1C29A

Crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxyphenylthio)-1-butenylphosphonic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
266
structure length
264
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Crystallographic studies of phosphonate-based alpha-reaction transition-state analogues complexed to tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase/lyase inhibitor
total genus 97
structure length 264
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1999-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1c29A00
3HB9A 2YW4A 3L5LA 3T7VA 1TPDA 2WV8A 2ZRXA 4LVDA 3I7QA 2J9ZA 3P74A 3W1AA 4UMCA 1F6KA 1VCFA 2B7NA 3ABQA 1Q6OA 2W6RA 3AJXA 5HUPA 1FDYA 3F03K 1OYCA 4GWEA 1U5JA 5F4WA 3A24A 3UWWA 1QPQA 2QCGA 4NX5A 1W0MA 3OIXA 2DZTA 3W72A 3PBVA 2JGQA 5EA9A 3DKLA 2V2DA 4BR1A 3MYOA 3IIZA 3LB0A 1DQXA 4NUWA 2DP3A 2A2IA 1THFD 1TTIA 1ZFJA 5CPOA 1F6PA 3MMTA 5F2GA 3FLUA 4JIQA 2Q8ZA 2C16A 7TIMA 3GAKA 3NL6A 1XL9A 3P80A 1JRCA 4FNPA 5T26A 1KM1A 4KFPA 3W7IA 5AYZA 1VR6A 4LOCA 6ALDA 2PURA 5KITA 2Z6IA 4GUFA 1GTHA 1YDOA 1DKWA 2F84A 4WY0A 4BI7A 4HNTA 2G95A 3QEZA 3G0UA 1UB3A 1LDCA 3TFCA 1TRDA 2VFEA 2E5CA 4MJZA 3TAOA 4O14A 3HGJA 2H6RA 4PL1A 1OFAA 2XFWA 3RLVA 4O0ZA 4A22A 2OT0A 1T99A 4N9EA 1TRIA 4WX2A 1MEWA 4DBDA 2D73A 3S1XA 2V5BA 3UXDA 2P0OA 4CQ8A 3PS7A 3WJWA 4M6PA 1ZY9A 3STFA 1V5XA 5MHBA 1ZENA 2O7SA 1H7NA 2CLFA 4OQVA 1YYAA 4GJ1A 1JQVA 2CW6A 3L5AA 2E6AA 4LS1A 3W7GA 2C19A 5A5WA 3S5YA 3ZS4A 5LSMA 4FNQA 1H7RA 2Y7FA 3FJLA 3RMJA 5E93A 4DEFA 4A3UA 1VYRA 3STEA 2Y70A 4FO4A 1MSSA 1PE1A 4UFMA 1S5TA 1H1YA 1LRQA 4U28A 4N2YA 1LROA 4UTUA 4WJEA 4DPPA 4K6AA 3NPVA 3UWZA 3PULA 1LLZA 2C13A 3LBMA 2ZZ4A 3KVLA 2CLKA 4M6QA 3SZ8A 1R46A 2OMAA 4JNMA 1SPQA 2IQTA 3DFSA 5SWUA 1WA3A 3W1MA 3PC0A 3P62A 4LWWA 3PR2A 3U8GA 2ALDA 5BOOA 2A21A 3D0CA 3B8DA 3N14A 4N6EA 3W70A 1XDLA 1F73A 3GAYA 1JCJA 3PY2A 3C61A 2P10A 3M44A 4MVAA 4KFOA 1PCKA 1KFLA 1G69A 3EXSA 2BXVA 4BF9A 4UFKA 3TX9A 4RJEA 4A21A 1BWKA 2HMCA 3ZWTA 2C6QA 2J27A 1CX9A 1G6CA 3HJZA 1Q6QA 4XBSA 3TR2A 4O1DA 5D37A 1X6UA 1NVMA 4M6VA 4NNCA 1OYAA 3W23A 4WZHA 1W31A 1K7XA 2TMDA 3W1PA 3W1TA 1LBLA 1SO3A 3WJXA 2CLIA 3NXFA 3HBLA 2VELA 1O5KA 4NZFA 5E0KA 4MZ1A 5DCEA 3G24A 2VENA 3NZRA 5D05A 3PWAA 4QM1A 3VCRA 3LCGA 1FWSA 1EEPA 3R89A 3INPA 4AAJA 3LHUA 4Z1DA 4J9JA 2C1HA 3W2KA 1T96A 1ZALA 4KWVA 2GUUA 4XTIA 5G4WA 5LNWA 1CI1A 3JRKA 3DGRA 1ICPA 1S5WA 4EIVA 3GDMA 1TO3A 4OHQA 1TTJA 3R13A 5TBOA 2EPHA 1H63A 3QMRA 1EWEA 3I7RA 1V7YA 5D04C 1EA0A 4NNBA 1P0KA 1UUOA 3I6RA 3W6YA 1TCDA 1UJPA 3GXPA 3NQDA 3UWUA 1VCVA 1UBSA 2ZTJA 5DBUA 5H91A 3ABRA 4DBEA 5DXXA 3NYZA 5K9DA 4A2RA 1GT8A 4OT7A 2CWNA 1K02A 5K4ZA 4H4IA 5K3VA 1W3NA 2B7QA 4WOZA 1SO4A 4TX9A 3LV6A 2VC6A 1ZAHA 3W7NA 1A50A 1WV2A 5BNKA 2ZZ3A 5C5YA 3TIMA 4B5NA 2ZRVA 4FXRA 2R91A 3QJAA 4FIRA 1NF0A 3W2LA 2ISSA 3E49A 5LNUA 1OK4A 3WK1A 3MHGA 1MO0A 4K36A 4U4MA 3R5EA 3IGXA 1LBFA 2BTMA 1QWGA 4ALDA 4UUIA 4XBKA 4UMAA 4ICNA 3JS3A 2WNNA 2QCHA 2X30A 5U4NA 4DF1A 1SZFA 1VCGA 4FEZA 2RDUA 1F76A 2C15A 3B0VC 5EBUA 2CFFA 1OFEA 1W37A 4MYXA 1SZGA 5HNRA 4Q33A 1H7OA 3G1HA 4CCDA 1XBXA 1TPWA 4NJKA 2EF9A 1U83A 2FB2A 1GZGA 5FEWA 3MP4A 1Z44A 3UWQA 1LRNA 4UTKA 1XDMA 2NZLA 4HHPA 4JTFA 1B57A 3KAOA 1JCXA 1WQ5A 3RU6A 1A5SA 3NM1A 4ORMA 3U2OA 3N2XA 1KM3A 1YPIA 2Q3RA 3TXZA 1JQXA 3F4NA 5HWJA 5U7SA 3EKLA 1QNVA 2TRSA 1K7FA 2CU0A 2DJLA 1DORA 1OFOA 4PH6A 3IVUA 4GC4A 5D2XA 2YFNA 1I2OA 3CU2A 1KTBA 3KOFA 4Q32A 3DFQA 4P2VA 2QCMA 1LOLA 1TMHA 5I3IA 1TB3A 1VC4A 5AFDA 4RZ4A 3BW3A 2GOUA 3NQMA 3C2VA 4ZVJA 1RQEA 1OFPA 1LP6A 3UWYA 3GK0A 3N9RA 4ZMGA 4PTNA 4EVZA 4OE7A 2W0UA 5E1QA 3NQVA 3T44A 1D3GA 4RZ5A 1M6JA 1OJXA 1ADOA 1R47A 3QF0A 4LRTA 3MHUA 3SECA 2OCZA 3Q58A 2A6LA 3SIZA 3VFLA 5KTLA 3C6CA 5IBXC 2Y7DA 1LM1A 2A7RA 2TPSA 2ZTKA 3EWYA 2J9YA 5CGQA 4TMCA 4MUZA 5D30A 3BW2A 4LV4A 3NGJA 1H50A 3N19B 4R33A 3GX9A 1EP3A 4O17A 1LYXA 3MI6A 3HG2A 2FQIA 3QC3A 4UMBA 3IRDA 2A1YA 2V2CA 4RK8A 3IGUA 3LCFA 3S42A 4JYFA 3CC1A 2HSAA 8TIMA 2ZZ1A 2HS8A 4FNUA 2JBMA 5DY3A 1P0NA 1HFBA 3HOJA 3DH7A 4AWUA 4OV4A 3T78A 4NJHA 4O1CA 4IMEA 2J9XA 4IMGA 4UR8A 4MYAA 3IIXA 1VH7A 4O18A 5C6MA 4N9CA 3TUUA 1MZHA 3PBYA 3IEBA 1OFQA 1W5NA 3GNDA 3M7WA 1B3OA 3PUEA 4LTSA 1OYBA 3M5YA 2Z0IA 3NQ6A 4O8RA 3NO5A 2G97A 4K7VA 1G4SA 3LERA 1KBIA 5L9FA 1JCMP 2QJHA 3CB8A 1F05A 3TQ0A 3EWBX 4DQWA 2RH9A 3W2JA 3W1UA 3I7SA 2ISVA 1VHCA 4X9SA 3W7DA 2A85A 4I7WA 1UCWA 2NUWA 3TW6A 4NXKA 4DF2A 1P5BA 1F2JA 4UTWC 4XKYA 3ZFHA 1N55A 1IF2A 4UTMA 2B7PA 4DF0A 2ZCGA 4Q4KA 3H55A 5CSSA 3Q37A 1L9WA 1YXDA 1OABA 1N8FA 5A8GA 5DY2A 3W2NA 3PAJA 1LZOA 1K3UA 3TW7A 5FEPA 3W86A 4JXCA 5FEZA 4X3ZA 3MWAA 4AXKA 3TROA 4MFEA 1GJPA 1AW5A 3G22A 3G1VA 2XN1A 4NVTA 3GZ3A 3W7OA 3M0ZA 3FKRA 4W9TA 2BWGA 2FLIA 4POCA 1YDNA 2QUUA 3HIJA 4LVGA 3RFAA 1XBVA 2B7OA 2I14A 1AMKA 5AOUA 2H8ZA 3T40A 2VFIA 1TV8A 3LCWA 5F4SA 3TA6A 3DHDA 1VJIA 2ZRUA 2ZFAA 3L0NA 4O4VA 1PVNA 5G5IA 3PSVA 3DHFA 5D02A 5DCBA 1H7WA 3P7YA 3C52A 4HNNA 3CTLA 4UTLA 1X8FA 2GJLA 4GUHA 4NZJA 4FHAA 1XFBA 1QDSA 3ZWSA 3TC7A 2CLLA 5G4EA 2NWRA 3GB6A 4PEKA 3IIVA 4JS3A 3IVSA 4LU0A 1RZMA 1WX0A 3TCEA 1Q3NA 3P67A 4ZQRA 1H60A 2VOMA 4NQ1A 3R12A 1EB3A 2OX1A 1O95A 3LHZA 4NJJA 1ICQA 3HPSA 3S9YA 4FNRA 4GE8A 3W3OA 4NX0A 4O1AA 1AL7A 4JYDA 3LX9A 1JUKA 3DFNA 3UYCA 2VEIA 3TJLA 3M5VA 3OVPA 4OV9A 1FX6A 1WDWA 4IX2A 2Q3OA 2FPVA 1W8SA 5F2LA 2YCEA 1WXJA 4PODA 2TYSA 5D2YA 2XN2A 3KVMA 3SSJA 1J4EA 3BV4A 1X7FA 3EEGA 2NUXA 3FEMA 3NL3A 4HNUA 3M41A 4ZZ9A 4R53A 1HG3A 1H62A 1KV5A 4O0KA 3L2IA 2GPTA 2YX0A 1T8XA 4WUIA 3CM4A 1YTDA 2E5DA 4PL2A 3TJXA 1JCNA 2X1RA 4JICA 2NV2A 4JX4A 1UASA 3K30A 2WSQA 4AWTA 2A4AA 5K2ZA 1Q6LA 1R2RA 3QSTA 2LLEA 3BGGA 4JTEA 1TJPA 2WPBA 3PB0A 1WBHA 4K38A 3B4UA 5LHEA 1TJRA 1QR7A 3ZR4A 3LHTA 2JKEA 4CNPA 1GVOA 4ADTA 5BMXA 1XKYA 1SSDA 3NL2A 3CHVA 3P5ZA 1K8YA 2FB3A 2C18A 2R94A 3PG8A 4JTLA 1PL9A 1YADA 1VRDA 4AHPA 3O16A 1YXCA 1K7EA 3O15A 2A6NA 3LV5A 2WJZA 4O19A 3EWWA 3A23A 4UTTA 3OVQA 3I65A 5G2IA 2ZYFA 5DXYA 3HPXA 4QITA 1W56A 4KFNA 2H90A 3DFTA 1QPNA 2DJXA 3G8RA 4Y6GA 1WOAA 5LNRA 1DBTA 1PHWA 3KRUA 2F7FA 4QIUA 4FB7A 3CPRA 1O94A 1RD5A 3NQ2A 4YCPA 5AHEA 4EOUA 2DZWA 1TQJA 3W88A 1XM3A 1EPXA 1O4UA 1OF6A 4LS2A 3M43A 1NEYA 3U6WA 4R34A 3E0IA 3LBCA 4UNLA 2VXNA 3F4WA 2PC4A 5CSRA 2I1OA 2PE4A 3M47A 1C29A 4ZQNA 2E68A 3L0GA 1HO1A 1ZAJA 3W7EA 3W87A 3DI1A 1KM6A 1L6WA 2ZRYA 4GUJA 1C8VA 3C2EA 4RLIA 1FCVA 2B4GA 5KZMA 3N2MA 1TPUA 2YXGA 4Z0JA 2RKXA 3GXNA 2G5WA 2ZZ2A 4YXGA 1JCYA 3M9YA 4ONVA 4Y9AA 3UZJA 4NT0A 4IOTA 3QRHA 1OK6A 3LGEA 3LI1A 3E9AA 4RR4A 4TIMA 1XUUA 3H53A 3N3MA 3L9CA 4GRSA 4AHQA 1GG1A 1YLVA 1TPH1 3HG3A 3NG3A 3LTPA 3W1QA 1SU5A 5K7JA 3NPWA 1SO6A 3C2FA 3PF3A 3TU9A 5KZDA 5CKSA 5FF4A 4BK9A 5AYYA 1DL3A 3PBUA 1TIMA 3UPBA 3LXBA 1KFCA 1I4NA 2H8XA 3NQ7A 3C0JA 4WXYA 2X16A 1VLIA 1ALDA 4AF0A 4MLJA 2NX9A 3TFXA 4O52A 4YLWA 4TO8A 1JCLA 1KM4A 2X2GA 4A29A 4FX7A 1FXQA 4XWUA 2Z6JA 1SQ7A 3BW4A 2VFHA 4XQ6A 4UTIA 2YFOA 5FESA 1GEQA 4QNWA 3W1RA 3ABOA 1KFEA 1B4KA 4L4MA 3GLCA 3KX6A 4JTJA 2EGZA 4ADSA 1FBAA 3W83A 5LZLA 1OFRA 2CLMA 3PM6A 1DVJA 2EHHA 2G96A 1R2SA 1K8XA 3NAVA 1LTDA 5LKYA 5CG7A 3LLDA 4O4WA 2XN0A 1H7XA 4AH7A 1SSGA 2QCDA 2JK2A 2NV1A 2PRHA 2QUTA 4DO5A 3LDVA 3NQEA 4WXZA 2QCEA 3CWNA 3TC6A 3M16A 3EB2A 4BWLA 2V9DA 2GQ8A 1RR2A 4JR5A 4LV9A 3EX2A 2CZ5A 4LS0A 1HL2A 4WQ6A 5D2VA 3IIOA 1KFKA 3LLFA 5LNSA 4BI6A 3QQ0A 3P81A 4NU7A 1OX4A 2GVLA 4O15A 3LCLA 4IMCA 1XBZA 2ZBTA 4L4LA 1EP2A 3GDLA 3QYQA 3TMLA 4N9DA 5IM51 4C1LA 2ZZ5A 4AEOA 3CEUA 3MI3A 4ZQPA 4LUIA 3L66A 1LORA 3RK8A 5F1UA 4H3DA 4YWIA 2BZNA 3GKFA 3QZEA 2ZZ7A 1SW7A 5D32A 5CZ0A 1VHNA 3SY5A 1ICSA 3G1YA 1Z41A 3AO0A 5F2IA 5EL1A 4IXXA 3QSRA 4OBTA 3O05A 1GQNA 3W7HA 3UWVA 3TQVA 4R7JA 3A5VA 5G1YA 2VEMA 3NR0A 4LVFA 1KM2A 1IXNA 3I68A 4CCEA 1NF7A 4RXGA 4PCFA 4IWWA 3MYPA 3TKFA 2DZSA 4TU1A 5D2TA 1FQ0A 3STGA 2JKPA 3KHJA 4HSOA 2GQ9A 5KSWA 2YYTA 1TPB1 2RDWA 1OHLA 3W75A 1TYGA 1VYPX 3IVTA 4XKYB 3B0UX 2WQPA 2E6FA 1HTIA 4S1FA 1FXPA 2FPYA 3DFPA 3W7KA 3TNOA 4ADUA 2YGYA 4PC8A 4Y96A 4DO4A 1GYNA 3WK0A 5EYWA 3QMTA 1FDZA 3DENA 3A21A 3NEVA 3Q94A 4JEQA 3CIWA 4IGHA 2ATMA 3UQNA 4HN4A 3G8EA 2V8ZA 1QO5A 3FA5A 3UPWA 5HJLA 2OZ0A 3YPIA 1ME9A 1DJNA 3MHFA 5CPNA 3GYEA 3W73A 2NX1A 3N9SA 5LGXA 1SZEA 1W54A 4LT9A 5AHMA 1ML1A 1SUXA 2Y7GA 1KLZA 3GNNA 2WSRA 1JUEA 4GBUA 3PBWA 3LCXA 3NQ8A 1LCOA 1W5PA 3B03A 4Z1CA 3W7RA 3HMJG 1W5OA 3EKZA 1KFJA 4O57A 3E12A 3DBPA 5EY5A 3A9IA 5G2HA 2CLEA 3B0PA 3O6YX 2BSLA 2CZDA 4O54A 3WFAA 4QAIA 1YTKA 3LHWA 3W9ZA 3LHVA 2DZPA 3BG9A 2J6XA 3NPXA 4UNKA 4UFHA 3MBFA 2PRLA 1CW2A 3QW4B 1I45A 3FOKA 5C54A 3G3MA 5AHLA 4E2DA 1S3HA 3SI9A 3EWXA 1G4EA 3MW7A 4N4PA 1IIGA 2V0TA 4JTGA 3BPWA 1L2UA 3NDOA 1H1ZA 3KRSA 2AQWA 3BG5A 3C8FA 3DFOA 3O06A 3G3DA 4HKPA 2WOQA 3HGOA 5AYXA 1LRTA 4FX6M 3W1XA 3FJ6A 4JN6A 4EF8A 3F1QA 3VI2A 1SFLA 2QAPA 4UFJA 3DZ1A 4MZ8A 1E51A 2EAWA 2ABAA 2E09A 4M19A 2QAFA 1PS9A 4WY0B 2FTPA 4O11A 3BLEA 2JKAA 3BGJA 3QQ1A 3SGZA 1WBJA 3HPZA 3E02A 1JVNA 3B06A 4OGZA 1GVQA 1OFDA 3S5NA 4LUJA 1VGAA 4AB4A 2HTMA 3KFTA 3LHYA 3O8AA 1IXPA 2ZRZA 1XBYA 2ZA3A 5L6UA 3TAKA 5J5DA 3V1PA 1G67A 4M7SA 4PFMA 1RQBA 3E96A 1R30A 4LRSA 5HMSA 1R2TA 3TDFA 4EWND 4FX8A 4E2BA 3JR2A 2X1SA 3LM7A 1XXXA 1W5QA 4NXSA 3WJZA 4K37A 1KV8A 3M6YA 3KXQA 1FWTA 2W79A 3BK0A 3W76A 2H3DA 4RV8A 3VE7A 2Y6ZA 2J24A 5BRBA 1TREA 3LCHA 1I2QA 3LRLA 1O5XA 5FEXA 1OX5A 2EKCA 3BARA 3P82A 4XUGA 4YMZA 3GR8A 4I7VA 1KTCA 5F1VA 4KKXA 3SFKA 1BTMA 2Y89A 3W85A 3GDRA 4JYEA 1OFBA 1LOQA 5G2WA 1QOPA 4MKNA 1L6YA 3NA8A 3DXIA 4UTHA 4GFSA 1B4EA 3EX4A 2FPTA 2Y7EA 1F74A 2AGKA 5KMYA 3ANYA 4QNEA 1TTQA 5LHFA 1GVSA 2QJGA 3L5MA 5EPDA 1KA9F 3EX3A 4P61A 2PRMA 4TR9A 4JX6A 3B04A 4HPXA 3FKKA 1H61A 3P84A 4BFAA 1MXSA 3IV3A 3EXTA 5K4XA 5J5RA 2VFFA 2E6DA 3OEXA 4MZYA 4MJMA 3P61A 1GVFA 4WY0F 1DV7A 5D33A 4CLMA 4NJIA 3O07A 2QCFA 5H2ZA 3QFEA 3V75A 2VFGA 1W5MA 1AL8A 4UFLA 2OJPA 1F5ZA 3C4UA 4MFDA 2ATSA 3S5ZA 4QSHA 5F2MA 1GTEA 2QF7A 3TXVA 1ME7A 5D09A 3CQ0A 3HQ1A 2AAMA 3BLFA 3WK3A 1EWDA 4MPQA 3CWOX 3LCIA 1G4TA 2ZRWA 4N4QA 4PA8A 1WAUA 5I3JA 1S5VA 4QJ1A 3USBA 1A5CA 1NFBA 1ZAIA 3GXTA 4WD0A 5C2XA 2E5BA 1FUYA 4GNJA 1IIHA 4O50A 4AWSA 1OF8A 4MY1A 3FYOA 3MP3A 1ONRA 1Q45A 4HIBA 4TMBA 4G1KA 5HWMA 1ZNNA 3MO7A 3OBKA 2QCCA 3S6DA 2YW3A 4AF0B 4ZL1A 3HO8A 3IIPA 4IPIA 5G1TA 2YR1A 2R8WA 2UV8G 4O1BA 3M5ZA 1EIXA 1Z48A 2JGYA 3PUOA 2NXIA 3NQAA 1QAPA 2Y85A 3OA3A 1SFJA 3N34A 1GWJA 2H3BA 1DHPA 1M7OA 4ML9A 5GVJA 3PG9A 4MIMA 4XTDA 1G7UA 1H7PA 3Q2DA 1C9DA 4JY8A 4YL2A 4ZQMA 3TK7A 5AHFA 4MY8A 3SR7A 3G18A 5AHNA 4LVBA 3FFSA 5FF2A 1IXOA 4N9BA 5CZTA 1QO2A 4JY9A 3M5XA 1WYIA 1PV8A 1OG0A 4LY8A 1P1XA 2C3ZA 2VFDA 3S0CA 1L6SA 5K9CA 1LLWA 5CPLA 3MUXA 1Y0EA 2PCQA 3G1AA 1FWWA 1QFEA 5LNVA 2WNQA 2QCDB 3SW6A 2WSYA 4LVAA 1FWRA 4Y8FA 4K39A 4JTIA 3HGRA 4MY9A 5TQLA 3HG5A 1I2RA 4XZ9A 4LW7A 1SO5A 1EUNA 4UTTC 1T0OA 2NXHA 1Z42A 4E38A 3O1NA 2YSWA 3P5YA 4CNOA 4QQ3A 2V2HA 1A5AA 4N6FA 3CLMA 3NQFA 5KZEA 1I8JA 1I2PA 3NVTA 4IUOA 1OX4B 2X1TA 5HULA 3DU0A 4IXHA 3OG3A 3LI0A 4LC6A 5AB3A 1ZCOA 2ZA2A 4O28A 5CZJA 2V81A 3W84A 4K8HA 2B0MA 4S2BA 2Y62A 3FS2A 1RQHA 3B05A 4GXMA 1JR1A 3TSMA 5AC8A 1H51A 3UXAA 4JIPA 4FNSA 1A5BA 3W2UA 1K8ZA 1PIIA 5I3GA 1DOSA 4O12A 5D38A 3M1ZA 3MI2A 1LBMA 1KTNA 2C0AA 3W74A 4BI5A 3KVKA 3W7PA 1GVRA 4JDYA 1AW1A 2QUVA 2DZXA 3C2RA 3UD6A 1H5YA 3NQGA 1TTPA 1M7PA 1FWNA 3PSWA 1G4PA 1TPVA 2V5LA 2O7QA 2Y63A 2OT1A 4RKAA 1SW0A 3IGSA 2P1FA 3GDTA 4FNTA 3S5OA 5HR6A 1W3IA 3LXCA 4IPJA 2BX7A 3NOEA 1JJKA 3S1VA 3S1UA 1ME8A 1KBJA 3RLUA 2QR6A 4ORIA 1SR9A 1M5WA 5EMUA 2A0NA 4DPQA 3STCA 4YCOA 1X1ZA 1SZNA 3CIXA 3W1LA 3G1SA 3QM3A 1HUVA 4ZQCA 1KM5A 3DAQA 4I7UA 2QDHA 4O16A 3TMQA 3S8HA 1OX6A 2FDSA 1KFBA 2NLIA 1J5TA 2YZRA 2NXGA 3KRZA 3SJ3A 3L68A 1B9BA 4MOZA 3GIYA 4WOQA 2ZZ6A 2RFGA 3PVFA 1RVGA 2YYUA 1P4CA 1TPFA 2E6YA 3MJYA 4JTSA 1BWLA 2YPIA 3OHIA 1QOQA 4NNAA 4RX0A 2FJKA 3GVGA 3VNDA 5C55A 3LOTA 5DBTA 4CCCA 3EWZA 5I3FA 4FXSA 4RCXA 4DELA 5I3KA 2NWSA 1ZJIA 3R2GA 4S2CA 4NJGA 2FIQA 4C1KA 3TSBA 5F4XA 3P8IA 4UR7A 1FCBA 4IMDA 3KVJA 5DELA 3W7MA 2ZA1A 4UCGA 3ATZA 1X1OA 2NX3A 2I9EA 3NM3A 2KZHA 3GDKA 2C14A 4M7TA 4ZQOA 3GKAA 2X1UA 3PUDA 3S1WA 5BW6A 3TSDA 2HS6A 3CEPA 4X2RA 4Y90A 2CLHA 2VEPA 2QKFA 3FYPA 3QMSA 1F7BA 1TPC1 4O13A 1MEIA 2ABBA 2CZEA 3LTYA 1SW3A 1TSIA 4N02A 3A22A 1XI3A 1W3TA 4BWLC 4KWWA 3UY8A 3MBDA 4O53A 4JTUA 1IXQA 4E0CA 4UTJA 1QPRA 1VZWA 2RDTA 1FCUA 2NUYA 3C3NA 4UC5A 5I3HA 3NNTA 3EX6A 1DQWA 3SGUA 4H6KA 3C2OA 3W1NA 2GVJA 1XCFA 2GQAA 3N73A 1FY6A 4AVFA 1VQTA 1TQXA 4HT3A 1O60A 4DO6A 3W7QA 1W1ZA 3BO9A 3LRKA 4RZ6A 1VLWA 2CLOA 1D3HA 1GG0A 4JD4A 2WNZA 3PB2A 3G0SA 3QW3A 3L67A 1PHQA 4HNVA 4JX5A 5IBXA 4A2SA 3G1DA 1HO4A 4GUGA 5LGZA 5HUOA 3ELFA 1NAL1 3TV8A 3EWUA 1EP1A 3R8RA 1YDVA 2VEKA 5FF3A 2BLEA 4LC8A 4OWGA 2A7PA 5BMWA 3UY7A 5DLCA 2Q8LA 3EXRA 5KINA 3W22A 3VKJA 3QPYA 4UIOA 2A7NA 3WJSA 4DXVA 5CZSA 3O6CA 3NPUA 4UXDA 3P8JA 5DN1A 4K8EA 5FF7A 4Z1AA 2DZVA 4X22A 1DJQA 2J88A 3LXAA 5D03A 1YXYA 2Z2UA 4UFIA 2ZDRA 4IX0A 4HSNA 1AW2A 2VKZG 2RHGA 1GOXA 1RV8A 3VE9A 4JDBA 4Z08A 4IMFA 3NL5A 1QCWA 4D2JA 1JULA 4AHOA 1A53A 3EX1A 2QCNA 4HPJA 2ISWA 3HGSA 2ZQ0A 3CT7A 2Y61A 6TIMA 3G0XA 4O10A 4RXFA 3W7LA 2DZUA 2E77A 1LOSA 3ATYA 4MLRA 4AMAA 5K9XA 2V30A 2WO5A 3O63A 5CPMA 3W2MA 1AG1O 2Y88A 2DU2A 5HWNA 4CNNA 3T55A 5DCDA 4UTWA 4LNYA 5D2WA 4EF9A 3W07A 1EX5A 1Q6RA 4IQLA 4I9AA 1ZHAA 2A5HA 4QISA 3FIGA 3MP5A 3O6DA 5AHIA 1XUZA 3TH6A 3BLIA 4GUIA 5EKYA 1AK5A 4FIQA 1EUAA 1VYSX 4JTHA 3UNDA 1FDJA 3WK2A 1K03A 1QPOA 2WKJA 1OVDA 2YDAA 1KW1A 4Z0SA 3WJYA 1FCQA 1D9EA 2QEZA 3RNDA 3NZ1A 3W7JA 3C56A 2E1DA 5AN7A 3BVJA 3NQCA 1J2WA 3QPZA 2TSYA 1YTEA 1QMLA 3GR7A 3G1XA 4M5PA 3ABSA 3HF3A 4K7YA 1GYLA 3L65A 1IGSA 1VS1A 3QH2A 5AC6A 1VPXA 5FF0A 2Z1BA 1BKSA 5ABTA 3BG3A 2DORA 5HINA 3T4CA 3A5FA 3UZ5A 1KM0A 1JUBA 3RF9A 3TQKA 1RPXA 2FFCA 2QDGA 3P60A 4IJBA 2QJIA 4Z1BA 3G1FA 2QCLA 1BEUA 1XC4A 1TPEA 1PCWA 1TV7A 1MEHA 1GPWA 4CQ9A 3H54A 3THQA 1I2NA 2GVGA 3DKJA 5AC7A 3L0KA 4FF7A 3LTSA 1UUMA 1NSJA 3W7CA 3W71A 3LRMA 1G7VA 1WOBA 2R14A 1N7KA 5HR7A 3DI0A 5FI8A 3L21A 1YPFA 1TV5A 2GJNA 2V82A 3TE9A 4OU1A 4CQAA 1JRBA 3THAA 4JGDA 5TIMA 1KLYA 4JTTA 2CZFA 3OVRA 5HQEA 4JTKA 3HG4A
chains in the Genus database with same CATH superfamily
2GSHA 2YW4A 1E0VA 1VFSA 1TPDA 2J9ZA 1JGIA 3P74A 2OKOA 4XBJA 3RX2A 4I8DA 3H7VA 2B7NA 3ABQA 2GVYA 3WEOA 4JFSA 1OYCA 2HK0A 3A24A 1CYGA 1QPQA 2QCGA 1FWHC 3NQBA 1Q13A 3PBVA 1V0MA 3VD3A 2V2DA 4H9ZA 3OVGA 4O8AA 1MRQA 3IIZA 1CXKA 4HGXA 1DQXA 1V51A 4NUWA 2DP3A 2W4XA 2A2IA 1DJGA 4K2SA 4J3SA 4R7WA 2PDKA 2HISA 1GHRA 5F2GA 3FLUA 4JIQA 1AMYA 2C16A 4KMQA 3P80A 2VWSA 3ARQA 4PUKA 4DBUA 1VR6A 4EANA 1LWIA 4MG4A 4YU1A 4RUBA 4GUFA 1XYBA 3B3DA 1XX1A 1DKWA 1TCMA 3V0SA 4BI7A 1MXGA 1E55A 3HU7A 3G0UA 7ODCA 1LDCA 3TFCA 1TRDA 3I6EA 3TAOA 4XK2A 2DIEA 3HGJA 8A3HA 3RLVA 2VT0A 1GVYA 1RA0A 4N9EA 3AS3A 1IWPA 3PBMA 1KGUA 3CB3A 4IUGA 3BC9A 4DWSA 2NLYA 3SY1A 3RCYA 4DWDA 1FWEC 2HK1A 3WMCA 2BVYA 1AZ1A 2GWNA 2VYOA 3SCNA 3ARWA 3WLKX 1ZENA 2O7SA 2POTA 4GO8A 1E1CA 1DWFM 2WBKA 4Q8WA 2CW6A 2W61A 3L5AA 4LS1A 4JTAA 3THDA 3S5YA 3HQOA 3N2CA 5LSMA 2HROA 3RMJA 3VD4A 5E93A 3CNYA 4DEFA 2GVEA 3WLTA 5IHSA 3STEA 3A3XA 3FJNA 4JL1A 1H1YA 2IXVA 4H04A 5C0QA 6XIAA 3EA2A 2WBGA 3UWZA 3PULA 2C13A 2ZZ4A 4MAVA 1MVYA 2JQXA 2CLKA 4ZOBA 2IQTA 3DFSA 3WBEA 4CKQA 4A3HA 1XLHA 2Z27A 4AD1A 4PCTA 3PR2A 1A0CA 1IWBA 5GPRA 3L4TA 1JNDA 3PY2A 1W8GA 7TAAA 1KBLA 4KETA 4YTRA 4YN5A 2FGZA 5EMKA 2XFRA 2VRJA 3ZWTA 4LF1A 1PSCA 3AYSA 2EXOA 3Q45A 1G6CA 3HJZA 1Q6QA 4F3HA 4H9MA 3R25A 4O1DA 1X6UA 4LB3A 4M6VA 3I6TA 3RPDA 2Y8VA 4DYJA 3W23A 3KBMA 2JF7A 1LBLA 1SO3A 2CLIA 3A4WA 1V3HA 3ZYZA 2BOFX 5GNZA 5DCEA 1NP2A 2VENA 1N2VA 1U2YA 3O3RA 4QG9A 3VNMA 4QM1A 3LMYA 3LCGA 2CBJA 3INPA 2XIJA 3SCTA 3W2KA 1ZALA 1LJYA 4ZGYA 2GUUA 5LNWA 1CGVA 2PGWA 2GSJA 5FJPA 3VNZA 1TO3A 2WKLA 3CAVA 4DIAA 1H63A 5CJ5A 3QOMA 3QMRA 3KOZA 4LH8A 4NNBA 1P0KA 1UUOA 3VZYA 3K1GA 1JD9A 4HMNA 4Q3MA 3NQDA 2R82A 3EA1A 2ZTJA 5DBUA 4M82A 4EP8C 3GXIA 3MSYA 1JZ6A 3IGHX 2CWNA 1ZBKA 2PAJA 5CZKA 3CZKA 1J6OA 3OODA 1W6TA 4TX9A 3K46A 4WVXA 3Q67A 1CTNA 4EPEC 1A50A 1QW7A 4N42A 3QY6A 2C1IA 2VL4A 1GOIA 2ZRVA 5G4HC 1D8CA 3QJAA 4FIRA 4GQ0A 2D1ZA 1PKMA 3E49A 4B5WA 5LNUA 3M4HA 4U4MA 3R5EA 3CIVA 1LBFA 4ALDA 4IG2A 4FI4A 3CQKA 1DJIA 3CHEA 2QCHA 4H6EA 2GWGA 2RDUA 1UD3A 3UVIA 4L9XA 4MYXA 3SIMA 3GTNA 1H7OA 4CCDA 4AUBA 3CT2A 1U83A 3TLLA 1Z44A 1JYVA 4HHPA 4LAOA 1X1NA 3QV7A 1L2QA 3DIPA 1N8IA 3N2XA 3TXZA 2R1MA 1IT8A 2ACQA 1L0PA 1DORA 4C7FA 1OFOA 3KCLA 4PH6A 3WQ4A 4AZ5A 4Q32A 4FAMA 1LOLA 1TMHA 3VGEA 2GJXA 2R1NA 2VUNA 4LALA 1GPFA 1RQEA 1OFPA 3IAPA 3WLJA 4F40A 4Y9OA 3B9AA 1QWKA 4ZMGA 2I5QA 1B0IA 3NQVA 3WLLA 3QF0A 4GVIA 4HPGA 2PZNA 5KTLA 3H2EA 2Y7DA 3SURA 1E6QM 4LUYA 3XISA 3OLGA 1LT8A 4MUZA 2CYGA 3GM8A 4ZO7A 3S2LA 4HA0A 2FQIA 3IRDA 3UERA 4PRWA 1L8PA 1P1MA 3FHAA 3EB3A 4YIWA 2ZZ1A 2HS8A 1C92A 5DMMA 3PN8A 2WJFA 6XIMA 2PGFA 1HFBA 3HOJA 1DWIM 4NJHA 3BH4A 5E6ZA 1OY0A 3NWRA 8CGTA 5DMLA 1NU5A 1V77A 4HNOA 4ILSA 2VR4A 1RJQA 4N9CA 3VUPA 3TUUA 1MZHA 3S2CA 4GHRA 3QHMA 3LA4A 1B3OA 3W81A 2FFIA 3OHMB 4QJ3B 4O8RA 1SZRA 1W91A 2G97A 3V1HA 4JEJA 1PZ1A 3FAWA 3GO2A 3VNJA 4PEEA 3CB8A 1Q8AA 3JZUA 3ZZ1A 3FAXA 2XWDA 4I7WA 5C2GA 1UCWA 3TW6A 1P5BA 3ARVA 3H55A 3Q37A 4LY4A 2VRQA 4GNKB 3ZVHA 1VEMA 1OABA 3NXLA 1PB0A 5DY2A 3TYEA 3TYCA 3EB4A 2PWFA 1W9BM 3T9PA 3TZNA 3E0LA 4JXCA 4X3ZA 5EMLA 3AXXA 2OYKA 2BODX 3TROA 4US5D 1XYLA 3N3TA 2ZIDA 2XN1A 5A95A 3W7OA 3GZ3A 4W9TA 4Y9PA 3AXMA 3KEHA 1W17A 2BXYA 5IFTA 4CD7A 4XD4A 1XBVA 5AOUA 3DDMA 3ITXA 1H0IA 3T40A 2VFIA 3TTYA 2QDEA 3CK5A 3M0LA 3PTMA 3CMGA 2ZRUA 3K2GA 4O4VA 3OZMA 3DHFA 3P7YA 4M29A 2GJLA 5FJTA 4GUHA 4LGXA 5C9RA 4NZJA 1F8MA 1UZ4A 3EWCA 1XFBA 4H8HA 2O9PA 3ABZA 1GOMA 3NSNA 3WDQA 4GNVA 3ZWSA 4DRSA 3WQWA 3ZT7A 3GB6A 4F9JA 1TZ9A 4DJEC 3AWOA 3IVSA 1WX0A 1Q3NA 1TV3A 2YBVA 3P67A 1ZZMA 1H60A 2D20A 3R12A 3OLDA 1O95A 2ASHA 3S9YA 2EJ1A 3T42A 3ZQ9A 4GE8A 4PBGA 3GHTA 1B90A 1E1FA 4UWMA 1YE6A 1T8QA 4B9YA 4J35A 2V5JA 2CETA 4OV9A 1WKDA 5I2UA 1WDWA 4IX2A 2Q3OA 3W4RA 1W8SA 5M03A 4XAGA 3EDKA 2PBGA 3CV7A 3KVMA 1XRFA 1X7FA 3EEGA 3NL3A 4W4QA 3M41A 1Y5VA 4KIEA 2YXXA 1H62A 1KV5A 4O0KA 2WMJA 3TNBA 4WUIA 3CM4A 2E5DA 4GKLA 4HA3A 1GYMA 1H11A 4Q7BA 3E38A 1UASA 2JF6A 1I9CB 3RCNA 3H22A 1R2RA 1JF5A 2FGBA 2I57A 1XHGA 2PCEA 3NCOA 4W86A 3PZIA 3EYPA 5LHEA 1QR7A 3QTGA 3U57A 2JKEA 1P7TB 4CNPA 1GVOA 2FB3A 1B31A 1DXIA 1EJSC 2PBOA 4LQ1A 1YADA 3CV2A 3WQ5A 1VD6A 4AHPA 3VOCA 1W9UA 1SMAA 2A6NA 1MQRA 2PDHA 3VCCA 1XIFA 1I1WA 3I65A 5G2IA 3VD5A 3ANUA 3IK2A 2H90A 3DFTA 3EPMA 3G8RA 4Y6GA 1WOAA 1DBTA 3KRUA 2F7FA 1OG6A 1P6BA 2A3CA 4B3KA 4B5TA 3KBVA 5HMDA 3AMGA 2XU2A 1JPHA 2XDFA 1TQJA 1PJ9A 1EPXA 1DWHM 2GDVA 1O4UA 4H7CA 3M43A 4GVGA 3HN3A 4DZAA 2OU4A 5A8MA 1S2VA 4L56A 3WFLA 2XGIA 1C29A 1FKWA 3L0GA 4CD5A 3A64A 3CUJA 4AD5A 1Q4NX 1L6WA 1BWVA 2QF8A 4GUJA 1IR1A 3M6DA 2HPMA 1KRCC 5BXSA 3N2MA 4L65A 2JE8A 1JFXA 1Z69A 3MQTA 2XIOA 3GXNA 1HL9A 2P53A 4Y9AA 4XD5A 1OCJA 3NTYA 3E0VA 7A3HA 1BGGA 3ARXA 2Z29A 3USZA 3ZT5A 1YLVA 1TPH1 4R5EA 3TYUA 3PFRA 1SU5A 2ODOA 4AD2A 3BUVA 4HTBA 1TIMA 3UPBA 3LXBA 1I4NA 1ZJHA 3EOEA 1PX4A 5ENLA 4P7OA 4MLJA 4AIUA 3PNUA 2ZX5A 1HKVA 4IL0A 4HU0A 4NILA 3PPGA 1BF6A 1OIFA 3EDFA 3QBUA 1TMQA 2Z6JA 1SQ7A 3AOFA 4HU4A 2VFHA 4CQBA 4UTIA 1GEQA 1XLJA 3ABOA 4Q6JA 4HMEA 4L4MA 3GYCA 2RJHA 1BAGA 1M03A 4OECA 4PBFA 2CLMA 5CC7A 3OLIA 2WZIA 1R7OA 1ZBCA 2GGEA 1R2SA 5D9NA 3DGBA 2XN0A 1OCQA 4NG3A 5FD0A 2NV1A 1W1IE 1JL8A 1S38A 4UQCA 3OOQA 3TCSA 3CWNA 2PODA 1ITUA 2FMNA 1YX1A 4PB3A 5EU9A 3VGFA 5CJMA 2GQ8A 4DUVA 4S3GA 3ARYA 1UJQA 2CZ5A 4GY1A 2OYMA 2PWDA 5LNSA 1XIDA 3GBDA 3PTQA 3SSZA 2BNJA 3QQ0A 4US5A 4MB3A 3LCLA 4HK7A 1XD0A 2ZBTA 1EP2A 3GDLA 4IZGA 5IM51 4C1LA 1HN1A 3EWDA 1HIZA 2ZZ5A 4NKCA 3MI3A 2OLAA 1LORA 5HPOA 2PFHA 4K1GA 2RDXA 4H3DA 4GI6A 4LX4A 4MSSA 3TWAA 3CHFA 2ZZ7A 3NDZA 4JIHA 5CZ0A 3SY5A 3G1YA 1Z41A 5EL1A 4JQ4A 2WSPA 3A5VA 2VEMA 2D69A 4KCUA 4LVFA 3AZSA 1IXNA 5FJIA 3DERA 4RXGA 3OO2A 3F5JA 5BOEA 2DZSA 1FQ0A 1KBBA 2ZDSA 5BXRA 3KHJA 4PTMA 1MNZA 2YYTA 1TPB1 3PHAA 3W75A 1VYPX 2QS8A 3LQLA 1P43A 3LPFA 1BVZA 2E8YA 3TNOA 4QX4A 2VHLA 4ZA0A 4PC8A 1GYNA 3QMTA 2WVSA 3DENA 3IJQA 4LEFA 3CIWA 3WMLA 4ZXLA 1UYQA 4HN4A 3W53A 1EFZA 1QO5A 2OOGA 1TWWA 3UPWA 3VDAA 2Z00A 3QQWA 1DJNA 3EDJA 5CPNA 3GYEA 2E67A 1VENA 2GJPA 2BY3A 5LGXA 3W37A 2FHCA 3AUOA 1SZEA 1W54A 5E0FA 3LNPA 1EZ2A 4LT9A 1QI0A 3PUGA 4GG9A 4A6GA 2OSYA 1QUMA 3BJFA 1JUEA 1E3XA 4AIOA 3LCXA 1Q5MA 4GKTA 3B03A 3W7RA 1IEXA 1SM9A 1IGWA 3WH8A 4HB7A 3O6AA 4GXWA 5EY5A 1NDVA 1EH9A 2PP3A 1XJBA 1YTKA 3OA5A 2G3JA 3RPMA 2DV0A 1E6NA 4I8YA 4GISA 3BG9A 1TJ0A 3TA9A 1CGYA 1CW2A 4RPQA 3D6NA 3FOKA 3T2QA 3SI9A 2GFTA 4UQDA 1WP6A 2JFEX 1L2UA 2GGJA 4U10A 4ZOEA 2AQWA 3BG5A 3O06A 1PEZA 1VFUA 5HAOA 2IPWA 3HGOA 3WBAA 2CC0A 3B97A 3GG0A 3W1XA 3FJ6A 4JN6A 1AA1B 3DC0A 1V3IA 3C5QA 4NY2A 4KRUA 1SFLA 4JZ5A 4UFJA 2EAWA 3SUVA 3S6OA 1Q6DA 2JEQA 4WY0B 1TA3B 2P8CA 1EQCA 4Q8MA 2WMGA 1UROA 9CGTA 5C9ZA 3GC4A 4GVFA 4V28A 1Q6CA 4LUJA 3O8AA 4QDMA 1XBYA 5L6UA 3TAKA 3OB8A 2BY1A 5HMSA 3TDFA 4EWND 2PDBA 1TMLA 2PMQA 2VEGA 2WMHA 1LL6A 1KV8A 3M6YA 3KXQA 1FWTA 3L2LA 3A47A 3W76A 2H3DA 3VE7A 1QNOA 2O0TA 2J24A 5BRBA 1HJUA 4Z2KA 3LRLA 3U7VA 1OX5A 2EKCA 4S3AA 3W00A 1KTCA 4JBRA 3GDBA 4KKXA 3W85A 1OFBA 1LOQA 2C91A 1QOPA 5A8NA 2R1PA 3VU2A 4GFSA 1B4EA 3A4AA 2XIMA 2PDUA 4IP7A 1E15A 3BMWA 2YOCA 4NRSA 2OEKA 1TWDA 2O92A 5GJPA 1VPQA 4HPXA 1LUCB 3P84A 5BOFA 3TLQA 3EXTA 1U1JA 3WQGA 1K9FA 3T0BA 1F3WA 1X98A 3P61A 1UR3M 5D33A 4CLMA 4YVXA 2XSBA 4QS5A 1R0MA 3N18A 3WD1A 2D0FA 4UFLA 4MFDA 1GTEA 3TR9A 4PMOA 3SQMA 2WC7A 1EWDA 3CWOX 1G4TA 3ME3A 3WLSA 4N4QA 2QJJA 3R0DA 3N6QA 3CZEA 3USBA 4Q8TA 2CHNA 4O50A 4F0SA 4G56A 4LSBA 4MY1A 5I3DA 2ANUA 1I75A 4TMBA 3V5FA 3OBKA 2QCCA 3WD4A 4PUDA 4U5IA 4AF0B 4WSKA 2FVKA 1W32A 4KRTA 4IT1A 2QYGA 4ZL1A 4KCVA 3PANA 5JH2A 3WD2A 1GOOA 2JGYA 1UP0A 3PUOA 4C90A 3OA3A 1SFJA 3M0VA 3N34A 3DBNA 1I6NA 1M7OA 3ANVA 4ZE4A 2YA2A 5GVJA 3PG9A 2O4MA 1H7PA 1C9DA 4CD8A 3TK7A 2VZTA 5AHFA 4AEEA 1FP9A 3GHUA 2NSOA 2EPMX 4L61A 3AWNA 4JFVA 4JY9A 3HJEA 3M5XA 2D2OA 3HMCA 3O0KA 4LY8A 4LAMA 5EFFA 2ZE0A 2VFDA 3DUGA 3MUXA 2PCQA 4RPPA 3H4WA 1QFEA 3SW6A 1OEPA 5B7YA 1FWRA 4YNGA 3BJTA 5E09A 4K39A 4AVOA 1CB7B 4LUSA 2YIHA 3HGRA 5TQLA 5D9PA 2J7GA 4WRHA 1I2RA 3WUFA 1EUNA 3PAOA 1PBGA 1T0OA 2V3DA 2NXHA 4E38A 3GNPA 2HCVA 3BAYA 3IJDA 4CUCA 4I5RA 3OZOA 3CLMA 4GQQA 4QDWA 1I8JA 1I2PA 1HGWA 1EJTC 3NVTA 4IUOA 1R9XA 3IK4A 2SFPA 5HULA 3DU0A 3MUCA 3FEQA 3OG3A 8XIAA 2G3FA 5A6AA 2YDQA 3W84A 4K8HA 2B0MA 2Y62A 7ENLA 4DNHA 3FS2A 3TN3A 1RQHA 3TSMA 2WW5A 3SCQA 2X0YA 5D38A 1NY1A 5I00A 2PS2A 3SRKA 4BI5A 3KVKA 2G3IA 1AW1A 2ONEA 2QUVA 7CGTA 1QRQA 4NHVA 3UD6A 5DRCA 4F0RA 5AECA 1LQ2A 4W7UA 1P7TA 2OT1A 4RKAA 1QHOA 4FXJA 2YCKX 1RVKA 1ISXA 3AHXA 2A3LA 4IPJA 1DPMA 4RE3A 2BX7A 4FLOA 1KBJA 1XLKA 2INFA 4JIIX 5EMUA 1X1ZA 3W1LA 1KXVA 4A8RA 1HUVA 4GY0A 3UW6A 4I7UA 2QDHA 3WDIA 4O16A 4WKFA 3LUTA 1OX6A 1HZYA 2FDSA 1EGVA 1J5TA 1U33A 4PMJA 2NXGA 5A2CA 1W1VA 3SJ3A 1SJDA 4MOZA 3PVFA 1ZTVA 4W5UA 3WQCA 5LIUX 1QOQA 3H2CA 4RX0A 2FJKA 3N6JA 4GZ7A 2PWVA 2WHKA 4L4PA 5TF0A 5I02A 5DBTA 4X9YA 2PLKA 4JL2A 1FKXA 3B40A 4RCXA 1OINA 2KAUC 1UMYA 3R2GA 2C1GA 4S2CA 5J04A 3I3DA 3P8IA 5DELA 3W7MA 3SO7A 4H8VA 1RP8A 2NX3A 3GD6A 3CBWA 4HMDA 2X1UA 3H24A 3S1WA 4XD6A 3B8VA 2VVSA 1GVIA 4Y90A 2VEPA 1J18A 2HBVA 3SGGA 2YKKA 1TPC1 4LB4A 4FALA 3DFYA 3FX4A 4C6LA 3G6LA 3LTYA 2X42A 4I9JA 2HVNA 3A22A 1XI3A 4FR6A 1X7IA 3UY8A 1G9HA 4O53A 4HOZA 2RDTA 1DE6A 1E0UA 3H12A 4H6KA 1BFNA 2GVJA 2EEXA 2GQAA 1VQTA 2VX6A 4HT3A 1W1ZA 2REQA 4IIEA 2V3FA 4JD4A 5I5RA 3G5EA 5CBJA 3PB2A 3QW3A 3L67A 4A8NA 4X0NA 5IBXA 4GD0A 3BSGA 3CTTA 4FOKA 3FSUA 2Z26A 3L4ZA 5HUOA 4AX7A 2OSXA 2A3EA 4WF7A 1M65A 4OUIA 5HK4A 2XPKA 4OWGA 3WCZA 5BMWA 3UY7A 3A13A 1DYSA 3AS2A 4UZSA 3AQUA 1EYWA 4UIOA 4DXVA 4H19A 1CT5A 2RUSA 4X22A 1DJHA 1ENUA 3OTRA 5BROA 1DJQA 1WDDA 3LXAA 2Z2UA 1LQ0A 3KW3A 4MM1A 2ZDRA 4HSNA 2GDQA 1AW2A 1QASA 1K9DA 1GOXA 2RHGA 5H6HA 5CGTA 2WJEA 4JDBA 4IMFA 3RXZA 4AHOA 2W5FA 3EX1A 4HPJA 1YIXA 2PU0A 2CEQA 2E9LA 2BFGA 2OEMA 4O10A 3W7LA 4ROPA 3ATYA 4MLRA 2IKGA 2O55A 5K9XA 2V30A 3VTRA 5FOOA 5CC3A 4NAFB 3WYZA 2DQXA 4UTWA 3QVQA 4HNCA 1IZJA 1Q2RA 5D9MA 3TJIA 2XG9A 3FIGA 1GCYA 1XLMA 1TZ7A 3NUKA 3FK4A 4IFOA 5H8MA 4KPLA 4AYGA 1K6AA 5TD4A 2CZVA 1OVDA 1E43A 3E2QA 4GMEA 1DIEA 5T9CE 1KW1A 2J25A 1XRVA 4QLLA 4Z0SA 4C6EA 1RP9A 4G9PA 3NZ1A 3W7JA 2E1DA 5AN7A 2AQVA 5A8OA 2Z1XA 3TONA 1R3RA 1PKYA 3GR7A 1ZLPA 4LJ3A 3G1XA 3CS2A 2OLSA 4K7YA 1VS1A 1XLDA 1H4PA 3DFHA 3UXLA 3LSBA 5FF0A 1UQZA 3OLEA 3T4CA 3S46A 3C3UA 3AS1A 2XIBA 3S5SA 3AHTA 3V7PA 4BJHA 1XC4A 1MEHA 5AYBA 4NIRA 4DJFD 4DJDC 3GG7A 2G0WA 1KKOA 2GVGA 4H83A 3S2NA 4DY1A 1UH3A 3LRMA 1SFSA 1G7VA 2PTWA 3VGGA 1E9IA 3L21A 1DJYA 4KWUA 5CQ1A 1JRBA 1QW9A 4JGDA 4LYPA 2ZC1A 1R87A 4TUFA 4BA0A 3QV8A 4RNFA 3DX5A 5GNXA 1W2VA 2WB5A 3HB9A 2XGBA 4ZO8A 1WKYA 1FFRA 4PGLA 4EXBA 3TQPA 2ZRXA 5A6BD 3EPNA 1FP8A 2AQOA 2W67A 1F6KA 5A6JA 1UD8A 2Z25A 1Q6OA 3PP7A 3LK6A 4OZOA 3AJXA 5HUPA 1FDYA 3F03K 2VQTA 1QOXA 3WMBA 5EFDA 4MTVA 3OIXA 4Z2IA 2DZTA 2JGQA 1HXJA 3HQPA 5EA9A 2POZA 4BR1A 5DMNA 3MYOA 1RLDA 3S9IA 2DY3A 4WLCA 5H1WA 3IJ8A 5CPOA 3NL6A 4S3FA 2WM0A 3A3WA 5M3WA 1XL9A 2W63A 1JRCA 5T26A 1KM1A 3RN6A 3W7IA 5AYZA 2EPNA 4LOCA 2PURA 5KITA 2Z6IA 4MB5A 3S3GA 3MCMA 4WY0A 1UR4A 3KBSA 4L9YA 1E40A 3M0IA 3MKCA 4MJZA 1E6ZA 4L6HA 4NAEB 4O14A 1AQ0A 4O0ZA 3GH7A 2OT0A 5HBFA 1T99A 1F3TA 3RILA 1OM0A 4S38A 4DBDA 4XZHA 5HQMA 3CZLA 1PTGA 2V5BA 4L9ZA 3UXDA 2BVDA 4L5ZA 4NF7A 1JD7A 1J6PA 3WG6A 3GRIA 3URNA 4NRRA 5MHBA 3DCPA 4Q8NA 2CLFA 3UCCA 3NSXA 1RY8A 3CASA 4INFA 4L7ZA 2E6AA 2C19A 2DUZA 3CQJA 2AL1A 3ZS4A 5CBBA 2FGLA 4FNQA 4HSHA 3FJLA 3BQ5A 3NZPA 1VYRA 1XLEA 5HA7A 4F2TA 4FO4A 5XIMA 1BGAA 2FZ8A 1PE1A 4C6KA 4UFMA 1S5TA 4HYWA 4G2DA 1LRQA 3GQYA 3WQVA 5DRIA 4DPPA 3NPVA 3UCDA 1C91A 2P5NA 3WDPP 3SZ8A 1R46A 1CXLA 3SUTA 2QHAA 5SWUA 1P6CA 1WA3A 1IE7C 3PC0A 1OSEA 3P62A 4LWWA 3E6EA 3SQSA 4ICCX 1DE5A 2ALDA 2A21A 3B8DA 2AMGA 2GQ3A 1A5MC 1GKRA 3RGTA 3W70A 3GAYA 1JCJA 4IJRA 1UHVA 2P88A 2VVNA 3B9OA 2FKPA 4MVAA 4KFOA 4PUNA 2Q6ZA 1WDPA 3EXSA 2BXVA 4RV3A 4BF9A 3T8LA 1WZMA 4Y9MA 4A21A 3QZ6A 1BWKA 4GQRA 3LLXA 2QPUA 2CKSA 2BXZA 2C6QA 2J27A 1Q2SA 7XIMA 4JKKA 3ZOAA 4PMYA 1NVMA 3C2YA 1Q65A 3N2BA 4QE5A 1PZ2A 2PI6A 3TVAA 3W1PA 1KFWA 1IEIA 4AEFA 1UZ1A 3E1F1 2BS9A 3EMCA 4B3ZA 4MZ1A 3G24A 4KRZA 4PUUA 3E3HA 4TVCA 1XIEA 1YEYA 4UOJA 3ZR6A 1CZ1A 4HK5A 4AX6A 1RXOB 2X7WA 5F7UA 4BQ5A 3NO3A 4B5XA 4WJ8A 4J9JA 2E7FA 2F9RA 3S1GA 4KWVA 4XTIA 1CI1A 1S5WA 4EIVA 1PTDA 2PB1A 4OHQA 3AS0A 5ABGA 2EPHA 5BU6A 1EWEA 1OB0A 3I7RA 5D04C 3W6YA 1TCDA 3VX0A 3QZAA 5DXXA 3NYZA 4D72A 5K9DA 5DT7A 3GVVA 1GT8A 3BQ6A 4OT7A 1FTXA 2XZ7A 2EG6A 4H4IA 1W3NA 1V7AA 4WOZA 1SO4A 3OGVA 4ATDA 3ITGA 3MANA 4QS6A 3N4FA 1TE1A 3LV6A 2HPIA 4KWOA 4C6IA 1ITQA 3UJEA 5C5YA 3MZ2A 4HBKA 4B5NA 4FXRA 2ISSA 2WXDM 3WK1A 3ITVA 2VR5A 2BTMA 4UUIA 3FDKA 4C6NA 4UMAA 1V3JA 1GK8A 3NSMA 2X30A 5U4NA 1KWGA 4FEZA 2DDXA 3UBPC 1F76A 2H9AB 3PJXA 3B0VC 2ZUNA 1W37A 4XO7A 1SZGA 2V67A 4JFWA 5HNRA 4Q33A 1JPKA 4V27A 3L4VA 1XBXA 1TPWA 5FEWA 3UWQA 4Q4SA 1LRNA 4RDVA 1RJRA 1KWKA 4UTKA 3MCOA 1VBRA 1ZB5A 3B0XA 5A6BA 1E56A 1RBAA 1JPDX 3U2OA 4AD4A 1UH2A 3LZ5A 5AKQA 1QNVA 2CU0A 2NQJA 3IVUA 3QLLA 3CU2A 1KTBA 3O2LA 3KOFA 3DFQA 5JU6A 4WGHA 3ARUA 1VC4A 3P14A 1ZBVA 1JDDA 2BOEX 4RZ4A 1XG4A 3TEVA 3BW3A 1ZPTA 4ZVJA 3UWEA 3IAQA 3UWYA 2P3EA 1S5NA 1RCOB 4PTNA 1XPGA 5I23A 1GOQA 2W0UA 3ITLA 3BLLA 1OJXA 3GC2A 1V02E 3MHUA 3H7RA 1M7XA 2PLJA 3SIZA 3TN5A 3C6CA 2OWCA 2WVVB 4H2HA 4J4KA 3EWYA 2J9YA 2G37A 2WYSA 4TMCA 3H21A 1P0BA 2WCAA 4GI8A 3LN3A 3NGJA 5E5CA 3N19B 3GX9A 1H0GA 3AMLA 1JDFA 4C60A 3UF9A 2PWGA 3UP8A 3QC3A 2A1YA 1QATA 3IGUA 4ZSUA 3S42A 1TVLA 5I77A 4I6VA 2JBMA 3C86A 1AQFA 3TYZA 2OYLA 3TTSA 4OV4A 3T78A 3TJ4A 4O1CA 3VKBA 2J9XA 4ERAA 4NZ4A 4UR8A 4MWAC 1VH7A 4UQ9A 2QNEA 4MADA 1VEOA 1OFQA 3GNDA 3VDGA 1QI2A 1GQKA 3M7WA 4AD3A 4H01A 3VGHA 1CIUA 3ONBA 4LTSA 3VOGA 2J79A 2Z0IA 3NQ6A 3V5OA 3VILA 1EHAA 1G4SA 1PYMA 2PDXA 3LERA 3VFCA 3ZMRA 4GJJA 1JCMP 4YHEA 1MYRA 4DI9A 2QJHA 2ZUWA 4ACZB 2D3LA 4HZ7A 3EWBX 4DQWA 1OC6A 3W1UA 2XVKA 1VHCA 4X9SA 4ICMA 1VBGA 2NUWA 4NXKA 1F2JA 4PTXA 1P0DA 4D1JA 4IPNB 1N55A 1SMDA 1IF2A 4UTMA 2B7PA 2ZCGA 4Q4KA 4XZIA 1V93A 1WZLA 2Z4GA 5CSSA 5I7GA 1DEDA 2ZUVA 3PAJA 1K3UA 3TW7A 5FEPA 3W86A 1EDTA 5FEZA 3H6OA 3MWAA 1QT1A 2G4JA 3IUDA 3BWWA 1C9WA 2BHZA 3G1VA 2PDYA 3VOHA 3AHZA 4POCA 2CHOA 1AH0A 3KL3A 3HIJA 1R3TA 3WNLA 3GU9A 5IXEA 2H8ZA 3RM9A 3ZJ6A 2GK1A 4RDZA 2O9OA 2VC9A 1E1CB 1KO0A 3PSVA 4OKDA 3RR1A 3VNKA 5DCBA 1H7WA 1OIMA 4HNNA 3CTLA 4FHAA 3WELA 1QDSA 4XX6A 2NWRA 4OFCA 1FHLA 2QVHA 1JGMA 3ES7A 1K9TA 1RZMA 1ZRQA 4QCEA 3TCEA 1FWIC 4NAFA 2BBFA 2HE8A 3UFYA 4NJJA 1UPMB 1ICQA 3HPSA 2PDGA 4FNRA 2CERA 3VAVA 2ACSA 4FA3A 2WCSA 4JYDA 3DFNA 2VOTA 3VCNA 2VEIA 3A4XA 1BRLA 1F6YA 4QRNA 1FX6A 2PWUA 2FPVA 1FWFC 1WXJA 3AZRA 4X2PA 3QY8A 5C8BB 1J4EA 3NVDA 3P2VA 4HHLA 4R53A 4IF2A 4PTVA 4EK7A 1G94A 1M01A 3IACA 3L2IA 2YX0A 3VOJA 3DESA 4PL2A 1R9ZA 3UVAA 1M53A 1JCNA 1L6FA 1KGWA 4JICA 2A4AA 3VKAA 2ZVRA 1WBHA 1F61A 4XAZA 1CCWB 3B4UA 1BXBA 5LXEA 2Y8UA 3CV6A 4E4FA 4W93A 5HMFA 4ADTA 4QAWA 2HV5A 4UB9A 2C18A 1YNPA 4M3PA 3PG8A 4IPLA 1PL9A 4BF5A 3O16A 1BXCA 4HU3A 4LCSA 3LV5A 2WJZA 2WCGA 4YS1A 4HU8A 3ONCA 4AVNA 4DZIA 3OVQA 2BVWA 4PMNA 5DXYA 2A3BA 2IQDA 4QITA 1JEZA 5MKGB 4KFNA 1QPNA 5LNRA 5I07A 3RIKA 2BGSA 2NW0A 3RO6A 4QIUA 4ZENA 3G2GA 4YCPA 2DSWA 5JIWA 1YKWA 3U9IA 1MNSA 1X38A 5HPCA 2P3ZA 4MJ2A 4CCZA 5H8UA 4AU0A 3LBCA 1PZ3A 4DM2A 3F4WA 3LEPA 1XQLA 4ZSTA 2Y5JA 2I1OA 2CXGA 3VKDA 4DBWA 4ZQNA 1R3QA 2VCBA 1BSIA 4RDYA 2NQHA 4M81A 6CGTA 2PF0A 2ZRYA 4ERGA 1C8VA 4RLIA 5KZMA 1J0JA 1A3HA 1TPUA 2YXGA 2EJAA 2BASA 1XWYA 4MNKA 4RNJA 4IOTA 3P0XA 2BMBA 4S3CA 3LI1A 1XH1A 4WDWA 1E71M 1PXGA 1XUUA 3N3MA 3L9CA 4GRSA 1UD4A 3LTPA 3VDCA 3RRXA 1UWRA 4JFTA 3RLHA 2NVCA 3DN5A 1SO6A 1ZJBA 4PMDA 3PF3A 3TU9A 5KZDA 1LQAA 5CKSA 5FF4A 4BK9A 1B30A 2FHFA 4NAEA 4Z17A 1VFLA 3PBUA 1OGGA 1NWTA 4C91A 2H8XA 4E8CA 3QY7A 3TTEA 2RJGA 3R43A 4WXYA 2X16A 1C3FA 2Y2WA 4FOUA 4LAUA 4O52A 3AU6A 4ENLA 5C71A 3D3AA 1LT7A 4FX7A 1PIGA 4L6OA 1ITCA 4J28A 1V03A 3BW4A 3PTKA 1A47A 4XQ6A 2YZ5A 4DO7A 2YFOA 5BXTA 3W1RA 1KFEA 1QK2A 3DG3A 1POKA 2V5KA 3CV1A 4R85A 3CZ8A 2G96A 4PN2A 5KETA 1A4MA 4O4WA 1EKOA 1H41A 1SSGA 2JK2A 3MUIA 4HYRA 4DO5A 2F8QA 5DEZA 4CU6A 4W8BA 4WXZA 1DJWA 2QCEA 3TC3A 2OGJA 3MO4A 4BWLA 4ZTYA 4QGCA 4QFUA 3F4DA 3TTQA 1ECQA 3N04A 1MXDA 2QJNA 4HCDA 1U22A 3CH0A 5D2VA 1UR2A 2EPLX 4B9ZA 3FCPA 1EX1A 4V33A 4BI6A 4NU7A 4O15A 1OX4A 1YE4A 3AIWA 2BOGX 1HVXA 3WSUA 1E0XA 4P8WA 4B3LA 1JI1A 1NDZA 3S9ZA 4KQNA 3SBFA 3QV6A 1VEPA 4G6CA 3L66A 4J40A 5F1UA 1IEQA 3QZEA 3NOYA 4NL1A 1SW7A 2PWEA 5AC4A 3AO0A 5F2IA 3GXMA 1BQGA 1GQNA 4S3EA 3UWVA 3TQVA 1JNEA 4XVEA 3W0KA 2R6OA 3CGTA 3NR0A 3I68A 4PCFA 3MYPA 1EGMA 3U4AA 5D2TA 4GZJA 5LA0A 3STGA 4BQ3A 3THUA 4CN1A 5CC6A 3P3BA 5KSWA 3PPFA 3BLOA 1TYGA 3IVTA 2E6FA 4J27A 3GWQA 4GBDA 2B81A 4ZTXA 3W7KA 3GXDA 1DJZA 3CZJA 5EYWA 1EJXC 1FDZA 3FGCA 3NEVA 3A21A 4JEQA 4MB1A 1XPYA 3P93A 1V6WA 2F2KA 3SAZA 1UW9A 3G8EA 3GH5A 1US2A 1M68A 3YPIA 3VIOA 3MHFA 4PB4A 5CCZA 3W73A 4H6RA 2WSKA 5AHMA 1VFTA 3WQ6A 1KLZA 2WSRA 3EOOA 4GBUA 3WNMA 3PBWA 3MV11 3BICA 3NQ8A 1LCOA 1EA9C 3SQLA 4Z1CA 3WF3A 1ZP4A 3BLDA 1W5OA 4O57A 3A9IA 4EAMA 1Q63A 5G2HA 4H1ZA 2CZDA 4LBRA 1XV8A 4WHBA 2PUZA 3NYDA 3LHVA 2DZPA 2J77A 3NPXA 4KERA 1W1TA 4R27A 3XINA 1S3HA 1GKQA 3EWXA 1IIGA 2V0TA 2VGIA 4JTGA 1ZQ5A 4NSBA 3UR7A 3DFOA 1HKIA 3R11A 2WNWA 4C6PA 2WMIA 2UBPC 1LRTA 2NVAA 4ASTA 3OJGA 4EF8A 1F8IA 2ADAA 1JZ4A 2IPFA 2D0GA 3DZ1A 1CLVA 4MZ8A 2ABAA 2E09A 1TWIA 1G5AA 2QAFA 1XP3A 2FTPA 4O11A 1BLIA 3BLEA 4AISA 3ZSSA 3WN6A 3BGJA 1BHGA 3WQDA 4Y7EA 3HPZA 2W27A 3AAMA 3T1GA 3OG2A 4CD4A 1VGAA 2HTMA 3RUBL 2ZA3A 4CVWA 1EBHA 4QJ4B 5J5DA 5JXQA 1G67A 2QMJA 1POJA 3ID7A 1RQBA 5BCAA 4LRSA 2NQ5A 1R2TA 2OTDA 5DMYA 4FX8A 3COTA 4KGLA 4E2BA 1YNQA 2X1SA 3JR2A 3LM7A 1XXXA 4MGGA 3WJZA 4K37A 3W25A 1J5SA 2W79A 3BK0A 3DC8A 2WVVA 4RV8A 4CQCA 2Y6ZA 2AMXA 4N0RA 5A8PA 3LCHA 4LYRA 1TV2A 2YCJA 2R1LA 2VWTA 3GR8A 4FOJA 4IMAA 1YDYA 1FH7A 4C7DA 3OBAA 4H8NA 5G2WA 4MKNA 3DXIA 4UTHA 3EX4A 3L2MA 4HZMA 1F74A 2QQ6A 3HTWA 5KMYA 1XR2A 1TTQA 1W3LA 1UPPA 1KA9F 4P61A 1X97A 1EXPA 1V02A 2PRMA 2F6UA 1PO9A 4C5YA 3Q65A 4BFAA 1MXSA 1EGZA 3IV3A 3TYBA 5K4XA 5J5RA 3UG3A 3GH4A 3L23A 4MZYA 1DV7A 4NJIA 3O07A 3PZNA 3T6CA 3V75A 2VFGA 1AL8A 3UA4A 1F5ZA 4ACZA 3S5ZA 4QSHA 1HKWA 3QPEA 3TXVA 1V6XA 3HQ1A 4HNLA 5DFAA 4MPQA 1B3ZA 4DVOA 3I4EA 2XSXA 4PA8A 1WAUA 5I3JA 1S5VA 1ZAIA 1JIBA 1UKPA 2ISDA 4AWSA 3GTFA 3GC5A 3GG1A 4D6EA 1P48A 3MP3A 3B9NA 3AMKA 3SN1A 4W7VA 1Q45A 3NEHA 4HD5A 2DQWA 1ZNNA 3MO7A 5IRPA 2INZA 3W02A 4A3RA 4C6MA 4WEVX 1AVAA 4GLEA 3EDDA 3RPTA 4M80A 4PUWA 3T0DA 3M0MA 1Z48A 3NQAA 1O1ZA 1QAPA 2Y85A 4XAYA 1UWTA 1GWJA 3T81A 3CAWA 3TTOA 1AH4A 5FACA 3RM8A 3WIJA 4KW2A 3VPLA 4JY8A 1XLGA 4R88A 5AHNA 4GY7A 4TTUA 4F0MA 1IEWA 1IXOA 1VP5A 5CZTA 1QO2A 4HP5A 3APYA 4DLFA 1P1XA 3MUY1 3L4UA 2DGAA 3N11A 2YLLA 1QTWA 3GW0A 1V08A 2C3ZA 3S0CA 1L6SA 1LLWA 5CPLA 3G1AA 2DEPA 4AZCA 3BTNA 5LNVA 4LVAA 1S3TC 5CGMA 3D5HA 3HG5A 3MUZ1 4XZ9A 1SO5A 4UTTC 4KCTA 1Z42A 4QLJA 3O1NA 2YSWA 2ZVIA 3L4XA 3ORWA 1A5AA 2GOKA 3NQFA 5KZEA 2FZMA 4UZUA 3TYDA 2HZGA 3KCOA 2Y5SA 2ZA2A 1T5AA 5JQ9A 1BKHA 1LL7A 2BHUA 2P50A 5KEZA 3IUIA 3S4TA 4NI8A 3GSMA 3L4WA 1PIIA 4O12A 1UC4A 4EPKA 2PDJA 3W74A 4MPKA 3VC6A 1GVRA 3CL8A 2GZXA 1KCXA 1BVWA 1MW3A 2YL8A 5ABHA 4D6IA 2Z7KA 1B54A 2P76A 3N4EA 1TTPA 4KESA 3PSWA 1TPVA 1JDAA 5M17A 1SW0A 4W8LA 3GDTA 4FNTA 1MRAA 3H7UA 5A1AA 3L12A 1CPUA 3FNDA 2ZUMA 3NOEA 3WDJA 1JJKA 1KRAC 3S1VA 1ME8A 3RMEA 4YVPA 2QR6A 4ORIA 1SR9A 2A0NA 5ABEA 1R8LA 4YCOA 1CENA 4XAFA 3G1SA 2QXWA 6PTDA 3QM3A 3VGDA 4ZQCA 2Z2AA 3TOYA 2YBTA 4Q8OA 1KFBA 1E6PA 2NQZA 5MKGA 1C93A 1OT1A 3LM3A 3WBYA 1JYXA 3MT1A 4A4AA 2ZZ6A 1HJSA 2RFGA 1TPFA 3MJYA 4WJXA 2YPIA 1MFUA 3OHIA 3TP4A 3CJPA 2DSVA 3GHSA 4LBSA 1FHDA 4WDUA 1KCZA 4DI8A 3LOTA 4CCCA 3EWZA 1Q6FA 1K8CA 1E4MM 4DELA 2EPOA 2ZX6A 2NWSA 1ZJIA 5HNTA 4HQVA 3TSBA 1CGUA 3KDNA 2XGZA 2ZA1A 2IQ0A 4QEEA 2PD5A 4HOWA 1X1OA 3GG8A 3TN6A 4L1GA 3NM3A 4ZQOA 3GDKA 5BW6A 1UA7A 1XLBA 4J3XA 2HS6A 5HNNA 2VD8A 2CLHA 4YHGA 1AD1A 3WDRA 3ARRA 1G1YA 3HQNA 2CZEA 1SW3A 1TUFA 4QROA 4N02A 2C79A 1W3TA 5FSDC 5J8LA 3BXWA 2PSNA 4W84A 2QPSA 4E0CA 3SCVA 1E9ZB 4UTJA 3ZO9A 3S6TA 3NNTA 3VA8A 4FZIA 1PAMA 1XH0A 4IHCA 1XLLA 1FY6A 2J62A 1DIKA 3CQHA 4WK9A 4QBXA 3W7QA 4C5ZA 1VLWA 3OBEA 1D3HA 2HNHA 4S3BA 4AY7A 2WNZA 4EACA 1PHQA 4HNVA 4XO6A 4U5KA 4A2SA 4U2ZA 1IT0A 2DW7A 1JYWA 3K4WA 4BCEA 3OU8A 4GUGA 2WZEA 3QXBA 4GYPC 3WF2A 2PD9A 3WNNA 1PKNA 4LAKA 2CBIA 1W3JA 3NIYA 2VEKA 2D3NA 2DT2A 1WAWA 2NT1A 2IS7A 2BLEA 1XYMA 4LC8A 2XH2A 2A7PA 1LLOA 4H2CA 4PMXA 5DLCA 2Q8LA 1DQUA 1JF6A 5KINA 1KXHA 4L4OA 3W22A 2A7NA 2WJDA 2CITA 5CZSA 1BYDA 5A6SA 1XS2A 4JTDA 2Y5EA 4K8EA 1O66A 3FVMA 4Z1AA 2DZVA 4R9XA 2J88A 5CLTA 2XFFA 2BP1A 2VKZG 4XIAA 4KCWA 4DYEA 3KWSA 5JBDA 1QCWA 1JULA 3GU2A 1O5QA 1XC6A 2ISWA 3HGSA 2QW5A 2WKGA 3CT7A 5JBEA 4RXFA 2DZUA 2E77A 2X05A 3KP0A 2FZDA 3U7BA 3MDUA 1D2KA 4BHYA 1Z89A 5A6TC 2CBUA 2J78A 3W2MA 1EDQA 5HWNA 4CNNA 1V3MA 3H2MA 5D2WA 2D24A 3K8LA 3W07A 4ZO6A 1Q6RA 3MP5A 5AHIA 1GOKA 2A3HA 2ON3A 2ISFA 3CUHA 5EKYA 3AHVA 3MDWA 4FIQA 3B4YA 1IYXA 3PFMA 4JTHA 3WK2A 2GUBA 1K03A 2QV4A 1RPKA 2G4FA 2X0SA 4D6HA 4QXIA 2YDAA 3ZVIA 1NFGA 4OOZA 3WJYA 3C56A 1GONA 3WX7A 2ZE3A 3BVJA 3MKVA 1YHTA 1J11A 3DYMA 3UZWA 4BKNA 1YTEA 1QMLA 3PZ9A 1JXKA 4M24A 4M5PA 3R4IA 2DSUA 2Y4SA 1GYLA 1IGSA 3L65A 5LIXX 3S2JA 4ERIA 3BG3A 3MSRA 1HKJA 1EDGA 2HNEA 3WBXA 3A5FA 1KM0A 3NZGA 2V3GA 3RF9A 2QDGA 1VB9A 2QJIA 3IJ9A 4X60A 4W89A 1TPEA 1L6GA 1BG4A 3V4BA 1HF6A 4DJEA 4CQ9A 3EOLA 3THQA 3O7UA 3DKJA 1NIUA 1Q4WA 1M7JA 3LTSA 2DVTA 1UUMA 3W7CA 3W71A 2DT3A 2R14A 1N7KA 2JEPA 3TN4A 1OQFA 4QCFA 2OFJA 5FI8A 4IJCA 1NWRA 1UQYA 1WXYA 4WIWA 5TIMA 1KLYA 4GJIA 4JTTA 3ITCA 4E4PA 1P0EA 1TVNA 1H1NA 1UWQA 4FLRA 4EAYA 3IV8A 3L5LA 4LVDA 1D3CA 4F2BA 2YLAA 4ZR8A 5DT5A 4ZEPA 2W6RA 3CO4A 3EMQA 4I90A 3UWWA 3CHDA 3VYLA 4NX5A 3UEQA 4LUSB 3SM0A 3U0HA 3JU2A 2OX4A 1M9HA 3UXIA 1XW8A 3LB0A 1EJVC 2J13A 1THFD 1XIBA 1F6PA 3MMTA 4FMVA 2BHYA 2PZ0A 3EBVA 1UZHA 2D2HA 1VKFA 1NOFA 1RA5A 4RL3A 6ALDA 1XIGA 5LYRA 1GTHA 2YXOA 2V3EA 3OZYA 1TWSA 4JTRA 1QNSA 2OEJA 3F2DA 4PUJA 1S2WA 1MZRA 2VFEA 1B1YA 3OZPA 2H6RA 4PL1A 2ZX8A 2XFWA 3BOFA 4A22A 1FWGC 5EMJA 1F07A 4WX2A 5CC5A 2XHYA 2D73A 1ADSA 2Z2BA 1M1BA 3DHUA 4FP1A 2OSWA 3VIFA 5HJYA 2PDQA 4CQ8A 3OW1A 3IJIA 1BSLA 2Z1KA 1YYAA 3QHOA 1JQVA 3W7GA 3S83A 2HEJA 3AIVA 3VKKA 4RE0A 2DT1A 3IJLA 1XGDA 4A3UA 2J7HA 4C7GA 3CMJA 1ITXA 3CXOA 3IWPA 2WVTA 3HV8A 3EMZA 4H6QA 3RDKA 4U28A 2HDJA 4N2YA 4PTWA 1LROA 4UTUA 4WJEA 4K6AA 5LXXA 3SCSA 2D22A 5ECVA 2J8TA 1CLXA 3MY9A 3LBMA 5DANA 4M6QA 3SUSA 2OMAA 1T41A 4LAZA 4C6JA 2CCRA 2PDCA 3GTHA 3W1MA 3U8GA 1HX0A 3WNKA 2PTDA 3N14A 4S3DA 3H2NA 4N6EA 1F73A 1I0DA 4YTQA 3C61A 1RCQA 3B8WA 1Z32X 4PTDA 1KFLA 1G69A 3LYEA 3VNYA 4UFKA 3TX9A 4RJEA 4NZ3A 1LG2A 4BF7A 3G6MA 5XINA 3K8MA 2WMFA 2GJRA 3AIUA 3ZLGA 2I16A 3WH6A 4JFUA 1CX9A 5DO8A 4D8ZA 5PTDA 1XLAA 1OYAA 1K4GA 2WWCA 1AODA 3AIBA 4XSLA 4WZHA 1ISYA 1K7XA 1SJBA 3WJXA 2ZADA 3NXFA 3HBLA 1O5KA 3UR2A 4NZFA 5E0KA 2DVUA 1A49A 1OBAA 3MKKA 1PX8A 4REQB 3NZRA 5D05A 4J7RA 3CMFA 3PWAA 4JN7A 1FWSA 1EEPA 4AAJA 4Z1DA 2REQB 1T96A 4H7ZA 1TR9A 5G4WA 3PWIA 1REQA 3JW7A 3JRKA 2AKMA 3DGRA 3GDMA 5M1TA 4DYKA 4JIRA 2VX7A 1UKQA 3GVRA 1EC8A 1QHZA 1V7YA 1EA0A 3NGFA 3GXPA 4OJYA 3FA4A 1IQ8A 1UBSA 2R1KA 4DBEA 1J9YA 3OYZA 3I10A 4AG0A 5K4ZA 1K6WA 5JMUA 2ZX7A 2CESA 2B7QA 1E1EA 1YMYA 3ARTA 1QK0A 2RAGA 1AD4A 2YCLA 5FA5A 3QR3A 4JHOA 1DTNA 4MF4A 2MANA 1F3EA 1RHCA 1FVPA 5BNKA 1E0TA 2ZZ3A 5BRQA 2CLPA 1NF0A 3O0FA 1OK4A 3MHGA 2OZ8A 8RUCA 5JBFA 4KEVA 3ZXWA 4XBKA 3M0JA 4S3JA 4ICNA 4LUTB 2WNNA 1J96A 1DWAM 2CFFA 5KZ6A 2X7VA 3MJMA 1S1PA 4XZNX 5CPTA 5H8PA 3PTDA 1R5YA 2J7CA 4M56A 5DF0A 3SDOA 2FB2A 3TWBA 1P6WA 3L7RA 1XDMA 1EEXA 3NO1A 3AC0A 1B57A 4AC7C 1WQ5A 3RU6A 4IIFA 1A5SA 1UD6A 1ZBWA 1KM3A 4QDPA 1YPIA 2Q3RA 3RAOA 1GJUA 5U7SA 2TRSA 1K7FA 2DJLA 2Z1VA 4GC4A 5D2XA 2YFNA 2QCMA 1TB3A 5AFDA 4Q4QA 1UIPA 3PZQA 3NQMA 2WK2A 4QLKA 3MVTA 2NQ9A 4WR3A 2X41A 3IANA 2WHMA 3K8KA 1TELA 3HFYA 2FZNA 1XGEA 3N9RA 4F66A 3H2FA 4OE7A 4ZXOA 5E1QA 2FH8A 3T44A 1M6JA 4M6UA 4AYSA 4LRTA 2I5IA 3SECA 3Q58A 2A6LA 1V0KA 1SYTA 1A80A 4AZ6A 2R24A 1BXNA 3VFLA 1FFQA 3W27A 2A7RA 2TPSA 5CGQA 3H4GA 5D30A 3BW2A 4LV4A 1H50A 4R33A 1W9DM 1XYCA 4O17A 3IUHA 1LYXA 4RK8A 2V2CA 5C70A 3N29A 4JYFA 3CC1A 3FYYA 3W6MA 4UOZA 3GNXA 4U33A 1N82A 4PCNA 1P0NA 3POCA 3DH7A 4AWUA 3KDOA 3N9KA 1VFMA 1D7FA 4IMEA 4IMGA 3WD0A 4MYAA 3IIXA 4O18A 5G1MA 1UR1A 5E70A 3QTPA 4OTKA 1MUMA 3PBYA 4MNMA 1W5NA 5AYIA 5LIYX 3PUEA 1OYBA 1OD8A 3QKEA 3M5YA 1HP4A 5AY7A 2ALRA 3T0CA 3NO5A 3B8UA 4K7VA 2V6AA 4AQLA 1KBIA 2PGRA 1C8YA 5JH1A 1C8QA 1QU4A 1AH3A 3WF0A 2O4QA 1F05A 1XIHA 3MU7A 3TQ0A 1U5VA 3EOUA 2ISVA 1R86A 3W7DA 4A3YA 4DF2A 4IQJA 4XKYA 1FHVA 3ZFHA 2CBVA 1B3XA 1L9WA 1YXDA 5RUBA 2VP8A 5A8GA 3W2NA 1LZOA 4PR4A 1EYEA 3W29A 4GH1A 4BQ2A 3MWCA 4DUOA 4EE9A 3KOXA 4AXKA 1FHUA 3DG7A 1GJPA 1AW5A 5AZ0A 3G22A 2PWHA 1R3YA 3FKRA 3M0ZA 2Y0FA 3VXGA 1EJUC 2BWGA 1YDNA 2QUUA 3A9BA 5FAJA 2BVTA 1AMKA 4Y2WA 2I17A 4DHGA 5F4SA 1KQYA 3PWGA 3FW6A 1VJIA 2ZFAA 3TZFA 4LPCA 1PVNA 4D6GA 4QQUA 4GXPA 2WZHA 3NZQA 1A5LC 3A12A 3VMOA 4LANA 3K4DA 4UTLA 1PWMA 3TOPA 3F5KA 3QC0A 3BLPX 2CLLA 2BGQA 5G4EA 2RGMA 3BZGA 1XRSA 1E4LA 5TAOA 4KEMA 1QW8A 4JS3A 1PPIA 4H9TA 3EAUA 2VOMA 1EB3A 5CG0A 4JCLA 1Q85A 3SFWA 1HJVA 2WZTA 1NH6A 4IPPA 1IZKA 2OZ3A 4NX0A 4O1AA 1AL7A 1SJCA 3HURA 3OGSA 4ZCWA 3UG5A 3M5VA 3AMDA 3OVPA 4KEUA 2QZRA 1BVNP 3KLLA 4H9XA 5F2LA 5C7VA 4GO9A 1JG9A 5IHRA 2TYSA 2XN2A 1DIOA 2WLZA 3BV4A 1Y5XA 3FEMA 4HNUA 1CGTA 4ZZ9A 3II1A 1CLKA 3AIQA 1HG3A 2EKGA 2J74A 3CUIA 4ROQA 4XUYA 1YTDA 3SRFA 4Q4RA 3TJXA 2X1RA 3SRDA 4JX4A 2NV2A 4G5DA 1YBQA 3K30A 2OKTA 2ZXQA 1J8VA 2E9MA 4AWTA 3ECQA 5K2ZA 1Q6LA 1LWJA 2LLEA 3BGGA 1TJPA 3KZSA 1DIDA 1TJRA 3VDHA 1XRTA 4HN8A 3LHTA 4FLSA 5BMXA 3S47A 1XKYA 1XYAA 3NL2A 3OPSA 3CHVA 3P5ZA 9XIAA 3EA3A 1WB0A 2F6XA 1NDWA 4D1IA 3IPWA 1RBLA 1K7EA 4MHBA 3VC5A 4O19A 1NOUA 1ISZA 1JPIA 3EKGA 1VPYA 2GGGA 1UMLA 3CPUA 1ODUA 4FXFA 5I6SA 5XIAA 2I9UA 4J5NA 2V69A 1WO2A 1KXTA 3CPRA 4DWSC 2CKRA 4F0KA 1Q7ZA 2DW6A 2EQDA 3BJSA 1B9ZA 5AHEA 4DJDD 4EOUA 2DZWA 4CNTA 1UD2A 3W88A 3UGRA 4GQBA 4Q7IA 4LS2A 2X40A 4FSAA 4WDXA 1NEYA 3U6WA 2PP0A 3BZJA 3E0IA 3BCFA 4J2MA 1BD0A 1FWDC 2ZOXA 1JDCA 3MS8A 5CSRA 2PE4A 3M47A 4BQ4A 2VM8A 1HO1A 1ZAJA 4LEQA 3W87A 1KM6A 3MCNA 3RX3A 4DBSA 3C2EA 1BYBA 3BAKA 1FCVA 4EPDC 1YQ2A 3AFBA 4Z0JA 1TJ1A 2G5WA 3ZJKA 3MA8A 4ONVA 3M9YA 3UZJA 3UJSA 2IPGA 4NT0A 3QRHA 1OK6A 4BZYA 4B4HA 4TIMA 1BYCA 1BG9A 3N2OA 3W1QA 3NPWA 1X6LA 1YRRA 3C2FA 5AYYA 4IH3A 1DL3A 1MW0A 5A69A 1I0BA 4IP5A 3UPMA 3NQ7A 5CSYA 4D8LA 3C0JA 4JCMA 4UR9A 4MWAE 1ALDA 5BWAA 1KKRA 5GNYA 2NX9A 1JCLA 4URIA 3M07A 4A29A 3F2BA 3RR4A 3N15A 1FXQA 4I6KA 4XWUA 2XYLA 3E2SA 1ZJAA 4NYYA 2ZKMX 3M64A 3A3HA 5FESA 4NP7A 1UC5A 2Y8KA 1W2PA 3ISIX 5HDRA 3GLCA 3KX6A 4JTJA 2EGZA 4ADSA 1FBAA 3KWXA 3W83A 5LZLA 1W9VA 3RO8A 3KOYA 4LBUA 4DUWA 3WMSA 2QUMA 3PM6A 1QBAA 2WMKA 5CH9A 3IJ6A 1LTDA 1XSKA 4PSRA