1C21A

E. coli methionine aminopeptidase: methionine complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c21A00
4MATA 1BOAA 4IECA 4A6VA 4B28A 2B3HA 3TB5A 2GU4A 5CIKA 2GU5A 2Q94A 4ZWOA 2Q93A 3PKAA 4RGZ1 4S00A 1PV9A 2NQ7A 1QZYA 1C22A 1WBQA 2BB7A 4FLJA 4IKRA 4U6WA 2BHAA 2BWUA 3CB6A 3PKCA 2GG7A 4U70A 4U73A 4KM3A 1QXYA 5D6EA 2BWSA 4U75A 4JUQA 3BIQA 1XNZA 2GG8A 2V6CA 2GG3A 4FLLA 1B59A 2MATA 4U6JA 1YW8A 2Q96A 1WKMA 2IW2A 1C24A 1MATA 1WY2A 4IKUA 3L7GA 3MATA 2Q8KA 2G6PA 3MR1A 3TAVA 5CDLA 4IKTA 4IU6A 1C23A 3MX6A 1W7VA 2BHDA 1YJ3A 4R60A 2BWYA 3RVAA 1XGMA 2GGCA 3IU9A 4RZYA 5CDVA 1XGSA 2BWVA 2EVCA 2GZ5A 3D27A 1N51A 4QR8A 2V3XA 4S2RP 4U6ZA 4IPAA 1A16A 5CDEA 1CHMA 1R5GA 1C21A 1WLRA 2P99A 2V3ZA 4FLIA 4FLKA 4U69A 2EVMA 1Y1NA 5FCHA 4U71A 5FCFA 5JI6A 2GG9A 3FMQA 4OOKA 5D6FA 2GG5A 2BWTA 4ZWUA 2GU7A 2DFIA 4IF7A 2Q95A 3CB5A 4IDYA 3FM3A 3PKEA 1KQ0A 4PNCA 2Q92A 1QXWA 2ADUA 2OAZA 1R5HA 5E5BA 1QXZA 1JAWA 2GTXA 1XGNA 1C27A 4RZZA 3L24A 1M35A 5CNXA 1KP0A 2V3YA 4PV4A 2BH3A 4S01A 2B3LA 2BWXA 2GG0A 3IU7A 1BN5A 3Q6DA 4ZNGA 2GG2A 4U76A 5CLSA 1KQ9A 4U6CA 2EA2A 4U1BA 1O0XA 4S2TP 3FMRA 4HXXA 4ZWPA 1WL6A 2BHCA 1B6AA 1YVMA 4FO7A 2ZSGA 2BHBA 2EVOA 3BIPA 3IG4A 3IU8A 4IKSA 4EGEA 2B3KA 5JHUA 2P9AA 2OKNA 3PKBA 1WL9A 2NQ6A 2HOWA 2BN7A 4FO8A 2GA2A 1YW7A 1YW9A 5CE6A 3S6BA 3PKDA 2GGBA 1WN1A 5JFRA 4FKCA 2GU6A 1R58A 4A6WA 1XGOA 3BITA 3CTZA 4Z7MA 2BWWA 1W2MA 4FUKA 4U6EA 2P98A 3RORA 2EA4A
chains in the Genus database with same CATH superfamily
4MATA 1BOAA 4IECA 4A6VA 4B28A 2B3HA 3TB5A 2GU4A 5CIKA 2GU5A 2Q94A 4ZWOA 2Q93A 3PKAA 4RGZ1 4S00A 1PV9A 2NQ7A 1QZYA 1C22A 1WBQA 2BB7A 4FLJA 4IKRA 4U6WA 2BHAA 2BWUA 3CB6A 3PKCA 2GG7A 4U70A 4U73A 4KM3A 1QXYA 5D6EA 2BWSA 4U75A 4JUQA 3BIQA 1XNZA 2GG8A 2V6CA 2GG3A 4FLLA 1B59A 2MATA 4U6JA 1YW8A 2Q96A 1WKMA 2IW2A 1C24A 1MATA 1WY2A 4IKUA 3L7GA 3MATA 2Q8KA 2G6PA 3MR1A 3TAVA 5CDLA 4IKTA 4IU6A 1C23A 3MX6A 1W7VA 2BHDA 1YJ3A 4R60A 2BWYA 3RVAA 1XGMA 2GGCA 3IU9A 4RZYA 5CDVA 1XGSA 2BWVA 2EVCA 2GZ5A 3D27A 1N51A 4QR8A 2V3XA 4S2RP 4U6ZA 4IPAA 1A16A 5CDEA 1CHMA 1R5GA 1C21A 1WLRA 2P99A 2V3ZA 4FLIA 4FLKA 4U69A 2EVMA 1Y1NA 5FCHA 4U71A 5FCFA 5JI6A 2GG9A 3FMQA 4OOKA 5D6FA 2GG5A 2BWTA 4ZWUA 2GU7A 2DFIA 4IF7A 2Q95A 3CB5A 4IDYA 3FM3A 3PKEA 1KQ0A 4PNCA 2Q92A 1QXWA 2ADUA 2OAZA 1R5HA 5E5BA 1QXZA 1JAWA 2GTXA 1XGNA 1C27A 4RZZA 3L24A 1M35A 5CNXA 1KP0A 2V3YA 4PV4A 2BH3A 4S01A 2B3LA 2BWXA 2GG0A 3IU7A 1BN5A 3Q6DA 4ZNGA 2GG2A 4U76A 5CLSA 1KQ9A 4U6CA 2EA2A 4U1BA 1O0XA 4S2TP 3FMRA 4HXXA 4ZWPA 1WL6A 2BHCA 1B6AA 1YVMA 4FO7A 2ZSGA 2BHBA 2EVOA 3BIPA 3IG4A 3IU8A 4IKSA 4EGEA 2B3KA 5JHUA 2P9AA 2OKNA 3PKBA 1WL9A 2NQ6A 2HOWA 2BN7A 4FO8A 2GA2A 1YW7A 1YW9A 5CE6A 3S6BA 3PKDA 2GGBA 1WN1A 5JFRA 4FKCA 2GU6A 1R58A 4A6WA 1XGOA 3BITA 3CTZA 4Z7MA 2BWWA 1W2MA 4FUKA 4U6EA 2P98A 3RORA 2EA4A
chains in the Genus database with same CATH topology
4MATA 1BOAA 4IECA 4A6VA 4B28A 2B3HA 3TB5A 2GU4A 5CIKA 2GU5A 2Q94A 4ZWOA 2Q93A 3PKAA 4RGZ1 4S00A 1PV9A 2NQ7A 1QZYA 1C22A 1WBQA 2BB7A 4FLJA 4IKRA 4U6WA 2BHAA 2BWUA 3CB6A 3PKCA 2GG7A 4U70A 4U73A 4KM3A 1QXYA 5D6EA 2BWSA 4U75A 4JUQA 3BIQA 1XNZA 2GG8A 2V6CA 2GG3A 4FLLA 1B59A 2MATA 4U6JA 1YW8A 2Q96A 1WKMA 2IW2A 1C24A 1MATA 1WY2A 4IKUA 3L7GA 3MATA 2Q8KA 2G6PA 3MR1A 3TAVA 5CDLA 4IKTA 4IU6A 1C23A 3MX6A 1W7VA 2BHDA 1YJ3A 4R60A 2BWYA 3RVAA 1XGMA 2GGCA 3IU9A 4RZYA 5CDVA 1XGSA 2BWVA 2EVCA 2GZ5A 3D27A 1N51A 4QR8A 2V3XA 4S2RP 4U6ZA 4IPAA 1A16A 5CDEA 1CHMA 1R5GA 1C21A 1WLRA 2P99A 2V3ZA 4FLIA 4FLKA 4U69A 2EVMA 1Y1NA 5FCHA 4U71A 5FCFA 5JI6A 2GG9A 3FMQA 4OOKA 5D6FA 2GG5A 2BWTA 4ZWUA 2GU7A 2DFIA 4IF7A 2Q95A 3CB5A 4IDYA 3FM3A 3PKEA 1KQ0A 4PNCA 2Q92A 1QXWA 2ADUA 2OAZA 1R5HA 5E5BA 1QXZA 1JAWA 2GTXA 1XGNA 1C27A 4RZZA 3L24A 1M35A 5CNXA 1KP0A 2V3YA 4PV4A 2BH3A 4S01A 2B3LA 2BWXA 2GG0A 3IU7A 1BN5A 3Q6DA 4ZNGA 2GG2A 4U76A 5CLSA 1KQ9A 4U6CA 2EA2A 4U1BA 1O0XA 4S2TP 3FMRA 4HXXA 4ZWPA 1WL6A 2BHCA 1B6AA 1YVMA 4FO7A 2ZSGA 2BHBA 2EVOA 3BIPA 3IG4A 3IU8A 4IKSA 4EGEA 2B3KA 5JHUA 2P9AA 2OKNA 3PKBA 1WL9A 2NQ6A 2HOWA 2BN7A 4FO8A 2GA2A 1YW7A 1YW9A 5CE6A 3S6BA 3PKDA 2GGBA 1WN1A 5JFRA 4FKCA 2GU6A 1R58A 4A6WA 1XGOA 3BITA 3CTZA 4Z7MA 2BWWA 1W2MA 4FUKA 4U6EA 2P98A 3RORA 2EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAT A;  1BOA A;  4IEC A;  4A6V A;  4B28 A;  2B3H A;  3TB5 A;  2GU4 A;  5CIK A;  2GU5 A;  2Q94 A;  4ZWO A;  2Q93 A;  3PKA A;  4RGZ 1;  4S00 A;  1PV9 A;  2NQ7 A;  1QZY A;  1C22 A;  1WBQ A;  2BB7 A;  4FLJ A;  4IKR A;  4U6W A;  2BHA A;  2BWU A;  3CB6 A;  3PKC A;  2GG7 A;  4U70 A;  4U73 A;  4KM3 A;  1QXY A;  5D6E A;  2BWS A;  4U75 A;  4JUQ A;  3BIQ A;  1XNZ A;  2GG8 A;  2V6C A;  2GG3 A;  4FLL A;  1B59 A;  2MAT A;  4U6J A;  1YW8 A;  2Q96 A;  1WKM A;  2IW2 A;  1C24 A;  1MAT A;  1WY2 A;  4IKU A;  3L7G A;  3MAT A;  2Q8K A;  2G6P A;  3MR1 A;  3TAV A;  5CDL A;  4IKT A;  4IU6 A;  1C23 A;  3MX6 A;  1W7V A;  2BHD A;  1YJ3 A;  4R60 A;  2BWY A;  3RVA A;  1XGM A;  2GGC A;  3IU9 A;  4RZY A;  5CDV A;  1XGS A;  2BWV A;  2EVC A;  2GZ5 A;  3D27 A;  1N51 A;  4QR8 A;  2V3X A;  4S2R P;  4U6Z A;  4IPA A;  1A16 A;  5CDE A;  1CHM A;  1R5G A;  1C21 A;  1WLR A;  2P99 A;  2V3Z A;  4FLI A;  4FLK A;  4U69 A;  2EVM A;  1Y1N A;  5FCH A;  4U71 A;  5FCF A;  5JI6 A;  2GG9 A;  3FMQ A;  4OOK A;  5D6F A;  2GG5 A;  2BWT A;  4ZWU A;  2GU7 A;  2DFI A;  4IF7 A;  2Q95 A;  3CB5 A;  4IDY A;  3FM3 A;  3PKE A;  1KQ0 A;  4PNC A;  2Q92 A;  1QXW A;  2ADU A;  2OAZ A;  1R5H A;  5E5B A;  1QXZ A;  1JAW A;  2GTX A;  1XGN A;  1C27 A;  4RZZ A;  3L24 A;  1M35 A;  5CNX A;  1KP0 A;  2V3Y A;  4PV4 A;  2BH3 A;  4S01 A;  2B3L A;  2BWX A;  2GG0 A;  3IU7 A;  1BN5 A;  3Q6D A;  4ZNG A;  2GG2 A;  4U76 A;  5CLS A;  1KQ9 A;  4U6C A;  2EA2 A;  4U1B A;  1O0X A;  4S2T P;  3FMR A;  4HXX A;  4ZWP A;  1WL6 A;  2BHC A;  1B6A A;  1YVM A;  4FO7 A;  2ZSG A;  2BHB A;  2EVO A;  3BIP A;  3IG4 A;  3IU8 A;  4IKS A;  4EGE A;  2B3K A;  5JHU A;  2P9A A;  2OKN A;  3PKB A;  1WL9 A;  2NQ6 A;  2HOW A;  2BN7 A;  4FO8 A;  2GA2 A;  1YW7 A;  1YW9 A;  5CE6 A;  3S6B A;  3PKD A;  2GGB A;  1WN1 A;  5JFR A;  4FKC A;  2GU6 A;  1R58 A;  4A6W A;  1XGO A;  3BIT A;  3CTZ A;  4Z7M A;  2BWW A;  1W2M A;  4FUK A;  4U6E A;  2P98 A;  3ROR A;  2EA4 A; 
#chains in the Genus database with same CATH topology
 4MAT A;  1BOA A;  4IEC A;  4A6V A;  4B28 A;  2B3H A;  3TB5 A;  2GU4 A;  5CIK A;  2GU5 A;  2Q94 A;  4ZWO A;  2Q93 A;  3PKA A;  4RGZ 1;  4S00 A;  1PV9 A;  2NQ7 A;  1QZY A;  1C22 A;  1WBQ A;  2BB7 A;  4FLJ A;  4IKR A;  4U6W A;  2BHA A;  2BWU A;  3CB6 A;  3PKC A;  2GG7 A;  4U70 A;  4U73 A;  4KM3 A;  1QXY A;  5D6E A;  2BWS A;  4U75 A;  4JUQ A;  3BIQ A;  1XNZ A;  2GG8 A;  2V6C A;  2GG3 A;  4FLL A;  1B59 A;  2MAT A;  4U6J A;  1YW8 A;  2Q96 A;  1WKM A;  2IW2 A;  1C24 A;  1MAT A;  1WY2 A;  4IKU A;  3L7G A;  3MAT A;  2Q8K A;  2G6P A;  3MR1 A;  3TAV A;  5CDL A;  4IKT A;  4IU6 A;  1C23 A;  3MX6 A;  1W7V A;  2BHD A;  1YJ3 A;  4R60 A;  2BWY A;  3RVA A;  1XGM A;  2GGC A;  3IU9 A;  4RZY A;  5CDV A;  1XGS A;  2BWV A;  2EVC A;  2GZ5 A;  3D27 A;  1N51 A;  4QR8 A;  2V3X A;  4S2R P;  4U6Z A;  4IPA A;  1A16 A;  5CDE A;  1CHM A;  1R5G A;  1C21 A;  1WLR A;  2P99 A;  2V3Z A;  4FLI A;  4FLK A;  4U69 A;  2EVM A;  1Y1N A;  5FCH A;  4U71 A;  5FCF A;  5JI6 A;  2GG9 A;  3FMQ A;  4OOK A;  5D6F A;  2GG5 A;  2BWT A;  4ZWU A;  2GU7 A;  2DFI A;  4IF7 A;  2Q95 A;  3CB5 A;  4IDY A;  3FM3 A;  3PKE A;  1KQ0 A;  4PNC A;  2Q92 A;  1QXW A;  2ADU A;  2OAZ A;  1R5H A;  5E5B A;  1QXZ A;  1JAW A;  2GTX A;  1XGN A;  1C27 A;  4RZZ A;  3L24 A;  1M35 A;  5CNX A;  1KP0 A;  2V3Y A;  4PV4 A;  2BH3 A;  4S01 A;  2B3L A;  2BWX A;  2GG0 A;  3IU7 A;  1BN5 A;  3Q6D A;  4ZNG A;  2GG2 A;  4U76 A;  5CLS A;  1KQ9 A;  4U6C A;  2EA2 A;  4U1B A;  1O0X A;  4S2T P;  3FMR A;  4HXX A;  4ZWP A;  1WL6 A;  2BHC A;  1B6A A;  1YVM A;  4FO7 A;  2ZSG A;  2BHB A;  2EVO A;  3BIP A;  3IG4 A;  3IU8 A;  4IKS A;  4EGE A;  2B3K A;  5JHU A;  2P9A A;  2OKN A;  3PKB A;  1WL9 A;  2NQ6 A;  2HOW A;  2BN7 A;  4FO8 A;  2GA2 A;  1YW7 A;  1YW9 A;  5CE6 A;  3S6B A;  3PKD A;  2GGB A;  1WN1 A;  5JFR A;  4FKC A;  2GU6 A;  1R58 A;  4A6W A;  1XGO A;  3BIT A;  3CTZ A;  4Z7M A;  2BWW A;  1W2M A;  4FUK A;  4U6E A;  2P98 A;  3ROR A;  2EA4 A; 
#chains in the Genus database with same CATH homology
 4MAT A;  1BOA A;  4IEC A;  4A6V A;  4B28 A;  2B3H A;  3TB5 A;  2GU4 A;  5CIK A;  2GU5 A;  2Q94 A;  4ZWO A;  2Q93 A;  3PKA A;  4RGZ 1;  4S00 A;  1PV9 A;  2NQ7 A;  1QZY A;  1C22 A;  1WBQ A;  2BB7 A;  4FLJ A;  4IKR A;  4U6W A;  2BHA A;  2BWU A;  3CB6 A;  3PKC A;  2GG7 A;  4U70 A;  4U73 A;  4KM3 A;  1QXY A;  5D6E A;  2BWS A;  4U75 A;  4JUQ A;  3BIQ A;  1XNZ A;  2GG8 A;  2V6C A;  2GG3 A;  4FLL A;  1B59 A;  2MAT A;  4U6J A;  1YW8 A;  2Q96 A;  1WKM A;  2IW2 A;  1C24 A;  1MAT A;  1WY2 A;  4IKU A;  3L7G A;  3MAT A;  2Q8K A;  2G6P A;  3MR1 A;  3TAV A;  5CDL A;  4IKT A;  4IU6 A;  1C23 A;  3MX6 A;  1W7V A;  2BHD A;  1YJ3 A;  4R60 A;  2BWY A;  3RVA A;  1XGM A;  2GGC A;  3IU9 A;  4RZY A;  5CDV A;  1XGS A;  2BWV A;  2EVC A;  2GZ5 A;  3D27 A;  1N51 A;  4QR8 A;  2V3X A;  4S2R P;  4U6Z A;  4IPA A;  1A16 A;  5CDE A;  1CHM A;  1R5G A;  1C21 A;  1WLR A;  2P99 A;  2V3Z A;  4FLI A;  4FLK A;  4U69 A;  2EVM A;  1Y1N A;  5FCH A;  4U71 A;  5FCF A;  5JI6 A;  2GG9 A;  3FMQ A;  4OOK A;  5D6F A;  2GG5 A;  2BWT A;  4ZWU A;  2GU7 A;  2DFI A;  4IF7 A;  2Q95 A;  3CB5 A;  4IDY A;  3FM3 A;  3PKE A;  1KQ0 A;  4PNC A;  2Q92 A;  1QXW A;  2ADU A;  2OAZ A;  1R5H A;  5E5B A;  1QXZ A;  1JAW A;  2GTX A;  1XGN A;  1C27 A;  4RZZ A;  3L24 A;  1M35 A;  5CNX A;  1KP0 A;  2V3Y A;  4PV4 A;  2BH3 A;  4S01 A;  2B3L A;  2BWX A;  2GG0 A;  3IU7 A;  1BN5 A;  3Q6D A;  4ZNG A;  2GG2 A;  4U76 A;  5CLS A;  1KQ9 A;  4U6C A;  2EA2 A;  4U1B A;  1O0X A;  4S2T P;  3FMR A;  4HXX A;  4ZWP A;  1WL6 A;  2BHC A;  1B6A A;  1YVM A;  4FO7 A;  2ZSG A;  2BHB A;  2EVO A;  3BIP A;  3IG4 A;  3IU8 A;  4IKS A;  4EGE A;  2B3K A;  5JHU A;  2P9A A;  2OKN A;  3PKB A;  1WL9 A;  2NQ6 A;  2HOW A;  2BN7 A;  4FO8 A;  2GA2 A;  1YW7 A;  1YW9 A;  5CE6 A;  3S6B A;  3PKD A;  2GGB A;  1WN1 A;  5JFR A;  4FKC A;  2GU6 A;  1R58 A;  4A6W A;  1XGO A;  3BIT A;  3CTZ A;  4Z7M A;  2BWW A;  1W2M A;  4FUK A;  4U6E A;  2P98 A;  3ROR A;  2EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...