1C21A

E. coli methionine aminopeptidase: methionine complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
molecule tags Hydrolase
source organism Escherichia coli
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c21A00
2GG7A 2GG9A 3BIQA 2GTXA 2DFIA 2B3HA 4U1BA 2NQ6A 2GG3A 4A6VA 1W2MA 4S2RP 3TAVA 1C24A 1C27A 4IKTA 5CDLA 4B28A 3IU7A 1MATA 3L7GA 4FLIA 4FO7A 4IPAA 3S6BA 1WN1A 5JFRA 4IKRA 2P9AA 4PV4A 2G6PA 1KQ9A 2V6CA 1YJ3A 1KQ0A 2Q8KA 2GGCA 4IU6A 4FUKA 4RZZA 2BWXA 4R60A 1W7VA 2BWTA 2EVMA 4U6WA 5CE6A 2P98A 5D6EA 4MATA 4ZWOA 1C23A 1WL6A 2V3YA 5CIKA 3MATA 3IU9A 4IKSA 4RZYA 1R58A 1XGSA 1YVMA 3L24A 5CNXA 2V3XA 1Y1NA 1WLRA 4JUQA 4PNCA 1R5GA 2B3LA 3MX6A 4HXXA 1XGOA 2GGBA 2OAZA 5E5BA 4FLJA 1A16A 2V3ZA 4IDYA 4U71A 2Q94A 1CHMA 1O0XA 4U75A 2Q95A 2GZ5A 1C22A 1QXZA 3FM3A 1QXYA 2BWVA 2BHDA 1KP0A 2ZSGA 3BIPA 2EVCA 1YW7A 1PV9A 4IF7A 4KM3A 2HOWA 4U6EA 3PKAA 2EA4A 2GU4A 4U70A 4ZWPA 1XGMA 2Q93A 3FMRA 3BITA 2GG2A 2BN7A 3TB5A 4U6CA 2BWWA 4RGZ1 2BHCA 5CDVA 3RVAA 2GU7A 5FCHA 3IU8A 4U73A 1JAWA 2GG0A 2BWSA 3PKDA 1N51A 2BWYA 4S00A 1XNZA 3CB6A 1BN5A 3FMQA 3PKEA 4S01A 4U6JA 2GA2A 4FO8A 2GG8A 3CTZA 4U76A 2BWUA 1QXWA 2ADUA 4A6WA 3CB5A 2NQ7A 3MR1A 4ZWUA 2Q96A 4Z7MA 3D27A 4IECA 1WY2A 1YW9A 1QZYA 2OKNA 3PKBA 4IKUA 5JI6A 1B6AA 3Q6DA 2MATA 2BHAA 1R5HA 2GU5A 2GU6A 4FKCA 1C21A 4FLKA 2BH3A 2BHBA 3IG4A 2B3KA 1B59A 4OOKA 1WL9A 4EGEA 1YW8A 2BB7A 4FLLA 1XGNA 4QR8A 4ZNGA 5JHUA 2GG5A 2IW2A 4S2TP 4U69A 1WBQA 1BOAA 2EA2A 2Q92A 4U6ZA 5D6FA 5CDEA 3RORA 2EVOA 5FCFA 1WKMA 1M35A 2P99A 5CLSA 3PKCA
chains in the Genus database with same CATH superfamily
2GG7A 2GG9A 3BIQA 2GTXA 2DFIA 2B3HA 4U1BA 2NQ6A 2GG3A 4A6VA 1W2MA 4S2RP 3TAVA 1C24A 1C27A 4IKTA 5CDLA 4B28A 3IU7A 1MATA 3L7GA 4FLIA 4FO7A 4IPAA 3S6BA 1WN1A 5JFRA 4IKRA 2P9AA 4PV4A 2G6PA 1KQ9A 2V6CA 1YJ3A 1KQ0A 2Q8KA 2GGCA 4IU6A 4FUKA 4RZZA 2BWXA 4R60A 1W7VA 2BWTA 2EVMA 4U6WA 5CE6A 2P98A 5D6EA 4MATA 4ZWOA 1C23A 1WL6A 2V3YA 5CIKA 3MATA 3IU9A 4IKSA 4RZYA 1R58A 1XGSA 1YVMA 3L24A 5CNXA 2V3XA 1Y1NA 1WLRA 4JUQA 4PNCA 1R5GA 2B3LA 3MX6A 4HXXA 1XGOA 2GGBA 2OAZA 5E5BA 4FLJA 1A16A 2V3ZA 4IDYA 4U71A 2Q94A 1CHMA 1O0XA 4U75A 2Q95A 2GZ5A 1C22A 1QXZA 3FM3A 1QXYA 2BWVA 2BHDA 1KP0A 2ZSGA 3BIPA 2EVCA 1YW7A 1PV9A 4IF7A 4KM3A 2HOWA 4U6EA 3PKAA 2EA4A 2GU4A 4U70A 4ZWPA 1XGMA 2Q93A 3FMRA 3BITA 2GG2A 2BN7A 3TB5A 4U6CA 2BWWA 4RGZ1 2BHCA 5CDVA 3RVAA 2GU7A 5FCHA 3IU8A 4U73A 1JAWA 2GG0A 2BWSA 3PKDA 1N51A 2BWYA 4S00A 1XNZA 3CB6A 1BN5A 3FMQA 3PKEA 4S01A 4U6JA 2GA2A 4FO8A 2GG8A 3CTZA 4U76A 2BWUA 1QXWA 2ADUA 4A6WA 3CB5A 2NQ7A 3MR1A 4ZWUA 2Q96A 4Z7MA 3D27A 4IECA 1WY2A 1YW9A 1QZYA 2OKNA 3PKBA 4IKUA 5JI6A 1B6AA 3Q6DA 2MATA 2BHAA 1R5HA 2GU5A 2GU6A 4FKCA 1C21A 4FLKA 2BH3A 2BHBA 3IG4A 2B3KA 1B59A 4OOKA 1WL9A 4EGEA 1YW8A 2BB7A 4FLLA 1XGNA 4QR8A 4ZNGA 5JHUA 2GG5A 2IW2A 4S2TP 4U69A 1WBQA 1BOAA 2EA2A 2Q92A 4U6ZA 5D6FA 5CDEA 3RORA 2EVOA 5FCFA 1WKMA 1M35A 2P99A 5CLSA 3PKCA
chains in the Genus database with same CATH topology
2GG7A 2GG9A 3BIQA 2GTXA 2DFIA 2B3HA 4U1BA 2NQ6A 2GG3A 4A6VA 1W2MA 4S2RP 3TAVA 1C24A 1C27A 4IKTA 5CDLA 4B28A 3IU7A 1MATA 3L7GA 4FLIA 4FO7A 4IPAA 3S6BA 1WN1A 5JFRA 4IKRA 2P9AA 4PV4A 2G6PA 1KQ9A 2V6CA 1YJ3A 1KQ0A 2Q8KA 2GGCA 4IU6A 4FUKA 4RZZA 2BWXA 4R60A 1W7VA 2BWTA 2EVMA 4U6WA 5CE6A 2P98A 5D6EA 4MATA 4ZWOA 1C23A 1WL6A 2V3YA 5CIKA 3MATA 3IU9A 4IKSA 4RZYA 1R58A 1XGSA 1YVMA 3L24A 5CNXA 2V3XA 1Y1NA 1WLRA 4JUQA 4PNCA 1R5GA 2B3LA 3MX6A 4HXXA 1XGOA 2GGBA 2OAZA 5E5BA 4FLJA 1A16A 2V3ZA 4IDYA 4U71A 2Q94A 1CHMA 1O0XA 4U75A 2Q95A 2GZ5A 1C22A 1QXZA 3FM3A 1QXYA 2BWVA 2BHDA 1KP0A 2ZSGA 3BIPA 2EVCA 1YW7A 1PV9A 4IF7A 4KM3A 2HOWA 4U6EA 3PKAA 2EA4A 2GU4A 4U70A 4ZWPA 1XGMA 2Q93A 3FMRA 3BITA 2GG2A 2BN7A 3TB5A 4U6CA 2BWWA 4RGZ1 2BHCA 5CDVA 3RVAA 2GU7A 5FCHA 3IU8A 4U73A 1JAWA 2GG0A 2BWSA 3PKDA 1N51A 2BWYA 4S00A 1XNZA 3CB6A 1BN5A 3FMQA 3PKEA 4S01A 4U6JA 2GA2A 4FO8A 2GG8A 3CTZA 4U76A 2BWUA 1QXWA 2ADUA 4A6WA 3CB5A 2NQ7A 3MR1A 4ZWUA 2Q96A 4Z7MA 3D27A 4IECA 1WY2A 1YW9A 1QZYA 2OKNA 3PKBA 4IKUA 5JI6A 1B6AA 3Q6DA 2MATA 2BHAA 1R5HA 2GU5A 2GU6A 4FKCA 1C21A 4FLKA 2BH3A 2BHBA 3IG4A 2B3KA 1B59A 4OOKA 1WL9A 4EGEA 1YW8A 2BB7A 4FLLA 1XGNA 4QR8A 4ZNGA 5JHUA 2GG5A 2IW2A 4S2TP 4U69A 1WBQA 1BOAA 2EA2A 2Q92A 4U6ZA 5D6FA 5CDEA 3RORA 2EVOA 5FCFA 1WKMA 1M35A 2P99A 5CLSA 3PKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG7 A;  2GG9 A;  3BIQ A;  2GTX A;  2DFI A;  2B3H A;  4U1B A;  2NQ6 A;  2GG3 A;  4A6V A;  1W2M A;  4S2R P;  3TAV A;  1C24 A;  1C27 A;  4IKT A;  5CDL A;  4B28 A;  3IU7 A;  1MAT A;  3L7G A;  4FLI A;  4FO7 A;  4IPA A;  3S6B A;  1WN1 A;  5JFR A;  4IKR A;  2P9A A;  4PV4 A;  2G6P A;  1KQ9 A;  2V6C A;  1YJ3 A;  1KQ0 A;  2Q8K A;  2GGC A;  4IU6 A;  4FUK A;  4RZZ A;  2BWX A;  4R60 A;  1W7V A;  2BWT A;  2EVM A;  4U6W A;  5CE6 A;  2P98 A;  5D6E A;  4MAT A;  4ZWO A;  1C23 A;  1WL6 A;  2V3Y A;  5CIK A;  3MAT A;  3IU9 A;  4IKS A;  4RZY A;  1R58 A;  1XGS A;  1YVM A;  3L24 A;  5CNX A;  2V3X A;  1Y1N A;  1WLR A;  4JUQ A;  4PNC A;  1R5G A;  2B3L A;  3MX6 A;  4HXX A;  1XGO A;  2GGB A;  2OAZ A;  5E5B A;  4FLJ A;  1A16 A;  2V3Z A;  4IDY A;  4U71 A;  2Q94 A;  1CHM A;  1O0X A;  4U75 A;  2Q95 A;  2GZ5 A;  1C22 A;  1QXZ A;  3FM3 A;  1QXY A;  2BWV A;  2BHD A;  1KP0 A;  2ZSG A;  3BIP A;  2EVC A;  1YW7 A;  1PV9 A;  4IF7 A;  4KM3 A;  2HOW A;  4U6E A;  3PKA A;  2EA4 A;  2GU4 A;  4U70 A;  4ZWP A;  1XGM A;  2Q93 A;  3FMR A;  3BIT A;  2GG2 A;  2BN7 A;  3TB5 A;  4U6C A;  2BWW A;  4RGZ 1;  2BHC A;  5CDV A;  3RVA A;  2GU7 A;  5FCH A;  3IU8 A;  4U73 A;  1JAW A;  2GG0 A;  2BWS A;  3PKD A;  1N51 A;  2BWY A;  4S00 A;  1XNZ A;  3CB6 A;  1BN5 A;  3FMQ A;  3PKE A;  4S01 A;  4U6J A;  2GA2 A;  4FO8 A;  2GG8 A;  3CTZ A;  4U76 A;  2BWU A;  1QXW A;  2ADU A;  4A6W A;  3CB5 A;  2NQ7 A;  3MR1 A;  4ZWU A;  2Q96 A;  4Z7M A;  3D27 A;  4IEC A;  1WY2 A;  1YW9 A;  1QZY A;  2OKN A;  3PKB A;  4IKU A;  5JI6 A;  1B6A A;  3Q6D A;  2MAT A;  2BHA A;  1R5H A;  2GU5 A;  2GU6 A;  4FKC A;  1C21 A;  4FLK A;  2BH3 A;  2BHB A;  3IG4 A;  2B3K A;  1B59 A;  4OOK A;  1WL9 A;  4EGE A;  1YW8 A;  2BB7 A;  4FLL A;  1XGN A;  4QR8 A;  4ZNG A;  5JHU A;  2GG5 A;  2IW2 A;  4S2T P;  4U69 A;  1WBQ A;  1BOA A;  2EA2 A;  2Q92 A;  4U6Z A;  5D6F A;  5CDE A;  3ROR A;  2EVO A;  5FCF A;  1WKM A;  1M35 A;  2P99 A;  5CLS A;  3PKC A; 
#chains in the Genus database with same CATH topology
 2GG7 A;  2GG9 A;  3BIQ A;  2GTX A;  2DFI A;  2B3H A;  4U1B A;  2NQ6 A;  2GG3 A;  4A6V A;  1W2M A;  4S2R P;  3TAV A;  1C24 A;  1C27 A;  4IKT A;  5CDL A;  4B28 A;  3IU7 A;  1MAT A;  3L7G A;  4FLI A;  4FO7 A;  4IPA A;  3S6B A;  1WN1 A;  5JFR A;  4IKR A;  2P9A A;  4PV4 A;  2G6P A;  1KQ9 A;  2V6C A;  1YJ3 A;  1KQ0 A;  2Q8K A;  2GGC A;  4IU6 A;  4FUK A;  4RZZ A;  2BWX A;  4R60 A;  1W7V A;  2BWT A;  2EVM A;  4U6W A;  5CE6 A;  2P98 A;  5D6E A;  4MAT A;  4ZWO A;  1C23 A;  1WL6 A;  2V3Y A;  5CIK A;  3MAT A;  3IU9 A;  4IKS A;  4RZY A;  1R58 A;  1XGS A;  1YVM A;  3L24 A;  5CNX A;  2V3X A;  1Y1N A;  1WLR A;  4JUQ A;  4PNC A;  1R5G A;  2B3L A;  3MX6 A;  4HXX A;  1XGO A;  2GGB A;  2OAZ A;  5E5B A;  4FLJ A;  1A16 A;  2V3Z A;  4IDY A;  4U71 A;  2Q94 A;  1CHM A;  1O0X A;  4U75 A;  2Q95 A;  2GZ5 A;  1C22 A;  1QXZ A;  3FM3 A;  1QXY A;  2BWV A;  2BHD A;  1KP0 A;  2ZSG A;  3BIP A;  2EVC A;  1YW7 A;  1PV9 A;  4IF7 A;  4KM3 A;  2HOW A;  4U6E A;  3PKA A;  2EA4 A;  2GU4 A;  4U70 A;  4ZWP A;  1XGM A;  2Q93 A;  3FMR A;  3BIT A;  2GG2 A;  2BN7 A;  3TB5 A;  4U6C A;  2BWW A;  4RGZ 1;  2BHC A;  5CDV A;  3RVA A;  2GU7 A;  5FCH A;  3IU8 A;  4U73 A;  1JAW A;  2GG0 A;  2BWS A;  3PKD A;  1N51 A;  2BWY A;  4S00 A;  1XNZ A;  3CB6 A;  1BN5 A;  3FMQ A;  3PKE A;  4S01 A;  4U6J A;  2GA2 A;  4FO8 A;  2GG8 A;  3CTZ A;  4U76 A;  2BWU A;  1QXW A;  2ADU A;  4A6W A;  3CB5 A;  2NQ7 A;  3MR1 A;  4ZWU A;  2Q96 A;  4Z7M A;  3D27 A;  4IEC A;  1WY2 A;  1YW9 A;  1QZY A;  2OKN A;  3PKB A;  4IKU A;  5JI6 A;  1B6A A;  3Q6D A;  2MAT A;  2BHA A;  1R5H A;  2GU5 A;  2GU6 A;  4FKC A;  1C21 A;  4FLK A;  2BH3 A;  2BHB A;  3IG4 A;  2B3K A;  1B59 A;  4OOK A;  1WL9 A;  4EGE A;  1YW8 A;  2BB7 A;  4FLL A;  1XGN A;  4QR8 A;  4ZNG A;  5JHU A;  2GG5 A;  2IW2 A;  4S2T P;  4U69 A;  1WBQ A;  1BOA A;  2EA2 A;  2Q92 A;  4U6Z A;  5D6F A;  5CDE A;  3ROR A;  2EVO A;  5FCF A;  1WKM A;  1M35 A;  2P99 A;  5CLS A;  3PKC A; 
#chains in the Genus database with same CATH homology
 2GG7 A;  2GG9 A;  3BIQ A;  2GTX A;  2DFI A;  2B3H A;  4U1B A;  2NQ6 A;  2GG3 A;  4A6V A;  1W2M A;  4S2R P;  3TAV A;  1C24 A;  1C27 A;  4IKT A;  5CDL A;  4B28 A;  3IU7 A;  1MAT A;  3L7G A;  4FLI A;  4FO7 A;  4IPA A;  3S6B A;  1WN1 A;  5JFR A;  4IKR A;  2P9A A;  4PV4 A;  2G6P A;  1KQ9 A;  2V6C A;  1YJ3 A;  1KQ0 A;  2Q8K A;  2GGC A;  4IU6 A;  4FUK A;  4RZZ A;  2BWX A;  4R60 A;  1W7V A;  2BWT A;  2EVM A;  4U6W A;  5CE6 A;  2P98 A;  5D6E A;  4MAT A;  4ZWO A;  1C23 A;  1WL6 A;  2V3Y A;  5CIK A;  3MAT A;  3IU9 A;  4IKS A;  4RZY A;  1R58 A;  1XGS A;  1YVM A;  3L24 A;  5CNX A;  2V3X A;  1Y1N A;  1WLR A;  4JUQ A;  4PNC A;  1R5G A;  2B3L A;  3MX6 A;  4HXX A;  1XGO A;  2GGB A;  2OAZ A;  5E5B A;  4FLJ A;  1A16 A;  2V3Z A;  4IDY A;  4U71 A;  2Q94 A;  1CHM A;  1O0X A;  4U75 A;  2Q95 A;  2GZ5 A;  1C22 A;  1QXZ A;  3FM3 A;  1QXY A;  2BWV A;  2BHD A;  1KP0 A;  2ZSG A;  3BIP A;  2EVC A;  1YW7 A;  1PV9 A;  4IF7 A;  4KM3 A;  2HOW A;  4U6E A;  3PKA A;  2EA4 A;  2GU4 A;  4U70 A;  4ZWP A;  1XGM A;  2Q93 A;  3FMR A;  3BIT A;  2GG2 A;  2BN7 A;  3TB5 A;  4U6C A;  2BWW A;  4RGZ 1;  2BHC A;  5CDV A;  3RVA A;  2GU7 A;  5FCH A;  3IU8 A;  4U73 A;  1JAW A;  2GG0 A;  2BWS A;  3PKD A;  1N51 A;  2BWY A;  4S00 A;  1XNZ A;  3CB6 A;  1BN5 A;  3FMQ A;  3PKE A;  4S01 A;  4U6J A;  2GA2 A;  4FO8 A;  2GG8 A;  3CTZ A;  4U76 A;  2BWU A;  1QXW A;  2ADU A;  4A6W A;  3CB5 A;  2NQ7 A;  3MR1 A;  4ZWU A;  2Q96 A;  4Z7M A;  3D27 A;  4IEC A;  1WY2 A;  1YW9 A;  1QZY A;  2OKN A;  3PKB A;  4IKU A;  5JI6 A;  1B6A A;  3Q6D A;  2MAT A;  2BHA A;  1R5H A;  2GU5 A;  2GU6 A;  4FKC A;  1C21 A;  4FLK A;  2BH3 A;  2BHB A;  3IG4 A;  2B3K A;  1B59 A;  4OOK A;  1WL9 A;  4EGE A;  1YW8 A;  2BB7 A;  4FLL A;  1XGN A;  4QR8 A;  4ZNG A;  5JHU A;  2GG5 A;  2IW2 A;  4S2T P;  4U69 A;  1WBQ A;  1BOA A;  2EA2 A;  2Q92 A;  4U6Z A;  5D6F A;  5CDE A;  3ROR A;  2EVO A;  5FCF A;  1WKM A;  1M35 A;  2P99 A;  5CLS A;  3PKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...