1C24A

E. coli methionine aminopeptidase: methionine phosphinate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c24A00
2GA2A 4FUKA 5E5BA 1XGNA 2V3XA 2BHBA 2IW2A 3PKDA 2BHCA 2BWXA 2V3ZA 2V3YA 3Q6DA 1C21A 1R5GA 2EA2A 3CTZA 2GGCA 2ADUA 3D27A 3TAVA 4FLLA 1JAWA 3L24A 1W7VA 2OAZA 4IKTA 1QXZA 2V6CA 2HOWA 3BITA 4IKSA 4U71A 5CE6A 2GU6A 4ZWUA 5CDLA 1M35A 1C22A 3FMRA 1WY2A 4U1BA 2Q92A 4A6VA 2GG2A 1B59A 3PKEA 4MATA 5CDVA 2BWSA 4IKUA 1C23A 3CB6A 5JFRA 2BWVA 2BH3A 2GG8A 3BIQA 1R58A 4ZWPA 1CHMA 1XGOA 4IDYA 4FKCA 2EA4A 5FCHA 1WBQA 4JUQA 4U6CA 1KQ0A 4A6WA 3IU9A 1BN5A 2B3LA 2BWUA 2P99A 3PKBA 2EVMA 4U6JA 4U73A 3RVAA 1YW7A 3MATA 3MX6A 1WL9A 3IG4A 2GG5A 2NQ6A 4KM3A 4B28A 5CLSA 1QZYA 2GG3A 1WL6A 4R60A 2GG9A 1Y1NA 1YW9A 4U6ZA 5CNXA 4FLIA 2P9AA 4HXXA 4EGEA 4U76A 2GG0A 2Q94A 2Q8KA 5JHUA 1YJ3A 2EVOA 4S01A 3TB5A 5FCFA 2OKNA 4S2TP 2B3KA 1XGSA 5D6FA 4IKRA 3CB5A 1WKMA 2BN7A 2MATA 4PV4A 5CIKA 4RZYA 1QXWA 3FM3A 4S2RP 1R5HA 1QXYA 2Q95A 2BWWA 4U75A 4QR8A 1MATA 1O0XA 2BB7A 3S6BA 3PKAA 4PNCA 2NQ7A 5D6EA 4U69A 1PV9A 2GGBA 4ZNGA 3IU7A 3BIPA 2GU4A 3MR1A 4U70A 1KP0A 1C27A 1A16A 1WN1A 4FO7A 1BOAA 4IU6A 2BWYA 1C24A 1YVMA 4U6EA 4Z7MA 4FLJA 2P98A 3RORA 1N51A 4IECA 4FLKA 1WLRA 2G6PA 1YW8A 2EVCA 4S00A 4U6WA 4IPAA 2GU5A 4RZZA 5CDEA 2Q96A 2BWTA 3PKCA 2BHAA 2BHDA 2ZSGA 4OOKA 1XNZA 4IF7A 2GZ5A 4RGZ1 5JI6A 2Q93A 3IU8A 1KQ9A 4ZWOA 2GG7A 3L7GA 1W2MA 4FO8A 1XGMA 3FMQA 2DFIA 2GTXA 2GU7A 1B6AA 2B3HA
chains in the Genus database with same CATH superfamily
2GA2A 4FUKA 5E5BA 1XGNA 2V3XA 2BHBA 2IW2A 3PKDA 2BHCA 2BWXA 2V3ZA 2V3YA 3Q6DA 1C21A 1R5GA 2EA2A 3CTZA 2GGCA 2ADUA 3D27A 3TAVA 4FLLA 1JAWA 3L24A 1W7VA 2OAZA 4IKTA 1QXZA 2V6CA 2HOWA 3BITA 4IKSA 4U71A 5CE6A 2GU6A 4ZWUA 5CDLA 1M35A 1C22A 3FMRA 1WY2A 4U1BA 2Q92A 4A6VA 2GG2A 1B59A 3PKEA 4MATA 5CDVA 2BWSA 4IKUA 1C23A 3CB6A 5JFRA 2BWVA 2BH3A 2GG8A 3BIQA 1R58A 4ZWPA 1CHMA 1XGOA 4IDYA 4FKCA 2EA4A 5FCHA 1WBQA 4JUQA 4U6CA 1KQ0A 4A6WA 3IU9A 1BN5A 2B3LA 2BWUA 2P99A 3PKBA 2EVMA 4U6JA 4U73A 3RVAA 1YW7A 3MATA 3MX6A 1WL9A 3IG4A 2GG5A 2NQ6A 4KM3A 4B28A 5CLSA 1QZYA 2GG3A 1WL6A 4R60A 2GG9A 1Y1NA 1YW9A 4U6ZA 5CNXA 4FLIA 2P9AA 4HXXA 4EGEA 4U76A 2GG0A 2Q94A 2Q8KA 5JHUA 1YJ3A 2EVOA 4S01A 3TB5A 5FCFA 2OKNA 4S2TP 2B3KA 1XGSA 5D6FA 4IKRA 3CB5A 1WKMA 2BN7A 2MATA 4PV4A 5CIKA 4RZYA 1QXWA 3FM3A 4S2RP 1R5HA 1QXYA 2Q95A 2BWWA 4U75A 4QR8A 1MATA 1O0XA 2BB7A 3S6BA 3PKAA 4PNCA 2NQ7A 5D6EA 4U69A 1PV9A 2GGBA 4ZNGA 3IU7A 3BIPA 2GU4A 3MR1A 4U70A 1KP0A 1C27A 1A16A 1WN1A 4FO7A 1BOAA 4IU6A 2BWYA 1C24A 1YVMA 4U6EA 4Z7MA 4FLJA 2P98A 3RORA 1N51A 4IECA 4FLKA 1WLRA 2G6PA 1YW8A 2EVCA 4S00A 4U6WA 4IPAA 2GU5A 4RZZA 5CDEA 2Q96A 2BWTA 3PKCA 2BHAA 2BHDA 2ZSGA 4OOKA 1XNZA 4IF7A 2GZ5A 4RGZ1 5JI6A 2Q93A 3IU8A 1KQ9A 4ZWOA 2GG7A 3L7GA 1W2MA 4FO8A 1XGMA 3FMQA 2DFIA 2GTXA 2GU7A 1B6AA 2B3HA
chains in the Genus database with same CATH topology
2GA2A 4FUKA 5E5BA 1XGNA 2V3XA 2BHBA 2IW2A 3PKDA 2BHCA 2BWXA 2V3ZA 2V3YA 3Q6DA 1C21A 1R5GA 2EA2A 3CTZA 2GGCA 2ADUA 3D27A 3TAVA 4FLLA 1JAWA 3L24A 1W7VA 2OAZA 4IKTA 1QXZA 2V6CA 2HOWA 3BITA 4IKSA 4U71A 5CE6A 2GU6A 4ZWUA 5CDLA 1M35A 1C22A 3FMRA 1WY2A 4U1BA 2Q92A 4A6VA 2GG2A 1B59A 3PKEA 4MATA 5CDVA 2BWSA 4IKUA 1C23A 3CB6A 5JFRA 2BWVA 2BH3A 2GG8A 3BIQA 1R58A 4ZWPA 1CHMA 1XGOA 4IDYA 4FKCA 2EA4A 5FCHA 1WBQA 4JUQA 4U6CA 1KQ0A 4A6WA 3IU9A 1BN5A 2B3LA 2BWUA 2P99A 3PKBA 2EVMA 4U6JA 4U73A 3RVAA 1YW7A 3MATA 3MX6A 1WL9A 3IG4A 2GG5A 2NQ6A 4KM3A 4B28A 5CLSA 1QZYA 2GG3A 1WL6A 4R60A 2GG9A 1Y1NA 1YW9A 4U6ZA 5CNXA 4FLIA 2P9AA 4HXXA 4EGEA 4U76A 2GG0A 2Q94A 2Q8KA 5JHUA 1YJ3A 2EVOA 4S01A 3TB5A 5FCFA 2OKNA 4S2TP 2B3KA 1XGSA 5D6FA 4IKRA 3CB5A 1WKMA 2BN7A 2MATA 4PV4A 5CIKA 4RZYA 1QXWA 3FM3A 4S2RP 1R5HA 1QXYA 2Q95A 2BWWA 4U75A 4QR8A 1MATA 1O0XA 2BB7A 3S6BA 3PKAA 4PNCA 2NQ7A 5D6EA 4U69A 1PV9A 2GGBA 4ZNGA 3IU7A 3BIPA 2GU4A 3MR1A 4U70A 1KP0A 1C27A 1A16A 1WN1A 4FO7A 1BOAA 4IU6A 2BWYA 1C24A 1YVMA 4U6EA 4Z7MA 4FLJA 2P98A 3RORA 1N51A 4IECA 4FLKA 1WLRA 2G6PA 1YW8A 2EVCA 4S00A 4U6WA 4IPAA 2GU5A 4RZZA 5CDEA 2Q96A 2BWTA 3PKCA 2BHAA 2BHDA 2ZSGA 4OOKA 1XNZA 4IF7A 2GZ5A 4RGZ1 5JI6A 2Q93A 3IU8A 1KQ9A 4ZWOA 2GG7A 3L7GA 1W2MA 4FO8A 1XGMA 3FMQA 2DFIA 2GTXA 2GU7A 1B6AA 2B3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA2 A;  4FUK A;  5E5B A;  1XGN A;  2V3X A;  2BHB A;  2IW2 A;  3PKD A;  2BHC A;  2BWX A;  2V3Z A;  2V3Y A;  3Q6D A;  1C21 A;  1R5G A;  2EA2 A;  3CTZ A;  2GGC A;  2ADU A;  3D27 A;  3TAV A;  4FLL A;  1JAW A;  3L24 A;  1W7V A;  2OAZ A;  4IKT A;  1QXZ A;  2V6C A;  2HOW A;  3BIT A;  4IKS A;  4U71 A;  5CE6 A;  2GU6 A;  4ZWU A;  5CDL A;  1M35 A;  1C22 A;  3FMR A;  1WY2 A;  4U1B A;  2Q92 A;  4A6V A;  2GG2 A;  1B59 A;  3PKE A;  4MAT A;  5CDV A;  2BWS A;  4IKU A;  1C23 A;  3CB6 A;  5JFR A;  2BWV A;  2BH3 A;  2GG8 A;  3BIQ A;  1R58 A;  4ZWP A;  1CHM A;  1XGO A;  4IDY A;  4FKC A;  2EA4 A;  5FCH A;  1WBQ A;  4JUQ A;  4U6C A;  1KQ0 A;  4A6W A;  3IU9 A;  1BN5 A;  2B3L A;  2BWU A;  2P99 A;  3PKB A;  2EVM A;  4U6J A;  4U73 A;  3RVA A;  1YW7 A;  3MAT A;  3MX6 A;  1WL9 A;  3IG4 A;  2GG5 A;  2NQ6 A;  4KM3 A;  4B28 A;  5CLS A;  1QZY A;  2GG3 A;  1WL6 A;  4R60 A;  2GG9 A;  1Y1N A;  1YW9 A;  4U6Z A;  5CNX A;  4FLI A;  2P9A A;  4HXX A;  4EGE A;  4U76 A;  2GG0 A;  2Q94 A;  2Q8K A;  5JHU A;  1YJ3 A;  2EVO A;  4S01 A;  3TB5 A;  5FCF A;  2OKN A;  4S2T P;  2B3K A;  1XGS A;  5D6F A;  4IKR A;  3CB5 A;  1WKM A;  2BN7 A;  2MAT A;  4PV4 A;  5CIK A;  4RZY A;  1QXW A;  3FM3 A;  4S2R P;  1R5H A;  1QXY A;  2Q95 A;  2BWW A;  4U75 A;  4QR8 A;  1MAT A;  1O0X A;  2BB7 A;  3S6B A;  3PKA A;  4PNC A;  2NQ7 A;  5D6E A;  4U69 A;  1PV9 A;  2GGB A;  4ZNG A;  3IU7 A;  3BIP A;  2GU4 A;  3MR1 A;  4U70 A;  1KP0 A;  1C27 A;  1A16 A;  1WN1 A;  4FO7 A;  1BOA A;  4IU6 A;  2BWY A;  1C24 A;  1YVM A;  4U6E A;  4Z7M A;  4FLJ A;  2P98 A;  3ROR A;  1N51 A;  4IEC A;  4FLK A;  1WLR A;  2G6P A;  1YW8 A;  2EVC A;  4S00 A;  4U6W A;  4IPA A;  2GU5 A;  4RZZ A;  5CDE A;  2Q96 A;  2BWT A;  3PKC A;  2BHA A;  2BHD A;  2ZSG A;  4OOK A;  1XNZ A;  4IF7 A;  2GZ5 A;  4RGZ 1;  5JI6 A;  2Q93 A;  3IU8 A;  1KQ9 A;  4ZWO A;  2GG7 A;  3L7G A;  1W2M A;  4FO8 A;  1XGM A;  3FMQ A;  2DFI A;  2GTX A;  2GU7 A;  1B6A A;  2B3H A; 
#chains in the Genus database with same CATH topology
 2GA2 A;  4FUK A;  5E5B A;  1XGN A;  2V3X A;  2BHB A;  2IW2 A;  3PKD A;  2BHC A;  2BWX A;  2V3Z A;  2V3Y A;  3Q6D A;  1C21 A;  1R5G A;  2EA2 A;  3CTZ A;  2GGC A;  2ADU A;  3D27 A;  3TAV A;  4FLL A;  1JAW A;  3L24 A;  1W7V A;  2OAZ A;  4IKT A;  1QXZ A;  2V6C A;  2HOW A;  3BIT A;  4IKS A;  4U71 A;  5CE6 A;  2GU6 A;  4ZWU A;  5CDL A;  1M35 A;  1C22 A;  3FMR A;  1WY2 A;  4U1B A;  2Q92 A;  4A6V A;  2GG2 A;  1B59 A;  3PKE A;  4MAT A;  5CDV A;  2BWS A;  4IKU A;  1C23 A;  3CB6 A;  5JFR A;  2BWV A;  2BH3 A;  2GG8 A;  3BIQ A;  1R58 A;  4ZWP A;  1CHM A;  1XGO A;  4IDY A;  4FKC A;  2EA4 A;  5FCH A;  1WBQ A;  4JUQ A;  4U6C A;  1KQ0 A;  4A6W A;  3IU9 A;  1BN5 A;  2B3L A;  2BWU A;  2P99 A;  3PKB A;  2EVM A;  4U6J A;  4U73 A;  3RVA A;  1YW7 A;  3MAT A;  3MX6 A;  1WL9 A;  3IG4 A;  2GG5 A;  2NQ6 A;  4KM3 A;  4B28 A;  5CLS A;  1QZY A;  2GG3 A;  1WL6 A;  4R60 A;  2GG9 A;  1Y1N A;  1YW9 A;  4U6Z A;  5CNX A;  4FLI A;  2P9A A;  4HXX A;  4EGE A;  4U76 A;  2GG0 A;  2Q94 A;  2Q8K A;  5JHU A;  1YJ3 A;  2EVO A;  4S01 A;  3TB5 A;  5FCF A;  2OKN A;  4S2T P;  2B3K A;  1XGS A;  5D6F A;  4IKR A;  3CB5 A;  1WKM A;  2BN7 A;  2MAT A;  4PV4 A;  5CIK A;  4RZY A;  1QXW A;  3FM3 A;  4S2R P;  1R5H A;  1QXY A;  2Q95 A;  2BWW A;  4U75 A;  4QR8 A;  1MAT A;  1O0X A;  2BB7 A;  3S6B A;  3PKA A;  4PNC A;  2NQ7 A;  5D6E A;  4U69 A;  1PV9 A;  2GGB A;  4ZNG A;  3IU7 A;  3BIP A;  2GU4 A;  3MR1 A;  4U70 A;  1KP0 A;  1C27 A;  1A16 A;  1WN1 A;  4FO7 A;  1BOA A;  4IU6 A;  2BWY A;  1C24 A;  1YVM A;  4U6E A;  4Z7M A;  4FLJ A;  2P98 A;  3ROR A;  1N51 A;  4IEC A;  4FLK A;  1WLR A;  2G6P A;  1YW8 A;  2EVC A;  4S00 A;  4U6W A;  4IPA A;  2GU5 A;  4RZZ A;  5CDE A;  2Q96 A;  2BWT A;  3PKC A;  2BHA A;  2BHD A;  2ZSG A;  4OOK A;  1XNZ A;  4IF7 A;  2GZ5 A;  4RGZ 1;  5JI6 A;  2Q93 A;  3IU8 A;  1KQ9 A;  4ZWO A;  2GG7 A;  3L7G A;  1W2M A;  4FO8 A;  1XGM A;  3FMQ A;  2DFI A;  2GTX A;  2GU7 A;  1B6A A;  2B3H A; 
#chains in the Genus database with same CATH homology
 2GA2 A;  4FUK A;  5E5B A;  1XGN A;  2V3X A;  2BHB A;  2IW2 A;  3PKD A;  2BHC A;  2BWX A;  2V3Z A;  2V3Y A;  3Q6D A;  1C21 A;  1R5G A;  2EA2 A;  3CTZ A;  2GGC A;  2ADU A;  3D27 A;  3TAV A;  4FLL A;  1JAW A;  3L24 A;  1W7V A;  2OAZ A;  4IKT A;  1QXZ A;  2V6C A;  2HOW A;  3BIT A;  4IKS A;  4U71 A;  5CE6 A;  2GU6 A;  4ZWU A;  5CDL A;  1M35 A;  1C22 A;  3FMR A;  1WY2 A;  4U1B A;  2Q92 A;  4A6V A;  2GG2 A;  1B59 A;  3PKE A;  4MAT A;  5CDV A;  2BWS A;  4IKU A;  1C23 A;  3CB6 A;  5JFR A;  2BWV A;  2BH3 A;  2GG8 A;  3BIQ A;  1R58 A;  4ZWP A;  1CHM A;  1XGO A;  4IDY A;  4FKC A;  2EA4 A;  5FCH A;  1WBQ A;  4JUQ A;  4U6C A;  1KQ0 A;  4A6W A;  3IU9 A;  1BN5 A;  2B3L A;  2BWU A;  2P99 A;  3PKB A;  2EVM A;  4U6J A;  4U73 A;  3RVA A;  1YW7 A;  3MAT A;  3MX6 A;  1WL9 A;  3IG4 A;  2GG5 A;  2NQ6 A;  4KM3 A;  4B28 A;  5CLS A;  1QZY A;  2GG3 A;  1WL6 A;  4R60 A;  2GG9 A;  1Y1N A;  1YW9 A;  4U6Z A;  5CNX A;  4FLI A;  2P9A A;  4HXX A;  4EGE A;  4U76 A;  2GG0 A;  2Q94 A;  2Q8K A;  5JHU A;  1YJ3 A;  2EVO A;  4S01 A;  3TB5 A;  5FCF A;  2OKN A;  4S2T P;  2B3K A;  1XGS A;  5D6F A;  4IKR A;  3CB5 A;  1WKM A;  2BN7 A;  2MAT A;  4PV4 A;  5CIK A;  4RZY A;  1QXW A;  3FM3 A;  4S2R P;  1R5H A;  1QXY A;  2Q95 A;  2BWW A;  4U75 A;  4QR8 A;  1MAT A;  1O0X A;  2BB7 A;  3S6B A;  3PKA A;  4PNC A;  2NQ7 A;  5D6E A;  4U69 A;  1PV9 A;  2GGB A;  4ZNG A;  3IU7 A;  3BIP A;  2GU4 A;  3MR1 A;  4U70 A;  1KP0 A;  1C27 A;  1A16 A;  1WN1 A;  4FO7 A;  1BOA A;  4IU6 A;  2BWY A;  1C24 A;  1YVM A;  4U6E A;  4Z7M A;  4FLJ A;  2P98 A;  3ROR A;  1N51 A;  4IEC A;  4FLK A;  1WLR A;  2G6P A;  1YW8 A;  2EVC A;  4S00 A;  4U6W A;  4IPA A;  2GU5 A;  4RZZ A;  5CDE A;  2Q96 A;  2BWT A;  3PKC A;  2BHA A;  2BHD A;  2ZSG A;  4OOK A;  1XNZ A;  4IF7 A;  2GZ5 A;  4RGZ 1;  5JI6 A;  2Q93 A;  3IU8 A;  1KQ9 A;  4ZWO A;  2GG7 A;  3L7G A;  1W2M A;  4FO8 A;  1XGM A;  3FMQ A;  2DFI A;  2GTX A;  2GU7 A;  1B6A A;  2B3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...