1C24A

E. coli methionine aminopeptidase: methionine phosphinate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c24A00
1CHMA 2GU4A 1QXYA 2GG2A 2HOWA 2GA2A 4FLJA 3FMRA 4U6JA 1QZYA 1Y1NA 1XGMA 1WLRA 3IU9A 1WKMA 2BWSA 1C27A 4FO7A 1O0XA 1M35A 2G6PA 2GGCA 2BB7A 2GG5A 1BN5A 4S00A 4A6VA 1B6AA 2EA4A 4U6EA 4ZWUA 2Q94A 4PV4A 3TB5A 4FUKA 5CIKA 4FLKA 1MATA 1WL9A 2Q96A 2GG8A 3Q6DA 2B3KA 2V6CA 1WN1A 5CDVA 2GZ5A 5E5BA 2GU6A 3BIQA 2BH3A 3D27A 4RZZA 4S2TP 4A6WA 4Z7MA 2BHAA 3S6BA 1YW9A 5CNXA 4ZNGA 4MATA 4U70A 1XGOA 2BHCA 1YW8A 3CTZA 1R5GA 2Q95A 2V3XA 4IKRA 4IF7A 1C24A 3IU7A 2GU7A 3BITA 4U73A 2B3HA 2P99A 1A16A 2BWUA 3IG4A 5CDEA 5JHUA 1C21A 1XGSA 4FLLA 4U6CA 1WY2A 5D6FA 3L24A 4IECA 1PV9A 2GG9A 2BWXA 2B3LA 3FM3A 2V3YA 1KP0A 3L7GA 4QR8A 1KQ9A 3TAVA 2GGBA 5FCHA 1XGNA 2NQ6A 3BIPA 2NQ7A 4KM3A 2ADUA 4IKTA 3FMQA 2BWVA 4JUQA 2BWWA 2BWTA 2EVOA 4FLIA 1BOAA 4IKUA 1JAWA 1XNZA 2GG3A 3PKAA 4FO8A 4U6WA 3PKEA 2OKNA 1QXWA 1N51A 1B59A 3CB6A 4U71A 2Q92A 3MX6A 4U76A 4PNCA 2EVMA 4B28A 1C23A 4U1BA 4ZWPA 3MATA 4IKSA 4IPAA 1C22A 2P98A 4IDYA 2EVCA 1W7VA 3IU8A 4OOKA 1QXZA 4IU6A 3PKDA 1KQ0A 1YVMA 3PKCA 3CB5A 4S2RP 1YJ3A 1R5HA 5JFRA 4S01A 2BWYA 2Q8KA 4HXXA 5CLSA 5D6EA 2V3ZA 1R58A 2GG0A 3PKBA 4FKCA 2EA2A 5CDLA 5JI6A 2BN7A 2GTXA 2GU5A 2BHBA 4EGEA 2DFIA 2Q93A 2OAZA 2MATA 2ZSGA 4RGZ1 2P9AA 2GG7A 4U69A 5FCFA 4R60A 1YW7A 3MR1A 3RVAA 4U75A 3RORA 5CE6A 1W2MA 2IW2A 4RZYA 1WL6A 1WBQA 4ZWOA 4U6ZA 2BHDA
chains in the Genus database with same CATH superfamily
1CHMA 2GU4A 1QXYA 2GG2A 2HOWA 2GA2A 4FLJA 3FMRA 4U6JA 1QZYA 1Y1NA 1XGMA 1WLRA 3IU9A 1WKMA 2BWSA 1C27A 4FO7A 1O0XA 1M35A 2G6PA 2GGCA 2BB7A 2GG5A 1BN5A 4S00A 4A6VA 1B6AA 2EA4A 4U6EA 4ZWUA 2Q94A 4PV4A 3TB5A 4FUKA 5CIKA 4FLKA 1MATA 1WL9A 2Q96A 2GG8A 3Q6DA 2B3KA 2V6CA 1WN1A 5CDVA 2GZ5A 5E5BA 2GU6A 3BIQA 2BH3A 3D27A 4RZZA 4S2TP 4A6WA 4Z7MA 2BHAA 3S6BA 1YW9A 5CNXA 4ZNGA 4MATA 4U70A 1XGOA 2BHCA 1YW8A 3CTZA 1R5GA 2Q95A 2V3XA 4IKRA 4IF7A 1C24A 3IU7A 2GU7A 3BITA 4U73A 2B3HA 2P99A 1A16A 2BWUA 3IG4A 5CDEA 5JHUA 1C21A 1XGSA 4FLLA 4U6CA 1WY2A 5D6FA 3L24A 4IECA 1PV9A 2GG9A 2BWXA 2B3LA 3FM3A 2V3YA 1KP0A 3L7GA 4QR8A 1KQ9A 3TAVA 2GGBA 5FCHA 1XGNA 2NQ6A 3BIPA 2NQ7A 4KM3A 2ADUA 4IKTA 3FMQA 2BWVA 4JUQA 2BWWA 2BWTA 2EVOA 4FLIA 1BOAA 4IKUA 1JAWA 1XNZA 2GG3A 3PKAA 4FO8A 4U6WA 3PKEA 2OKNA 1QXWA 1N51A 1B59A 3CB6A 4U71A 2Q92A 3MX6A 4U76A 4PNCA 2EVMA 4B28A 1C23A 4U1BA 4ZWPA 3MATA 4IKSA 4IPAA 1C22A 2P98A 4IDYA 2EVCA 1W7VA 3IU8A 4OOKA 1QXZA 4IU6A 3PKDA 1KQ0A 1YVMA 3PKCA 3CB5A 4S2RP 1YJ3A 1R5HA 5JFRA 4S01A 2BWYA 2Q8KA 4HXXA 5CLSA 5D6EA 2V3ZA 1R58A 2GG0A 3PKBA 4FKCA 2EA2A 5CDLA 5JI6A 2BN7A 2GTXA 2GU5A 2BHBA 4EGEA 2DFIA 2Q93A 2OAZA 2MATA 2ZSGA 4RGZ1 2P9AA 2GG7A 4U69A 5FCFA 4R60A 1YW7A 3MR1A 3RVAA 4U75A 3RORA 5CE6A 1W2MA 2IW2A 4RZYA 1WL6A 1WBQA 4ZWOA 4U6ZA 2BHDA
chains in the Genus database with same CATH topology
1CHMA 2GU4A 1QXYA 2GG2A 2HOWA 2GA2A 4FLJA 3FMRA 4U6JA 1QZYA 1Y1NA 1XGMA 1WLRA 3IU9A 1WKMA 2BWSA 1C27A 4FO7A 1O0XA 1M35A 2G6PA 2GGCA 2BB7A 2GG5A 1BN5A 4S00A 4A6VA 1B6AA 2EA4A 4U6EA 4ZWUA 2Q94A 4PV4A 3TB5A 4FUKA 5CIKA 4FLKA 1MATA 1WL9A 2Q96A 2GG8A 3Q6DA 2B3KA 2V6CA 1WN1A 5CDVA 2GZ5A 5E5BA 2GU6A 3BIQA 2BH3A 3D27A 4RZZA 4S2TP 4A6WA 4Z7MA 2BHAA 3S6BA 1YW9A 5CNXA 4ZNGA 4MATA 4U70A 1XGOA 2BHCA 1YW8A 3CTZA 1R5GA 2Q95A 2V3XA 4IKRA 4IF7A 1C24A 3IU7A 2GU7A 3BITA 4U73A 2B3HA 2P99A 1A16A 2BWUA 3IG4A 5CDEA 5JHUA 1C21A 1XGSA 4FLLA 4U6CA 1WY2A 5D6FA 3L24A 4IECA 1PV9A 2GG9A 2BWXA 2B3LA 3FM3A 2V3YA 1KP0A 3L7GA 4QR8A 1KQ9A 3TAVA 2GGBA 5FCHA 1XGNA 2NQ6A 3BIPA 2NQ7A 4KM3A 2ADUA 4IKTA 3FMQA 2BWVA 4JUQA 2BWWA 2BWTA 2EVOA 4FLIA 1BOAA 4IKUA 1JAWA 1XNZA 2GG3A 3PKAA 4FO8A 4U6WA 3PKEA 2OKNA 1QXWA 1N51A 1B59A 3CB6A 4U71A 2Q92A 3MX6A 4U76A 4PNCA 2EVMA 4B28A 1C23A 4U1BA 4ZWPA 3MATA 4IKSA 4IPAA 1C22A 2P98A 4IDYA 2EVCA 1W7VA 3IU8A 4OOKA 1QXZA 4IU6A 3PKDA 1KQ0A 1YVMA 3PKCA 3CB5A 4S2RP 1YJ3A 1R5HA 5JFRA 4S01A 2BWYA 2Q8KA 4HXXA 5CLSA 5D6EA 2V3ZA 1R58A 2GG0A 3PKBA 4FKCA 2EA2A 5CDLA 5JI6A 2BN7A 2GTXA 2GU5A 2BHBA 4EGEA 2DFIA 2Q93A 2OAZA 2MATA 2ZSGA 4RGZ1 2P9AA 2GG7A 4U69A 5FCFA 4R60A 1YW7A 3MR1A 3RVAA 4U75A 3RORA 5CE6A 1W2MA 2IW2A 4RZYA 1WL6A 1WBQA 4ZWOA 4U6ZA 2BHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHM A;  2GU4 A;  1QXY A;  2GG2 A;  2HOW A;  2GA2 A;  4FLJ A;  3FMR A;  4U6J A;  1QZY A;  1Y1N A;  1XGM A;  1WLR A;  3IU9 A;  1WKM A;  2BWS A;  1C27 A;  4FO7 A;  1O0X A;  1M35 A;  2G6P A;  2GGC A;  2BB7 A;  2GG5 A;  1BN5 A;  4S00 A;  4A6V A;  1B6A A;  2EA4 A;  4U6E A;  4ZWU A;  2Q94 A;  4PV4 A;  3TB5 A;  4FUK A;  5CIK A;  4FLK A;  1MAT A;  1WL9 A;  2Q96 A;  2GG8 A;  3Q6D A;  2B3K A;  2V6C A;  1WN1 A;  5CDV A;  2GZ5 A;  5E5B A;  2GU6 A;  3BIQ A;  2BH3 A;  3D27 A;  4RZZ A;  4S2T P;  4A6W A;  4Z7M A;  2BHA A;  3S6B A;  1YW9 A;  5CNX A;  4ZNG A;  4MAT A;  4U70 A;  1XGO A;  2BHC A;  1YW8 A;  3CTZ A;  1R5G A;  2Q95 A;  2V3X A;  4IKR A;  4IF7 A;  1C24 A;  3IU7 A;  2GU7 A;  3BIT A;  4U73 A;  2B3H A;  2P99 A;  1A16 A;  2BWU A;  3IG4 A;  5CDE A;  5JHU A;  1C21 A;  1XGS A;  4FLL A;  4U6C A;  1WY2 A;  5D6F A;  3L24 A;  4IEC A;  1PV9 A;  2GG9 A;  2BWX A;  2B3L A;  3FM3 A;  2V3Y A;  1KP0 A;  3L7G A;  4QR8 A;  1KQ9 A;  3TAV A;  2GGB A;  5FCH A;  1XGN A;  2NQ6 A;  3BIP A;  2NQ7 A;  4KM3 A;  2ADU A;  4IKT A;  3FMQ A;  2BWV A;  4JUQ A;  2BWW A;  2BWT A;  2EVO A;  4FLI A;  1BOA A;  4IKU A;  1JAW A;  1XNZ A;  2GG3 A;  3PKA A;  4FO8 A;  4U6W A;  3PKE A;  2OKN A;  1QXW A;  1N51 A;  1B59 A;  3CB6 A;  4U71 A;  2Q92 A;  3MX6 A;  4U76 A;  4PNC A;  2EVM A;  4B28 A;  1C23 A;  4U1B A;  4ZWP A;  3MAT A;  4IKS A;  4IPA A;  1C22 A;  2P98 A;  4IDY A;  2EVC A;  1W7V A;  3IU8 A;  4OOK A;  1QXZ A;  4IU6 A;  3PKD A;  1KQ0 A;  1YVM A;  3PKC A;  3CB5 A;  4S2R P;  1YJ3 A;  1R5H A;  5JFR A;  4S01 A;  2BWY A;  2Q8K A;  4HXX A;  5CLS A;  5D6E A;  2V3Z A;  1R58 A;  2GG0 A;  3PKB A;  4FKC A;  2EA2 A;  5CDL A;  5JI6 A;  2BN7 A;  2GTX A;  2GU5 A;  2BHB A;  4EGE A;  2DFI A;  2Q93 A;  2OAZ A;  2MAT A;  2ZSG A;  4RGZ 1;  2P9A A;  2GG7 A;  4U69 A;  5FCF A;  4R60 A;  1YW7 A;  3MR1 A;  3RVA A;  4U75 A;  3ROR A;  5CE6 A;  1W2M A;  2IW2 A;  4RZY A;  1WL6 A;  1WBQ A;  4ZWO A;  4U6Z A;  2BHD A; 
#chains in the Genus database with same CATH topology
 1CHM A;  2GU4 A;  1QXY A;  2GG2 A;  2HOW A;  2GA2 A;  4FLJ A;  3FMR A;  4U6J A;  1QZY A;  1Y1N A;  1XGM A;  1WLR A;  3IU9 A;  1WKM A;  2BWS A;  1C27 A;  4FO7 A;  1O0X A;  1M35 A;  2G6P A;  2GGC A;  2BB7 A;  2GG5 A;  1BN5 A;  4S00 A;  4A6V A;  1B6A A;  2EA4 A;  4U6E A;  4ZWU A;  2Q94 A;  4PV4 A;  3TB5 A;  4FUK A;  5CIK A;  4FLK A;  1MAT A;  1WL9 A;  2Q96 A;  2GG8 A;  3Q6D A;  2B3K A;  2V6C A;  1WN1 A;  5CDV A;  2GZ5 A;  5E5B A;  2GU6 A;  3BIQ A;  2BH3 A;  3D27 A;  4RZZ A;  4S2T P;  4A6W A;  4Z7M A;  2BHA A;  3S6B A;  1YW9 A;  5CNX A;  4ZNG A;  4MAT A;  4U70 A;  1XGO A;  2BHC A;  1YW8 A;  3CTZ A;  1R5G A;  2Q95 A;  2V3X A;  4IKR A;  4IF7 A;  1C24 A;  3IU7 A;  2GU7 A;  3BIT A;  4U73 A;  2B3H A;  2P99 A;  1A16 A;  2BWU A;  3IG4 A;  5CDE A;  5JHU A;  1C21 A;  1XGS A;  4FLL A;  4U6C A;  1WY2 A;  5D6F A;  3L24 A;  4IEC A;  1PV9 A;  2GG9 A;  2BWX A;  2B3L A;  3FM3 A;  2V3Y A;  1KP0 A;  3L7G A;  4QR8 A;  1KQ9 A;  3TAV A;  2GGB A;  5FCH A;  1XGN A;  2NQ6 A;  3BIP A;  2NQ7 A;  4KM3 A;  2ADU A;  4IKT A;  3FMQ A;  2BWV A;  4JUQ A;  2BWW A;  2BWT A;  2EVO A;  4FLI A;  1BOA A;  4IKU A;  1JAW A;  1XNZ A;  2GG3 A;  3PKA A;  4FO8 A;  4U6W A;  3PKE A;  2OKN A;  1QXW A;  1N51 A;  1B59 A;  3CB6 A;  4U71 A;  2Q92 A;  3MX6 A;  4U76 A;  4PNC A;  2EVM A;  4B28 A;  1C23 A;  4U1B A;  4ZWP A;  3MAT A;  4IKS A;  4IPA A;  1C22 A;  2P98 A;  4IDY A;  2EVC A;  1W7V A;  3IU8 A;  4OOK A;  1QXZ A;  4IU6 A;  3PKD A;  1KQ0 A;  1YVM A;  3PKC A;  3CB5 A;  4S2R P;  1YJ3 A;  1R5H A;  5JFR A;  4S01 A;  2BWY A;  2Q8K A;  4HXX A;  5CLS A;  5D6E A;  2V3Z A;  1R58 A;  2GG0 A;  3PKB A;  4FKC A;  2EA2 A;  5CDL A;  5JI6 A;  2BN7 A;  2GTX A;  2GU5 A;  2BHB A;  4EGE A;  2DFI A;  2Q93 A;  2OAZ A;  2MAT A;  2ZSG A;  4RGZ 1;  2P9A A;  2GG7 A;  4U69 A;  5FCF A;  4R60 A;  1YW7 A;  3MR1 A;  3RVA A;  4U75 A;  3ROR A;  5CE6 A;  1W2M A;  2IW2 A;  4RZY A;  1WL6 A;  1WBQ A;  4ZWO A;  4U6Z A;  2BHD A; 
#chains in the Genus database with same CATH homology
 1CHM A;  2GU4 A;  1QXY A;  2GG2 A;  2HOW A;  2GA2 A;  4FLJ A;  3FMR A;  4U6J A;  1QZY A;  1Y1N A;  1XGM A;  1WLR A;  3IU9 A;  1WKM A;  2BWS A;  1C27 A;  4FO7 A;  1O0X A;  1M35 A;  2G6P A;  2GGC A;  2BB7 A;  2GG5 A;  1BN5 A;  4S00 A;  4A6V A;  1B6A A;  2EA4 A;  4U6E A;  4ZWU A;  2Q94 A;  4PV4 A;  3TB5 A;  4FUK A;  5CIK A;  4FLK A;  1MAT A;  1WL9 A;  2Q96 A;  2GG8 A;  3Q6D A;  2B3K A;  2V6C A;  1WN1 A;  5CDV A;  2GZ5 A;  5E5B A;  2GU6 A;  3BIQ A;  2BH3 A;  3D27 A;  4RZZ A;  4S2T P;  4A6W A;  4Z7M A;  2BHA A;  3S6B A;  1YW9 A;  5CNX A;  4ZNG A;  4MAT A;  4U70 A;  1XGO A;  2BHC A;  1YW8 A;  3CTZ A;  1R5G A;  2Q95 A;  2V3X A;  4IKR A;  4IF7 A;  1C24 A;  3IU7 A;  2GU7 A;  3BIT A;  4U73 A;  2B3H A;  2P99 A;  1A16 A;  2BWU A;  3IG4 A;  5CDE A;  5JHU A;  1C21 A;  1XGS A;  4FLL A;  4U6C A;  1WY2 A;  5D6F A;  3L24 A;  4IEC A;  1PV9 A;  2GG9 A;  2BWX A;  2B3L A;  3FM3 A;  2V3Y A;  1KP0 A;  3L7G A;  4QR8 A;  1KQ9 A;  3TAV A;  2GGB A;  5FCH A;  1XGN A;  2NQ6 A;  3BIP A;  2NQ7 A;  4KM3 A;  2ADU A;  4IKT A;  3FMQ A;  2BWV A;  4JUQ A;  2BWW A;  2BWT A;  2EVO A;  4FLI A;  1BOA A;  4IKU A;  1JAW A;  1XNZ A;  2GG3 A;  3PKA A;  4FO8 A;  4U6W A;  3PKE A;  2OKN A;  1QXW A;  1N51 A;  1B59 A;  3CB6 A;  4U71 A;  2Q92 A;  3MX6 A;  4U76 A;  4PNC A;  2EVM A;  4B28 A;  1C23 A;  4U1B A;  4ZWP A;  3MAT A;  4IKS A;  4IPA A;  1C22 A;  2P98 A;  4IDY A;  2EVC A;  1W7V A;  3IU8 A;  4OOK A;  1QXZ A;  4IU6 A;  3PKD A;  1KQ0 A;  1YVM A;  3PKC A;  3CB5 A;  4S2R P;  1YJ3 A;  1R5H A;  5JFR A;  4S01 A;  2BWY A;  2Q8K A;  4HXX A;  5CLS A;  5D6E A;  2V3Z A;  1R58 A;  2GG0 A;  3PKB A;  4FKC A;  2EA2 A;  5CDL A;  5JI6 A;  2BN7 A;  2GTX A;  2GU5 A;  2BHB A;  4EGE A;  2DFI A;  2Q93 A;  2OAZ A;  2MAT A;  2ZSG A;  4RGZ 1;  2P9A A;  2GG7 A;  4U69 A;  5FCF A;  4R60 A;  1YW7 A;  3MR1 A;  3RVA A;  4U75 A;  3ROR A;  5CE6 A;  1W2M A;  2IW2 A;  4RZY A;  1WL6 A;  1WBQ A;  4ZWO A;  4U6Z A;  2BHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...