8A 1TGTA 2VWOA 4B1TA 7GCHF 5L6NH 3MO9A 1GJCB 1CVWH 1LKBA 1Z1IA 2ZTZA 4MNWA 1ELEE 1O2LA 3SNCA 2F3CE 1KXEA 4Y76A 1HDTH 4UFFH 3UOPA 5EOKA 1GI9B 1BMFD 2B9LA 2LP6A 3IG6B 4D9RA 3LIWA 1LHGH 2ZFFH 3NUMA 1THSH 3RXFA 2QXJA 4AFQA 3M7UA 4HGCA 2ZKSA 5DP3A 1UTPA 7LPRA 2AEIH 4ZHLU 3V13A 3FANA 3ZV8A 5HXFA 1AFEH 8LPRA 1WOFA 1P8VC 3A87A 1PPZA 2J4IA 5SGAE 3SYJA 1AD8H 3KIDU 5C67A 5K7RA 1SC8U 3DD2H 7GCHG 2ZQ2A 3ZZ6A 1MZDA 2P8OC 1F0UA 3KNXA 1WYKA 1DDJA 5DJ7A 1CA0C 2UWLA 1EB2A 1VZQH 2J94A 2BMGB 4X6MA 2EC9H 1GMHF 1J16A 2GMTC 1AB9B 2O8TA 2O8MA 1SGFG 1O2TA 1O5AB 1QA7A 4Z1MD 3FP7E 1KDQB 2VWNA 2P8OB 2FOMB 3NK8A 1TPOA 5DPAA 1TAWA 1GJ7B 2KZ4A 1CA0B 3KYFA 3TITA 3GCOA 3B23B 3RXSA 5DP9A 4U30A 1K1LA 4JK6A 3TU7H 1ESBA 1FIZA 1BRCE 2OTVA 2GMTB 1O2XA 1MAXA 3AW1A 3MH4A 5T1VA 3TLOA 3ZZCA 4BOHA 5ESTE 3D49H 2V3MA 1ZSJA 4FU9A 5HIYA 2Y81A 3UUZA 1YLCA 2A5IA 3KQBA 5KEDA 1THPB 2SNVA 1P0SH 1P04A 2OC1A 1BTXA 2OCVB 1MTNC 2PTCE 2Z3EA 1K1OA 3SV6A 4FUBA 1IQEA 2ZHWH 3M3VA 1GMHG 4MPXA 1IAUA 2XYAA 3LU9B 3DT0H 1K21H 2BHGA 4VGCB 4E06H 1V6DA 1RIWC 3URCA 4Q7YA 3VGCC 4WXVA 4I33A 1HBTH 2F43B 1ESTA 2GX4A 1C2IA 1FQ3A 3RMOH 1B7XB 4INHA 1OYQA 1GL1A 5KECA 1F0SA 1EQ9A 4ZCNA 1PPFE 3A89A 1ZPZA 1GBDA 4YOGA 4DJZB 2C3SA 1ANCA 1RIWB 1AZ8A 1AE5A 4CR5A 2ZU5A 4B75A 1BIOA 2GCHF 1HAXB 5FHTA 2GZ9A 1BRUP 1FDPA 1W13U 1GMDF 4XSKU 1A1RA 1V2PT 2RA3A 2GKVE 1TPSA 1C5QA 1INCA 1SLWB 1DICA 1Z6JH 1OPHB 1TA2A 2BD3A 3L6PA 2YMSB 5DP8A 4A7IB 1GBHA 2ZGCA 2Z6BD 2ZFTA 1NFXA 1SQTA 2VB0A 3NXPA 2VWLA 3TGKE 3GY3A 1BJUA 3SU0A 1HAGE 1XXFA 2WINI 8KME2 2SGQE 4I8KA 4Y6DA 1G9IE 3H5CB 2I6SA 4UDWH 1FY5A 3P17H 3F9FA 1S6HA 1M9UA 2XWAA 3HGPA 5EU8A 5EQRA 3A86A 4HG6A 5T6GA 2GCHG 1MKXK 4HZHA 1DWCH 3HPTB 2PHBA 4BXWA 1G3EA 3RXCA 4TWWA 3QGNB 2GT8A 6ESTA 2ZDMA 1ETRH 1EJMA 4FETA 1SL3A 1Z8IB 2A5KA 2G5VA 1QTFA 2F83A 4X2WA 3P8GA 1NFYA 2OP9A 1C9TA 2Z9IA 3LC3A 1PYTC 3S7KB 2Z9GA 1K1PA 3NKKA 1IQLA 4GHQA 3URDA 2FI4E 1FPHH 3QGJA 2W26A 1HAYB 1O35A 4AFUA 1VCWA 2P3UB 1BTZA 3RXIA 1MTVA 1O2QA 3M7TA 4BNRA 1A46H 1W0JD 1BUIA 3V3MA 4ABHA 1U6QA 2FO9A 3UWJH 3T28A 1RXPA 1KLJH 2B0FA 1RTLA 2KAIA 4OGYA 4WH8A 1C1OA 2VIQA 4OS7A 4B6FA 3E0NB 3DUXH 9ESTA 4FUCA 1ELTA 1ZRKA 2AFQB 4ZROA 4Q80A 1O3KA 4UFGH 1UTJA 1S84A 3RMLH 3PTBA 1JIRA 1HIAA 1E1QD 3DSGA 2Q6FA 1G3CA 4IC5A 3UR6A 1IQMA 1FX0B 3PMAB 5C5NA 4Y8YA 1KSNA 2P3FH 1FI8A 3SJ8A 1HB0B 3QWCH 6CHAC 3RXVA 1MKWH 1RRKA 1SR5C 5EGMA 5C2ZA 1DS2E 1EP5A 4X2VA 2F9PA 3PMHB 1T8MA 2VINA 1A0JA 1O2VA 1ZHPA 2K0QA 4UONA 1P12E 1W3CA 3AK5A 2BLWA 1QZ8A 2XXLA 2GV7A 3F9GA 3M5OA 3TGJE 4ABJA 3PYHA 2BY8X 3TH4H 3E90B 1NTPA 1BTPA 4TY6A 1MD7A 3BV9B 4X8SH 5K0HA 4NZLA 4K1SA 4U32A 1WTGH 2WV4A 1DT2A 2FXRA 3U69H 3VB3A 2O9QA 1EAUA 1O2NA 2F9VA 5FL7D 5DK1A 1LKAA 2JH0D 1P2QA 1NBME 1ELBA 3A85A 3F1SB 4BTTB 2HRVA 1ZTKA 3SUDA 1HCGA 1F5RA 1CHGA 3U98H 3PMBB 1IQKA 1O3BA 1NZQH 3T25A 2ZQ1A 3UNSA 1NPMA 4CRGA 1JXPA 2ZHEH 1NRPH 2VU8E 3BTHE 2CJIA 1YPHE 4BAHB 3LGTA 2J98A 2PGBB 2QAAA 4YT7H 4R0IA 4CHAC 1QIXB 5JB9S 1DE7H 1G37A 2NU1E 2KCYA 1H4WA 3SU4A 1XVMA 2GP9B 3SN8A 2QE7D 1ZSLA 3FFGA 2AMDA 3OU0A 1YPGH 2J9NA 4YOJA 1HAPH 4ABIA 5CHAC 5HIZA 1NY22 1TGCA 1WV7H 4BAOB 4CRBA 1GHAG 1EP6A 3LGIA 3QTOH 2ZPSA 3M5LA 1J9CH 3OY6U 5IDKA 4Y10E 1MUEB 3GS9A 1A5IA 1T32A 2HALA 1MABB 1QQUA 1TIOA 3ZVGA 2ZDNA 1DY9A 1UK2A 2FTMA 3OYPA 2IJD1 5EODA 1ANBA 3KHVA 4ZKSU 4B2BA 4WVPE 5JBCS 2UWPA 1GHVH 1GGDB 4M9FA 1ETTH 4ZHAA 5C1UA 1DSTA 1RGQA 1LHEH 2WUBA 1C2MA 2ZHQH 2KAIB 1O3CA 1TX7A 1O3GA 1T4UH 1A0LA 3BTEE 5HKKD 1O5FH 3SNBA 1DLKB 2J92A 2VNTA 2HWLB 4OS5A 4F48B 3ZZAA 3ZZ9A 1NFUA 3TPIZ 4B74A 2BDYA 2HNTE 3U8OH 4RI0A 2KCOA 1AVWA 4A1XA 1L4DA 3O8BA 7ESTE 1C4V2 5GXPA 5FAHA 3S7HB 2SGDE 1WSSH 1T7CA 4TPIZ 5GCHF 1SHHB 1C5YB 3FVFB 1G2MA 1GHZA 3LH3A 1C5VA 3R3GB 3VB6A 2W3IA 4TYDA 4KTCA 5LPRA 1AKSB 4CREA 1T8LA 4MTBA 4Y11E 1QBOA 1QBVH 2FTLE 1FY1A 2BDBA 4LOYH 3RDZA 2V35A 3I78A 1SGRE 5FCRA 3G01A 3OEHD 1KYNA 1JOUB 1YLNA 4GLYA 1HJ9A 1GBEA 2FOBA 3HK3B 2A7CA 4WWYA 3LGYA 5F53A 3RXGA 2L74A 1E35B 5EXMA 2BD4A 1QGFA 2CF8H 1ABJH 1D3DB 1QRXA 3EQ0H 3TK6A 1OSSA 5GCHG 2ZDLA 1E1RD 1UTNA 2ZTYA 3A8BA 1MAYA 2JKHA 1QQ4A 1MTUA 2GCTC 5A0CA 1W10U 1HNEE 1QA0A 2BVSH 1ZJDA 4K2YA 1QNJA 1O32A 1GJ5H 3O8CA 1OWEA 2QY0B 3Q3KA 1W0YH 2J98B 1O0DH 1W7XH 2OINA 4K5ZA 8GCHF 1GDNA 3UFAA 1CHOF 1BTHH 1GBJA 3QO6A 1XKAC 3MNSA 3ZZBA 3SJKA 3UNRA 2STBE 3OSYA 4H4FA 4AC9A 3GICB 1TMBH 2AIQA 1F0RA 1SSXA 4J1YA 4XE4A 1UW7A 2BD5A 3MMGA 3KQ5A 5H4IB 1VR1H 1NN6A 2G00A 1GJ9B 2VVCA 2PUQH 4FU8A 1G3DA 5CE1A 1SFQB 1GJAB 2ZFRH 2H9TH 5C20A 5E2OA 4DG4A 3A7YA 2ZFQH 5GPIB 2BXUH 8GCHG 1SGIB 1CSOE 1MH0A 2VIVA 3P8FA 1CHOG 5JBTA 1Z1JA 1HGTH 4NA9H 2ULLA 4AYVB 1O36A 3IWMA 2OQUA 5GDSH 3SUEA 3A8CA 5HGGA 3RXLA 2VBCA 2Q1JA 4F4OC 2Z3CA 3PROA 1C2GA 2H1UA 1K28D 1V2UT 3SV9A 1FIWA 1NESE 4TPYA 2ZEBA 1VKYA 3K6YA 4XDEA 3SGQE 3UY9A 1HUTH 1FONA 1IOEA 1HJ8A 3MI4A 1P2OA 4KP0A 4K1TA 1E79D 2B7DH 1GI0A 1YPKH 3RU4D 4E7RG 1ZGIA 3FKSD 5JPMH 6GCHF 2A5AA 2WPIS 1T8OA 1O2GH 4X6NA 1L1JA 1A61H 2AIPA 2HVXA 4KTSA 2J34A 1O3NA 1Z8JB 4B2CA 2Z9KA 1W8BH 1L0ZA 2BY6X 1WU1A 1EZUC 2JJ2D 2DE8A 3ATWA 3LPRA 4UFDH 4RSPA 1N8OB 2OK5A 2FLBH 2TRMA 3CNRA 1ARBA 1O3EA 3ZVCA 3D62A 2TBSA 1EATA 5I46H 4B6EA 4AORA 1SGTA 1BBRK 2OBOA 1AWHB 2FODA 5T6DA 5F8ZA 2FLRH 1ZTJA 4RKOB 3M3TA 6GCHG 3PV2A 3SJOA 1OXGA 3RC4A 4OS6A 1SVPA 1YPMH 3LT3A 2JIZD 3AASA 3T62A 2NWNA 1ZMJA 4YOIA 5KGOA 3MFJA 3MH6A 4B76A 1V2TT 1TRYA 1VJAU 3OX7U 4RKJB 1YCPK 5CHBA 3UPEA 1LTOA 2BQ7B 1KIGH 5HM2A 1HFDA 1N6XA 2H5CA 1G30B 2CF9H 1MZAA 4X1QU 4IN1A 4ZXXH 1O5BB 4NWLA 4GCHG 3LDXH 4ABFA 3K6ZA 3ZIAD 3RXQA 3FN8A 2A1DB 3EAJA 1FY4A 1TWXB 3Q3XA 1NC6A 1AWFH 1ORFA 2A4OA 3BG4C 2P59A 3GYLB 5TCCA 1C5TA 3MOCA 3QDZB 4ISLA 5FPTA 1O37A 1P2MA 3ATMA 2ZCHP 3DFJA 3FO8D 4AB9A 4NSVA 4NZQA 3BG4B 1FN8A 1W0KD 4NCYA 4IC6A 1O30A 2VIWA 2G8TA 3SNAA 1AB9C 4CR9A 1EB1H 1YKTA 1DANH 1QCPA 4NIXA 3ZZDA
chains in the Genus database with same CATH topology
1ANEA 1ZPCA 3NZIA 2XBVA 1PYTD 3T29A 1SOZA 3SZNA 1CT0E 4MVNA 3MWIU 1C5RA 1LDTT 1C2DA 2FEQH 1GBKA 1K9OE 3SBKA 2BX4A 5A0BA 3RLWH 2F9OA 1HAIH 2FOFA 1OYTH 1AHTH 3K2UA 1TYNA 2GDDA 3GY5A 1HYLA 1MD8A 1IHTH 3MU5A 3OY5U 3TJVA 4O3TA 2H2ZA 3RXAA 4K60A 2WYGA 1VITH 1ANDA 2Z3DA 5EXNA 1HAHH 4BANB 3SI4H 2J95A 1CT2E 1O3FA 3CS0A 9LPRA 1YPEH 2OBQA 4OGXA 4E7NA 4GAWA 4VGCC 2A2QH 2EI8A 2O8WA 2PUXB 2FDAA 3RUOA 2C8ZB 2XRCA 3SO3A 3MTYA 1MMJN 1BITA 1S0QA 2C4FH 2ILNA 2FYRA 5J4QA 2D2DA 3CP7A 1TBRH 3HKIB 1AUTC 3RXRA 1BTUA 1IQJA 1HXEH 1ID5H 3DA9B 3EA7A 1V2QT 3H7OA 2FOAA 3PO1C 1SGNE 3FP6E 1UVOA 2J38A 1D6RA 1B5GH 1PPGE 3BTKE 3S9BA 1EOJA 1TQ0B 1TPAE 2BOKA 3LH1A 1UVUH 2W7SA 5T6FA 2G81E 1W0ZU 2UWOA 2OUAA 1C9PA 1A5GH 4JCNA 3S69A 2V0BA 4JYTA 1Y3XA 3PO1B 5C1YA 2Y5FA 3ZYDA 2G4TA 3MH7A 4ISIH 1AMHA 1Z8GA 1XUHA 2ESTE 4Z6AH 5EW2H 2BY9X 2AGEX 4WMEA 1GMCF 4ISHH 2ZHDA 1DITH 2HNTF 4FUJA 1O3IA 2FOHA 2PR3A 3ATLA 1YPHC 1J15A 3BIVH 1FAXA 1S85A 3BTTE 3TNSA 3GCTF 3RXUA 3PMJA 2GTBA 2TGPZ 1PQAA 4JYVH 1KXAA 2QGRA 3SI3H 1UHBA 3M5NA 3GDVA 3BIUH 1O34A 4YESB 1MU8B 1W14U 3EA8A 1WAYB 1C5WB 1TNJA 1DUAA 2C8WB 3EYDA 4WMDA 1BMNH 2Y80A 4LXBH 3M61U 1TABE 4AGJA 1Y3YA 5F6MA 1XVOA 5HM9A 3UTUH 1GMDG 1TE0A 1SFIA 1AU8A 2FYQA 2ZGHA 1GMCG 3VPKA 3R0FA 5FBIA 3SQHE 3TJOA 4H42U 3GCNA 2BVXH 3M37A 1W12U 1TFXA 3KN2A 1GI8B 5FPYA 1HJAB 2BZ6H 2P94A 1BRBE 4IBLH 3GCTG 3STIA 2ALVA 2PWXA 1HLTH 1GBFA 2FM2A 1BA8B 5JYIA 3AAVA 5C5OA 1BMAA 4CRDA 1LPGB 1NRNH 5I25A 1EJAA 3TH3H 1FJSA 1NRQH 1EPTA 2YNBA 3UNQA 1HXFH 1V2OT 2Z94A 3A84A 3BEUA 2ZECA 1FZZA 2P3TB 3WY8A 1JBUH 4XOJA 2GZ7A 4NWKA 1KLIH 5BPEA 1UCYK 1NU7B 2Y82A 3SOSA 2BM2A 2C8XB 2G55A 1WUNH 2C8YB 4UFEH 2ANWA 1FPCH 4FVDA 2QXGA 3T26A 1H9LB 1GL0E 1KXBA 1C1PA 1NS3A 3MNXA 3QZRA 3LGWA 4Y8XA 1VITF 3FAOA 1MKXH 1O2YA 1FY8E 5L2ZH 1X7AC 3MNBA 2BLVA 4HTCH 1LVBA 4YT6H 1AZZA 1RTKA 1SLUB 4I8LA 3U1IB 2IN2A 3E0PB 3ELAH 1N6YA 1SG8B 4QT8C 1SGDE 4Y0YE 1GI5A 1THRH 1YC0A 2SGPE 3GY8A 2A4GA 1JWTA 4MNYA 3GCHB 5LPFA 1SB1H 2WPJS 3O8RA 4ABBA 2GDEH 1G36A 2FX4A 1OP8A 2ZFPH 1UK4A 1GI2A 2TPIZ 1BDAA 1OWJA 1GCDA 3BTDE 2A0QB 2QF0A 3EA9A 1GBTA 1O3DA 3ENSB 4NG9H 1D3PB 1VITG 1O2RA 1BJVA 1LHFH 2XWBI 4MLFB 1UHBB 1TMTH 2NU4E 2ZP0H 3BSQA 4K1EA 4Y8ZA 5ETXA 1GI7B 3RXJA 1CGIE 4Q7ZA 1VGCB 1PQ8A 3UQVA 1TB6H 3QN7A 1HV7A 4YM9A 1GJ4H 1DX5M 5A8XA 1LVOA 2CXVA 3PTNA 2B8OH 5AF9H 4RN6A 4ZMAH 1YCPM 3O8DA 1NU9A 5IYTA 1ZGVA 3LGUA 2F9NA 4NFFA 2O8LA 2ODPA 1F2SE 1LVYA 1C4U2 4HFPB 1GGDC 1IQHA 3A81A 2VH0A 1O2PA 2ZCKP 1AN1E 3AW0A 1DPOA 1XUFA 3QX5H 2GGVB 1GDQA 3VEQB 1CE5A 1P2NA 3SW2B 1GBLA 1V2WT 3A7VA 4DURA 1JRSA 1J17T 1DM4B 2V3OH 3E1XB 2FI3E 1KXCA 3SGBE 1S83A 2HOBA 3V7TA 4X1PU 4AFSA 4CRFA 1YPLH 3UOUA 2H6MA 1GVLA 1KTTB 1QBNA 3A7TA 2HPQH 3GYMA 1RFNA 1MU6B 1Y3WA 3MU8A 1RS0A 1C1VH 3SU6A 5JDUB 4ABDA 2ZCLP 5L2YH 2PKAA 3VXFH 1NFWA 1KLTA 1D9IA 1HIAB 4GPGA 1UTMA 1A5HA 3QTVH 3U1JB 1Z8RA 1MBMA 1O2WA 5FX5A 2PKSC 1HRTH 3VB5A 1T31A 2OD3B 3KQDA 4R8TB 3S0NA 4TWYA 1KXDA 1FAKH 1S6FA 2Y5HA 3RMNH 3GY7A 2D1JA 1GHXH 3RM0H 5TCAA 1A0HB 1SPJA 4WF8A 4IN2A 1P09A 3PV4A 1C1MA 1KY9A 2PKSB 3LJOA 4LZ4B 2FPZA 1P3CA 1QB1A 3UR9A 1C1NA 1CA8B 4Q7XA 2ZF0H 2WYJA 1NRRH 2QYIA 1O2MA 1QY6A 3SHAH 1SGYE 1LMWB 5F8XA 2QCYA 3GOVB 1QJ7B 4F49A 1OX1A 3SORA 4BXSA 2ZU3A 2THFB 3RC5A 2Z9LA 2ZGXH 4FU7A 2GD4B 1CO7E 2QXIA 1GCTB 1Z71A 5PTPA 4BAQB 1C5NH 1FY3A 2VIPA 3S9CA 1C5ZB 3PM3A 4TY7A 2A32A 1C5MD 1LVMA 2A45B 1UVPA 1BBRE 4Y71A 1Q2WA 1O33A 2OQ5A 5GIBA 1E36B 1FXYA 1UTOA 1WQVH 2Q6DA 1GHWH 3LKWA 3ZVFA 1LPZB 1ZYOA 1OOKB 6LPRA 1LQDB 4DIHH 2C93B 3M7QA 2AMQA 1C2EA 1PPEE 2QC2A 3KGPA 3A83A 2JH6D 1O5CB 1VCQA 2ZO3H 4H6SB 3ZZ3A 1C5OH 4ZKOU 1SGPE 4THNH 4J2YB 1E38B 3KF2A 2ZPQA 1DXPA 3BTFE 3MO6A 3ITIA 2M5TA 1GI6A 3BN9A 4BAMB 3PWCA 3JZ2B 1QHRB 1UMAH 3ZZ7A 4ABAA 1ELFA 1RJXB 4HI3A 4X6PA 2H9HA 4JMYA 2SNWA 1O2IA 1DLEA 3A80A 2XNIA 3NPSA 1P05A 2TIOA 1N1LA 7KMEH 3P6ZB 4AG2A 1XUGA 5JB8S 2BZAA 1O2OA 1O2UA 1TALA 1W2KH 2ZDAH 2OXSA 2DUCA 2UUYA 2PKAB 2H5DA 3T2NA 3VB7A 1O3HA 3RXOA 3MO3A 1D4PB 1EXFA 1WBGB 4FXGH 2BQWB 1IQFA 1O5DH 2RDLA 1A3BH 1LQEA 1C5XB 2FS8A 2BOHB 2W7UA 4E05H 1C2KA 4ZXYH 1BCUH 1MQ5A 2R2WU 1P02A 2ZPRA 2G5NA 1N8OC 2FIRH 2CMYA 2WPHS 5CMXH 1EKBB 4BTUB 1SOTA 1LPKB 1QJ1B 3TK9A 1P57B 2BVRH 4D76A 2ZFSA 2XC0A 3AVZA 3ZZ5A 2FOGA 2GT7A 2V3HH 2WUCA 4OS1A 3B8JA 4WXIA 2IJOB 4ZH8A 2XC5A 3CENA 4XBCA 1KDQA 1V2MT 1TNLA 1XX9A 5JBBS 3UREA 2A4RA 2VIOA 3TIUA 1GVKB 4ZKRU 4SGBE 3C27B 2OC8A 1F5LA 1K1IA 1K22H 1D3QB 2ZIQH 4NGAH 3E91A 3HK6B 4SGAE 3RLYH 1L4ZA 1ZJKA 3TJUA 1ACBE 1YPJH 2C90B 3SV8A 1AVGH 1XXDA 1LCYA 3NCLA 2BQ6B 4WY3A 2OC0A 2F9BH 3P95A 1Y59T 5B6OA 2BX3A 4X1NU 1MCVA 1OP2A 4DW2U 2BDIA 1S81A 3RXBA 1XUIA 1G3BA 1C5LH 2CN0H 1ETSH 1V2LT 4XBBA 1HAOH 2TGTA 2RCEA 3SGAE 2XW9A 2XCFA 3HGNA 4CRAA 1PJPA 1EAWA 1SGFA 1S0RA 3BF6H 4ZKNU 3LC5A 1ABIH 3MU0A 2FP7B 3LJJA 5E2PA 1LHDH 4U2WA 1C5SA 1O2SA 4NFEA 4FUHA 2IOTA 4X0WU 4ZAEA 2PFEA 4UD9H 1O3JA 4WJG2 4A5TS 1O5GH 1H8IH 2WPLS 3BTME 2NU0E 4MPWA 1ESAA 2ZU2A 1L1GA 1BQYA 3Q3YA 1Z7KA 4GUXA 3OTJE 1TNIA 1TPPA 2GVFA 1XUKA 1XM1A 4FUDA 3VB4A 3H7TA 1IQIA 3M5MA 2QIQA 1UK3A 1ELDE 3D65E 2A31A 1BBRH 1YM0A 3EDXB 1DFPA 1BTWA 1K1NA 4AZ2B 3MU4A 3CS7A 3BEIB 3K65B 2K1QA 1E34B 4AG1A 2Y7XA 4H6TA 5DP7A 2UUFB 3ZVBA 2FX6A 1D3TB 3N7OA 1BMLA 3PB1E 1YCPH 2BY7X 1IQGA 1DSUA 3PLBA 5A09A 1GDUA 1CGJE 1V2NT 1P01A 1V3XA 3I29A 3UWIA 1Y5AT 1CBWC 2VJ1A 3MYWA 3A7WA 5AFYH 5FPSA 4DGJA 5BRRE 1C1UH 1ELVA 1BOQA 4B71A 2HGTH 3P92A 4IS5A 1GHYH 2UUJB 1B0FA 1GI1A 1C1QA 3RXEA 5AHGH 1DWDH 2Y7ZA 3DFLA 3ZVAA 2HLCA 1CBWB 3SUGA 2F91A 2QA9E 1UTKA 1TGSZ 4DT7B 1C5PA 1PQ5A 1P2KA 4GSOA 1O2JA 2QXHA 4X1RU 1E0FD 1EAIA 2XCNA 1NROH 3GY4A 3HKJB 3SU1A 1MBQA 2ZU1A 5DP6A 1UCYE 1SLXB 1Z6EA 2SGEE 3SUFA 3RXHA 1Q31A 2F9UA 1A3EH 1SQOA 4I7YH 1JRTA 1C2JA 1L1NA 2Y6TA 4JZIA 3AAUA 3KL6A 4FUGA 3P8NA 4KGAA 1E37B 1GBBA 3U8RH 1TONA 1C1WH 4JZEH 2XC4A 3ZZ8A 2AYWA 1ZRBA 2BD9A 1TBQH 1AFQC 3KEEA 2JETC 2ALPA 1O2ZA 3TH2H 4CH2B 3W95A 1ZTLA 1MTNB 4X8VH 1IHSH 5FXLA 1O3OA 1TOMH 3ZVEA 1TA6A 1SHYA 3TJNA 1OWHA 3T27A 4ISNA 1FNIA 2ZDKA 3RU4T 1ELGA 4ABGA 1DWEH 5EG4A 3Q77A 1AFQB 3LGVA 5E0HA 5HYOA 2JETB 3VGCB 1GWAA 1P9SA 4A92A 1GHBF 2J2UA 3SV2H 2BDGA 1Q3XA 2PV9B 3M36A 2BLQA 4YLQH 3BTGE 4K8YA 4Y7BA 4O03A 4BTIB 1Y5BT 2DE9A 4LK4A 1EZSC 3ODFA 1ZHRA 3E16B 2WPKS 1Y5UT 1EAXA 1AIXH 3P70B 5A8YA 3L3TA 1HJAC 2G4UA 4AFZA 2PSXA 2FZZA 2AMPA 1ZOMA 1T4VH 2V6NA 2PW8H 1JMOH 4MDSA 5ESBA 2XBWA 3SJIA 1OP0A 3GDUA 1AI8H 2Z9JA 1P10A 5DG6A 2ZDVH 2EI6A 3UIRA 1FLEE 4A1VA 2ZG0H 3ZYEA 1GHBG 3E3TA 3KCGH 2TGAA 3K9XB 2NU3E 1MKWK 1ZPBA 3A88A 3D23A 2I6QA 1BZXE 3ATIA 1ARCA 1QB9A 2ANYA 1OS8A 4I31A 4YO9A 1TBZH 1AQ7A 1BMMH 2A2XH 1NRSH 1SLVB 8ESTE 1DWBH 2HNTC 4ESTE 1GVZA 3E8LA 2D8WA 1YP9A 3KQCA 4X2YA 1GBMA 5C3NA 1O3AA 2ZU4A 4KELA 1GI4A 2BD8A 1BRAA 4CH8B 1T8NA 4UE7H 2R2MB 1MTSA 1EASA 5EQSA 4D9QA 1QL8A 2BD7A 4YTAA 2G51A 2BXTH 3MH5A 2XBYA 3LONA 4IW4E 1GBIA 1ZLRA 3C1KA 5T3HA 2PTNA 4ISOA 4LZ1H 4XBDA 2R0KA 4IGDA 5J4SA 4FVBA 3SJ9A 2ASUB 1GJDB 1TGBA 3RU4E 3GCHC 1ZMLA 5EPNA 4AYYB 1UTLM 1AGJA 1OKXA 2VIDA 4X8UH 3QUMP 4AGKA 1OWIA 1QL9A 1S82A 4IMZA 3SV7A 1V2JT 2TGDA 4ZHMU 2G52A 1BB0B 2RA0A 5E0JA 5EQQA 4ZUHA 5LH8A 1QR3E 2BD2A 5F8TA 2ZNKH 2EI7A 5EXLA 3F9HA 4OS2A 3RXKA 2XTTB 1SGQE 1MCTA 2R9PA 5L30H 5ABWA 4JYUH 2P95A 2JH5D 2FOCA 1VGCC 5EPYA 1EZXC 1H1BA 2CGAA 1AKSA 1H9IE 1JIMA 5DO4H 6CHAB 1PPBH 2CV3A 2BYAX 4AB8A 1TNKA 1A2CH 2Z7FE 3GY6A 3SQEE 4AN7A 2VWMA 5A8ZA 3JZ1B 4K69A 1EUFA 1WQSA 1G2LA 2R3UA 4IMQA 1ZZZA 1UCYH 4KKDA 2BB4A 3QLPH 2SGFE 1W7GH 3MNCA 1BT7A 1GHAF 2BDAA 1Y3UA 4FUIA 3TVJB 1AE8H 1OWKA 1V2ST 1HAZB 1QL7A 2BDCA 1WTHD 2ZWLH 4WH6A 2ODQA 2OC7A 2ODYB 1SGEE 1UVTH 1UJ1A 2SFAA 1PQ7A 5AVDA 1A4WH 3GY2A 3FZDA 1F7ZA 2ZZUH 1NT1A 1O3LA 1QRWA 3I77A 1FMGA 2UUKB 1GG6C 1A7SA 2EEKA 1CGHA 1EPTC 1HAVA 1D6WA 1FUJA 1AY6H 2CHAC 1XMNB 3A8DA 5EW1H 5DGJA 4DIIH 1NM6A 3S9AA 1TNGA 3ZV9A 2A7JA 1C4Y2 3QK1A 1GPZA 4GHTA 3DHKH 2BDHA 4CHAB 1GG6B 2BY5X 4UEHH 1P11E 3GISB 1EPTB 4NIWA 2CHAB 1TRNA 4Y0ZE 3LOXA 2RG3A 2AS9A