1C22A

E. coli methionine aminopeptidase: trifluoromethionine complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c22A00
1KQ0A 1YVMA 2BHDA 4IKUA 4U1BA 4EGEA 1KP0A 1W7VA 2GG8A 1Y1NA 1C27A 5CIKA 3CB6A 2GGBA 4QR8A 3FMQA 2GU6A 4IECA 2IW2A 4OOKA 2DFIA 3D27A 2Q8KA 3L24A 1QZYA 1XGOA 2GG7A 2GG0A 2EVCA 3MATA 4IPAA 3CTZA 1XGSA 3IG4A 3BITA 4FUKA 4S01A 4U71A 5CLSA 4ZNGA 3IU7A 4FLIA 4U6WA 4B28A 1B59A 4FLLA 1JAWA 1B6AA 4FLKA 4KM3A 5CNXA 5CDLA 2GZ5A 5CDVA 1WL6A 2MATA 1YJ3A 2NQ7A 2Q94A 3L7GA 2BHAA 1R5HA 2BH3A 1M35A 2Q96A 1WKMA 2EVOA 4S2TP 2V3XA 3PKCA 2P98A 4RGZ1 1YW7A 4IKTA 2BWUA 5FCHA 2GGCA 2BWXA 2G6PA 2BWTA 4PV4A 2Q92A 5CDEA 2OKNA 4U73A 5FCFA 4U69A 4ZWUA 3FM3A 2EA4A 2ADUA 2EVMA 3TB5A 2Q93A 4IKSA 1C21A 1R58A 5E5BA 3PKDA 4FO7A 2V3ZA 2GG9A 3BIQA 1WBQA 1WL9A 3MX6A 2P9AA 4S2RP 1O0XA 3PKBA 4ZWPA 3BIPA 1A16A 1QXYA 3CB5A 2NQ6A 2BHCA 3PKAA 4RZZA 5JFRA 5D6EA 2EA2A 2HOWA 5CE6A 4MATA 1BOAA 1QXWA 1CHMA 2V6CA 3MR1A 1C24A 2V3YA 4HXXA 2BWYA 1WY2A 1WLRA 1C23A 1QXZA 1XNZA 1YW9A 5JI6A 2BB7A 2GG5A 4U70A 2B3KA 3Q6DA 4IKRA 4IU6A 1WN1A 2BHBA 4U75A 4A6WA 2BN7A 2GU7A 4PNCA 4IF7A 2Q95A 4R60A 3TAVA 4A6VA 4U6CA 3IU8A 4U6EA 5D6FA 4FO8A 2GG3A 1C22A 4RZYA 1BN5A 3IU9A 4FKCA 4S00A 4U6ZA 3S6BA 5JHUA 1R5GA 4IDYA 2GU5A 4Z7MA 1PV9A 3PKEA 1MATA 2OAZA 3FMRA 3RVAA 1N51A 4ZWOA 1W2MA 2BWWA 1XGNA 2B3HA 2BWSA 2GTXA 2GU4A 1XGMA 2GG2A 2ZSGA 2B3LA 4FLJA 1YW8A 4U6JA 1KQ9A 2GA2A 3RORA 4U76A 2BWVA 2P99A 4JUQA
chains in the Genus database with same CATH superfamily
1KQ0A 1YVMA 2BHDA 4IKUA 4U1BA 4EGEA 1KP0A 1W7VA 2GG8A 1Y1NA 1C27A 5CIKA 3CB6A 2GGBA 4QR8A 3FMQA 2GU6A 4IECA 2IW2A 4OOKA 2DFIA 3D27A 2Q8KA 3L24A 1QZYA 1XGOA 2GG7A 2GG0A 2EVCA 3MATA 4IPAA 3CTZA 1XGSA 3IG4A 3BITA 4FUKA 4S01A 4U71A 5CLSA 4ZNGA 3IU7A 4FLIA 4U6WA 4B28A 1B59A 4FLLA 1JAWA 1B6AA 4FLKA 4KM3A 5CNXA 5CDLA 2GZ5A 5CDVA 1WL6A 2MATA 1YJ3A 2NQ7A 2Q94A 3L7GA 2BHAA 1R5HA 2BH3A 1M35A 2Q96A 1WKMA 2EVOA 4S2TP 2V3XA 3PKCA 2P98A 4RGZ1 1YW7A 4IKTA 2BWUA 5FCHA 2GGCA 2BWXA 2G6PA 2BWTA 4PV4A 2Q92A 5CDEA 2OKNA 4U73A 5FCFA 4U69A 4ZWUA 3FM3A 2EA4A 2ADUA 2EVMA 3TB5A 2Q93A 4IKSA 1C21A 1R58A 5E5BA 3PKDA 4FO7A 2V3ZA 2GG9A 3BIQA 1WBQA 1WL9A 3MX6A 2P9AA 4S2RP 1O0XA 3PKBA 4ZWPA 3BIPA 1A16A 1QXYA 3CB5A 2NQ6A 2BHCA 3PKAA 4RZZA 5JFRA 5D6EA 2EA2A 2HOWA 5CE6A 4MATA 1BOAA 1QXWA 1CHMA 2V6CA 3MR1A 1C24A 2V3YA 4HXXA 2BWYA 1WY2A 1WLRA 1C23A 1QXZA 1XNZA 1YW9A 5JI6A 2BB7A 2GG5A 4U70A 2B3KA 3Q6DA 4IKRA 4IU6A 1WN1A 2BHBA 4U75A 4A6WA 2BN7A 2GU7A 4PNCA 4IF7A 2Q95A 4R60A 3TAVA 4A6VA 4U6CA 3IU8A 4U6EA 5D6FA 4FO8A 2GG3A 1C22A 4RZYA 1BN5A 3IU9A 4FKCA 4S00A 4U6ZA 3S6BA 5JHUA 1R5GA 4IDYA 2GU5A 4Z7MA 1PV9A 3PKEA 1MATA 2OAZA 3FMRA 3RVAA 1N51A 4ZWOA 1W2MA 2BWWA 1XGNA 2B3HA 2BWSA 2GTXA 2GU4A 1XGMA 2GG2A 2ZSGA 2B3LA 4FLJA 1YW8A 4U6JA 1KQ9A 2GA2A 3RORA 4U76A 2BWVA 2P99A 4JUQA
chains in the Genus database with same CATH topology
1KQ0A 1YVMA 2BHDA 4IKUA 4U1BA 4EGEA 1KP0A 1W7VA 2GG8A 1Y1NA 1C27A 5CIKA 3CB6A 2GGBA 4QR8A 3FMQA 2GU6A 4IECA 2IW2A 4OOKA 2DFIA 3D27A 2Q8KA 3L24A 1QZYA 1XGOA 2GG7A 2GG0A 2EVCA 3MATA 4IPAA 3CTZA 1XGSA 3IG4A 3BITA 4FUKA 4S01A 4U71A 5CLSA 4ZNGA 3IU7A 4FLIA 4U6WA 4B28A 1B59A 4FLLA 1JAWA 1B6AA 4FLKA 4KM3A 5CNXA 5CDLA 2GZ5A 5CDVA 1WL6A 2MATA 1YJ3A 2NQ7A 2Q94A 3L7GA 2BHAA 1R5HA 2BH3A 1M35A 2Q96A 1WKMA 2EVOA 4S2TP 2V3XA 3PKCA 2P98A 4RGZ1 1YW7A 4IKTA 2BWUA 5FCHA 2GGCA 2BWXA 2G6PA 2BWTA 4PV4A 2Q92A 5CDEA 2OKNA 4U73A 5FCFA 4U69A 4ZWUA 3FM3A 2EA4A 2ADUA 2EVMA 3TB5A 2Q93A 4IKSA 1C21A 1R58A 5E5BA 3PKDA 4FO7A 2V3ZA 2GG9A 3BIQA 1WBQA 1WL9A 3MX6A 2P9AA 4S2RP 1O0XA 3PKBA 4ZWPA 3BIPA 1A16A 1QXYA 3CB5A 2NQ6A 2BHCA 3PKAA 4RZZA 5JFRA 5D6EA 2EA2A 2HOWA 5CE6A 4MATA 1BOAA 1QXWA 1CHMA 2V6CA 3MR1A 1C24A 2V3YA 4HXXA 2BWYA 1WY2A 1WLRA 1C23A 1QXZA 1XNZA 1YW9A 5JI6A 2BB7A 2GG5A 4U70A 2B3KA 3Q6DA 4IKRA 4IU6A 1WN1A 2BHBA 4U75A 4A6WA 2BN7A 2GU7A 4PNCA 4IF7A 2Q95A 4R60A 3TAVA 4A6VA 4U6CA 3IU8A 4U6EA 5D6FA 4FO8A 2GG3A 1C22A 4RZYA 1BN5A 3IU9A 4FKCA 4S00A 4U6ZA 3S6BA 5JHUA 1R5GA 4IDYA 2GU5A 4Z7MA 1PV9A 3PKEA 1MATA 2OAZA 3FMRA 3RVAA 1N51A 4ZWOA 1W2MA 2BWWA 1XGNA 2B3HA 2BWSA 2GTXA 2GU4A 1XGMA 2GG2A 2ZSGA 2B3LA 4FLJA 1YW8A 4U6JA 1KQ9A 2GA2A 3RORA 4U76A 2BWVA 2P99A 4JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ0 A;  1YVM A;  2BHD A;  4IKU A;  4U1B A;  4EGE A;  1KP0 A;  1W7V A;  2GG8 A;  1Y1N A;  1C27 A;  5CIK A;  3CB6 A;  2GGB A;  4QR8 A;  3FMQ A;  2GU6 A;  4IEC A;  2IW2 A;  4OOK A;  2DFI A;  3D27 A;  2Q8K A;  3L24 A;  1QZY A;  1XGO A;  2GG7 A;  2GG0 A;  2EVC A;  3MAT A;  4IPA A;  3CTZ A;  1XGS A;  3IG4 A;  3BIT A;  4FUK A;  4S01 A;  4U71 A;  5CLS A;  4ZNG A;  3IU7 A;  4FLI A;  4U6W A;  4B28 A;  1B59 A;  4FLL A;  1JAW A;  1B6A A;  4FLK A;  4KM3 A;  5CNX A;  5CDL A;  2GZ5 A;  5CDV A;  1WL6 A;  2MAT A;  1YJ3 A;  2NQ7 A;  2Q94 A;  3L7G A;  2BHA A;  1R5H A;  2BH3 A;  1M35 A;  2Q96 A;  1WKM A;  2EVO A;  4S2T P;  2V3X A;  3PKC A;  2P98 A;  4RGZ 1;  1YW7 A;  4IKT A;  2BWU A;  5FCH A;  2GGC A;  2BWX A;  2G6P A;  2BWT A;  4PV4 A;  2Q92 A;  5CDE A;  2OKN A;  4U73 A;  5FCF A;  4U69 A;  4ZWU A;  3FM3 A;  2EA4 A;  2ADU A;  2EVM A;  3TB5 A;  2Q93 A;  4IKS A;  1C21 A;  1R58 A;  5E5B A;  3PKD A;  4FO7 A;  2V3Z A;  2GG9 A;  3BIQ A;  1WBQ A;  1WL9 A;  3MX6 A;  2P9A A;  4S2R P;  1O0X A;  3PKB A;  4ZWP A;  3BIP A;  1A16 A;  1QXY A;  3CB5 A;  2NQ6 A;  2BHC A;  3PKA A;  4RZZ A;  5JFR A;  5D6E A;  2EA2 A;  2HOW A;  5CE6 A;  4MAT A;  1BOA A;  1QXW A;  1CHM A;  2V6C A;  3MR1 A;  1C24 A;  2V3Y A;  4HXX A;  2BWY A;  1WY2 A;  1WLR A;  1C23 A;  1QXZ A;  1XNZ A;  1YW9 A;  5JI6 A;  2BB7 A;  2GG5 A;  4U70 A;  2B3K A;  3Q6D A;  4IKR A;  4IU6 A;  1WN1 A;  2BHB A;  4U75 A;  4A6W A;  2BN7 A;  2GU7 A;  4PNC A;  4IF7 A;  2Q95 A;  4R60 A;  3TAV A;  4A6V A;  4U6C A;  3IU8 A;  4U6E A;  5D6F A;  4FO8 A;  2GG3 A;  1C22 A;  4RZY A;  1BN5 A;  3IU9 A;  4FKC A;  4S00 A;  4U6Z A;  3S6B A;  5JHU A;  1R5G A;  4IDY A;  2GU5 A;  4Z7M A;  1PV9 A;  3PKE A;  1MAT A;  2OAZ A;  3FMR A;  3RVA A;  1N51 A;  4ZWO A;  1W2M A;  2BWW A;  1XGN A;  2B3H A;  2BWS A;  2GTX A;  2GU4 A;  1XGM A;  2GG2 A;  2ZSG A;  2B3L A;  4FLJ A;  1YW8 A;  4U6J A;  1KQ9 A;  2GA2 A;  3ROR A;  4U76 A;  2BWV A;  2P99 A;  4JUQ A; 
#chains in the Genus database with same CATH topology
 1KQ0 A;  1YVM A;  2BHD A;  4IKU A;  4U1B A;  4EGE A;  1KP0 A;  1W7V A;  2GG8 A;  1Y1N A;  1C27 A;  5CIK A;  3CB6 A;  2GGB A;  4QR8 A;  3FMQ A;  2GU6 A;  4IEC A;  2IW2 A;  4OOK A;  2DFI A;  3D27 A;  2Q8K A;  3L24 A;  1QZY A;  1XGO A;  2GG7 A;  2GG0 A;  2EVC A;  3MAT A;  4IPA A;  3CTZ A;  1XGS A;  3IG4 A;  3BIT A;  4FUK A;  4S01 A;  4U71 A;  5CLS A;  4ZNG A;  3IU7 A;  4FLI A;  4U6W A;  4B28 A;  1B59 A;  4FLL A;  1JAW A;  1B6A A;  4FLK A;  4KM3 A;  5CNX A;  5CDL A;  2GZ5 A;  5CDV A;  1WL6 A;  2MAT A;  1YJ3 A;  2NQ7 A;  2Q94 A;  3L7G A;  2BHA A;  1R5H A;  2BH3 A;  1M35 A;  2Q96 A;  1WKM A;  2EVO A;  4S2T P;  2V3X A;  3PKC A;  2P98 A;  4RGZ 1;  1YW7 A;  4IKT A;  2BWU A;  5FCH A;  2GGC A;  2BWX A;  2G6P A;  2BWT A;  4PV4 A;  2Q92 A;  5CDE A;  2OKN A;  4U73 A;  5FCF A;  4U69 A;  4ZWU A;  3FM3 A;  2EA4 A;  2ADU A;  2EVM A;  3TB5 A;  2Q93 A;  4IKS A;  1C21 A;  1R58 A;  5E5B A;  3PKD A;  4FO7 A;  2V3Z A;  2GG9 A;  3BIQ A;  1WBQ A;  1WL9 A;  3MX6 A;  2P9A A;  4S2R P;  1O0X A;  3PKB A;  4ZWP A;  3BIP A;  1A16 A;  1QXY A;  3CB5 A;  2NQ6 A;  2BHC A;  3PKA A;  4RZZ A;  5JFR A;  5D6E A;  2EA2 A;  2HOW A;  5CE6 A;  4MAT A;  1BOA A;  1QXW A;  1CHM A;  2V6C A;  3MR1 A;  1C24 A;  2V3Y A;  4HXX A;  2BWY A;  1WY2 A;  1WLR A;  1C23 A;  1QXZ A;  1XNZ A;  1YW9 A;  5JI6 A;  2BB7 A;  2GG5 A;  4U70 A;  2B3K A;  3Q6D A;  4IKR A;  4IU6 A;  1WN1 A;  2BHB A;  4U75 A;  4A6W A;  2BN7 A;  2GU7 A;  4PNC A;  4IF7 A;  2Q95 A;  4R60 A;  3TAV A;  4A6V A;  4U6C A;  3IU8 A;  4U6E A;  5D6F A;  4FO8 A;  2GG3 A;  1C22 A;  4RZY A;  1BN5 A;  3IU9 A;  4FKC A;  4S00 A;  4U6Z A;  3S6B A;  5JHU A;  1R5G A;  4IDY A;  2GU5 A;  4Z7M A;  1PV9 A;  3PKE A;  1MAT A;  2OAZ A;  3FMR A;  3RVA A;  1N51 A;  4ZWO A;  1W2M A;  2BWW A;  1XGN A;  2B3H A;  2BWS A;  2GTX A;  2GU4 A;  1XGM A;  2GG2 A;  2ZSG A;  2B3L A;  4FLJ A;  1YW8 A;  4U6J A;  1KQ9 A;  2GA2 A;  3ROR A;  4U76 A;  2BWV A;  2P99 A;  4JUQ A; 
#chains in the Genus database with same CATH homology
 1KQ0 A;  1YVM A;  2BHD A;  4IKU A;  4U1B A;  4EGE A;  1KP0 A;  1W7V A;  2GG8 A;  1Y1N A;  1C27 A;  5CIK A;  3CB6 A;  2GGB A;  4QR8 A;  3FMQ A;  2GU6 A;  4IEC A;  2IW2 A;  4OOK A;  2DFI A;  3D27 A;  2Q8K A;  3L24 A;  1QZY A;  1XGO A;  2GG7 A;  2GG0 A;  2EVC A;  3MAT A;  4IPA A;  3CTZ A;  1XGS A;  3IG4 A;  3BIT A;  4FUK A;  4S01 A;  4U71 A;  5CLS A;  4ZNG A;  3IU7 A;  4FLI A;  4U6W A;  4B28 A;  1B59 A;  4FLL A;  1JAW A;  1B6A A;  4FLK A;  4KM3 A;  5CNX A;  5CDL A;  2GZ5 A;  5CDV A;  1WL6 A;  2MAT A;  1YJ3 A;  2NQ7 A;  2Q94 A;  3L7G A;  2BHA A;  1R5H A;  2BH3 A;  1M35 A;  2Q96 A;  1WKM A;  2EVO A;  4S2T P;  2V3X A;  3PKC A;  2P98 A;  4RGZ 1;  1YW7 A;  4IKT A;  2BWU A;  5FCH A;  2GGC A;  2BWX A;  2G6P A;  2BWT A;  4PV4 A;  2Q92 A;  5CDE A;  2OKN A;  4U73 A;  5FCF A;  4U69 A;  4ZWU A;  3FM3 A;  2EA4 A;  2ADU A;  2EVM A;  3TB5 A;  2Q93 A;  4IKS A;  1C21 A;  1R58 A;  5E5B A;  3PKD A;  4FO7 A;  2V3Z A;  2GG9 A;  3BIQ A;  1WBQ A;  1WL9 A;  3MX6 A;  2P9A A;  4S2R P;  1O0X A;  3PKB A;  4ZWP A;  3BIP A;  1A16 A;  1QXY A;  3CB5 A;  2NQ6 A;  2BHC A;  3PKA A;  4RZZ A;  5JFR A;  5D6E A;  2EA2 A;  2HOW A;  5CE6 A;  4MAT A;  1BOA A;  1QXW A;  1CHM A;  2V6C A;  3MR1 A;  1C24 A;  2V3Y A;  4HXX A;  2BWY A;  1WY2 A;  1WLR A;  1C23 A;  1QXZ A;  1XNZ A;  1YW9 A;  5JI6 A;  2BB7 A;  2GG5 A;  4U70 A;  2B3K A;  3Q6D A;  4IKR A;  4IU6 A;  1WN1 A;  2BHB A;  4U75 A;  4A6W A;  2BN7 A;  2GU7 A;  4PNC A;  4IF7 A;  2Q95 A;  4R60 A;  3TAV A;  4A6V A;  4U6C A;  3IU8 A;  4U6E A;  5D6F A;  4FO8 A;  2GG3 A;  1C22 A;  4RZY A;  1BN5 A;  3IU9 A;  4FKC A;  4S00 A;  4U6Z A;  3S6B A;  5JHU A;  1R5G A;  4IDY A;  2GU5 A;  4Z7M A;  1PV9 A;  3PKE A;  1MAT A;  2OAZ A;  3FMR A;  3RVA A;  1N51 A;  4ZWO A;  1W2M A;  2BWW A;  1XGN A;  2B3H A;  2BWS A;  2GTX A;  2GU4 A;  1XGM A;  2GG2 A;  2ZSG A;  2B3L A;  4FLJ A;  1YW8 A;  4U6J A;  1KQ9 A;  2GA2 A;  3ROR A;  4U76 A;  2BWV A;  2P99 A;  4JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...