1C24A

E. coli methionine aminopeptidase: methionine phosphinate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c24A00
1O0XA 4PNCA 4U71A 2GGCA 2EVOA 1BN5A 4FO8A 2BWTA 4QR8A 4ZNGA 4U6ZA 3MX6A 4MATA 4U1BA 1C24A 1WKMA 2Q95A 2MATA 4R60A 4FO7A 4U6WA 5CDLA 5E5BA 1JAWA 3CB6A 5CIKA 4S00A 2EA4A 2EVMA 2NQ6A 4FLJA 4U70A 1W2MA 1QZYA 1WL6A 1R5HA 3Q6DA 2G6PA 5FCHA 1KQ0A 2BHDA 3PKBA 2GU4A 3MR1A 4IDYA 4IPAA 1C27A 2DFIA 1YW7A 3FMRA 4U73A 4IU6A 1KP0A 3L7GA 4IKUA 5FCFA 1A16A 4IKSA 1YVMA 2BHBA 2BWSA 1M35A 4PV4A 1W7VA 2B3LA 2GG3A 2ZSGA 3FM3A 1WBQA 3S6BA 3TAVA 4U69A 2GG8A 1KQ9A 2GG0A 4KM3A 3IG4A 1QXYA 3FMQA 2BWWA 4S2RP 1XGSA 3D27A 3IU7A 2GG7A 1YW9A 2GG5A 1C23A 1XGMA 1R58A 4IF7A 2P9AA 5D6FA 4EGEA 4U6CA 4RGZ1 2P99A 2GA2A 2Q92A 1CHMA 2V6CA 3L24A 4Z7MA 4IKTA 1Y1NA 2B3HA 2EVCA 1WL9A 2NQ7A 2EA2A 2BHCA 3PKEA 2BN7A 2GTXA 4JUQA 4S01A 4S2TP 2BWVA 4U6JA 3RVAA 3RORA 3TB5A 2GG9A 5JFRA 4IKRA 1XNZA 5JI6A 1PV9A 3PKAA 4FKCA 2GZ5A 2B3KA 5CDEA 2GU7A 4ZWOA 4A6VA 4FLKA 3IU9A 2BHAA 2V3YA 4U75A 1B59A 4FUKA 4IECA 2Q8KA 4OOKA 2V3XA 2BH3A 4A6WA 1WLRA 1XGNA 1MATA 2Q93A 1BOAA 2P98A 3MATA 2BWXA 1WY2A 4RZYA 4B28A 2IW2A 2HOWA 4HXXA 2GGBA 4U76A 1YW8A 5CE6A 1XGOA 3PKCA 4FLIA 5JHUA 2ADUA 2V3ZA 3PKDA 1YJ3A 5D6EA 2BB7A 4ZWUA 4FLLA 2Q96A 4U6EA 1QXZA 2OKNA 3BITA 1C22A 1WN1A 2OAZA 3CTZA 5CDVA 1C21A 2BWYA 4ZWPA 1N51A 3IU8A 1R5GA 2GU5A 3BIPA 2GG2A 2GU6A 2Q94A 4RZZA 2BWUA 3CB5A 1B6AA 5CNXA 3BIQA 5CLSA 1QXWA
chains in the Genus database with same CATH superfamily
1O0XA 4PNCA 4U71A 2GGCA 2EVOA 1BN5A 4FO8A 2BWTA 4QR8A 4ZNGA 4U6ZA 3MX6A 4MATA 4U1BA 1C24A 1WKMA 2Q95A 2MATA 4R60A 4FO7A 4U6WA 5CDLA 5E5BA 1JAWA 3CB6A 5CIKA 4S00A 2EA4A 2EVMA 2NQ6A 4FLJA 4U70A 1W2MA 1QZYA 1WL6A 1R5HA 3Q6DA 2G6PA 5FCHA 1KQ0A 2BHDA 3PKBA 2GU4A 3MR1A 4IDYA 4IPAA 1C27A 2DFIA 1YW7A 3FMRA 4U73A 4IU6A 1KP0A 3L7GA 4IKUA 5FCFA 1A16A 4IKSA 1YVMA 2BHBA 2BWSA 1M35A 4PV4A 1W7VA 2B3LA 2GG3A 2ZSGA 3FM3A 1WBQA 3S6BA 3TAVA 4U69A 2GG8A 1KQ9A 2GG0A 4KM3A 3IG4A 1QXYA 3FMQA 2BWWA 4S2RP 1XGSA 3D27A 3IU7A 2GG7A 1YW9A 2GG5A 1C23A 1XGMA 1R58A 4IF7A 2P9AA 5D6FA 4EGEA 4U6CA 4RGZ1 2P99A 2GA2A 2Q92A 1CHMA 2V6CA 3L24A 4Z7MA 4IKTA 1Y1NA 2B3HA 2EVCA 1WL9A 2NQ7A 2EA2A 2BHCA 3PKEA 2BN7A 2GTXA 4JUQA 4S01A 4S2TP 2BWVA 4U6JA 3RVAA 3RORA 3TB5A 2GG9A 5JFRA 4IKRA 1XNZA 5JI6A 1PV9A 3PKAA 4FKCA 2GZ5A 2B3KA 5CDEA 2GU7A 4ZWOA 4A6VA 4FLKA 3IU9A 2BHAA 2V3YA 4U75A 1B59A 4FUKA 4IECA 2Q8KA 4OOKA 2V3XA 2BH3A 4A6WA 1WLRA 1XGNA 1MATA 2Q93A 1BOAA 2P98A 3MATA 2BWXA 1WY2A 4RZYA 4B28A 2IW2A 2HOWA 4HXXA 2GGBA 4U76A 1YW8A 5CE6A 1XGOA 3PKCA 4FLIA 5JHUA 2ADUA 2V3ZA 3PKDA 1YJ3A 5D6EA 2BB7A 4ZWUA 4FLLA 2Q96A 4U6EA 1QXZA 2OKNA 3BITA 1C22A 1WN1A 2OAZA 3CTZA 5CDVA 1C21A 2BWYA 4ZWPA 1N51A 3IU8A 1R5GA 2GU5A 3BIPA 2GG2A 2GU6A 2Q94A 4RZZA 2BWUA 3CB5A 1B6AA 5CNXA 3BIQA 5CLSA 1QXWA
chains in the Genus database with same CATH topology
1O0XA 4PNCA 4U71A 2GGCA 2EVOA 1BN5A 4FO8A 2BWTA 4QR8A 4ZNGA 4U6ZA 3MX6A 4MATA 4U1BA 1C24A 1WKMA 2Q95A 2MATA 4R60A 4FO7A 4U6WA 5CDLA 5E5BA 1JAWA 3CB6A 5CIKA 4S00A 2EA4A 2EVMA 2NQ6A 4FLJA 4U70A 1W2MA 1QZYA 1WL6A 1R5HA 3Q6DA 2G6PA 5FCHA 1KQ0A 2BHDA 3PKBA 2GU4A 3MR1A 4IDYA 4IPAA 1C27A 2DFIA 1YW7A 3FMRA 4U73A 4IU6A 1KP0A 3L7GA 4IKUA 5FCFA 1A16A 4IKSA 1YVMA 2BHBA 2BWSA 1M35A 4PV4A 1W7VA 2B3LA 2GG3A 2ZSGA 3FM3A 1WBQA 3S6BA 3TAVA 4U69A 2GG8A 1KQ9A 2GG0A 4KM3A 3IG4A 1QXYA 3FMQA 2BWWA 4S2RP 1XGSA 3D27A 3IU7A 2GG7A 1YW9A 2GG5A 1C23A 1XGMA 1R58A 4IF7A 2P9AA 5D6FA 4EGEA 4U6CA 4RGZ1 2P99A 2GA2A 2Q92A 1CHMA 2V6CA 3L24A 4Z7MA 4IKTA 1Y1NA 2B3HA 2EVCA 1WL9A 2NQ7A 2EA2A 2BHCA 3PKEA 2BN7A 2GTXA 4JUQA 4S01A 4S2TP 2BWVA 4U6JA 3RVAA 3RORA 3TB5A 2GG9A 5JFRA 4IKRA 1XNZA 5JI6A 1PV9A 3PKAA 4FKCA 2GZ5A 2B3KA 5CDEA 2GU7A 4ZWOA 4A6VA 4FLKA 3IU9A 2BHAA 2V3YA 4U75A 1B59A 4FUKA 4IECA 2Q8KA 4OOKA 2V3XA 2BH3A 4A6WA 1WLRA 1XGNA 1MATA 2Q93A 1BOAA 2P98A 3MATA 2BWXA 1WY2A 4RZYA 4B28A 2IW2A 2HOWA 4HXXA 2GGBA 4U76A 1YW8A 5CE6A 1XGOA 3PKCA 4FLIA 5JHUA 2ADUA 2V3ZA 3PKDA 1YJ3A 5D6EA 2BB7A 4ZWUA 4FLLA 2Q96A 4U6EA 1QXZA 2OKNA 3BITA 1C22A 1WN1A 2OAZA 3CTZA 5CDVA 1C21A 2BWYA 4ZWPA 1N51A 3IU8A 1R5GA 2GU5A 3BIPA 2GG2A 2GU6A 2Q94A 4RZZA 2BWUA 3CB5A 1B6AA 5CNXA 3BIQA 5CLSA 1QXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0X A;  4PNC A;  4U71 A;  2GGC A;  2EVO A;  1BN5 A;  4FO8 A;  2BWT A;  4QR8 A;  4ZNG A;  4U6Z A;  3MX6 A;  4MAT A;  4U1B A;  1C24 A;  1WKM A;  2Q95 A;  2MAT A;  4R60 A;  4FO7 A;  4U6W A;  5CDL A;  5E5B A;  1JAW A;  3CB6 A;  5CIK A;  4S00 A;  2EA4 A;  2EVM A;  2NQ6 A;  4FLJ A;  4U70 A;  1W2M A;  1QZY A;  1WL6 A;  1R5H A;  3Q6D A;  2G6P A;  5FCH A;  1KQ0 A;  2BHD A;  3PKB A;  2GU4 A;  3MR1 A;  4IDY A;  4IPA A;  1C27 A;  2DFI A;  1YW7 A;  3FMR A;  4U73 A;  4IU6 A;  1KP0 A;  3L7G A;  4IKU A;  5FCF A;  1A16 A;  4IKS A;  1YVM A;  2BHB A;  2BWS A;  1M35 A;  4PV4 A;  1W7V A;  2B3L A;  2GG3 A;  2ZSG A;  3FM3 A;  1WBQ A;  3S6B A;  3TAV A;  4U69 A;  2GG8 A;  1KQ9 A;  2GG0 A;  4KM3 A;  3IG4 A;  1QXY A;  3FMQ A;  2BWW A;  4S2R P;  1XGS A;  3D27 A;  3IU7 A;  2GG7 A;  1YW9 A;  2GG5 A;  1C23 A;  1XGM A;  1R58 A;  4IF7 A;  2P9A A;  5D6F A;  4EGE A;  4U6C A;  4RGZ 1;  2P99 A;  2GA2 A;  2Q92 A;  1CHM A;  2V6C A;  3L24 A;  4Z7M A;  4IKT A;  1Y1N A;  2B3H A;  2EVC A;  1WL9 A;  2NQ7 A;  2EA2 A;  2BHC A;  3PKE A;  2BN7 A;  2GTX A;  4JUQ A;  4S01 A;  4S2T P;  2BWV A;  4U6J A;  3RVA A;  3ROR A;  3TB5 A;  2GG9 A;  5JFR A;  4IKR A;  1XNZ A;  5JI6 A;  1PV9 A;  3PKA A;  4FKC A;  2GZ5 A;  2B3K A;  5CDE A;  2GU7 A;  4ZWO A;  4A6V A;  4FLK A;  3IU9 A;  2BHA A;  2V3Y A;  4U75 A;  1B59 A;  4FUK A;  4IEC A;  2Q8K A;  4OOK A;  2V3X A;  2BH3 A;  4A6W A;  1WLR A;  1XGN A;  1MAT A;  2Q93 A;  1BOA A;  2P98 A;  3MAT A;  2BWX A;  1WY2 A;  4RZY A;  4B28 A;  2IW2 A;  2HOW A;  4HXX A;  2GGB A;  4U76 A;  1YW8 A;  5CE6 A;  1XGO A;  3PKC A;  4FLI A;  5JHU A;  2ADU A;  2V3Z A;  3PKD A;  1YJ3 A;  5D6E A;  2BB7 A;  4ZWU A;  4FLL A;  2Q96 A;  4U6E A;  1QXZ A;  2OKN A;  3BIT A;  1C22 A;  1WN1 A;  2OAZ A;  3CTZ A;  5CDV A;  1C21 A;  2BWY A;  4ZWP A;  1N51 A;  3IU8 A;  1R5G A;  2GU5 A;  3BIP A;  2GG2 A;  2GU6 A;  2Q94 A;  4RZZ A;  2BWU A;  3CB5 A;  1B6A A;  5CNX A;  3BIQ A;  5CLS A;  1QXW A; 
#chains in the Genus database with same CATH topology
 1O0X A;  4PNC A;  4U71 A;  2GGC A;  2EVO A;  1BN5 A;  4FO8 A;  2BWT A;  4QR8 A;  4ZNG A;  4U6Z A;  3MX6 A;  4MAT A;  4U1B A;  1C24 A;  1WKM A;  2Q95 A;  2MAT A;  4R60 A;  4FO7 A;  4U6W A;  5CDL A;  5E5B A;  1JAW A;  3CB6 A;  5CIK A;  4S00 A;  2EA4 A;  2EVM A;  2NQ6 A;  4FLJ A;  4U70 A;  1W2M A;  1QZY A;  1WL6 A;  1R5H A;  3Q6D A;  2G6P A;  5FCH A;  1KQ0 A;  2BHD A;  3PKB A;  2GU4 A;  3MR1 A;  4IDY A;  4IPA A;  1C27 A;  2DFI A;  1YW7 A;  3FMR A;  4U73 A;  4IU6 A;  1KP0 A;  3L7G A;  4IKU A;  5FCF A;  1A16 A;  4IKS A;  1YVM A;  2BHB A;  2BWS A;  1M35 A;  4PV4 A;  1W7V A;  2B3L A;  2GG3 A;  2ZSG A;  3FM3 A;  1WBQ A;  3S6B A;  3TAV A;  4U69 A;  2GG8 A;  1KQ9 A;  2GG0 A;  4KM3 A;  3IG4 A;  1QXY A;  3FMQ A;  2BWW A;  4S2R P;  1XGS A;  3D27 A;  3IU7 A;  2GG7 A;  1YW9 A;  2GG5 A;  1C23 A;  1XGM A;  1R58 A;  4IF7 A;  2P9A A;  5D6F A;  4EGE A;  4U6C A;  4RGZ 1;  2P99 A;  2GA2 A;  2Q92 A;  1CHM A;  2V6C A;  3L24 A;  4Z7M A;  4IKT A;  1Y1N A;  2B3H A;  2EVC A;  1WL9 A;  2NQ7 A;  2EA2 A;  2BHC A;  3PKE A;  2BN7 A;  2GTX A;  4JUQ A;  4S01 A;  4S2T P;  2BWV A;  4U6J A;  3RVA A;  3ROR A;  3TB5 A;  2GG9 A;  5JFR A;  4IKR A;  1XNZ A;  5JI6 A;  1PV9 A;  3PKA A;  4FKC A;  2GZ5 A;  2B3K A;  5CDE A;  2GU7 A;  4ZWO A;  4A6V A;  4FLK A;  3IU9 A;  2BHA A;  2V3Y A;  4U75 A;  1B59 A;  4FUK A;  4IEC A;  2Q8K A;  4OOK A;  2V3X A;  2BH3 A;  4A6W A;  1WLR A;  1XGN A;  1MAT A;  2Q93 A;  1BOA A;  2P98 A;  3MAT A;  2BWX A;  1WY2 A;  4RZY A;  4B28 A;  2IW2 A;  2HOW A;  4HXX A;  2GGB A;  4U76 A;  1YW8 A;  5CE6 A;  1XGO A;  3PKC A;  4FLI A;  5JHU A;  2ADU A;  2V3Z A;  3PKD A;  1YJ3 A;  5D6E A;  2BB7 A;  4ZWU A;  4FLL A;  2Q96 A;  4U6E A;  1QXZ A;  2OKN A;  3BIT A;  1C22 A;  1WN1 A;  2OAZ A;  3CTZ A;  5CDV A;  1C21 A;  2BWY A;  4ZWP A;  1N51 A;  3IU8 A;  1R5G A;  2GU5 A;  3BIP A;  2GG2 A;  2GU6 A;  2Q94 A;  4RZZ A;  2BWU A;  3CB5 A;  1B6A A;  5CNX A;  3BIQ A;  5CLS A;  1QXW A; 
#chains in the Genus database with same CATH homology
 1O0X A;  4PNC A;  4U71 A;  2GGC A;  2EVO A;  1BN5 A;  4FO8 A;  2BWT A;  4QR8 A;  4ZNG A;  4U6Z A;  3MX6 A;  4MAT A;  4U1B A;  1C24 A;  1WKM A;  2Q95 A;  2MAT A;  4R60 A;  4FO7 A;  4U6W A;  5CDL A;  5E5B A;  1JAW A;  3CB6 A;  5CIK A;  4S00 A;  2EA4 A;  2EVM A;  2NQ6 A;  4FLJ A;  4U70 A;  1W2M A;  1QZY A;  1WL6 A;  1R5H A;  3Q6D A;  2G6P A;  5FCH A;  1KQ0 A;  2BHD A;  3PKB A;  2GU4 A;  3MR1 A;  4IDY A;  4IPA A;  1C27 A;  2DFI A;  1YW7 A;  3FMR A;  4U73 A;  4IU6 A;  1KP0 A;  3L7G A;  4IKU A;  5FCF A;  1A16 A;  4IKS A;  1YVM A;  2BHB A;  2BWS A;  1M35 A;  4PV4 A;  1W7V A;  2B3L A;  2GG3 A;  2ZSG A;  3FM3 A;  1WBQ A;  3S6B A;  3TAV A;  4U69 A;  2GG8 A;  1KQ9 A;  2GG0 A;  4KM3 A;  3IG4 A;  1QXY A;  3FMQ A;  2BWW A;  4S2R P;  1XGS A;  3D27 A;  3IU7 A;  2GG7 A;  1YW9 A;  2GG5 A;  1C23 A;  1XGM A;  1R58 A;  4IF7 A;  2P9A A;  5D6F A;  4EGE A;  4U6C A;  4RGZ 1;  2P99 A;  2GA2 A;  2Q92 A;  1CHM A;  2V6C A;  3L24 A;  4Z7M A;  4IKT A;  1Y1N A;  2B3H A;  2EVC A;  1WL9 A;  2NQ7 A;  2EA2 A;  2BHC A;  3PKE A;  2BN7 A;  2GTX A;  4JUQ A;  4S01 A;  4S2T P;  2BWV A;  4U6J A;  3RVA A;  3ROR A;  3TB5 A;  2GG9 A;  5JFR A;  4IKR A;  1XNZ A;  5JI6 A;  1PV9 A;  3PKA A;  4FKC A;  2GZ5 A;  2B3K A;  5CDE A;  2GU7 A;  4ZWO A;  4A6V A;  4FLK A;  3IU9 A;  2BHA A;  2V3Y A;  4U75 A;  1B59 A;  4FUK A;  4IEC A;  2Q8K A;  4OOK A;  2V3X A;  2BH3 A;  4A6W A;  1WLR A;  1XGN A;  1MAT A;  2Q93 A;  1BOA A;  2P98 A;  3MAT A;  2BWX A;  1WY2 A;  4RZY A;  4B28 A;  2IW2 A;  2HOW A;  4HXX A;  2GGB A;  4U76 A;  1YW8 A;  5CE6 A;  1XGO A;  3PKC A;  4FLI A;  5JHU A;  2ADU A;  2V3Z A;  3PKD A;  1YJ3 A;  5D6E A;  2BB7 A;  4ZWU A;  4FLL A;  2Q96 A;  4U6E A;  1QXZ A;  2OKN A;  3BIT A;  1C22 A;  1WN1 A;  2OAZ A;  3CTZ A;  5CDV A;  1C21 A;  2BWY A;  4ZWP A;  1N51 A;  3IU8 A;  1R5G A;  2GU5 A;  3BIP A;  2GG2 A;  2GU6 A;  2Q94 A;  4RZZ A;  2BWU A;  3CB5 A;  1B6A A;  5CNX A;  3BIQ A;  5CLS A;  1QXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...