1C22A

E. coli methionine aminopeptidase: trifluoromethionine complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c22A00
2BHBA 4U71A 3TB5A 4U70A 4OOKA 5FCFA 2GG7A 4PV4A 4S2RP 2V3YA 2OKNA 2GTXA 3Q6DA 2GU5A 2EVOA 2B3LA 4S01A 2V3XA 2GA2A 5FCHA 2GZ5A 3BITA 3IU7A 4FUKA 5CE6A 4IKSA 4S00A 5CNXA 2GG8A 4ZWUA 1QXWA 2GGBA 4U73A 1BOAA 2BB7A 4KM3A 2HOWA 4A6WA 1O0XA 5CDEA 2P98A 2GG9A 1N51A 4U6JA 2GG0A 4MATA 1YVMA 3FM3A 1WL6A 5CIKA 1KQ0A 2BWTA 4PNCA 1MATA 2BHCA 2GU7A 2GG2A 1YW7A 2B3HA 2DFIA 1YW9A 2NQ6A 1WY2A 1M35A 4Z7MA 1Y1NA 2BWXA 5CDVA 1CHMA 2BN7A 3CB6A 5D6FA 2P99A 1WBQA 2V3ZA 2GU4A 4QR8A 2P9AA 1XGSA 2GG3A 4ZWPA 3D27A 1C23A 4R60A 2BWSA 2IW2A 4U6EA 5JI6A 4JUQA 2Q92A 3S6BA 4IKUA 2BHAA 2G6PA 3RORA 1PV9A 3PKCA 1XNZA 1R58A 4FO8A 4FLJA 4RGZ1 4U6ZA 5CDLA 4B28A 3RVAA 1C27A 4FLKA 2EA4A 1B59A 2NQ7A 1KQ9A 2MATA 3IU8A 4FLLA 1BN5A 1A16A 2Q8KA 2BWWA 1W7VA 3L24A 2ZSGA 1XGMA 1C21A 4ZNGA 3BIPA 2OAZA 3MATA 5E5BA 4U6CA 4U69A 3CB5A 1WLRA 2Q93A 1B6AA 1JAWA 1QXYA 2BWYA 2B3KA 2V6CA 4FLIA 3TAVA 3BIQA 2EVCA 2GG5A 4U6WA 2Q95A 4U76A 4IPAA 1R5GA 3IG4A 1C24A 1R5HA 3MX6A 2Q94A 1XGOA 3L7GA 2GGCA 3PKBA 2GU6A 2BHDA 2BWVA 4RZZA 4S2TP 3PKAA 4FO7A 4IECA 4HXXA 4IKRA 4RZYA 4U1BA 2EVMA 4A6VA 4FKCA 4IKTA 4ZWOA 3CTZA 4EGEA 2EA2A 5D6EA 1QXZA 1WL9A 1W2MA 2BWUA 1KP0A 5JFRA 3FMRA 1C22A 4U75A 2ADUA 1YJ3A 3IU9A 1WN1A 2BH3A 3FMQA 4IDYA 1WKMA 3PKDA 3MR1A 1XGNA 1YW8A 3PKEA 4IF7A 5JHUA 1QZYA 5CLSA 4IU6A 2Q96A
chains in the Genus database with same CATH superfamily
2BHBA 4U71A 3TB5A 4U70A 4OOKA 5FCFA 2GG7A 4PV4A 4S2RP 2V3YA 2OKNA 2GTXA 3Q6DA 2GU5A 2EVOA 2B3LA 4S01A 2V3XA 2GA2A 5FCHA 2GZ5A 3BITA 3IU7A 4FUKA 5CE6A 4IKSA 4S00A 5CNXA 2GG8A 4ZWUA 1QXWA 2GGBA 4U73A 1BOAA 2BB7A 4KM3A 2HOWA 4A6WA 1O0XA 5CDEA 2P98A 2GG9A 1N51A 4U6JA 2GG0A 4MATA 1YVMA 3FM3A 1WL6A 5CIKA 1KQ0A 2BWTA 4PNCA 1MATA 2BHCA 2GU7A 2GG2A 1YW7A 2B3HA 2DFIA 1YW9A 2NQ6A 1WY2A 1M35A 4Z7MA 1Y1NA 2BWXA 5CDVA 1CHMA 2BN7A 3CB6A 5D6FA 2P99A 1WBQA 2V3ZA 2GU4A 4QR8A 2P9AA 1XGSA 2GG3A 4ZWPA 3D27A 1C23A 4R60A 2BWSA 2IW2A 4U6EA 5JI6A 4JUQA 2Q92A 3S6BA 4IKUA 2BHAA 2G6PA 3RORA 1PV9A 3PKCA 1XNZA 1R58A 4FO8A 4FLJA 4RGZ1 4U6ZA 5CDLA 4B28A 3RVAA 1C27A 4FLKA 2EA4A 1B59A 2NQ7A 1KQ9A 2MATA 3IU8A 4FLLA 1BN5A 1A16A 2Q8KA 2BWWA 1W7VA 3L24A 2ZSGA 1XGMA 1C21A 4ZNGA 3BIPA 2OAZA 3MATA 5E5BA 4U6CA 4U69A 3CB5A 1WLRA 2Q93A 1B6AA 1JAWA 1QXYA 2BWYA 2B3KA 2V6CA 4FLIA 3TAVA 3BIQA 2EVCA 2GG5A 4U6WA 2Q95A 4U76A 4IPAA 1R5GA 3IG4A 1C24A 1R5HA 3MX6A 2Q94A 1XGOA 3L7GA 2GGCA 3PKBA 2GU6A 2BHDA 2BWVA 4RZZA 4S2TP 3PKAA 4FO7A 4IECA 4HXXA 4IKRA 4RZYA 4U1BA 2EVMA 4A6VA 4FKCA 4IKTA 4ZWOA 3CTZA 4EGEA 2EA2A 5D6EA 1QXZA 1WL9A 1W2MA 2BWUA 1KP0A 5JFRA 3FMRA 1C22A 4U75A 2ADUA 1YJ3A 3IU9A 1WN1A 2BH3A 3FMQA 4IDYA 1WKMA 3PKDA 3MR1A 1XGNA 1YW8A 3PKEA 4IF7A 5JHUA 1QZYA 5CLSA 4IU6A 2Q96A
chains in the Genus database with same CATH topology
2BHBA 4U71A 3TB5A 4U70A 4OOKA 5FCFA 2GG7A 4PV4A 4S2RP 2V3YA 2OKNA 2GTXA 3Q6DA 2GU5A 2EVOA 2B3LA 4S01A 2V3XA 2GA2A 5FCHA 2GZ5A 3BITA 3IU7A 4FUKA 5CE6A 4IKSA 4S00A 5CNXA 2GG8A 4ZWUA 1QXWA 2GGBA 4U73A 1BOAA 2BB7A 4KM3A 2HOWA 4A6WA 1O0XA 5CDEA 2P98A 2GG9A 1N51A 4U6JA 2GG0A 4MATA 1YVMA 3FM3A 1WL6A 5CIKA 1KQ0A 2BWTA 4PNCA 1MATA 2BHCA 2GU7A 2GG2A 1YW7A 2B3HA 2DFIA 1YW9A 2NQ6A 1WY2A 1M35A 4Z7MA 1Y1NA 2BWXA 5CDVA 1CHMA 2BN7A 3CB6A 5D6FA 2P99A 1WBQA 2V3ZA 2GU4A 4QR8A 2P9AA 1XGSA 2GG3A 4ZWPA 3D27A 1C23A 4R60A 2BWSA 2IW2A 4U6EA 5JI6A 4JUQA 2Q92A 3S6BA 4IKUA 2BHAA 2G6PA 3RORA 1PV9A 3PKCA 1XNZA 1R58A 4FO8A 4FLJA 4RGZ1 4U6ZA 5CDLA 4B28A 3RVAA 1C27A 4FLKA 2EA4A 1B59A 2NQ7A 1KQ9A 2MATA 3IU8A 4FLLA 1BN5A 1A16A 2Q8KA 2BWWA 1W7VA 3L24A 2ZSGA 1XGMA 1C21A 4ZNGA 3BIPA 2OAZA 3MATA 5E5BA 4U6CA 4U69A 3CB5A 1WLRA 2Q93A 1B6AA 1JAWA 1QXYA 2BWYA 2B3KA 2V6CA 4FLIA 3TAVA 3BIQA 2EVCA 2GG5A 4U6WA 2Q95A 4U76A 4IPAA 1R5GA 3IG4A 1C24A 1R5HA 3MX6A 2Q94A 1XGOA 3L7GA 2GGCA 3PKBA 2GU6A 2BHDA 2BWVA 4RZZA 4S2TP 3PKAA 4FO7A 4IECA 4HXXA 4IKRA 4RZYA 4U1BA 2EVMA 4A6VA 4FKCA 4IKTA 4ZWOA 3CTZA 4EGEA 2EA2A 5D6EA 1QXZA 1WL9A 1W2MA 2BWUA 1KP0A 5JFRA 3FMRA 1C22A 4U75A 2ADUA 1YJ3A 3IU9A 1WN1A 2BH3A 3FMQA 4IDYA 1WKMA 3PKDA 3MR1A 1XGNA 1YW8A 3PKEA 4IF7A 5JHUA 1QZYA 5CLSA 4IU6A 2Q96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHB A;  4U71 A;  3TB5 A;  4U70 A;  4OOK A;  5FCF A;  2GG7 A;  4PV4 A;  4S2R P;  2V3Y A;  2OKN A;  2GTX A;  3Q6D A;  2GU5 A;  2EVO A;  2B3L A;  4S01 A;  2V3X A;  2GA2 A;  5FCH A;  2GZ5 A;  3BIT A;  3IU7 A;  4FUK A;  5CE6 A;  4IKS A;  4S00 A;  5CNX A;  2GG8 A;  4ZWU A;  1QXW A;  2GGB A;  4U73 A;  1BOA A;  2BB7 A;  4KM3 A;  2HOW A;  4A6W A;  1O0X A;  5CDE A;  2P98 A;  2GG9 A;  1N51 A;  4U6J A;  2GG0 A;  4MAT A;  1YVM A;  3FM3 A;  1WL6 A;  5CIK A;  1KQ0 A;  2BWT A;  4PNC A;  1MAT A;  2BHC A;  2GU7 A;  2GG2 A;  1YW7 A;  2B3H A;  2DFI A;  1YW9 A;  2NQ6 A;  1WY2 A;  1M35 A;  4Z7M A;  1Y1N A;  2BWX A;  5CDV A;  1CHM A;  2BN7 A;  3CB6 A;  5D6F A;  2P99 A;  1WBQ A;  2V3Z A;  2GU4 A;  4QR8 A;  2P9A A;  1XGS A;  2GG3 A;  4ZWP A;  3D27 A;  1C23 A;  4R60 A;  2BWS A;  2IW2 A;  4U6E A;  5JI6 A;  4JUQ A;  2Q92 A;  3S6B A;  4IKU A;  2BHA A;  2G6P A;  3ROR A;  1PV9 A;  3PKC A;  1XNZ A;  1R58 A;  4FO8 A;  4FLJ A;  4RGZ 1;  4U6Z A;  5CDL A;  4B28 A;  3RVA A;  1C27 A;  4FLK A;  2EA4 A;  1B59 A;  2NQ7 A;  1KQ9 A;  2MAT A;  3IU8 A;  4FLL A;  1BN5 A;  1A16 A;  2Q8K A;  2BWW A;  1W7V A;  3L24 A;  2ZSG A;  1XGM A;  1C21 A;  4ZNG A;  3BIP A;  2OAZ A;  3MAT A;  5E5B A;  4U6C A;  4U69 A;  3CB5 A;  1WLR A;  2Q93 A;  1B6A A;  1JAW A;  1QXY A;  2BWY A;  2B3K A;  2V6C A;  4FLI A;  3TAV A;  3BIQ A;  2EVC A;  2GG5 A;  4U6W A;  2Q95 A;  4U76 A;  4IPA A;  1R5G A;  3IG4 A;  1C24 A;  1R5H A;  3MX6 A;  2Q94 A;  1XGO A;  3L7G A;  2GGC A;  3PKB A;  2GU6 A;  2BHD A;  2BWV A;  4RZZ A;  4S2T P;  3PKA A;  4FO7 A;  4IEC A;  4HXX A;  4IKR A;  4RZY A;  4U1B A;  2EVM A;  4A6V A;  4FKC A;  4IKT A;  4ZWO A;  3CTZ A;  4EGE A;  2EA2 A;  5D6E A;  1QXZ A;  1WL9 A;  1W2M A;  2BWU A;  1KP0 A;  5JFR A;  3FMR A;  1C22 A;  4U75 A;  2ADU A;  1YJ3 A;  3IU9 A;  1WN1 A;  2BH3 A;  3FMQ A;  4IDY A;  1WKM A;  3PKD A;  3MR1 A;  1XGN A;  1YW8 A;  3PKE A;  4IF7 A;  5JHU A;  1QZY A;  5CLS A;  4IU6 A;  2Q96 A; 
#chains in the Genus database with same CATH topology
 2BHB A;  4U71 A;  3TB5 A;  4U70 A;  4OOK A;  5FCF A;  2GG7 A;  4PV4 A;  4S2R P;  2V3Y A;  2OKN A;  2GTX A;  3Q6D A;  2GU5 A;  2EVO A;  2B3L A;  4S01 A;  2V3X A;  2GA2 A;  5FCH A;  2GZ5 A;  3BIT A;  3IU7 A;  4FUK A;  5CE6 A;  4IKS A;  4S00 A;  5CNX A;  2GG8 A;  4ZWU A;  1QXW A;  2GGB A;  4U73 A;  1BOA A;  2BB7 A;  4KM3 A;  2HOW A;  4A6W A;  1O0X A;  5CDE A;  2P98 A;  2GG9 A;  1N51 A;  4U6J A;  2GG0 A;  4MAT A;  1YVM A;  3FM3 A;  1WL6 A;  5CIK A;  1KQ0 A;  2BWT A;  4PNC A;  1MAT A;  2BHC A;  2GU7 A;  2GG2 A;  1YW7 A;  2B3H A;  2DFI A;  1YW9 A;  2NQ6 A;  1WY2 A;  1M35 A;  4Z7M A;  1Y1N A;  2BWX A;  5CDV A;  1CHM A;  2BN7 A;  3CB6 A;  5D6F A;  2P99 A;  1WBQ A;  2V3Z A;  2GU4 A;  4QR8 A;  2P9A A;  1XGS A;  2GG3 A;  4ZWP A;  3D27 A;  1C23 A;  4R60 A;  2BWS A;  2IW2 A;  4U6E A;  5JI6 A;  4JUQ A;  2Q92 A;  3S6B A;  4IKU A;  2BHA A;  2G6P A;  3ROR A;  1PV9 A;  3PKC A;  1XNZ A;  1R58 A;  4FO8 A;  4FLJ A;  4RGZ 1;  4U6Z A;  5CDL A;  4B28 A;  3RVA A;  1C27 A;  4FLK A;  2EA4 A;  1B59 A;  2NQ7 A;  1KQ9 A;  2MAT A;  3IU8 A;  4FLL A;  1BN5 A;  1A16 A;  2Q8K A;  2BWW A;  1W7V A;  3L24 A;  2ZSG A;  1XGM A;  1C21 A;  4ZNG A;  3BIP A;  2OAZ A;  3MAT A;  5E5B A;  4U6C A;  4U69 A;  3CB5 A;  1WLR A;  2Q93 A;  1B6A A;  1JAW A;  1QXY A;  2BWY A;  2B3K A;  2V6C A;  4FLI A;  3TAV A;  3BIQ A;  2EVC A;  2GG5 A;  4U6W A;  2Q95 A;  4U76 A;  4IPA A;  1R5G A;  3IG4 A;  1C24 A;  1R5H A;  3MX6 A;  2Q94 A;  1XGO A;  3L7G A;  2GGC A;  3PKB A;  2GU6 A;  2BHD A;  2BWV A;  4RZZ A;  4S2T P;  3PKA A;  4FO7 A;  4IEC A;  4HXX A;  4IKR A;  4RZY A;  4U1B A;  2EVM A;  4A6V A;  4FKC A;  4IKT A;  4ZWO A;  3CTZ A;  4EGE A;  2EA2 A;  5D6E A;  1QXZ A;  1WL9 A;  1W2M A;  2BWU A;  1KP0 A;  5JFR A;  3FMR A;  1C22 A;  4U75 A;  2ADU A;  1YJ3 A;  3IU9 A;  1WN1 A;  2BH3 A;  3FMQ A;  4IDY A;  1WKM A;  3PKD A;  3MR1 A;  1XGN A;  1YW8 A;  3PKE A;  4IF7 A;  5JHU A;  1QZY A;  5CLS A;  4IU6 A;  2Q96 A; 
#chains in the Genus database with same CATH homology
 2BHB A;  4U71 A;  3TB5 A;  4U70 A;  4OOK A;  5FCF A;  2GG7 A;  4PV4 A;  4S2R P;  2V3Y A;  2OKN A;  2GTX A;  3Q6D A;  2GU5 A;  2EVO A;  2B3L A;  4S01 A;  2V3X A;  2GA2 A;  5FCH A;  2GZ5 A;  3BIT A;  3IU7 A;  4FUK A;  5CE6 A;  4IKS A;  4S00 A;  5CNX A;  2GG8 A;  4ZWU A;  1QXW A;  2GGB A;  4U73 A;  1BOA A;  2BB7 A;  4KM3 A;  2HOW A;  4A6W A;  1O0X A;  5CDE A;  2P98 A;  2GG9 A;  1N51 A;  4U6J A;  2GG0 A;  4MAT A;  1YVM A;  3FM3 A;  1WL6 A;  5CIK A;  1KQ0 A;  2BWT A;  4PNC A;  1MAT A;  2BHC A;  2GU7 A;  2GG2 A;  1YW7 A;  2B3H A;  2DFI A;  1YW9 A;  2NQ6 A;  1WY2 A;  1M35 A;  4Z7M A;  1Y1N A;  2BWX A;  5CDV A;  1CHM A;  2BN7 A;  3CB6 A;  5D6F A;  2P99 A;  1WBQ A;  2V3Z A;  2GU4 A;  4QR8 A;  2P9A A;  1XGS A;  2GG3 A;  4ZWP A;  3D27 A;  1C23 A;  4R60 A;  2BWS A;  2IW2 A;  4U6E A;  5JI6 A;  4JUQ A;  2Q92 A;  3S6B A;  4IKU A;  2BHA A;  2G6P A;  3ROR A;  1PV9 A;  3PKC A;  1XNZ A;  1R58 A;  4FO8 A;  4FLJ A;  4RGZ 1;  4U6Z A;  5CDL A;  4B28 A;  3RVA A;  1C27 A;  4FLK A;  2EA4 A;  1B59 A;  2NQ7 A;  1KQ9 A;  2MAT A;  3IU8 A;  4FLL A;  1BN5 A;  1A16 A;  2Q8K A;  2BWW A;  1W7V A;  3L24 A;  2ZSG A;  1XGM A;  1C21 A;  4ZNG A;  3BIP A;  2OAZ A;  3MAT A;  5E5B A;  4U6C A;  4U69 A;  3CB5 A;  1WLR A;  2Q93 A;  1B6A A;  1JAW A;  1QXY A;  2BWY A;  2B3K A;  2V6C A;  4FLI A;  3TAV A;  3BIQ A;  2EVC A;  2GG5 A;  4U6W A;  2Q95 A;  4U76 A;  4IPA A;  1R5G A;  3IG4 A;  1C24 A;  1R5H A;  3MX6 A;  2Q94 A;  1XGO A;  3L7G A;  2GGC A;  3PKB A;  2GU6 A;  2BHD A;  2BWV A;  4RZZ A;  4S2T P;  3PKA A;  4FO7 A;  4IEC A;  4HXX A;  4IKR A;  4RZY A;  4U1B A;  2EVM A;  4A6V A;  4FKC A;  4IKT A;  4ZWO A;  3CTZ A;  4EGE A;  2EA2 A;  5D6E A;  1QXZ A;  1WL9 A;  1W2M A;  2BWU A;  1KP0 A;  5JFR A;  3FMR A;  1C22 A;  4U75 A;  2ADU A;  1YJ3 A;  3IU9 A;  1WN1 A;  2BH3 A;  3FMQ A;  4IDY A;  1WKM A;  3PKD A;  3MR1 A;  1XGN A;  1YW8 A;  3PKE A;  4IF7 A;  5JHU A;  1QZY A;  5CLS A;  4IU6 A;  2Q96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...