1C24A

E. coli methionine aminopeptidase: methionine phosphinate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c24A00
5CE6A 5CDVA 5CDEA 2BWVA 4ZWUA 3CB6A 4FKCA 3PKCA 2B3HA 1BN5A 1BOAA 1JAWA 1QXWA 2GG0A 4S00A 1MATA 2P9AA 2P98A 2ZSGA 1C21A 1M35A 3MATA 3IG4A 1O0XA 1PV9A 1YW8A 4FLIA 1YW9A 4U76A 2NQ6A 2V6CA 4B28A 3PKEA 2GU7A 5CNXA 4ZNGA 2OAZA 3IU8A 4U73A 2B3KA 2BB7A 1C22A 2GU6A 1C24A 3D27A 3S6BA 4A6VA 1WN1A 5D6EA 4KM3A 4U75A 5E5BA 2GG7A 1R5HA 1YVMA 2GZ5A 4R60A 2EA2A 5FCFA 1KQ9A 1YW7A 1XGSA 1WL6A 3BIQA 4U1BA 2B3LA 4IF7A 4U69A 2DFIA 4RZZA 1CHMA 2BWSA 2GU4A 1KQ0A 4S2TP 3BIPA 4RGZ1 4ZWOA 2GGBA 4FO7A 1WLRA 2IW2A 4IPAA 2ADUA 2BN7A 1A16A 2GA2A 1YJ3A 3FMRA 2BHBA 4A6WA 2EVOA 1QXZA 2GG2A 2BHDA 2V3XA 2OKNA 3L7GA 4QR8A 2V3YA 2BWYA 2Q93A 2Q92A 1KP0A 4U6ZA 3BITA 5CIKA 4IKUA 5D6FA 2GG9A 3PKAA 2BWUA 2EA4A 3RVAA 1C27A 1QZYA 4IKTA 3CTZA 5FCHA 1W2MA 4U71A 4IDYA 4PV4A 2MATA 3IU7A 4U70A 2BHAA 4IU6A 4S2RP 4JUQA 4HXXA 2GG3A 3PKDA 4MATA 1XGOA 3CB5A 4ZWPA 3MR1A 2BWXA 2G6PA 1R58A 4U6WA 1C23A 2HOWA 3IU9A 4OOKA 1W7VA 4U6EA 2V3ZA 1Y1NA 3MX6A 4S01A 1B59A 4PNCA 1WY2A 2Q96A 2BH3A 3FM3A 5CLSA 2NQ7A 1B6AA 2BHCA 2GU5A 3TB5A 2Q8KA 5JFRA 4FLKA 2GG8A 4FO8A 4U6JA 1WL9A 1XGMA 3L24A 3PKBA 1WBQA 4Z7MA 1XNZA 2GTXA 1R5GA 5CDLA 2P99A 4FLJA 5JHUA 1N51A 1XGNA 4FLLA 2GGCA 3FMQA 4RZYA 2BWWA 2GG5A 2EVCA 2EVMA 2BWTA 4FUKA 3Q6DA 3RORA 1WKMA 4IECA 2Q94A 4U6CA 4EGEA 3TAVA 5JI6A 4IKSA 4IKRA 1QXYA 2Q95A
chains in the Genus database with same CATH superfamily
5CE6A 5CDVA 5CDEA 2BWVA 4ZWUA 3CB6A 4FKCA 3PKCA 2B3HA 1BN5A 1BOAA 1JAWA 1QXWA 2GG0A 4S00A 1MATA 2P9AA 2P98A 2ZSGA 1C21A 1M35A 3MATA 3IG4A 1O0XA 1PV9A 1YW8A 4FLIA 1YW9A 4U76A 2NQ6A 2V6CA 4B28A 3PKEA 2GU7A 5CNXA 4ZNGA 2OAZA 3IU8A 4U73A 2B3KA 2BB7A 1C22A 2GU6A 1C24A 3D27A 3S6BA 4A6VA 1WN1A 5D6EA 4KM3A 4U75A 5E5BA 2GG7A 1R5HA 1YVMA 2GZ5A 4R60A 2EA2A 5FCFA 1KQ9A 1YW7A 1XGSA 1WL6A 3BIQA 4U1BA 2B3LA 4IF7A 4U69A 2DFIA 4RZZA 1CHMA 2BWSA 2GU4A 1KQ0A 4S2TP 3BIPA 4RGZ1 4ZWOA 2GGBA 4FO7A 1WLRA 2IW2A 4IPAA 2ADUA 2BN7A 1A16A 2GA2A 1YJ3A 3FMRA 2BHBA 4A6WA 2EVOA 1QXZA 2GG2A 2BHDA 2V3XA 2OKNA 3L7GA 4QR8A 2V3YA 2BWYA 2Q93A 2Q92A 1KP0A 4U6ZA 3BITA 5CIKA 4IKUA 5D6FA 2GG9A 3PKAA 2BWUA 2EA4A 3RVAA 1C27A 1QZYA 4IKTA 3CTZA 5FCHA 1W2MA 4U71A 4IDYA 4PV4A 2MATA 3IU7A 4U70A 2BHAA 4IU6A 4S2RP 4JUQA 4HXXA 2GG3A 3PKDA 4MATA 1XGOA 3CB5A 4ZWPA 3MR1A 2BWXA 2G6PA 1R58A 4U6WA 1C23A 2HOWA 3IU9A 4OOKA 1W7VA 4U6EA 2V3ZA 1Y1NA 3MX6A 4S01A 1B59A 4PNCA 1WY2A 2Q96A 2BH3A 3FM3A 5CLSA 2NQ7A 1B6AA 2BHCA 2GU5A 3TB5A 2Q8KA 5JFRA 4FLKA 2GG8A 4FO8A 4U6JA 1WL9A 1XGMA 3L24A 3PKBA 1WBQA 4Z7MA 1XNZA 2GTXA 1R5GA 5CDLA 2P99A 4FLJA 5JHUA 1N51A 1XGNA 4FLLA 2GGCA 3FMQA 4RZYA 2BWWA 2GG5A 2EVCA 2EVMA 2BWTA 4FUKA 3Q6DA 3RORA 1WKMA 4IECA 2Q94A 4U6CA 4EGEA 3TAVA 5JI6A 4IKSA 4IKRA 1QXYA 2Q95A
chains in the Genus database with same CATH topology
5CE6A 5CDVA 5CDEA 2BWVA 4ZWUA 3CB6A 4FKCA 3PKCA 2B3HA 1BN5A 1BOAA 1JAWA 1QXWA 2GG0A 4S00A 1MATA 2P9AA 2P98A 2ZSGA 1C21A 1M35A 3MATA 3IG4A 1O0XA 1PV9A 1YW8A 4FLIA 1YW9A 4U76A 2NQ6A 2V6CA 4B28A 3PKEA 2GU7A 5CNXA 4ZNGA 2OAZA 3IU8A 4U73A 2B3KA 2BB7A 1C22A 2GU6A 1C24A 3D27A 3S6BA 4A6VA 1WN1A 5D6EA 4KM3A 4U75A 5E5BA 2GG7A 1R5HA 1YVMA 2GZ5A 4R60A 2EA2A 5FCFA 1KQ9A 1YW7A 1XGSA 1WL6A 3BIQA 4U1BA 2B3LA 4IF7A 4U69A 2DFIA 4RZZA 1CHMA 2BWSA 2GU4A 1KQ0A 4S2TP 3BIPA 4RGZ1 4ZWOA 2GGBA 4FO7A 1WLRA 2IW2A 4IPAA 2ADUA 2BN7A 1A16A 2GA2A 1YJ3A 3FMRA 2BHBA 4A6WA 2EVOA 1QXZA 2GG2A 2BHDA 2V3XA 2OKNA 3L7GA 4QR8A 2V3YA 2BWYA 2Q93A 2Q92A 1KP0A 4U6ZA 3BITA 5CIKA 4IKUA 5D6FA 2GG9A 3PKAA 2BWUA 2EA4A 3RVAA 1C27A 1QZYA 4IKTA 3CTZA 5FCHA 1W2MA 4U71A 4IDYA 4PV4A 2MATA 3IU7A 4U70A 2BHAA 4IU6A 4S2RP 4JUQA 4HXXA 2GG3A 3PKDA 4MATA 1XGOA 3CB5A 4ZWPA 3MR1A 2BWXA 2G6PA 1R58A 4U6WA 1C23A 2HOWA 3IU9A 4OOKA 1W7VA 4U6EA 2V3ZA 1Y1NA 3MX6A 4S01A 1B59A 4PNCA 1WY2A 2Q96A 2BH3A 3FM3A 5CLSA 2NQ7A 1B6AA 2BHCA 2GU5A 3TB5A 2Q8KA 5JFRA 4FLKA 2GG8A 4FO8A 4U6JA 1WL9A 1XGMA 3L24A 3PKBA 1WBQA 4Z7MA 1XNZA 2GTXA 1R5GA 5CDLA 2P99A 4FLJA 5JHUA 1N51A 1XGNA 4FLLA 2GGCA 3FMQA 4RZYA 2BWWA 2GG5A 2EVCA 2EVMA 2BWTA 4FUKA 3Q6DA 3RORA 1WKMA 4IECA 2Q94A 4U6CA 4EGEA 3TAVA 5JI6A 4IKSA 4IKRA 1QXYA 2Q95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CE6 A;  5CDV A;  5CDE A;  2BWV A;  4ZWU A;  3CB6 A;  4FKC A;  3PKC A;  2B3H A;  1BN5 A;  1BOA A;  1JAW A;  1QXW A;  2GG0 A;  4S00 A;  1MAT A;  2P9A A;  2P98 A;  2ZSG A;  1C21 A;  1M35 A;  3MAT A;  3IG4 A;  1O0X A;  1PV9 A;  1YW8 A;  4FLI A;  1YW9 A;  4U76 A;  2NQ6 A;  2V6C A;  4B28 A;  3PKE A;  2GU7 A;  5CNX A;  4ZNG A;  2OAZ A;  3IU8 A;  4U73 A;  2B3K A;  2BB7 A;  1C22 A;  2GU6 A;  1C24 A;  3D27 A;  3S6B A;  4A6V A;  1WN1 A;  5D6E A;  4KM3 A;  4U75 A;  5E5B A;  2GG7 A;  1R5H A;  1YVM A;  2GZ5 A;  4R60 A;  2EA2 A;  5FCF A;  1KQ9 A;  1YW7 A;  1XGS A;  1WL6 A;  3BIQ A;  4U1B A;  2B3L A;  4IF7 A;  4U69 A;  2DFI A;  4RZZ A;  1CHM A;  2BWS A;  2GU4 A;  1KQ0 A;  4S2T P;  3BIP A;  4RGZ 1;  4ZWO A;  2GGB A;  4FO7 A;  1WLR A;  2IW2 A;  4IPA A;  2ADU A;  2BN7 A;  1A16 A;  2GA2 A;  1YJ3 A;  3FMR A;  2BHB A;  4A6W A;  2EVO A;  1QXZ A;  2GG2 A;  2BHD A;  2V3X A;  2OKN A;  3L7G A;  4QR8 A;  2V3Y A;  2BWY A;  2Q93 A;  2Q92 A;  1KP0 A;  4U6Z A;  3BIT A;  5CIK A;  4IKU A;  5D6F A;  2GG9 A;  3PKA A;  2BWU A;  2EA4 A;  3RVA A;  1C27 A;  1QZY A;  4IKT A;  3CTZ A;  5FCH A;  1W2M A;  4U71 A;  4IDY A;  4PV4 A;  2MAT A;  3IU7 A;  4U70 A;  2BHA A;  4IU6 A;  4S2R P;  4JUQ A;  4HXX A;  2GG3 A;  3PKD A;  4MAT A;  1XGO A;  3CB5 A;  4ZWP A;  3MR1 A;  2BWX A;  2G6P A;  1R58 A;  4U6W A;  1C23 A;  2HOW A;  3IU9 A;  4OOK A;  1W7V A;  4U6E A;  2V3Z A;  1Y1N A;  3MX6 A;  4S01 A;  1B59 A;  4PNC A;  1WY2 A;  2Q96 A;  2BH3 A;  3FM3 A;  5CLS A;  2NQ7 A;  1B6A A;  2BHC A;  2GU5 A;  3TB5 A;  2Q8K A;  5JFR A;  4FLK A;  2GG8 A;  4FO8 A;  4U6J A;  1WL9 A;  1XGM A;  3L24 A;  3PKB A;  1WBQ A;  4Z7M A;  1XNZ A;  2GTX A;  1R5G A;  5CDL A;  2P99 A;  4FLJ A;  5JHU A;  1N51 A;  1XGN A;  4FLL A;  2GGC A;  3FMQ A;  4RZY A;  2BWW A;  2GG5 A;  2EVC A;  2EVM A;  2BWT A;  4FUK A;  3Q6D A;  3ROR A;  1WKM A;  4IEC A;  2Q94 A;  4U6C A;  4EGE A;  3TAV A;  5JI6 A;  4IKS A;  4IKR A;  1QXY A;  2Q95 A; 
#chains in the Genus database with same CATH topology
 5CE6 A;  5CDV A;  5CDE A;  2BWV A;  4ZWU A;  3CB6 A;  4FKC A;  3PKC A;  2B3H A;  1BN5 A;  1BOA A;  1JAW A;  1QXW A;  2GG0 A;  4S00 A;  1MAT A;  2P9A A;  2P98 A;  2ZSG A;  1C21 A;  1M35 A;  3MAT A;  3IG4 A;  1O0X A;  1PV9 A;  1YW8 A;  4FLI A;  1YW9 A;  4U76 A;  2NQ6 A;  2V6C A;  4B28 A;  3PKE A;  2GU7 A;  5CNX A;  4ZNG A;  2OAZ A;  3IU8 A;  4U73 A;  2B3K A;  2BB7 A;  1C22 A;  2GU6 A;  1C24 A;  3D27 A;  3S6B A;  4A6V A;  1WN1 A;  5D6E A;  4KM3 A;  4U75 A;  5E5B A;  2GG7 A;  1R5H A;  1YVM A;  2GZ5 A;  4R60 A;  2EA2 A;  5FCF A;  1KQ9 A;  1YW7 A;  1XGS A;  1WL6 A;  3BIQ A;  4U1B A;  2B3L A;  4IF7 A;  4U69 A;  2DFI A;  4RZZ A;  1CHM A;  2BWS A;  2GU4 A;  1KQ0 A;  4S2T P;  3BIP A;  4RGZ 1;  4ZWO A;  2GGB A;  4FO7 A;  1WLR A;  2IW2 A;  4IPA A;  2ADU A;  2BN7 A;  1A16 A;  2GA2 A;  1YJ3 A;  3FMR A;  2BHB A;  4A6W A;  2EVO A;  1QXZ A;  2GG2 A;  2BHD A;  2V3X A;  2OKN A;  3L7G A;  4QR8 A;  2V3Y A;  2BWY A;  2Q93 A;  2Q92 A;  1KP0 A;  4U6Z A;  3BIT A;  5CIK A;  4IKU A;  5D6F A;  2GG9 A;  3PKA A;  2BWU A;  2EA4 A;  3RVA A;  1C27 A;  1QZY A;  4IKT A;  3CTZ A;  5FCH A;  1W2M A;  4U71 A;  4IDY A;  4PV4 A;  2MAT A;  3IU7 A;  4U70 A;  2BHA A;  4IU6 A;  4S2R P;  4JUQ A;  4HXX A;  2GG3 A;  3PKD A;  4MAT A;  1XGO A;  3CB5 A;  4ZWP A;  3MR1 A;  2BWX A;  2G6P A;  1R58 A;  4U6W A;  1C23 A;  2HOW A;  3IU9 A;  4OOK A;  1W7V A;  4U6E A;  2V3Z A;  1Y1N A;  3MX6 A;  4S01 A;  1B59 A;  4PNC A;  1WY2 A;  2Q96 A;  2BH3 A;  3FM3 A;  5CLS A;  2NQ7 A;  1B6A A;  2BHC A;  2GU5 A;  3TB5 A;  2Q8K A;  5JFR A;  4FLK A;  2GG8 A;  4FO8 A;  4U6J A;  1WL9 A;  1XGM A;  3L24 A;  3PKB A;  1WBQ A;  4Z7M A;  1XNZ A;  2GTX A;  1R5G A;  5CDL A;  2P99 A;  4FLJ A;  5JHU A;  1N51 A;  1XGN A;  4FLL A;  2GGC A;  3FMQ A;  4RZY A;  2BWW A;  2GG5 A;  2EVC A;  2EVM A;  2BWT A;  4FUK A;  3Q6D A;  3ROR A;  1WKM A;  4IEC A;  2Q94 A;  4U6C A;  4EGE A;  3TAV A;  5JI6 A;  4IKS A;  4IKR A;  1QXY A;  2Q95 A; 
#chains in the Genus database with same CATH homology
 5CE6 A;  5CDV A;  5CDE A;  2BWV A;  4ZWU A;  3CB6 A;  4FKC A;  3PKC A;  2B3H A;  1BN5 A;  1BOA A;  1JAW A;  1QXW A;  2GG0 A;  4S00 A;  1MAT A;  2P9A A;  2P98 A;  2ZSG A;  1C21 A;  1M35 A;  3MAT A;  3IG4 A;  1O0X A;  1PV9 A;  1YW8 A;  4FLI A;  1YW9 A;  4U76 A;  2NQ6 A;  2V6C A;  4B28 A;  3PKE A;  2GU7 A;  5CNX A;  4ZNG A;  2OAZ A;  3IU8 A;  4U73 A;  2B3K A;  2BB7 A;  1C22 A;  2GU6 A;  1C24 A;  3D27 A;  3S6B A;  4A6V A;  1WN1 A;  5D6E A;  4KM3 A;  4U75 A;  5E5B A;  2GG7 A;  1R5H A;  1YVM A;  2GZ5 A;  4R60 A;  2EA2 A;  5FCF A;  1KQ9 A;  1YW7 A;  1XGS A;  1WL6 A;  3BIQ A;  4U1B A;  2B3L A;  4IF7 A;  4U69 A;  2DFI A;  4RZZ A;  1CHM A;  2BWS A;  2GU4 A;  1KQ0 A;  4S2T P;  3BIP A;  4RGZ 1;  4ZWO A;  2GGB A;  4FO7 A;  1WLR A;  2IW2 A;  4IPA A;  2ADU A;  2BN7 A;  1A16 A;  2GA2 A;  1YJ3 A;  3FMR A;  2BHB A;  4A6W A;  2EVO A;  1QXZ A;  2GG2 A;  2BHD A;  2V3X A;  2OKN A;  3L7G A;  4QR8 A;  2V3Y A;  2BWY A;  2Q93 A;  2Q92 A;  1KP0 A;  4U6Z A;  3BIT A;  5CIK A;  4IKU A;  5D6F A;  2GG9 A;  3PKA A;  2BWU A;  2EA4 A;  3RVA A;  1C27 A;  1QZY A;  4IKT A;  3CTZ A;  5FCH A;  1W2M A;  4U71 A;  4IDY A;  4PV4 A;  2MAT A;  3IU7 A;  4U70 A;  2BHA A;  4IU6 A;  4S2R P;  4JUQ A;  4HXX A;  2GG3 A;  3PKD A;  4MAT A;  1XGO A;  3CB5 A;  4ZWP A;  3MR1 A;  2BWX A;  2G6P A;  1R58 A;  4U6W A;  1C23 A;  2HOW A;  3IU9 A;  4OOK A;  1W7V A;  4U6E A;  2V3Z A;  1Y1N A;  3MX6 A;  4S01 A;  1B59 A;  4PNC A;  1WY2 A;  2Q96 A;  2BH3 A;  3FM3 A;  5CLS A;  2NQ7 A;  1B6A A;  2BHC A;  2GU5 A;  3TB5 A;  2Q8K A;  5JFR A;  4FLK A;  2GG8 A;  4FO8 A;  4U6J A;  1WL9 A;  1XGM A;  3L24 A;  3PKB A;  1WBQ A;  4Z7M A;  1XNZ A;  2GTX A;  1R5G A;  5CDL A;  2P99 A;  4FLJ A;  5JHU A;  1N51 A;  1XGN A;  4FLL A;  2GGC A;  3FMQ A;  4RZY A;  2BWW A;  2GG5 A;  2EVC A;  2EVM A;  2BWT A;  4FUK A;  3Q6D A;  3ROR A;  1WKM A;  4IEC A;  2Q94 A;  4U6C A;  4EGE A;  3TAV A;  5JI6 A;  4IKS A;  4IKR A;  1QXY A;  2Q95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...