1C24A

E. coli methionine aminopeptidase: methionine phosphinate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c24A00
3IG4A 2OKNA 2IW2A 2EVCA 2BH3A 2GG2A 2GU6A 3IU9A 3PKEA 4U6WA 5CIKA 1YJ3A 2BHBA 2EVMA 4FKCA 4U71A 4ZNGA 4MATA 1JAWA 2BWXA 4JUQA 3CB5A 1KP0A 4PV4A 4U6JA 2DFIA 3MX6A 4FO7A 4OOKA 4EGEA 4IKRA 3D27A 4U76A 2Q92A 1BN5A 1R5GA 2GGBA 4U6EA 5JHUA 4RZYA 2GGCA 3TAVA 3RVAA 4U69A 1WLRA 1MATA 2GU4A 3CTZA 1QZYA 1C24A 2V6CA 3PKAA 4S2TP 2V3YA 4HXXA 4IU6A 1C21A 2BWTA 5CLSA 4U73A 1R58A 1XNZA 3MATA 4U6ZA 2GA2A 2V3XA 3IU8A 3PKBA 1WL6A 1PV9A 3TB5A 4S01A 4B28A 4FLKA 3BIQA 4KM3A 5CNXA 1WBQA 3CB6A 3FMRA 1R5HA 2EVOA 2Q96A 1C23A 1M35A 4IKSA 5FCHA 1WKMA 4ZWUA 1YVMA 1YW9A 4S2RP 2GU5A 2EA2A 2BN7A 5JFRA 1QXWA 4PNCA 5CE6A 2EA4A 3FM3A 2P98A 4R60A 1YW7A 5CDVA 1KQ0A 2B3LA 4IECA 2BHAA 3MR1A 1W7VA 5E5BA 2HOWA 2OAZA 3BITA 1YW8A 2BWUA 1WL9A 4IPAA 2NQ7A 2GG9A 4IKTA 2G6PA 2BHDA 1C22A 2GG8A 1QXYA 1A16A 1XGMA 1KQ9A 2NQ6A 2V3ZA 1B59A 2BWYA 2GG5A 2GZ5A 3S6BA 4ZWOA 2ZSGA 4U6CA 4FO8A 1WY2A 4IKUA 3L7GA 4ZWPA 4FUKA 4RZZA 2GG0A 4IF7A 1WN1A 4U75A 2BWSA 2Q8KA 4FLLA 4IDYA 3IU7A 1BOAA 3FMQA 4A6VA 1O0XA 3PKDA 4QR8A 4A6WA 2ADUA 1B6AA 2GG7A 4FLJA 2Q95A 3Q6DA 1XGSA 2GU7A 4U1BA 2Q93A 2P99A 1XGNA 1QXZA 2BWWA 5CDLA 4U70A 5D6EA 3L24A 2B3HA 2GG3A 2GTXA 5JI6A 3RORA 1Y1NA 4Z7MA 2BHCA 1XGOA 2BB7A 2P9AA 3PKCA 5CDEA 3BIPA 2MATA 2BWVA 2B3KA 4RGZ1 1W2MA 5FCFA 1C27A 2Q94A 4S00A 1CHMA 1N51A 5D6FA 4FLIA
chains in the Genus database with same CATH superfamily
3IG4A 2OKNA 2IW2A 2EVCA 2BH3A 2GG2A 2GU6A 3IU9A 3PKEA 4U6WA 5CIKA 1YJ3A 2BHBA 2EVMA 4FKCA 4U71A 4ZNGA 4MATA 1JAWA 2BWXA 4JUQA 3CB5A 1KP0A 4PV4A 4U6JA 2DFIA 3MX6A 4FO7A 4OOKA 4EGEA 4IKRA 3D27A 4U76A 2Q92A 1BN5A 1R5GA 2GGBA 4U6EA 5JHUA 4RZYA 2GGCA 3TAVA 3RVAA 4U69A 1WLRA 1MATA 2GU4A 3CTZA 1QZYA 1C24A 2V6CA 3PKAA 4S2TP 2V3YA 4HXXA 4IU6A 1C21A 2BWTA 5CLSA 4U73A 1R58A 1XNZA 3MATA 4U6ZA 2GA2A 2V3XA 3IU8A 3PKBA 1WL6A 1PV9A 3TB5A 4S01A 4B28A 4FLKA 3BIQA 4KM3A 5CNXA 1WBQA 3CB6A 3FMRA 1R5HA 2EVOA 2Q96A 1C23A 1M35A 4IKSA 5FCHA 1WKMA 4ZWUA 1YVMA 1YW9A 4S2RP 2GU5A 2EA2A 2BN7A 5JFRA 1QXWA 4PNCA 5CE6A 2EA4A 3FM3A 2P98A 4R60A 1YW7A 5CDVA 1KQ0A 2B3LA 4IECA 2BHAA 3MR1A 1W7VA 5E5BA 2HOWA 2OAZA 3BITA 1YW8A 2BWUA 1WL9A 4IPAA 2NQ7A 2GG9A 4IKTA 2G6PA 2BHDA 1C22A 2GG8A 1QXYA 1A16A 1XGMA 1KQ9A 2NQ6A 2V3ZA 1B59A 2BWYA 2GG5A 2GZ5A 3S6BA 4ZWOA 2ZSGA 4U6CA 4FO8A 1WY2A 4IKUA 3L7GA 4ZWPA 4FUKA 4RZZA 2GG0A 4IF7A 1WN1A 4U75A 2BWSA 2Q8KA 4FLLA 4IDYA 3IU7A 1BOAA 3FMQA 4A6VA 1O0XA 3PKDA 4QR8A 4A6WA 2ADUA 1B6AA 2GG7A 4FLJA 2Q95A 3Q6DA 1XGSA 2GU7A 4U1BA 2Q93A 2P99A 1XGNA 1QXZA 2BWWA 5CDLA 4U70A 5D6EA 3L24A 2B3HA 2GG3A 2GTXA 5JI6A 3RORA 1Y1NA 4Z7MA 2BHCA 1XGOA 2BB7A 2P9AA 3PKCA 5CDEA 3BIPA 2MATA 2BWVA 2B3KA 4RGZ1 1W2MA 5FCFA 1C27A 2Q94A 4S00A 1CHMA 1N51A 5D6FA 4FLIA
chains in the Genus database with same CATH topology
3IG4A 2OKNA 2IW2A 2EVCA 2BH3A 2GG2A 2GU6A 3IU9A 3PKEA 4U6WA 5CIKA 1YJ3A 2BHBA 2EVMA 4FKCA 4U71A 4ZNGA 4MATA 1JAWA 2BWXA 4JUQA 3CB5A 1KP0A 4PV4A 4U6JA 2DFIA 3MX6A 4FO7A 4OOKA 4EGEA 4IKRA 3D27A 4U76A 2Q92A 1BN5A 1R5GA 2GGBA 4U6EA 5JHUA 4RZYA 2GGCA 3TAVA 3RVAA 4U69A 1WLRA 1MATA 2GU4A 3CTZA 1QZYA 1C24A 2V6CA 3PKAA 4S2TP 2V3YA 4HXXA 4IU6A 1C21A 2BWTA 5CLSA 4U73A 1R58A 1XNZA 3MATA 4U6ZA 2GA2A 2V3XA 3IU8A 3PKBA 1WL6A 1PV9A 3TB5A 4S01A 4B28A 4FLKA 3BIQA 4KM3A 5CNXA 1WBQA 3CB6A 3FMRA 1R5HA 2EVOA 2Q96A 1C23A 1M35A 4IKSA 5FCHA 1WKMA 4ZWUA 1YVMA 1YW9A 4S2RP 2GU5A 2EA2A 2BN7A 5JFRA 1QXWA 4PNCA 5CE6A 2EA4A 3FM3A 2P98A 4R60A 1YW7A 5CDVA 1KQ0A 2B3LA 4IECA 2BHAA 3MR1A 1W7VA 5E5BA 2HOWA 2OAZA 3BITA 1YW8A 2BWUA 1WL9A 4IPAA 2NQ7A 2GG9A 4IKTA 2G6PA 2BHDA 1C22A 2GG8A 1QXYA 1A16A 1XGMA 1KQ9A 2NQ6A 2V3ZA 1B59A 2BWYA 2GG5A 2GZ5A 3S6BA 4ZWOA 2ZSGA 4U6CA 4FO8A 1WY2A 4IKUA 3L7GA 4ZWPA 4FUKA 4RZZA 2GG0A 4IF7A 1WN1A 4U75A 2BWSA 2Q8KA 4FLLA 4IDYA 3IU7A 1BOAA 3FMQA 4A6VA 1O0XA 3PKDA 4QR8A 4A6WA 2ADUA 1B6AA 2GG7A 4FLJA 2Q95A 3Q6DA 1XGSA 2GU7A 4U1BA 2Q93A 2P99A 1XGNA 1QXZA 2BWWA 5CDLA 4U70A 5D6EA 3L24A 2B3HA 2GG3A 2GTXA 5JI6A 3RORA 1Y1NA 4Z7MA 2BHCA 1XGOA 2BB7A 2P9AA 3PKCA 5CDEA 3BIPA 2MATA 2BWVA 2B3KA 4RGZ1 1W2MA 5FCFA 1C27A 2Q94A 4S00A 1CHMA 1N51A 5D6FA 4FLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG4 A;  2OKN A;  2IW2 A;  2EVC A;  2BH3 A;  2GG2 A;  2GU6 A;  3IU9 A;  3PKE A;  4U6W A;  5CIK A;  1YJ3 A;  2BHB A;  2EVM A;  4FKC A;  4U71 A;  4ZNG A;  4MAT A;  1JAW A;  2BWX A;  4JUQ A;  3CB5 A;  1KP0 A;  4PV4 A;  4U6J A;  2DFI A;  3MX6 A;  4FO7 A;  4OOK A;  4EGE A;  4IKR A;  3D27 A;  4U76 A;  2Q92 A;  1BN5 A;  1R5G A;  2GGB A;  4U6E A;  5JHU A;  4RZY A;  2GGC A;  3TAV A;  3RVA A;  4U69 A;  1WLR A;  1MAT A;  2GU4 A;  3CTZ A;  1QZY A;  1C24 A;  2V6C A;  3PKA A;  4S2T P;  2V3Y A;  4HXX A;  4IU6 A;  1C21 A;  2BWT A;  5CLS A;  4U73 A;  1R58 A;  1XNZ A;  3MAT A;  4U6Z A;  2GA2 A;  2V3X A;  3IU8 A;  3PKB A;  1WL6 A;  1PV9 A;  3TB5 A;  4S01 A;  4B28 A;  4FLK A;  3BIQ A;  4KM3 A;  5CNX A;  1WBQ A;  3CB6 A;  3FMR A;  1R5H A;  2EVO A;  2Q96 A;  1C23 A;  1M35 A;  4IKS A;  5FCH A;  1WKM A;  4ZWU A;  1YVM A;  1YW9 A;  4S2R P;  2GU5 A;  2EA2 A;  2BN7 A;  5JFR A;  1QXW A;  4PNC A;  5CE6 A;  2EA4 A;  3FM3 A;  2P98 A;  4R60 A;  1YW7 A;  5CDV A;  1KQ0 A;  2B3L A;  4IEC A;  2BHA A;  3MR1 A;  1W7V A;  5E5B A;  2HOW A;  2OAZ A;  3BIT A;  1YW8 A;  2BWU A;  1WL9 A;  4IPA A;  2NQ7 A;  2GG9 A;  4IKT A;  2G6P A;  2BHD A;  1C22 A;  2GG8 A;  1QXY A;  1A16 A;  1XGM A;  1KQ9 A;  2NQ6 A;  2V3Z A;  1B59 A;  2BWY A;  2GG5 A;  2GZ5 A;  3S6B A;  4ZWO A;  2ZSG A;  4U6C A;  4FO8 A;  1WY2 A;  4IKU A;  3L7G A;  4ZWP A;  4FUK A;  4RZZ A;  2GG0 A;  4IF7 A;  1WN1 A;  4U75 A;  2BWS A;  2Q8K A;  4FLL A;  4IDY A;  3IU7 A;  1BOA A;  3FMQ A;  4A6V A;  1O0X A;  3PKD A;  4QR8 A;  4A6W A;  2ADU A;  1B6A A;  2GG7 A;  4FLJ A;  2Q95 A;  3Q6D A;  1XGS A;  2GU7 A;  4U1B A;  2Q93 A;  2P99 A;  1XGN A;  1QXZ A;  2BWW A;  5CDL A;  4U70 A;  5D6E A;  3L24 A;  2B3H A;  2GG3 A;  2GTX A;  5JI6 A;  3ROR A;  1Y1N A;  4Z7M A;  2BHC A;  1XGO A;  2BB7 A;  2P9A A;  3PKC A;  5CDE A;  3BIP A;  2MAT A;  2BWV A;  2B3K A;  4RGZ 1;  1W2M A;  5FCF A;  1C27 A;  2Q94 A;  4S00 A;  1CHM A;  1N51 A;  5D6F A;  4FLI A; 
#chains in the Genus database with same CATH topology
 3IG4 A;  2OKN A;  2IW2 A;  2EVC A;  2BH3 A;  2GG2 A;  2GU6 A;  3IU9 A;  3PKE A;  4U6W A;  5CIK A;  1YJ3 A;  2BHB A;  2EVM A;  4FKC A;  4U71 A;  4ZNG A;  4MAT A;  1JAW A;  2BWX A;  4JUQ A;  3CB5 A;  1KP0 A;  4PV4 A;  4U6J A;  2DFI A;  3MX6 A;  4FO7 A;  4OOK A;  4EGE A;  4IKR A;  3D27 A;  4U76 A;  2Q92 A;  1BN5 A;  1R5G A;  2GGB A;  4U6E A;  5JHU A;  4RZY A;  2GGC A;  3TAV A;  3RVA A;  4U69 A;  1WLR A;  1MAT A;  2GU4 A;  3CTZ A;  1QZY A;  1C24 A;  2V6C A;  3PKA A;  4S2T P;  2V3Y A;  4HXX A;  4IU6 A;  1C21 A;  2BWT A;  5CLS A;  4U73 A;  1R58 A;  1XNZ A;  3MAT A;  4U6Z A;  2GA2 A;  2V3X A;  3IU8 A;  3PKB A;  1WL6 A;  1PV9 A;  3TB5 A;  4S01 A;  4B28 A;  4FLK A;  3BIQ A;  4KM3 A;  5CNX A;  1WBQ A;  3CB6 A;  3FMR A;  1R5H A;  2EVO A;  2Q96 A;  1C23 A;  1M35 A;  4IKS A;  5FCH A;  1WKM A;  4ZWU A;  1YVM A;  1YW9 A;  4S2R P;  2GU5 A;  2EA2 A;  2BN7 A;  5JFR A;  1QXW A;  4PNC A;  5CE6 A;  2EA4 A;  3FM3 A;  2P98 A;  4R60 A;  1YW7 A;  5CDV A;  1KQ0 A;  2B3L A;  4IEC A;  2BHA A;  3MR1 A;  1W7V A;  5E5B A;  2HOW A;  2OAZ A;  3BIT A;  1YW8 A;  2BWU A;  1WL9 A;  4IPA A;  2NQ7 A;  2GG9 A;  4IKT A;  2G6P A;  2BHD A;  1C22 A;  2GG8 A;  1QXY A;  1A16 A;  1XGM A;  1KQ9 A;  2NQ6 A;  2V3Z A;  1B59 A;  2BWY A;  2GG5 A;  2GZ5 A;  3S6B A;  4ZWO A;  2ZSG A;  4U6C A;  4FO8 A;  1WY2 A;  4IKU A;  3L7G A;  4ZWP A;  4FUK A;  4RZZ A;  2GG0 A;  4IF7 A;  1WN1 A;  4U75 A;  2BWS A;  2Q8K A;  4FLL A;  4IDY A;  3IU7 A;  1BOA A;  3FMQ A;  4A6V A;  1O0X A;  3PKD A;  4QR8 A;  4A6W A;  2ADU A;  1B6A A;  2GG7 A;  4FLJ A;  2Q95 A;  3Q6D A;  1XGS A;  2GU7 A;  4U1B A;  2Q93 A;  2P99 A;  1XGN A;  1QXZ A;  2BWW A;  5CDL A;  4U70 A;  5D6E A;  3L24 A;  2B3H A;  2GG3 A;  2GTX A;  5JI6 A;  3ROR A;  1Y1N A;  4Z7M A;  2BHC A;  1XGO A;  2BB7 A;  2P9A A;  3PKC A;  5CDE A;  3BIP A;  2MAT A;  2BWV A;  2B3K A;  4RGZ 1;  1W2M A;  5FCF A;  1C27 A;  2Q94 A;  4S00 A;  1CHM A;  1N51 A;  5D6F A;  4FLI A; 
#chains in the Genus database with same CATH homology
 3IG4 A;  2OKN A;  2IW2 A;  2EVC A;  2BH3 A;  2GG2 A;  2GU6 A;  3IU9 A;  3PKE A;  4U6W A;  5CIK A;  1YJ3 A;  2BHB A;  2EVM A;  4FKC A;  4U71 A;  4ZNG A;  4MAT A;  1JAW A;  2BWX A;  4JUQ A;  3CB5 A;  1KP0 A;  4PV4 A;  4U6J A;  2DFI A;  3MX6 A;  4FO7 A;  4OOK A;  4EGE A;  4IKR A;  3D27 A;  4U76 A;  2Q92 A;  1BN5 A;  1R5G A;  2GGB A;  4U6E A;  5JHU A;  4RZY A;  2GGC A;  3TAV A;  3RVA A;  4U69 A;  1WLR A;  1MAT A;  2GU4 A;  3CTZ A;  1QZY A;  1C24 A;  2V6C A;  3PKA A;  4S2T P;  2V3Y A;  4HXX A;  4IU6 A;  1C21 A;  2BWT A;  5CLS A;  4U73 A;  1R58 A;  1XNZ A;  3MAT A;  4U6Z A;  2GA2 A;  2V3X A;  3IU8 A;  3PKB A;  1WL6 A;  1PV9 A;  3TB5 A;  4S01 A;  4B28 A;  4FLK A;  3BIQ A;  4KM3 A;  5CNX A;  1WBQ A;  3CB6 A;  3FMR A;  1R5H A;  2EVO A;  2Q96 A;  1C23 A;  1M35 A;  4IKS A;  5FCH A;  1WKM A;  4ZWU A;  1YVM A;  1YW9 A;  4S2R P;  2GU5 A;  2EA2 A;  2BN7 A;  5JFR A;  1QXW A;  4PNC A;  5CE6 A;  2EA4 A;  3FM3 A;  2P98 A;  4R60 A;  1YW7 A;  5CDV A;  1KQ0 A;  2B3L A;  4IEC A;  2BHA A;  3MR1 A;  1W7V A;  5E5B A;  2HOW A;  2OAZ A;  3BIT A;  1YW8 A;  2BWU A;  1WL9 A;  4IPA A;  2NQ7 A;  2GG9 A;  4IKT A;  2G6P A;  2BHD A;  1C22 A;  2GG8 A;  1QXY A;  1A16 A;  1XGM A;  1KQ9 A;  2NQ6 A;  2V3Z A;  1B59 A;  2BWY A;  2GG5 A;  2GZ5 A;  3S6B A;  4ZWO A;  2ZSG A;  4U6C A;  4FO8 A;  1WY2 A;  4IKU A;  3L7G A;  4ZWP A;  4FUK A;  4RZZ A;  2GG0 A;  4IF7 A;  1WN1 A;  4U75 A;  2BWS A;  2Q8K A;  4FLL A;  4IDY A;  3IU7 A;  1BOA A;  3FMQ A;  4A6V A;  1O0X A;  3PKD A;  4QR8 A;  4A6W A;  2ADU A;  1B6A A;  2GG7 A;  4FLJ A;  2Q95 A;  3Q6D A;  1XGS A;  2GU7 A;  4U1B A;  2Q93 A;  2P99 A;  1XGN A;  1QXZ A;  2BWW A;  5CDL A;  4U70 A;  5D6E A;  3L24 A;  2B3H A;  2GG3 A;  2GTX A;  5JI6 A;  3ROR A;  1Y1N A;  4Z7M A;  2BHC A;  1XGO A;  2BB7 A;  2P9A A;  3PKC A;  5CDE A;  3BIP A;  2MAT A;  2BWV A;  2B3K A;  4RGZ 1;  1W2M A;  5FCF A;  1C27 A;  2Q94 A;  4S00 A;  1CHM A;  1N51 A;  5D6F A;  4FLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...