1C21A

E. coli methionine aminopeptidase: methionine complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c21A00
1N51A 3PKBA 1B59A 3BIPA 1W7VA 1C27A 2P99A 4RZZA 4U76A 2EA2A 3CB5A 5CLSA 5CE6A 4IU6A 4U1BA 2EVOA 4ZNGA 2GGCA 2V3YA 2NQ7A 3PKAA 4FLKA 2GU7A 4B28A 1C23A 2P98A 2HOWA 1YW8A 4S2TP 5E5BA 3PKDA 2ADUA 2BWYA 1W2MA 4IKSA 1QXZA 2GG0A 4IDYA 4S00A 1O0XA 4FLJA 3BIQA 1QZYA 2GG2A 1YVMA 2ZSGA 4HXXA 4FKCA 5JHUA 2GZ5A 5FCHA 4EGEA 2GG5A 5CDVA 1R58A 2GU6A 2MATA 3IU7A 1BN5A 1WN1A 4IPAA 4RGZ1 4U71A 1B6AA 2V3XA 2EVCA 2GA2A 1C22A 5CNXA 4U75A 4MATA 1WL6A 3MR1A 4FO8A 4RZYA 4U73A 3RORA 3FM3A 3D27A 5JI6A 1MATA 2DFIA 2Q93A 3RVAA 3PKCA 4PV4A 2NQ6A 4A6WA 2BH3A 3TAVA 2V3ZA 4FO7A 3S6BA 4QR8A 4U6CA 1Y1NA 1XGSA 2Q95A 4U6WA 2G6PA 2Q8KA 1QXYA 4R60A 4ZWOA 4ZWUA 4U70A 3Q6DA 2GGBA 2BB7A 2IW2A 2BWXA 3IU9A 2GG8A 1XNZA 4JUQA 2GU4A 2BWSA 1QXWA 2BWVA 1KP0A 1YJ3A 2Q94A 2BHBA 3MX6A 4A6VA 2BWWA 1YW9A 1BOAA 2OKNA 4U69A 4FLIA 3PKEA 2BWUA 3TB5A 2OAZA 1R5HA 2BN7A 5CDEA 4IKRA 2EVMA 1A16A 4PNCA 4U6EA 4IKUA 1WKMA 5D6FA 2BHAA 5JFRA 1WY2A 3IU8A 3CTZA 1C21A 1C24A 4ZWPA 4FUKA 4S2RP 5FCFA 1XGNA 2B3LA 5D6EA 2BWTA 4IECA 5CIKA 2Q92A 4Z7MA 1KQ9A 4S01A 3L7GA 1M35A 1CHMA 2Q96A 4IF7A 3BITA 1JAWA 5CDLA 2GU5A 3MATA 2BHCA 1WL9A 2GG7A 1KQ0A 2P9AA 2B3HA 1WBQA 2EA4A 1YW7A 1R5GA 2BHDA 2B3KA 3CB6A 3L24A 4OOKA 4IKTA 4KM3A 3FMQA 4U6JA 3FMRA 2GG9A 2GG3A 1PV9A 4FLLA 1WLRA 1XGOA 2GTXA 4U6ZA 2V6CA 1XGMA 3IG4A
chains in the Genus database with same CATH superfamily
1N51A 3PKBA 1B59A 3BIPA 1W7VA 1C27A 2P99A 4RZZA 4U76A 2EA2A 3CB5A 5CLSA 5CE6A 4IU6A 4U1BA 2EVOA 4ZNGA 2GGCA 2V3YA 2NQ7A 3PKAA 4FLKA 2GU7A 4B28A 1C23A 2P98A 2HOWA 1YW8A 4S2TP 5E5BA 3PKDA 2ADUA 2BWYA 1W2MA 4IKSA 1QXZA 2GG0A 4IDYA 4S00A 1O0XA 4FLJA 3BIQA 1QZYA 2GG2A 1YVMA 2ZSGA 4HXXA 4FKCA 5JHUA 2GZ5A 5FCHA 4EGEA 2GG5A 5CDVA 1R58A 2GU6A 2MATA 3IU7A 1BN5A 1WN1A 4IPAA 4RGZ1 4U71A 1B6AA 2V3XA 2EVCA 2GA2A 1C22A 5CNXA 4U75A 4MATA 1WL6A 3MR1A 4FO8A 4RZYA 4U73A 3RORA 3FM3A 3D27A 5JI6A 1MATA 2DFIA 2Q93A 3RVAA 3PKCA 4PV4A 2NQ6A 4A6WA 2BH3A 3TAVA 2V3ZA 4FO7A 3S6BA 4QR8A 4U6CA 1Y1NA 1XGSA 2Q95A 4U6WA 2G6PA 2Q8KA 1QXYA 4R60A 4ZWOA 4ZWUA 4U70A 3Q6DA 2GGBA 2BB7A 2IW2A 2BWXA 3IU9A 2GG8A 1XNZA 4JUQA 2GU4A 2BWSA 1QXWA 2BWVA 1KP0A 1YJ3A 2Q94A 2BHBA 3MX6A 4A6VA 2BWWA 1YW9A 1BOAA 2OKNA 4U69A 4FLIA 3PKEA 2BWUA 3TB5A 2OAZA 1R5HA 2BN7A 5CDEA 4IKRA 2EVMA 1A16A 4PNCA 4U6EA 4IKUA 1WKMA 5D6FA 2BHAA 5JFRA 1WY2A 3IU8A 3CTZA 1C21A 1C24A 4ZWPA 4FUKA 4S2RP 5FCFA 1XGNA 2B3LA 5D6EA 2BWTA 4IECA 5CIKA 2Q92A 4Z7MA 1KQ9A 4S01A 3L7GA 1M35A 1CHMA 2Q96A 4IF7A 3BITA 1JAWA 5CDLA 2GU5A 3MATA 2BHCA 1WL9A 2GG7A 1KQ0A 2P9AA 2B3HA 1WBQA 2EA4A 1YW7A 1R5GA 2BHDA 2B3KA 3CB6A 3L24A 4OOKA 4IKTA 4KM3A 3FMQA 4U6JA 3FMRA 2GG9A 2GG3A 1PV9A 4FLLA 1WLRA 1XGOA 2GTXA 4U6ZA 2V6CA 1XGMA 3IG4A
chains in the Genus database with same CATH topology
1N51A 3PKBA 1B59A 3BIPA 1W7VA 1C27A 2P99A 4RZZA 4U76A 2EA2A 3CB5A 5CLSA 5CE6A 4IU6A 4U1BA 2EVOA 4ZNGA 2GGCA 2V3YA 2NQ7A 3PKAA 4FLKA 2GU7A 4B28A 1C23A 2P98A 2HOWA 1YW8A 4S2TP 5E5BA 3PKDA 2ADUA 2BWYA 1W2MA 4IKSA 1QXZA 2GG0A 4IDYA 4S00A 1O0XA 4FLJA 3BIQA 1QZYA 2GG2A 1YVMA 2ZSGA 4HXXA 4FKCA 5JHUA 2GZ5A 5FCHA 4EGEA 2GG5A 5CDVA 1R58A 2GU6A 2MATA 3IU7A 1BN5A 1WN1A 4IPAA 4RGZ1 4U71A 1B6AA 2V3XA 2EVCA 2GA2A 1C22A 5CNXA 4U75A 4MATA 1WL6A 3MR1A 4FO8A 4RZYA 4U73A 3RORA 3FM3A 3D27A 5JI6A 1MATA 2DFIA 2Q93A 3RVAA 3PKCA 4PV4A 2NQ6A 4A6WA 2BH3A 3TAVA 2V3ZA 4FO7A 3S6BA 4QR8A 4U6CA 1Y1NA 1XGSA 2Q95A 4U6WA 2G6PA 2Q8KA 1QXYA 4R60A 4ZWOA 4ZWUA 4U70A 3Q6DA 2GGBA 2BB7A 2IW2A 2BWXA 3IU9A 2GG8A 1XNZA 4JUQA 2GU4A 2BWSA 1QXWA 2BWVA 1KP0A 1YJ3A 2Q94A 2BHBA 3MX6A 4A6VA 2BWWA 1YW9A 1BOAA 2OKNA 4U69A 4FLIA 3PKEA 2BWUA 3TB5A 2OAZA 1R5HA 2BN7A 5CDEA 4IKRA 2EVMA 1A16A 4PNCA 4U6EA 4IKUA 1WKMA 5D6FA 2BHAA 5JFRA 1WY2A 3IU8A 3CTZA 1C21A 1C24A 4ZWPA 4FUKA 4S2RP 5FCFA 1XGNA 2B3LA 5D6EA 2BWTA 4IECA 5CIKA 2Q92A 4Z7MA 1KQ9A 4S01A 3L7GA 1M35A 1CHMA 2Q96A 4IF7A 3BITA 1JAWA 5CDLA 2GU5A 3MATA 2BHCA 1WL9A 2GG7A 1KQ0A 2P9AA 2B3HA 1WBQA 2EA4A 1YW7A 1R5GA 2BHDA 2B3KA 3CB6A 3L24A 4OOKA 4IKTA 4KM3A 3FMQA 4U6JA 3FMRA 2GG9A 2GG3A 1PV9A 4FLLA 1WLRA 1XGOA 2GTXA 4U6ZA 2V6CA 1XGMA 3IG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N51 A;  3PKB A;  1B59 A;  3BIP A;  1W7V A;  1C27 A;  2P99 A;  4RZZ A;  4U76 A;  2EA2 A;  3CB5 A;  5CLS A;  5CE6 A;  4IU6 A;  4U1B A;  2EVO A;  4ZNG A;  2GGC A;  2V3Y A;  2NQ7 A;  3PKA A;  4FLK A;  2GU7 A;  4B28 A;  1C23 A;  2P98 A;  2HOW A;  1YW8 A;  4S2T P;  5E5B A;  3PKD A;  2ADU A;  2BWY A;  1W2M A;  4IKS A;  1QXZ A;  2GG0 A;  4IDY A;  4S00 A;  1O0X A;  4FLJ A;  3BIQ A;  1QZY A;  2GG2 A;  1YVM A;  2ZSG A;  4HXX A;  4FKC A;  5JHU A;  2GZ5 A;  5FCH A;  4EGE A;  2GG5 A;  5CDV A;  1R58 A;  2GU6 A;  2MAT A;  3IU7 A;  1BN5 A;  1WN1 A;  4IPA A;  4RGZ 1;  4U71 A;  1B6A A;  2V3X A;  2EVC A;  2GA2 A;  1C22 A;  5CNX A;  4U75 A;  4MAT A;  1WL6 A;  3MR1 A;  4FO8 A;  4RZY A;  4U73 A;  3ROR A;  3FM3 A;  3D27 A;  5JI6 A;  1MAT A;  2DFI A;  2Q93 A;  3RVA A;  3PKC A;  4PV4 A;  2NQ6 A;  4A6W A;  2BH3 A;  3TAV A;  2V3Z A;  4FO7 A;  3S6B A;  4QR8 A;  4U6C A;  1Y1N A;  1XGS A;  2Q95 A;  4U6W A;  2G6P A;  2Q8K A;  1QXY A;  4R60 A;  4ZWO A;  4ZWU A;  4U70 A;  3Q6D A;  2GGB A;  2BB7 A;  2IW2 A;  2BWX A;  3IU9 A;  2GG8 A;  1XNZ A;  4JUQ A;  2GU4 A;  2BWS A;  1QXW A;  2BWV A;  1KP0 A;  1YJ3 A;  2Q94 A;  2BHB A;  3MX6 A;  4A6V A;  2BWW A;  1YW9 A;  1BOA A;  2OKN A;  4U69 A;  4FLI A;  3PKE A;  2BWU A;  3TB5 A;  2OAZ A;  1R5H A;  2BN7 A;  5CDE A;  4IKR A;  2EVM A;  1A16 A;  4PNC A;  4U6E A;  4IKU A;  1WKM A;  5D6F A;  2BHA A;  5JFR A;  1WY2 A;  3IU8 A;  3CTZ A;  1C21 A;  1C24 A;  4ZWP A;  4FUK A;  4S2R P;  5FCF A;  1XGN A;  2B3L A;  5D6E A;  2BWT A;  4IEC A;  5CIK A;  2Q92 A;  4Z7M A;  1KQ9 A;  4S01 A;  3L7G A;  1M35 A;  1CHM A;  2Q96 A;  4IF7 A;  3BIT A;  1JAW A;  5CDL A;  2GU5 A;  3MAT A;  2BHC A;  1WL9 A;  2GG7 A;  1KQ0 A;  2P9A A;  2B3H A;  1WBQ A;  2EA4 A;  1YW7 A;  1R5G A;  2BHD A;  2B3K A;  3CB6 A;  3L24 A;  4OOK A;  4IKT A;  4KM3 A;  3FMQ A;  4U6J A;  3FMR A;  2GG9 A;  2GG3 A;  1PV9 A;  4FLL A;  1WLR A;  1XGO A;  2GTX A;  4U6Z A;  2V6C A;  1XGM A;  3IG4 A; 
#chains in the Genus database with same CATH topology
 1N51 A;  3PKB A;  1B59 A;  3BIP A;  1W7V A;  1C27 A;  2P99 A;  4RZZ A;  4U76 A;  2EA2 A;  3CB5 A;  5CLS A;  5CE6 A;  4IU6 A;  4U1B A;  2EVO A;  4ZNG A;  2GGC A;  2V3Y A;  2NQ7 A;  3PKA A;  4FLK A;  2GU7 A;  4B28 A;  1C23 A;  2P98 A;  2HOW A;  1YW8 A;  4S2T P;  5E5B A;  3PKD A;  2ADU A;  2BWY A;  1W2M A;  4IKS A;  1QXZ A;  2GG0 A;  4IDY A;  4S00 A;  1O0X A;  4FLJ A;  3BIQ A;  1QZY A;  2GG2 A;  1YVM A;  2ZSG A;  4HXX A;  4FKC A;  5JHU A;  2GZ5 A;  5FCH A;  4EGE A;  2GG5 A;  5CDV A;  1R58 A;  2GU6 A;  2MAT A;  3IU7 A;  1BN5 A;  1WN1 A;  4IPA A;  4RGZ 1;  4U71 A;  1B6A A;  2V3X A;  2EVC A;  2GA2 A;  1C22 A;  5CNX A;  4U75 A;  4MAT A;  1WL6 A;  3MR1 A;  4FO8 A;  4RZY A;  4U73 A;  3ROR A;  3FM3 A;  3D27 A;  5JI6 A;  1MAT A;  2DFI A;  2Q93 A;  3RVA A;  3PKC A;  4PV4 A;  2NQ6 A;  4A6W A;  2BH3 A;  3TAV A;  2V3Z A;  4FO7 A;  3S6B A;  4QR8 A;  4U6C A;  1Y1N A;  1XGS A;  2Q95 A;  4U6W A;  2G6P A;  2Q8K A;  1QXY A;  4R60 A;  4ZWO A;  4ZWU A;  4U70 A;  3Q6D A;  2GGB A;  2BB7 A;  2IW2 A;  2BWX A;  3IU9 A;  2GG8 A;  1XNZ A;  4JUQ A;  2GU4 A;  2BWS A;  1QXW A;  2BWV A;  1KP0 A;  1YJ3 A;  2Q94 A;  2BHB A;  3MX6 A;  4A6V A;  2BWW A;  1YW9 A;  1BOA A;  2OKN A;  4U69 A;  4FLI A;  3PKE A;  2BWU A;  3TB5 A;  2OAZ A;  1R5H A;  2BN7 A;  5CDE A;  4IKR A;  2EVM A;  1A16 A;  4PNC A;  4U6E A;  4IKU A;  1WKM A;  5D6F A;  2BHA A;  5JFR A;  1WY2 A;  3IU8 A;  3CTZ A;  1C21 A;  1C24 A;  4ZWP A;  4FUK A;  4S2R P;  5FCF A;  1XGN A;  2B3L A;  5D6E A;  2BWT A;  4IEC A;  5CIK A;  2Q92 A;  4Z7M A;  1KQ9 A;  4S01 A;  3L7G A;  1M35 A;  1CHM A;  2Q96 A;  4IF7 A;  3BIT A;  1JAW A;  5CDL A;  2GU5 A;  3MAT A;  2BHC A;  1WL9 A;  2GG7 A;  1KQ0 A;  2P9A A;  2B3H A;  1WBQ A;  2EA4 A;  1YW7 A;  1R5G A;  2BHD A;  2B3K A;  3CB6 A;  3L24 A;  4OOK A;  4IKT A;  4KM3 A;  3FMQ A;  4U6J A;  3FMR A;  2GG9 A;  2GG3 A;  1PV9 A;  4FLL A;  1WLR A;  1XGO A;  2GTX A;  4U6Z A;  2V6C A;  1XGM A;  3IG4 A; 
#chains in the Genus database with same CATH homology
 1N51 A;  3PKB A;  1B59 A;  3BIP A;  1W7V A;  1C27 A;  2P99 A;  4RZZ A;  4U76 A;  2EA2 A;  3CB5 A;  5CLS A;  5CE6 A;  4IU6 A;  4U1B A;  2EVO A;  4ZNG A;  2GGC A;  2V3Y A;  2NQ7 A;  3PKA A;  4FLK A;  2GU7 A;  4B28 A;  1C23 A;  2P98 A;  2HOW A;  1YW8 A;  4S2T P;  5E5B A;  3PKD A;  2ADU A;  2BWY A;  1W2M A;  4IKS A;  1QXZ A;  2GG0 A;  4IDY A;  4S00 A;  1O0X A;  4FLJ A;  3BIQ A;  1QZY A;  2GG2 A;  1YVM A;  2ZSG A;  4HXX A;  4FKC A;  5JHU A;  2GZ5 A;  5FCH A;  4EGE A;  2GG5 A;  5CDV A;  1R58 A;  2GU6 A;  2MAT A;  3IU7 A;  1BN5 A;  1WN1 A;  4IPA A;  4RGZ 1;  4U71 A;  1B6A A;  2V3X A;  2EVC A;  2GA2 A;  1C22 A;  5CNX A;  4U75 A;  4MAT A;  1WL6 A;  3MR1 A;  4FO8 A;  4RZY A;  4U73 A;  3ROR A;  3FM3 A;  3D27 A;  5JI6 A;  1MAT A;  2DFI A;  2Q93 A;  3RVA A;  3PKC A;  4PV4 A;  2NQ6 A;  4A6W A;  2BH3 A;  3TAV A;  2V3Z A;  4FO7 A;  3S6B A;  4QR8 A;  4U6C A;  1Y1N A;  1XGS A;  2Q95 A;  4U6W A;  2G6P A;  2Q8K A;  1QXY A;  4R60 A;  4ZWO A;  4ZWU A;  4U70 A;  3Q6D A;  2GGB A;  2BB7 A;  2IW2 A;  2BWX A;  3IU9 A;  2GG8 A;  1XNZ A;  4JUQ A;  2GU4 A;  2BWS A;  1QXW A;  2BWV A;  1KP0 A;  1YJ3 A;  2Q94 A;  2BHB A;  3MX6 A;  4A6V A;  2BWW A;  1YW9 A;  1BOA A;  2OKN A;  4U69 A;  4FLI A;  3PKE A;  2BWU A;  3TB5 A;  2OAZ A;  1R5H A;  2BN7 A;  5CDE A;  4IKR A;  2EVM A;  1A16 A;  4PNC A;  4U6E A;  4IKU A;  1WKM A;  5D6F A;  2BHA A;  5JFR A;  1WY2 A;  3IU8 A;  3CTZ A;  1C21 A;  1C24 A;  4ZWP A;  4FUK A;  4S2R P;  5FCF A;  1XGN A;  2B3L A;  5D6E A;  2BWT A;  4IEC A;  5CIK A;  2Q92 A;  4Z7M A;  1KQ9 A;  4S01 A;  3L7G A;  1M35 A;  1CHM A;  2Q96 A;  4IF7 A;  3BIT A;  1JAW A;  5CDL A;  2GU5 A;  3MAT A;  2BHC A;  1WL9 A;  2GG7 A;  1KQ0 A;  2P9A A;  2B3H A;  1WBQ A;  2EA4 A;  1YW7 A;  1R5G A;  2BHD A;  2B3K A;  3CB6 A;  3L24 A;  4OOK A;  4IKT A;  4KM3 A;  3FMQ A;  4U6J A;  3FMR A;  2GG9 A;  2GG3 A;  1PV9 A;  4FLL A;  1WLR A;  1XGO A;  2GTX A;  4U6Z A;  2V6C A;  1XGM A;  3IG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...