The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
120
|
structure length |
120
|
Chain Sequence |
KRPWKCCDEAVCTRSIPPICTCMDEVFECPKTCKSCGPSMGDPSRRICQDQYVGDPGPICRPWECCDKAICTRSNPPTCRCVDEVKKCAPTCKTCLPSRSRPSRRVCIDSYFGPVPPRCT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase inhibitor
|
molecule keywords |
BOWMAN-BIRK TRYPSIN INHIBITOR
|
publication title |
Crystal structure of a 16 kDa double-headed Bowman-Birk trypsin inhibitor from barley seeds at 1.9 A resolution.
pubmed doi rcsb |
total genus |
15
|
structure length |
120
|
sequence length |
120
|
ec nomenclature | |
pdb deposition date | 1999-07-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00228 | Bowman-Birk_leg | Bowman-Birk serine protease inhibitor family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | Cysteine Protease (Bromelain) Inhibitor, subunit H | Cysteine Protease (Bromelain) Inhibitor, subunit H | ||
Mainly Beta | Ribbon | Cysteine Protease (Bromelain) Inhibitor, subunit H | Cysteine Protease (Bromelain) Inhibitor, subunit H |
#chains in the Genus database with same CATH superfamily 3RU4 B; 2BI6 H; 1K9B A; 1H34 A; 2BBI A; 2G81 I; 1BI6 H; 1BBI A; 1C2A A; 5J4Q B; 1D6R I; 2FJ8 A; 2R33 A; 1PI2 A; 3MYW I; 1TX6 I; 1PBI A; 2AIH A; 2ILN I; 2QN5 B; 1MVZ A; 5J4S B; #chains in the Genus database with same CATH topology 3RU4 B; 2BI6 H; 1K9B A; 1H34 A; 2BBI A; 2G81 I; 1BI6 H; 1BBI A; 1C2A A; 5J4Q B; 1D6R I; 2FJ8 A; 2R33 A; 1PI2 A; 3MYW I; 1TX6 I; 1PBI A; 2AIH A; 2ILN I; 2QN5 B; 1MVZ A; 5J4S B; #chains in the Genus database with same CATH homology 3RU4 B; 2BI6 H; 1K9B A; 1H34 A; 2BBI A; 2G81 I; 1BI6 H; 1BBI A; 1C2A A; 5J4Q B; 1D6R I; 2FJ8 A; 2R33 A; 1PI2 A; 3MYW I; 1TX6 I; 1PBI A; 2AIH A; 2ILN I; 2QN5 B; 1MVZ A; 5J4S B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...