1C2FA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2fA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2fA02
2VWNA 3QTOH 1F0UA 3SUDA 1UO6A 3STIA 3LIWA 2Z3DA 2Q6GA 3HGPA 4A7IB 4FUBA 4U01A 3LT3A 3KQDA 2WPKS 1BTPA 2UUJB 1W14U 4ISIH 1DICA 1GJ4H 3F9HA 4I8JA 4I8GA 3TJUA 1OP0A 3U1JB 2C90B 2SNVA 4JYUH 4HFPB 2ZCLP 1LHFH 1DXWA 1Y59T 3RMOH 5HGGA 1D6RA 1DPOA 3AVZA 4ISLA 3GY4A 3OTJE 2QXGA 2ZGCA 2TRMA 3BV9B 1JXPA 1NN6A 1O2NA 3DFLA 3PM3A 5CHAC 3SQEE 4AFUA 1K1MA 4OGYA 1V2NT 1O3HA 4Y11E 1KIGH 1GMDF 3SW2B 2XXLA 5A0CA 1AI8H 1E35B 2G81E 2G51A 1O2WA 3IITA 4OGXA 1AU8A 5BPEA 4XDEA 1TIOA 2AGGX 1ZTKA 3F9GA 3KEEA 1O3EA 1QBOA 4Y79A 3TGIE 4B76A 2W7SA 2A5KA 3A80A 3VXFH 2PWXA 3P92A 3LGWA 4KP0A 1HAPH 1W10U 3EQ0H 1A0HB 1O3AA 1H8DH 4DG4A 1OP2A 2D1JA 1F0RA 2BVSH 2R2WU 1DY8A 2IN2A 1Y3WA 1KLIH 1AB9B 3SHAH 3GCTF 2ESTE 4I33A 4ISNA 1ELBA 2VVVA 2BY6X 5DG6A 1HJ8A 1TPAE 2PLXA 2BXTH 1GHXH 1LPGB 3BN9A 4Y0ZE 1GJAB 1GCDA 5IDKA 2TGTA 7GCHG 1P11E 1UTJA 1G3BA 1XM1A 2XYAA 2PKSC 2GV6A 1AVWA 2R0LA 1G9IE 4X6PA 2EC9H 5AVDA 1C2IA 1WYKA 2A31A 1FY1A 1GBLA 1GI1A 4BTTB 2XBYA 1CT4E 4INHA 2TPIZ 1IQHA 5K7RA 4YT7H 2QA9E 1A3BH 3E0PB 3F9EA 1WQSA 3ATWA 4GCHG 1MCVA 3HK6B 4NSVA 1DY9A 1J15A 5ETXA 1Y5AT 1B0EA 4SGBE 1Y3UA 2BTCE 3BTTE 1LHGH 1EPTA 1NM6A 2GT7A 5DKMA 3UREA 4Y8YA 2GZ9A 1TNHA 4Y10E 1EP5A 4BOHA 4FXGH 3PO1B 4AYYB 2GT8A 1OWEA 3A85A 3SU4A 1O34A 2P3UB 1EJNA 1YC0A 3DD2H 2H2ZA 4FUEA 1EJAA 1ZRBA 3RC5A 2ILNA 3PYHA 3GDUA 3KF2A 3B9FH 3SO3A 1C1OA 1CA0B 3KGPA 2J9NA 1WU1A 3NPSA 1UTQA 1EXFA 1TGBA 3MH7A 2ALVA 1P04A 2EEKA 2YOLA 2QYIA 2FIRH 5HM2A 1GJBB 1MAYA 3SOSA 1AUJA 3QO6A 4IC6A 3FP7E 2ZDKA 1O3KA 2P93A 3M3SA 3TLOA 1BMAA 3QUMP 1O35A 2FXRA 3SJKA 1AZZA 2BLOA 1GJ6A 1NC6A 3SU5A 4BAOB 2R2MB 3QLPH 3U8RH 1C5PA 1HAZB 1P02A 4K69A 1Q3XA 5JBBS 3SZNA 1CQQA 1J17T 4NA7A 2ODYB 1UK4A 3A7VA 1S84A 4ESTE 1Z6JH 1O2UA 1BBRK 4ABEA 3M3TA 2BD7A 1GBJA 3SNAA 4CH2B 2A2XH 4ZAEA 4KELA 4WMFA 3UIRA 2A5IA 1O5BB 2ASUB 4WVPE 1V2ST 2TGPZ 2QY0B 3NUMA 3SUGA 4B74A 4I8HA 1A46H 1CSOE 2BMGB 2QAAA 4IN2A 1SHHB 5EU8A 3K65B 2OBOA 2ANWA 3MYWA 5T3HA 1F0TA 8LPRA 1CHOG 1C5NH 3DUXH 1A3EH 4Q80A 2SGAA 5E2OA 5DPAA 1SQTA 4CHAB 1A61H 3ZV8A 2ZEBA 2BD8A 2JH0D 1SSXA 1TB6H 1AGJA 4AGJA 1QHRB 3A81A 5F8ZA 1QBVH 3LC3A 3ATLA 3BTKE 1EKBB 1GDUA 2PHBA 1O3PB 2OQUA 1MBMA 1EX3A 1TX7A 3GY2A 4FUDA 1EAXA 2EA3A 2CF9H 1Q2WA 1SGRE 2CN0H 5AF9H 3M36A 4BAMB 1PPFE 4FVDA 1Q31A 2D26C 2BXUH 1C9TA 1SGIB 2ZKSA 4J2YB 3QGJA 1QTFA 7ESTE 2FS9A 1SGFA 1TRMA 1W7GH 4MPWA 4X1NU 5LPEA 1THPB 1C2KA 1TMUH 5ESTE 1GHWH 3BTME 3M7QA 1QR3E 1YKTA 4AG2A 1UCYE 3A89A 1SB1H 1P2JA 1CE5A 1O2GH 1F2SE 2XNIA 3GY8A 3VGCB 2Z94A 1SGNE 3E1XB 1EOLA 5F8TA 1F5RA 4Y71A 1ETTH 2P8OB 1NFUA 1OP8A 4ABIA 1TPSA 3RU4E 1O3JA 1Y5BT 3T5FH 1BIOA 2NU3E 3LGIA 1GI7B 4SGAE 4XE4A 3LJJA 3QZRA 3SNBA 1FUJA 2FOFA 5A0BA 2BM2A 4DJZB 4X8VH 4OS7A 1TGTA 3A8BA 2BD5A 2FTLE 1AMHA 3QTVH 2A4RA 1ZR0A 1GPZA 2OD3B 4ABHA 2FI5E 4MTBA 1BMMH 2FWWA 4HZHA 5FCKA 3MMGA 1GJDB 1GMCF 2XBVA 3RLYH 3B8JA 1NRNH 4D8NA 4MVNA 3SV8A 2ZGHA 4ABGA 3K6YA 1AIXH 4BAHB 4YO9A 3SJIA 3O8DA 3VFEA 5L2YH 4O3UA 5CE1A 1SFQB 1TPPA 1BMLA 1QNJA 2K1QA 3P8GA 5PTPA 4O03A 4BAKB 5L2ZH 1GBEA 1MKXH 1KXCA 3VB7A 3RMNH 1QJ1B 1G36A 2XCFA 2ZFRH 4AOQA 1TMBH 1O2YA 4JYTA 1MKWK 2ZG0H 4NSYA 1A5IA 5DP7A 4GPGA 4ZUHA 3F1SB 2GCTC 1MUEB 3MH5A 1DXPA 1PQ7A 1JOUB 5EPNA 1GBDA 1ABJH 2NU4E 2SGEE 2ZQ2A 1ZMLA 3T27A 4BXWA 4JYVH 4WJG2 4CRBA 1T31A 4FU8A 5JYIA 1ZSLA 2GZ8A 1QFKH 3P17H 1GVLA 3F68H 2EI7A 2CHAB 2O8LA 3ZVAA 3GY3A 3NCLA 1TABE 3ZYDA 1KDQA 2DE8A 4U32A 1YLCA 1C5XB 1ESAA 1GVZA 4DOQA 1F5KU 3GYMA 1IQGA 2C3SA 2GMTB 1GCTB 2P16A 2FOAA 3TJOA 1A7SA 4FU9A 5F6MA 2V3OH 1C5WB 4FUHA 5E0HA 1ELVA 1H9HE 5LPFA 1S5SA 4AN7A 3K6ZA 2OXSA 1C1PA 3TH4H 1RTFB 5GJ4B 1L1NA 1O30A 2ODQA 4VGCB 2RA0A 2W5EA 1N8OB 5DK1A 3BSQA 1AQ7A 1DFPA 3RXDA 1N1LA 1TGNA 1A0LA 4MLFB 1SHYA 2FP7B 1TOMH 2HALA 1C1NA 1WV7H 4XSKU 1BRAA 4HTCH 3QWCH 1B7XB 2SGQE 2BLVA 1OS8A 4CH8B 3I78A 2FYRA 3RXIA 1IQKA 4O9VA 3N7OA 1XUIA 2H6MA 4X2VA 3RMLH 1MU6B 3A84A 5FXLA 5GCHG 3BTQE 1PQAA 4GVUA 3ZZ6A 3RXHA 1A0JA 2BZAA 1GBIA 1TA2A 2QCYA 3BTFE 4JMYA 1P06A 5E2PA 4HGCA 4YT6H 5A2MH 4X1RU 1V2VT 1UJ1A 1TWXB 1C5MD 3KCGH 1IQEA 2WPJS 3M5OA 1ZZZA 4BTIB 1JIMA 1UTMA 4MDSA 1O2LA 4ZXYH 1O2RA 1O39A 1ZJKA 2GCHF 1BBRH 1XUGA 3STJA 1GDQA 1CT0E 1T7CA 1Z8RA 2OC7A 3GCHB 3S69A 1F92A 1HFDA 5FPTA 2ZHQH 4IMZA 2SGPE 4NIXA 1EOJA 2GKVE 3M5MA 1SR5C 3IWMA 4ZHAA 3U8TH 1RIWC 3L6PA 1QIXB 3MU1A 3UTUH 4FUFA 2BDHA 1SGYE 1UTNA 2H5DA 2WPIS 3SGBE 1O2VA 4A6LA 3ZVFA 2O8UA 3SU3A 2XTTB 3G01A 3P8NA 2FOHA 3U9AH 3BG4B 1ZYOA 2IJOB 1GDNA 3CENA 9LPRA 2BDGA 1D9IA 1ZOMA 2Z3CA 3SNEA 4H6SB 8ESTE 4LK4A 5AFZH 3NKKA 4LXBH 3HKIB 3UR9A 1QJ7B 1XVOA 3TK9A 1ELGA 1A4WH 1RTLA 2H9TH 1MD8A 1W12U 3U98H 1BQYA 1EQ9A 1G3EA 2FOBA 1YP9A 2ANYA 2O8TA 4IMQA 3VB3A 1THRH 1BMNH 4X1SU 1C1UH 2VIDA 3Q76A 4Y76A 3PLPA 2BHGA 2BQ6B 5LH8A 3URCA 1C5QA 4YESB 3UOPA 4DT7B 5GWZA 5E8EH 2A5AA 3A7YA 4D7FA 3M35A 1TNKA 4A1TA 1QY6A 3ZZAA 1W13U 1H9LB 1FN6A 2Y80A 1Y8TA 3S9BA 3RXKA 3ATKA 1NFXA 2VIOA 2ZFFH 1KSNA 3TIUA 3VB4A 3LGYA 5DJ7A 3RXAA 1UK2A 1KYNA 2BDCA 3KNXA 3VXEH 1GMHF 1O2TA 1NPMA 4AYVB 3SU2A 3M7UA 2G4UA 4AGKA 3MHWU 1ELCA 3EA9A 3GISB 2SGDE 4K1SA 5EQQA 1K1OA 1EAIA 1SLXB 2GZ7A 1FPHH 1RXPA 4XBCA 1EPTB 1ELEE 1GGDC 1QB9A 1P05A 4UDWH 4ABJA 1V2PT 5FPYA 5EXLA 1G37A 1RFNA 2HRVA 4YM9A 4AFSA 1SMFE 1E0FD 1FN8A 1OKXA 4I8LA 1LTOA 2Q1JA 2BLWA 4KKDA 1ZHMA 3T28A 1ANDA 1BRCE 2OUAA 3SQHE 2UWLA 3GY5A 1S83A 4XBBA 5CMXH 2PV9B 1Z8GA 3EE0B 4THNH 1TGSZ 3MI4A 3GDSA 4Q7ZA 1FIWA 1UVOA 2OTVA 3RUOA 5L30H 2BY8X 1G32B 2G8TA 1AE5A 4YOIA 3PLBA 1O2OA 2Z9GA 1OWKA 3A8AA 3OU0A 3E0NB 1HV7A 3QN7A 2FOCA 2HOBA 3BEUA 1DDJA 1FNIA 4ASHA 5T6FA 1MKWH 1PFXC 1QA0A 3OSYA 1SLVB 3ATMA 1O3BA 3E3TA 2OBQA 3AAUA 1SOTA 5EXMA 1IQJA 3BIUH 1G3DA 2QN5T 1JRTA 1P2NA 1Z6EA 3PMJA 4K8BA 1UTKA 3MO9A 2B7DH 1DLEA 1O38A 1UTPA 3TJNA 3QDZB 1IOEA 2VH0A 4NCYA 1T4UH 4TWYA 3GCNA 3UWIA 5J4QA 1K1NA 1NRRH 3MU8A 3RU4T 2ZZUH 4ZMAH 3P8FA 1SLUB 2WPLS 4JZFH 3SJ9A 4B2AA 4FUGA 1O5AB 1ELAA 3VEQB 1C5UA 1LKAA 5IYTA 1RTKA 1ZLRA 1T8NA 4YLQH 4CBOA 1GJ9B 1T8MA 2R3YA 1GMCG 2XC4A 4Z0KA 1VGCC 3SI3H 3LH3A 1AFQC 1Z1JA 4GHQA 3LGUA 3FVFB 4O3TA 2F9OA 4X2YA 4I7YH 2Y5HA 2G00A 3RC4A 2P94A 1BJUA 1X7AC 2ZHEH 1NROH 4ZKSU 3TJVA 4IW4E 2A0QB 2JH6D 3RM0H 4DW2U 8GCHF 1CHGA 2ZGXH 1C5TA 3H7OA 2AMQA 1Z1IA 4K1EA 1V2KT 1J16A 1PPZA 1C5SA 4RN6A 4ABAA 1ELDE 2XRCA 2BD2A 1P2IA 1EASA 1PPHE 2QC2A 3K2UA 2P59A 3PMHB 2H9HA 3Q3KA 4CR5A 4K2YA 2G5NA 3MNCA 1HAGE 4MPVA 2RG3A 8KME2 1BZXE 3PB1E 3RXBA 4HI3A 1QRWA 3MNXA 1DOJA 5TJXA 5FX6A 1RGQA 5LGOA 2QIQA 1IQFA 1HXFH 4KTSA 1ZGIA 1HAIH 3MO3A 1NTPA 1MTUA 1SVPA 1KXDA 4CR9A 3BIVH 1HJAC 1QQ4A 1GJ5H 2QXHA 1PQ5A 6ESTA 2VGCB 6CHAB 1A5GH 2BDBA 4Q7YA 3BTGE 2DE9A 2G55A 2AMDA 3RC6A 1SGQE 3SU6A 2AGEX 1BHXB 1C4U2 3A7XA 1W0YH 2GDEH 1WUNH 2HGTH 2VWOA 2J95A 2GD4B 4CRAA 1K1PA 1GBBA 1O3DA 1ZJDA 3QK1A 4NA8A 5ABWA 2OC1A 2ZIQH 1EB2A 2F9UA 1O31A 1YGCH 3U8OH 1OWDA 1MBQA 3R0FA 3O8CA 4MQAA 4O97A 1GHAG 1TGCA 1WCZA 3LJOA 1LVOA 1V3XA 1VCPA 1BBRE 1O36A 1WTHD 3ZZ7A 3KL6A 1AY6H 1ORFA 1P03A 1TYNA 1UMAH 2G52A 5C1UA 1LVMA 3A82A 2CV3A 4ZHLU 2P3FH 2Y81A 4NZQA 2FYQA 5C5OA 1GHZA 1UVSH 1HYLA 1TNIA 4U2WA 1V2JT 1G3CA 4ZXXH 1O2MA 2ZDLA 1Z71A 1K2I1 4TPIZ 2UUFB 3MNBA 2ZDVH 2WPHS 2F3CE 1THSH 2J92A 3SU1A 1D6WA 4IS5A 1V2OT 3SV9A 1FY8E 3MFJA 3SNDA 3SJOA 4IGDA 1N6XA 3CS0A 2BYAX 2J4IA 2VH6A 3SN8A 3SV6A 1HAOH 1JIRA 2GVFA 1YPKH 1HNEE 4GUXA 2BY9X 1SQOA 5JB8S 4CRFA 1AO5A 2PGBB 2LPRA 5C67A 1BDAA 3P95A 1S6FA 3BEFB 1CT2E 4AB8A 1KDQB 4WY3A 4MNWA 4ISOA 3KN2A 1P9SA 1J14A 2FX4A 1XUKA 4Q2KA 3TU7H 1XUHA 3D49H 1MTNB 4K8YA 3O8RA 2AEIH 1CBWB 1O2SA 2ZGJA 3RXEA 3GY6A 4XFQA 3HPTB 4Y8ZA 4AFZA 2FODA 1HAHH 4UFGH 1IQNA 4X2WA 1QBNA 1KXBA 3DHKH 1MZDA 3H5CB 4WH8A 1QQUA 3UQOA 5EXNA 1L4DA 2ZC9H 3AW0A 5GDSH 1O5FH 3F9FA 2W7UA 1C9PA 1GHBG 4GHTA 1ELTA 1OOKB 4R8TB 2ZFQH 3HK3B 4TWWA 1TNLA 1PPCE 3TPIZ 4WH6A 3Q3YA 1C1WH 4F49A 1GJ8B 2W3KA 1GI0A 4I32A 2HPPH 1EATA 3IG6B 1SGTA 1AB9C 3V3MA 2BOHB 2ZTZA 1P01A 2BY5X 3EYDA 1DE7H 1VITH 1SG8B 5EQSA 1TBQH 1QB1A 3ODFA 1NU7B 1WAYB 2WV5A 1Y3VA 3VB5A 3M5LA 1NFWA 1ABIH 1GI9B 3RXVA 1FAXA 1TMTH 5JBCS 2ZU5A 5FHTA 4K1TA 3PMAB 1HAXB 1INCA 2BX4A 1SLWB 1TONA 3TGKE 1C1VH 5E0GA 2ZO3H 1GG6B 4MPUA 2AH4X 3MTYA 1V2TT 3SJ8A 2XW9A 2KAIA 2Z9IA 2PUXB 1E37B 2FX6A 4WWYA 3L3TA 1NFYA 1O3MA 4PROA 1P9UA 3TNSA 1DWEH 1TE0A 1P3EA 3RXUA 3ZZ5A 1BRBE 4JZIA 3NZIA 1P10A 2AS9A 5T6GA 1TNGA 2B8OH 1ZHRA 2Z9LA 1LKBA 1L1JA 2JETB 3PO1C 2TBSA 1YLDA 1C2GA 1O2QA 7GCHF 1ETSH 1LCYA 2WUBA 3GCOA 2J38A 5GPIB 1EUFA 2AGIX 2WYJA 1C2LA 1TQ0B 1K1JA 1QA7A 1TAWA 1WSSH 5C1XA 1HAVA 5A8XA 1O5DH 1YPJH 2Z3EA 1CA0C 1GMDG 4D9QA 2FI4E 3QZQA 2CXVA 1BTWA 4XOJA 1S0RA 1UHBA 2VVCA 2A7HA 1AD8H 1SGCA 3E91A 4GCHF 5EQRA 3SHCH 1C1SA 3O8BA 4FU7A 1XUFA 3V0XA 1GI4A 1P2QA 1S81A 1BUIA 4U30A 1MQ5A 1V2MT 4A1XA 1L0ZA 1Z8JB 1BHXF 1WQVH 2QXJA 1DM4B 2THFB 3PROA 2QF0A 5A0AE 1VCWA 4AG1A 5JDUB 4YOJA 2BOKA 4UE7H 2CJIA 4BNRA 1O5CB 4ZKOU 1PYTD 5HMAA 3MO6A 3DT0H 1O0DH 1VITF 2Q6DA 4BAQB 4YTAA 3Q3XA 5C2ZA 2FM2A 3BTEE 1FZZA 1BCUH 5CHAB 4X8TH 1T4VH 4DVAU 3GCTG 4UD9H 5E0JA 1CO7E 1P3CA 5L6NH 4ABBA 4WMDA 1YPEH 4FVBA 3VPKA 1D3QB 4CBNA 4LZ1H 3UNQA 2ZHWH 1QJ6B 1GL1A 1TALA 1RJXB 1ESBA 3V13A 2PTCE 4Y0YE 2FOMB 2FOGA 8GCHG 5DP5A 5EODA 3CS7A 1GBAA 1KTTB 2EI6A 4RSPA 1MTSA 2C93B 3MU0A 3UWJH 4TY6A 3S7HB 4CHAC 3RXJA 1VCQA 1DSUA 4MPXA 1DUAA 1AVGH 2VIVA 1ETRH 2VWMA 1HCGA 1LQEA 1FY4A 5I46H 1JMOH 3HKJB 4IBLH 1SGEE 2R3UA 1NRQH 3ZYEA 1C2DA 5F03A 1LPZB 4ZHMU 1CGHA 2A4GA 1KLTA 2ALPA 2V35A 2XC0A 2Z9KA 4KTUA 1ANEA 3UOUA 4NGAH 1BTYA 1MCTA 4UEHH 3GOVB 3A7ZA 1O2HA 1Z7KA 1GWAA 1IAUA 1V2UT 2O9QA 1DT2A 1C2MA 1ZRKA 2STBE 4MNVA 4NA9H 2Y7ZA 3RXOA 1F5LA 2FS8A 1C4V2 1NT1A 3MWIU 1TRYA 1KY9A 1CHOF 2BQWB 2PKSB 3JZ1B 2C8WB 2HNTF 2FPZA 2QV1A 3UFAA 1H8IH 1V6DA 1AVXA 1WOFA 3BF6H 1TNJA 1LHCH 1P12E 3PTBA 3RXLA 2GTBA 3VGCC 5T6DA 1M9UA 1C5OH 2P8OC 5TCCA 1YCPK 3C1KA 1FY3A 3CP7A 1K21H 1CU1A 4Y7BA 1J9CH 2AFQB 4JCNA 2A1DB 2JH5D 1O2IA 3P70B 1H9IE 4X1QU 1O3GA 1B5GH 5GXPA 1LPKB 5SGAE 2ZQ1A 1PPGE 4OS6A 1NRPH 3ZZ3A 1AFEH 1P09A 2PTNA 6GCHF 1TQ7B 2IOTA 1E38B 2ZPSA 9ESTA 1HDTH 1D4PB 3KQCA 1HIAA 1E36B 2W3IA 5DP9A 2VINA 5EG4A 1FV9A 1EAWA 2VVUA 3PV4A 3DA9B 4OS1A 4UFFH 1IQIA 1XXDA 4AFQA 1CGIE 1AUTC 4ISHH 2PW8H 2BD3A 3FZZA 3ODDA 4JK5A 2TIOA 1O3CA 2OC8A 3LPRA 1N6YA 3ZV9A 2GV7A 3TITA 3FAOA 1GG6C 4E05H 4B71A 1FY5A 1C5VA 5B6OA 1V2LT 1XUJA 5DP3A 2ULLA 3MOCA 2OC0A 1IQMA 1BTHH 5JBAS 2H5CA 2W26A 2I6SA 3U69H 2J34A 2Q6FA 1C2FA 3D65E 1FDPA 4ZH8A 4YOGA 5DO4H 4D9RA 1FQ3A 4FUJA 1K22H 1BOQA 3QGNB 1AKSA 1QB6A 2XCNA 1UVTH 1ZHPA 4DURA 4GAWA 1OWJA 4GSOA 3A86A 5EW1H 3RXSA 1YYY1 3GY7A 1Y5UT 2F9PA 1FLEE 3UNRA 2OINA 1EP6A 4MG3A 1BTUA 2ZDAH 2ZFPH 4ABFA 2CHAC 3V12A 3RXGA 3EDXB 2BLQA 2UWOA 2ZPRA 4KTCA 1YPHE 1WBGB 1O5EH 1ZSJA 2VNTA 2GMTC 3F6UH 1GCTC 2P3TB 3MU5A 1S82A 2PKAA 2BD9A 3FFGA 4ZKNU 1AE8H 1GHVH 1GBKA 4VGCC 5EPYA 1N8OC 5LPRA 4UONA 1TBZH 2ZP0H 4ABDA 1VJ9U 4X1PU 2XC5A 1ANBA 1YPGH 1C2EA 1LQDB 2HVXA 2RDLA 1XKBC 2Y5FA 3S9AA 1NO9H 1H1BA 1G2LA 2AIQA 1L2EA 1RD3B 2P95A 4A1VA 1OXGA 3MH6A 1HAYB 1GI6A 4LZ4B 3A7WA 3TGJE 3SGQE 3W95A 1TFXA 3EA8A 2AERH 1HXEH 4IC5A 1E34B 1NESE 2OQ5A 3A7TA 4JZEH 4UFEH 1W11U 1SQAA 1FJSA 1MTVA 5H4IB 3BG8A 1SC8U 4NIYA 1OWIA 3T29A 1A5HA 2O8MA 1DWCH 4B1TA 1FPCH 3SU0A 2F9NA 1MKXK 3GCHC 1T8OA 3RP2A 2HNTE 3RXRA 3B23B 2A7CA 2CMYA 3AAVA 4YZUA 1A2CH 1DVAH 2C8XB 1BTZA 2WYGA 4OS2A 1LVBA 2QXIA 3NWUA 1D3TB 1GI8B 4INLA 1GBMA 1DSTA 1WTGH 4BXSA 1SGFG 1C5YB 3BEIB 5GCHF 1ZMJA 2FLBH 2VJ1A 1EB1H 3ZZ4A 3ZZCA 1AZ8A 1K1LA 1EZQA 1OWHA 3BG4C 3V7TA 3SBKA 3NXPA 2ZWLH 1P2OA 5JPMH 1GHYH 4NWKA 2VU8E 2PSYA 3RXFA 3C27B 1ESTA 3E6PH 1C1MA 1FAKH 2B5TB 2ZTYA 2A45B 1HRTH 1C1RA 1LVYA 5FPSA 1XMNB 1QURH 2PGQB 2OCVB 5C20A 1O33A 1HUTH 3S7KB 1DX5M 1HBTH 1P0SH 1LDTT 2NU0E 4INKA 1YBWA 1C5RA 5FBIA 4NWLA 2GCTB 3L33A 1RS0A 1T32A 2BB4A 1PPEE 2ZDMA 4K3JA 1UK3A 3A87A 5I25A 1VITG 1HLTH 1QGFA 3ZVCA 4CRDA 1EJMA 2ANMH 5GIBA 2XWBI 2ZNKH 4GLYA 5HYOA 1ARBA 1GBTA 1P2KA 4BANB 2ZI2H 1D3PB 1KTSB 1SL3A 4D7GA 2FESH 1ZPBA 3A88A 2OLGA 2FEQH 1PQ8A 1YCPH 2J94A 2A4QA 2XBWA 3SGAE 1A1RA 2KAIB 3UQVA 1HJ9A 1CGJE 4XBDA 3LGVA 3MH4A 1O3IA 1EZUC 1H4WA 3BTHE 1W2KH 2H9EH 3M61U 3HGNA 4NZLA 2NWNA 1C5ZB 4X6NA 2AIPA 3GDVA 1EPTC 2UWPA 2A4OA 2BVRH 1O3OA 2ANKH 1L4ZA 1GI5A 2CF8H 3JZ2B 1ZTJA 2ODPA 2D8WA 4X0WU 1TLDA 2R0KA 2GCHG 3M5NA 1OYQA 1P8VC 1UVPA 1G2MA 1NY22 2G4TA 3E8LA 3M37A 2FTMA 1OPHB 1HAVB 2BD4A 1NZQH 3RM2H 1O2ZA 3AW1A 3PWBA 1KXAA 3T2NA 4I31A 3MU4A 4TY7A 1UHBB 2LNCA 2ZHFH 3RMMH 1K28D 1YPMH 3T26A 3P8OA 4CREA 4DIIH 1HPGA 2B9LA 5A8ZA 1JWTA 1ZMNA 7KMEH 1QCPA 1SGPE 2TGAA 1LO6A 4H4FA 4AX9H 3KHVA 4X2XA 1XX9A 3NK8A 2WPMS 1YM0A 2FI3E 2STAE 1QL8A 1KXFA 5DP8A 1JRSA 2FOEA 5DGJA 1DITH 2V3HH 4KGAA 3QX5H 1QRXA 1O2KA 2ZU1A 4WF8A 1FI8A 3FP8E 1UTOA 1Y3XA 2HLCA 1ZTLA 3T25A 1YPLH 3TNTA 1JBUH 1FONA 4Y7AA 2NU1E 4Y8XA 6GCHG 1UVUH 2ZCKP 4JZDH 1RIWB 2JKHA 2RCEA 3PTNA 4FUCA 4Q7XA 3SUFA 5DP4A 1BJVA 3M3VA 4CRGA 2Z6BD 1DWDH 3UUZA 1ZSKA 2J2UA 3P6ZB 1IHTH 1P2MA 2Y82A 5F8XA 2BY7X 2CGAA 3KQEA 3SV7A 4H6TA 2YNBA 1EAUA 3RXPA 2F83A 2BDIA 1TOCB 2A2QH 3WY8A 2Y6TA 1VZQH 3ZZDA 4E7RG 2F91A 2HWLB 4B73A 1GMHG 4X6MA 5C5NA 5DP6A 3OYPA 1U6QA 1DANH 1FXYA 5C1YA 1UCYK 2PFEA 3UR6A 2BDAA 1V2RT 2ZF0H 4K5ZA 4WXVA 3TH2H 1LHEH 1G30B 3I29A 2BZ6H 2ZECA 1W8BH 2AYWA 2ZCHP 3RLWH 2F9VA 4X8UH 1O3LA 4JK6A 5J4SA 1TPOA 1PPBH 4AB9A 4J1YA 2OP9A 4ZKRU 1BITA 3OX7U 4AORA 3RXTA 2FO9A 3HATH 4B75A 4F4OC 1KXEA 3S0NA 4OS4A 3BTWE 1FMGA 2QGRA 1GI3A 1BB0B 1KLJH 1K1IA 4ZROA 3FP6E 2ZTXA 4E7NA 3A83A 3SORA 1O37A 2C8YB 2VGCC 3ITIA 3ZVGA 4WMEA 6CHAC 1GBHA 4MNXA 4DY7B 3OY6U 2Y7XA 3U1IB 2ZFSA 1GGDB 1HGTH 2ZU3A 4RKOB 5JBTA 1SBWA 2WUCA 2WV4A 1AWHB 4UFDH 4LOYH 4A5TS 1L1GA 2A7JA 1ANCA 1HIAB 1QRZA 2EI8A 5FX5A 3ZVEA 5AHGH 5HXFA 1C5LH 2NU2E 5HM9A 4BTUB 3UPEA 1K9OE 3SV2H 1SOZA 1YPHC 3ZVDA 1OX1A 1ZGVA 1O2PA 2B0FA 5A8YA 3S9CA 5ESBA 2QF3A 1S0QA 1MZAA 2G5VA 3GICB 1DUEA 1BT7A 2ZU4A 5BRRE 1AN1E 1GBFA 4NIVA 7LPRA 1XKAC 2FDAA 2ZA5A 3PMBB 1OYTH 4NFFA 2HPQH 3SI4H 3RXQA 1Z8IB 1CA8B 3D62A 2WINI 1S6HA 2ZPQA 3LONA 1AWFH 4I8KA 1MD7A 3ZZ9A 4H42U 1TBRH 1BTXA 4WXIA 5EGMA 1GVKB 2ZDNA 2XBXA 3GYLB 1OSSA 3OY5U 1D3DB 1B0FA 1IHSH 2ZHDA 4DIHH 3MNSA 3PLKA 1FIZA 1P57B 2TGDA 3ENSB 3LOXA 1C1QA 3RXMA 2R9PA 1Y3YA 2XWAA 1AKSB 3R3GB 5EW2H 1MAXA 5AFYH 2F9BH 2Z9JA 2ZU2A 4MNYA 3DFJA 1C2HA 4JZ1A 1GHAF 2PSXA 3VB6A 3LC5A 4OS5A 4QT8C 3UY9A 4TYDA 1XXFA 1NS3A 1O5GH 1ELFA 2I6QA 1F7ZA 3LH1A 4Z6AH 3BTDE 1RRKA 1XVMA 1TRNA 5FBEA 2ZFTA 2SNWA 4DCDA 4NFEA 1ID5H 2HNTC 2ZGBH 3H7TA 1VGCB 2VWLA 1AFQB 2A32A 1W0ZU 1BA8B 3TVJB 5G4BA 2PKAB 2DUCA 1BRUP 2C4FH 2VIQA 4NG9H 5C3NA 1VR1H 2PUQH 3D23A 5FCRA 3ATIA 1MTNC 3SUEA 1CBWC 2UUYA 1MTWA 1MH0A 1O3NA 2GP9B 1DLKB 2VIWA 3RU4D 1J8AA 1GJ7B 1SGDE 3ZZBA 4DGJA 2RA3A 1O3FA 2FMJA 3W94A 1SI5H 1VJAU 2GX4A 3KIDU 3Q00A 5JB9S 1TX6A 2VIPA 1LMWB 6LPRA 3UNSA 5FAHA 1YCPM 3TH3H 5K0HA 1W7XH 4B2BA 1AHTH 1QL9A 3E90B 1GI2A 3TK5A 1ZPZA 1ACBE 1EZXC 3EAJA 2H1UA 5TCAA 1V2WT 3SNCA 2UUKB 1PJPA 1HB0B 4Y6DA 2AMPA 4AZ2B 2YNAA 3Q77A 4E06H 2C8ZB 1QL7A 3ZZ8A 3PWCA 3FZDA 1F0SA 2BVXH 3A8CA 2BX3A 3EGKH 1HJAB 3ESTA 3AASA 3ELAH 1S85A 1GL0E 2D2DA 4TPYA 3RDZA 2PR3A 4X6OA 1TX8A 3M7TA 2VB0A 4R0IA 2M5TA 1MU8B 1GJCB 1NU9A 1W3CA 1NRSH 4X8SH 1GHBF 3E16B 1C2JA 4A92A 1ARCA 4B2CA 2V6NA 2Z7FE 2V0BA 1EZSC 3ZVBA 1SPJA 1V2QT 3LKWA 4IN1A 4YLUA 3LU9B 2O8WA 3I77A 4D76A 1UTLM 4NIWA 3KQBA 2IPHA 2SFAA 2SGFE 1C1TA 3EA7A 5EOKA 3URDA 1IQLA 1MMJN 1O2JA 3LGTA 1TA6A 1ZPCA 2BQ7B 3TK6A 1UCYH 2JETC 4K60A 4M7GA 3T62A 2GDDA 1SFIA 3K9XB 2FLRH 3A8DA 1C4Y2 1O32A 4CRCA 1CVWH 3RXCA 2FZZA 3FANA 1DS2E 2GGVB 4RKJB 1O2XA 5A09A 1GBCA 1DWBH 2BDYA 4FUIA 1MQ6A 1YF4A 1PYTC 3LDXH 1T8LA 2Y5GA 1LHDH
chains in the Genus database with same CATH superfamily
2VWNA 3QTOH 5EJLA 1F0UA 3SUDA 1UO6A 3STIA 3LIWA 5KGOA 2Z3DA 3UAIC 2Q6GA 3HGPA 4A7IB 4FUBA 4U01A 2EQNA 3LT3A 3KQDA 2WPKS 1BTPA 2UUJB 1W14U 4ISIH 1DICA 1GJ4H 3F9HA 1COWD 4I8JA 4I8GA 3TJUA 1OP0A 3U1JB 2C90B 2SNVA 4JYUH 4HFPB 2ZCLP 1LHFH 1DXWA 1Y59T 3RMOH 5HGGA 1D6RA 1DPOA 3AVZA 4ISLA 3GY4A 3OTJE 2QXGA 2ZGCA 2TRMA 3BV9B 1JXPA 1NN6A 1O2NA 3DFLA 3PM3A 5CHAC 3SQEE 4AFUA 1K1MA 4OGYA 1V2NT 1O3HA 4Y11E 1KIGH 1GMDF 3SW2B 2XXLA 5A0CA 1AI8H 1E35B 2G81E 2G51A 1O2WA 3IITA 4OGXA 1AU8A 5BPEA 4XDEA 1TIOA 2AGGX 1ZTKA 3F9GA 3KEEA 1O3EA 3SZEA 1QBOA 4Y79A 3TGIE 4B76A 2KM0A 2W7SA 2A5KA 3A80A 4XD7D 3VXFH 2PWXA 3P92A 3FOAA 3LGWA 4KP0A 1HAPH 2V3MA 1W10U 3EQ0H 1A0HB 1O3AA 3KYGA 1H8DH 4DG4A 1OP2A 2D1JA 1F0RA 2BVSH 2R2WU 1DY8A 2IN2A 1Y3WA 1KLIH 2LP6A 1AB9B 3SHAH 3GCTF 2ESTE 2RDEA 4I33A 4ISNA 1ELBA 2VVVA 2BY6X 5DG6A 1HJ8A 1W0JD 1TPAE 2PLXA 2BXTH 1GHXH 1LPGB 3BN9A 4Y0ZE 1GJAB 1GCDA 2KFWA 5IDKA 2TGTA 7GCHG 1P11E 1UTJA 1G3BA 1XM1A 2XYAA 2PKSC 2GV6A 1AVWA 2R0LA 1G9IE 4X6PA 2EC9H 5AVDA 1C2IA 1WYKA 2A31A 1FY1A 1GBLA 1GI1A 4BTTB 2XBYA 1CT4E 4ZCNA 1SQRA 4INHA 2TPIZ 1IQHA 2IJD1 5K7RA 4YT7H 2QA9E 1A3BH 3E0PB 3F9EA 1WQSA 3ATWA 4GCHG 1MCVA 3HK6B 4NSVA 1DY9A 1J15A 5HKKD 5ETXA 1Y5AT 1B0EA 4SGBE 1NBMD 1Y3UA 2BTCE 3BTTE 1LHGH 1EPTA 1NM6A 2GT7A 5DKMA 3UREA 4Y8YA 2GZ9A 1TNHA 4Y10E 1EP5A 4BOHA 4FXGH 3PO1B 4AYYB 2GT8A 1OWEA 3A85A 3SU4A 1O34A 2P3UB 1EJNA 1YC0A 3DD2H 2H2ZA 4FUEA 1EJAA 1ZRBA 3RC5A 3DSOA 2ILNA 3PYHA 3GDUA 3KF2A 3B9FH 3SO3A 1C1OA 1CA0B 3KGPA 2J9NA 1WU1A 3NPSA 1UTQA 1EXFA 1TGBA 3FKSD 2ALVA 3MH7A 1P04A 2EEKA 2YOLA 2QYIA 2FIRH 5HM2A 1GJBB 1MAYA 3SOSA 1AUJA 3QO6A 4IC6A 3FP7E 2ZDKA 1O3KA 2P93A 3M3SA 3TLOA 1BMAA 3QUMP 1O35A 2FXRA 3SJKA 1AZZA 2BLOA 1GJ6A 1NC6A 3SU5A 4BAOB 2R2MB 3QLPH 3U8RH 1C5PA 1HAZB 1P02A 4K69A 1Q3XA 2RFKC 5JBBS 3SZNA 1CQQA 1J17T 4NA7A 2ODYB 1UK4A 3A7VA 1S84A 4ESTE 1Z6JH 1O2UA 1BBRK 4ABEA 3F0PA 2BD7A 1GBJA 3M3TA 2YMSB 3SNAA 4CH2B 2A2XH 4ZAEA 4KELA 4WMFA 3UIRA 2A5IA 1O5BB 2ASUB 4WVPE 1V2ST 2TGPZ 2QY0B 3N7EA 3NUMA 3SUGA 4B74A 4I8HA 4P00A 1A46H 1CSOE 2BMGB 2QAAA 4IN2A 1SHHB 5EU8A 3K65B 2OBOA 2ANWA 3MYWA 5T3HA 1F0TA 8LPRA 1CHOG 1C5NH 3DUXH 1A3EH 4Q80A 2SGAA 5E2OA 5DPAA 4M9FA 1SQTA 4CHAB 1A61H 3ZV8A 2YMSD 2ZEBA 2BD8A 2JH0D 1SSXA 1TB6H 1AGJA 4AGJA 1QHRB 3A81A 5F8ZA 2PP6A 1QBVH 3LC3A 3ATLA 3BTKE 2KZ4A 1EKBB 1GDUA 2PHBA 1O3PB 2OQUA 1MBMA 1EX3A 1TX7A 3F2FA 3GY2A 4FUDA 1EAXA 2EA3A 2CF9H 1Q2WA 1SGRE 2CN0H 3OEHD 5AF9H 3M36A 4BAMB 1YWUA 1PPFE 4FVDA 1Q31A 3OE7D 2D26C 2BXUH 1C9TA 1SGIB 2ZKSA 4J2YB 3QGJA 1QTFA 7ESTE 2FS9A 1SGFA 1TRMA 1W7GH 4MPWA 4X1NU 5LPEA 1THPB 1C2KA 1TMUH 5ESTE 1GHWH 3BTME 3M7QA 1QR3E 1YKTA 4AG2A 1UCYE 3A89A 1SB1H 1P2JA 1CE5A 1O2GH 1F2SE 2XNIA 3GY8A 3VGCB 2Z94A 1SGNE 3E1XB 1EOLA 5F8TA 1F5RA 4Y71A 1ETTH 3FO8D 2P8OB 1NFUA 1OP8A 4ABIA 1TPSA 3RU4E 1O3JA 1Y5BT 3T5FH 1BIOA 4ACBA 2NU3E 3LGIA 1GI7B 4SGAE 4XE4A 3LJJA 3QZRA 3SNBA 1FUJA 2FOFA 5A0BA 1QZ8A 2BM2A 4DJZB 4X8VH 4OS7A 1TGTA 3A8BA 2BD5A 2FTLE 1AMHA 3QTVH 2A4RA 1ZR0A 1GPZA 2OD3B 4HG6A 4ABHA 2FI5E 4MTBA 1BMMH 2FWWA 4HZHA 5FCKA 3MMGA 1GJDB 1GMCF 2XBVA 3RLYH 3W1EA 3B8JA 1NRNH 4D8NA 4MVNA 3SV8A 2ZGHA 4ABGA 3H09A 3K6YA 1AIXH 4BAHB 4YO9A 3SJIA 3O8DA 3VFEA 5L2YH 4O3UA 2JIZD 1SFQB 5CE1A 1TPPA 1BMLA 1QNJA 2K1QA 3P8GA 5PTPA 4O03A 4BAKB 5L2ZH 1GBEA 1MKXH 1KXCA 2HLDD 3VB7A 3RMNH 1QJ1B 1G36A 2XCFA 2ZFRH 4AOQA 1TMBH 1O2YA 4JYTA 1MKWK 2ZG0H 4NSYA 3OFND 1A5IA 5DP7A 4GPGA 4ZUHA 3F1SB 2GCTC 1MUEB 3MH5A 1DXPA 1PQ7A 1JOUB 5EPNA 1GBDA 1ABJH 2NU4E 2SGEE 2ZQ2A 2J98B 1ZMLA 3T27A 4BXWA 4JYVH 4WJG2 4CRBA 1T31A 4FU8A 5JYIA 1ZSLA 2GZ8A 1QFKH 3P17H 1GVLA 1KMHB 3F68H 2EI7A 2CHAB 2O8LA 3ZVAA 5GNDA 3GY3A 3NCLA 1TABE 3ZYDA 1KDQA 3SYJA 2DE8A 4U32A 1YLCA 1C5XB 1ESAA 1GVZA 5HIZA 4DOQA 1F5KU 3GYMA 1IQGA 2C3SA 2GMTB 1GCTB 2P16A 2FOAA 3TJOA 1A7SA 4FU9A 5F6MA 2V3OH 1C5WB 4FUHA 5E0HA 1ELVA 1H9HE 5LPFA 1S5SA 4AN7A 3K6ZA 2OXSA 1C1PA 3TH4H 1RTFB 5GJ4B 1L1NA 1O30A 2ODQA 4VGCB 2RA0A 2W5EA 1N8OB 5DK1A 3BSQA 1AQ7A 1DFPA 3RXDA 3N99A 1N1LA 1TGNA 1A0LA 4MLFB 1SHYA 2FP7B 1TOMH 2HALA 1C1NA 1WV7H 4XSKU 1BRAA 4HTCH 3QWCH 1B7XB 2SGQE 2WHXA 2BLVA 1OS8A 4CH8B 3I78A 2FYRA 3RXIA 1IQKA 4O9VA 3N7OA 1XUIA 2H6MA 4X2VA 3RMLH 1MU6B 3A84A 5FXLA 5GCHG 3BTQE 1PQAA 4GVUA 3ZZ6A 3RXHA 1A0JA 2BZAA 1GBIA 1TA2A 2QCYA 3BTFE 4JMYA 1P06A 5E2PA 4HGCA 4YT6H 5A2MH 4X1RU 1V2VT 1UJ1A 1TWXB 1C5MD 3KCGH 1IQEA 2WPJS 3M5OA 1ZZZA 4BTIB 5HIYA 1JIMA 1UTMA 4MDSA 1O2LA 4ZXYH 1O2RA 1O39A 1ZJKA 2GCHF 2WPDD 1BBRH 1XUGA 3STJA 1GDQA 1CT0E 1T7CA 1Z8RA 2OC7A 3GCHB 3S69A 1F92A 1HFDA 5FPTA 2ZHQH 4IMZA 2SGPE 4NIXA 1EOJA 2GKVE 3M5MA 1SR5C 3IWMA 4ZHAA 2AHME 3U8TH 2W6JD 1RIWC 3L6PA 1QIXB 3MU1A 3UTUH 4FUFA 2BDHA 1SGYE 1UTNA 2H5DA 2WPIS 3SGBE 1O2VA 4A6LA 3ZVFA 2O8UA 3SU3A 2XTTB 3G01A 3P8NA 2FOHA 3U9AH 3BG4B 1ZYOA 2IJOB 1GDNA 3CENA 9LPRA 2BDGA 1D9IA 1ZOMA 2Z3CA 3SNEA 4H6SB 8ESTE 4LK4A 5AFZH 3NKKA 4LXBH 3HKIB 3UR9A 1QJ7B 1XVOA 3TK9A 1ELGA 1A4WH 1RTLA 2H9TH 1MD8A 1W12U 3U98H 4P02A 1BQYA 1EQ9A 1G3EA 2FOBA 1YP9A 2ANYA 2O8TA 4IMQA 3VB3A 1THRH 1BMNH 4X1SU 1C1UH 2VIDA 3Q76A 4Y76A 3PLPA 2BHGA 2BQ6B 5LH8A 3URCA 1C5QA 4YESB 3UOPA 4DT7B 5GWZA 5E8EH 2A5AA 3A7YA 4D7FA 3M35A 1TNKA 4A1TA 1QY6A 3ZZAA 1W13U 1H9LB 1FN6A 2Y80A 1Y8TA 3S9BA 3RXKA 3ATKA 1NBME 1NFXA 2VIOA 2ZFFH 1KSNA 3TIUA 3VB4A 3LGYA 5DJ7A 3RXAA 1UK2A 1KYNA 4ASUD 2BDCA 3KNXA 3VXEH 1GMHF 1O2TA 1NPMA 4AYVB 3SU2A 3M7UA 2G4UA 4AGKA 3MHWU 3OTPA 1ELCA 3EA9A 3GISB 2SGDE 4K1SA 5EQQA 1K1OA 1EAIA 1SLXB 2GZ7A 1FPHH 1RXPA 4XBCA 1EPTB 1ELEE 1GGDC 1QB9A 1P05A 4UDWH 4ABJA 1V2PT 5FPYA 5EXLA 1G37A 1RFNA 2HRVA 4YM9A 4AFSA 1SMFE 1E0FD 1FN8A 1OKXA 4I8LA 1LTOA 2Q1JA 2BLWA 4KKDA 1ZHMA 3T28A 1ANDA 1BRCE 2OUAA 3SQHE 2KCYA 2UWLA 3GY5A 2F43B 1S83A 2KCOA 4XBBA 5CMXH 2PV9B 1Z8GA 3EE0B 3VG8A 4THNH 1TGSZ 3MI4A 3GDSA 4Q7ZA 1FIWA 1UVOA 2OTVA 3RUOA 5L30H 2BY8X 1G32B 2G8TA 1AE5A 4YOIA 3EE7A 3PLBA 1O2OA 2Z9GA 1OWKA 3A8AA 3OU0A 3E0NB 1HV7A 3QN7A 2FOCA 2JDID 2HOBA 3BEUA 1DDJA 1FNIA 4ASHA 5T6FA 1MKWH 1PFXC 5C0TA 1QA0A 3OSYA 1SLVB 3ATMA 1O3BA 3DCLA 3E3TA 2OBQA 3AAUA 1SOTA 5EXMA 1IQJA 3BIUH 1G3DA 2QN5T 1JRTA 1P2NA 1Z6EA 3PMJA 4K8BA 1UTKA 3MO9A 2B7DH 1DLEA 1O38A 1UTPA 3TJNA 3QDZB 3N7DA 1IOEA 2VH0A 4NCYA 1T4UH 4TWYA 3GCNA 3UWIA 5J4QA 1K1NA 1NRRH 3MU8A 3RU4T 2ZZUH 4ZMAH 3P8FA 1SLUB 2WPLS 4JZFH 3SJ9A 4B2AA 4FUGA 1O5AB 2L74A 1ELAA 3VEQB 4Z1MD 1C5UA 1LKAA 2LELA 5IYTA 1RTKA 2XOKD 1ZLRA 1T8NA 3ZIAD 4YLQH 4CBOA 5DN6D 1GJ9B 1T8MA 2R3YA 1GMCG 2XC4A 4Z0KA 1VGCC 3SI3H 3LH3A 1AFQC 1Z1JA 4GHQA 3LGUA 3FVFB 4O3TA 4Q63A 2F9OA 2KCPA 4X2YA 4I7YH 2Y5HA 2G00A 3RC4A 2P94A 1BJUA 1X7AC 2ZHEH 1NROH 4ZKSU 3TJVA 4Q4LA 4IW4E 2A0QB 2JH6D 3RM0H 4DW2U 8GCHF 1CHGA 2ZGXH 1C5TA 1UW7A 4B6EA 3H7OA 2AMQA 1Z1IA 4K1EA 4TSFD 1V2KT 1J16A 1PPZA 1C5SA 4RN6A 4ABAA 1ELDE 2XRCA 2BD2A 1P2IA 1EASA 1PPHE 2QC2A 3K2UA 2P59A 3PMHB 2H9HA 3Q3KA 4CR5A 4K2YA 2G5NA 3MNCA 1HAGE 4MPVA 2RG3A 8KME2 1BZXE 3PB1E 3RXBA 4HI3A 1QRWA 3MNXA 1DOJA 5TJXA 5FX6A 1RGQA 5LGOA 2QIQA 1IQFA 5F53A 1HXFH 4KTSA 4B6FA 1ZGIA 1HAIH 3MO3A 1NTPA 1MTUA 1SVPA 1KXDA 4CR9A 3BIVH 1HJAC 1QQ4A 1GJ5H 2QXHA 1PQ5A 2OK5A 6ESTA 2VGCB 6CHAB 1A5GH 2BDBA 4Q7YA 3BTGE 2DE9A 2G55A 4ACAA 2AMDA 3RC6A 1SGQE 3SU6A 2AGEX 1BHXB 1C4U2 3A7XA 1W0YH 2GDEH 1WUNH 2HGTH 2VWOA 1WDIA 2J95A 1WXRA 2GD4B 4CRAA 1K1PA 1GBBA 1O3DA 1ZJDA 3QK1A 4NA8A 5ABWA 5B6LA 2OC1A 2ZIQH 1EB2A 2F9UA 1O31A 1YGCH 3U8OH 1OWDA 1MBQA 3R0FA 3O8CA 4MQAA 4O97A 1GHAG 1TGCA 1WCZA 3LJOA 1LVOA 1V3XA 1VCPA 1BBRE 1O36A 1WTHD 3ZZ7A 3KL6A 1AY6H 1ORFA 1P03A 1TYNA 1UMAH 2G52A 5C1UA 1LVMA 3A82A 2CV3A 4ZHLU 2P3FH 2Y81A 4NZQA 2FYQA 5C5OA 1GHZA 1UVSH 1HYLA 1TNIA 4U2WA 3WW7A 1V2JT 1G3CA 4ZXXH 1O2MA 2ZDLA 1Z71A 1K2I1 4TPIZ 2UUFB 3MNBA 2ZDVH 2WPHS 2F3CE 1THSH 2J92A 3SU1A 1D6WA 4IS5A 1V2OT 3SV9A 1FY8E 3MFJA 3SNDA 3SJOA 4IGDA 1N6XA 3CS0A 2BYAX 2J4IA 2VH6A 3SN8A 3SV6A 1HAOH 1JIRA 2GVFA 1YPKH 1HNEE 4GUXA 2BY9X 1SQOA 5JB8S 4CRFA 1AO5A 2PGBB 3PRBA 2LPRA 5C67A 1BDAA 3P95A 1S6FA 2JJ1D 3BEFB 1CT2E 4AB8A 1KDQB 4WY3A 4MNWA 4ISOA 3KN2A 1P9SA 1J14A 2FX4A 1XUKA 4Q2KA 3TU7H 1XUHA 3D49H 1MTNB 4K8YA 3O8RA 2AEIH 1CBWB 1O2SA 2ZGJA 3RXEA 3GY6A 4XFQA 3HPTB 4Y8ZA 4AFZA 2FODA 3OAAD 1HAHH 4UFGH 1IQNA 4X2WA 1QBNA 1KXBA 3DHKH 1MZDA 3H5CB 4RT0A 4WH8A 1QQUA 3UQOA 5EXNA 1L4DA 2ZC9H 3AW0A 5GDSH 1O5FH 3F9FA 2W7UA 1C9PA 1GHBG 4GHTA 1ELTA 1OOKB 4R8TB 2ZFQH 3HK3B 4TWWA 1TNLA 1PPCE 3WWBA 3TPIZ 4WH6A 3Q3YA 1C1WH 4F49A 1GJ8B 3PRDA 2W3KA 1GI0A 4I32A 3F2HA 2HPPH 1EATA 3IG6B 1SGTA 1AB9C 3V3MA 2BOHB 2ZTZA 1P01A 2BY5X 3EYDA 5T1VA 4DT4A 1DE7H 1VITH 1SG8B 5EQSA 1TBQH 1QB1A 3ODFA 1NU7B 1WAYB 2WV5A 1Y3VA 3VB5A 3M5LA 1NFWA 1ABIH 1GI9B 3RXVA 1FAXA 1TMTH 5JBCS 2ZU5A 5FHTA 4K1TA 3PMAB 1HAXB 3KQ5A 1INCA 3NRLA 2BX4A 1SLWB 1TONA 3TGKE 1C1VH 5E0GA 2ZO3H 1GG6B 3F3BA 4MPUA 2AH4X 3MTYA 1V2TT 3SJ8A 2XW9A 2KAIA 2Z9IA 2PUXB 1E37B 2FX6A 4WWYA 3L3TA 1NFYA 1O3MA 4PROA 1P9UA 3TNSA 1DWEH 1TE0A 1P3EA 3RXUA 3ZZ5A 1BRBE 4JZIA 3NZIA 1P10A 2AS9A 3GS9A 5T6GA 1TNGA 2B8OH 1ZHRA 2Z9LA 1LKBA 1L1JA 2JETB 5EJ1A 3PO1C 2TBSA 1YLDA 1C2GA 1O2QA 7GCHF 1ETSH 1LCYA 2WUBA 3GCOA 2J38A 5GPIB 1EUFA 1E79D 2AGIX 2WYJA 1C2LA 1TQ0B 1K1JA 1QA7A 1TAWA 1WSSH 5C1XA 1HAVA 5A8XA 1O5DH 1YPJH 2Z3EA 1CA0C 1GMDG 4D9QA 2FI4E 3QZQA 2CXVA 1BTWA 4XOJA 1S0RA 1UHBA 2VVCA 2A7HA 1AD8H 1SGCA 3E91A 4GCHF 5EQRA 3SHCH 1C1SA 3O8BA 4FU7A 1XUFA 3V0XA 1FX0B 1GI4A 1P2QA 1S81A 1BUIA 4U30A 1MQ5A 1V2MT 4A1XA 1L0ZA 1Z8JB 1BHXF 1WQVH 2QXJA 1DM4B 2THFB 3PROA 2QF0A 5A0AE 1VCWA 4AG1A 5JDUB 4YOJA 2BOKA 4UE7H 3OEED 2CJIA 4BNRA 1O5CB 4ZKOU 1PYTD 5HMAA 3MO6A 3DT0H 1O0DH 1VITF 2Q6DA 4BAQB 4YTAA 3Q3XA 5C2ZA 2FM2A 3BTEE 1FZZA 1BCUH 2YMSC 5CHAB 4X8TH 1E1RD 1T4VH 4DVAU 3GCTG 4UD9H 5E0JA 1CO7E 1P3CA 5L6NH 4ABBA 4WMDA 1YPEH 4FVBA 3VPKA 1D3QB 4CBNA 4LZ1H 3UNQA 2ZHWH 1QJ6B 1GL1A 1TALA 1RJXB 1ESBA 5C94A 3V13A 2PTCE 4Y0YE 2FOMB 2FOGA 1EFRD 5DP5A 8GCHG 3WWFA 5EODA 3CS7A 1GBAA 1KTTB 2EI6A 4RSPA 1MTSA 2C93B 3MU0A 4YXWD 3UWJH 4TY6A 3S7HB 4CHAC 3RXJA 1VCQA 1DSUA 4MPXA 1DUAA 1AVGH 2VIVA 1ETRH 2VWMA 1HCGA 1LQEA 1FY4A 5I46H 1JMOH 3HKJB 4IBLH 1SGEE 2R3UA 1NRQH 3ZYEA 1C2DA 5F03A 2VBCA 2V7QD 1LPZB 4ZHMU 1CGHA 5CDFE 2A4GA 1KLTA 2ALPA 2V35A 2XC0A 2Z9KA 4KTUA 1ANEA 3UOUA 4NGAH 1BTYA 1MCTA 4UEHH 3GOVB 3A7ZA 1O2HA 1Z7KA 1GWAA 1IAUA 1V2UT 2O9QA 1DT2A 1C2MA 1ZRKA 2STBE 4MNVA 4NA9H 2Y7ZA 3RXOA 1F5LA 2FS8A 1C4V2 1NT1A 3MWIU 1TRYA 1KY9A 1CHOF 2BQWB 2PKSB 3JZ1B 2C8WB 2HNTF 2FPZA 2QV1A 3UFAA 1H8IH 1V6DA 1AVXA 1WOFA 3BF6H 1TNJA 1LHCH 1P12E 3PTBA 3RXLA 2GTBA 3VGCC 2F4LA 1M9UA 5T6DA 4FETA 1C5OH 2P8OC 3F2GA 5TCCA 1YCPK 3AK5A 3C1KA 1FY3A 3CP7A 1K21H 1CU1A 4Y7BA 1J9CH 2AFQB 4JCNA 2A1DB 2JH5D 1O2IA 3P70B 1H9IE 4X1QU 1O3GA 1B5GH 5GXPA 1BMFD 1LPKB 5SGAE 2ZQ1A 1PPGE 4OS6A 1NRPH 3ZZ3A 1AFEH 1P09A 2PTNA 6GCHF 1TQ7B 2IOTA 1E38B 1YLNA 2ZPSA 9ESTA 1HDTH 1D4PB 3KQCA 2M2AA 1HIAA 1E36B 2W3IA 5DP9A 2VINA 5EG4A 1FV9A 1EAWA 2W6ID 2VVUA 3PV4A 3DA9B 1OHHD 4OS1A 4UFFH 1IQIA 1XXDA 4AFQA 1CGIE 1AUTC 1VKYA 4ISHH 2PW8H 2BD3A 3FZZA 3ODDA 4JK5A 2TIOA 1O3CA 2OC8A 3LPRA 1N6YA 3ZV9A 2GV7A 3TITA 3FAOA 2WV9A 1GG6C 4E05H 4B71A 1FY5A 1C5VA 5B6OA 1V2LT 1XUJA 5DP3A 2ULLA 3MOCA 2OC0A 1IQMA 1BTHH 5JBAS 2H5CA 1YY3A 2W26A 4F48B 2I6SA 3U69H 2J34A 2Q6FA 1C2FA 3D65E 1FDPA 4ZH8A 4YOGA 5DO4H 5C0UA 4D9RA 1FQ3A 4FUJA 1K22H 1BOQA 3QGNB 1AKSA 1QB6A 5C17A 2XCNA 1UVTH 1ZHPA 4DURA 4GAWA 1OWJA 4GSOA 3A86A 5EW1H 3RXSA 2JJ2D 1YYY1 3GY7A 1Y5UT 2F9PA 1FLEE 3UNRA 2OINA 2K0QA 1EP6A 4MG3A 1BTUA 2ZDAH 2ZFPH 4ABFA 2CHAC 3V12A 2HVYB 3RXGA 3EDXB 2BLQA 2UWOA 2ZPRA 4KTCA 1YPHE 1WBGB 1O5EH 1ZSJA 2VNTA 2GMTC 3F6UH 1GCTC 2J97A 2P3TB 3MU5A 1S82A 2PKAA 2BD9A 3FFGA 4ZKNU 1AE8H 2QF4A 1GHVH 1GBKA 4VGCC 5EPYA 1N8OC 5LPRA 4UONA 1TBZH 2ZP0H 4ABDA 1VJ9U 4X1PU 2XC5A 4RI0A 1ANBA 1YPGH 1C2EA 1LQDB 2HVXA 2RDLA 1XKBC 2Y5FA 1H8ED 3S9AA 1NO9H 1H1BA 1G2LA 2AIQA 1L2EA 1RD3B 2P95A 4A1VA 1OXGA 3MH6A 1HAYB 1GI6A 4LZ4B 3A7WA 3TGJE 3SGQE 3W95A 1TFXA 3EA8A 2AERH 1HXEH 4IC5A 1E34B 1NESE 2OQ5A 3A7TA 4JZEH 4UFEH 1W11U 1SQAA 1FJSA 1MTVA 5H4IB 3BG8A 1SC8U 4NIYA 1OWIA 3T29A 1A5HA 2O8MA 1DWCH 5KECA 4B1TA 1FPCH 3SU0A 2F9NA 1MKXK 3GCHC 1T8OA 3RP2A 2HNTE 3RXRA 3B23B 2A7CA 2CMYA 3AAVA 4YZUA 1A2CH 1DVAH 2IPQX 2C8XB 1BTZA 2WYGA 4OS2A 1LVBA 2QXIA 3NWUA 1D3TB 1GI8B 4INLA 1GBMA 1DSTA 1WTGH 4BXSA 1SGFG 1C5YB 3BEIB 5GCHF 1ZMJA 2FLBH 2VJ1A 1EB1H 3ZZ4A 3ZZCA 1AZ8A 1K1LA 1EZQA 1OWHA 3BG4C 3V7TA 3SBKA 3NXPA 2ZWLH 1P2OA 5JPMH 1GHYH 4NWKA 2VU8E 2PSYA 3RXFA 3C27B 1ESTA 2XNDD 3E6PH 5IK2D 1C1MA 1FAKH 2B5TB 2ZTYA 2A45B 3PV5A 1HRTH 1C1RA 1LVYA 5FPSA 1XMNB 1QURH 2PGQB 2KR7A 2OCVB 5C20A 1O33A 1HUTH 3S7KB 1DX5M 1HBTH 1P0SH 1LDTT 2NU0E 4INKA 1YBWA 1W0KD 1C5RA 5FBIA 4NWLA 2GCTB 3L33A 1RS0A 1T32A 2BB4A 1PPEE 2ZDMA 4K3JA 1UK3A 3A87A 5I25A 1VITG 3MQKC 1HLTH 1QGFA 3ZVCA 4CRDA 1EJMA 2ANMH 5GIBA 2XWBI 2ZNKH 4GLYA 5HYOA 1ARBA 1GBTA 1P2KA 4BANB 2ZI2H 1D3PB 1KTSB 1SL3A 3KYFA 4D7GA 2FESH 1ZPBA 3A88A 2OLGA 2FEQH 1PQ8A 1YCPH 2J94A 2A4QA 2XBWA 3SGAE 1A1RA 2KAIB 3UQVA 1HJ9A 1CGJE 4XBDA 3LGVA 3MH4A 1O3IA 1EZUC 1H4WA 3BTHE 1W2KH 2H9EH 3M61U 3HGNA 4NZLA 2NWNA 1C5ZB 4X6NA 2AIPA 3GDVA 5FL7D 1EPTC 2UWPA 2A4OA 5EIYA 2BVRH 1O3OA 2ANKH 1L4ZA 1GI5A 2CF8H 3JZ2B 1ZTJA 2ODPA 2D8WA 4X0WU 1TLDA 2R0KA 2GCHG 4F55A 3M5NA 1OYQA 5CHBA 1P8VC 1UVPA 3CNRA 1G2MA 1NY22 2G4TA 3E8LA 3M37A 2FTMA 5DSFA 1OPHB 1HAVB 2BD4A 1NZQH 3RM2H 1O2ZA 3AW1A 3PWBA 1KXAA 3T2NA 4I31A 3MU4A 2CK3D 4TY7A 1UHBB 2LNCA 2ZHFH 3RMMH 1K28D 1YPMH 3T26A 3P8OA 4CREA 4DIIH 1HPGA 2B9LA 5A8ZA 1JWTA 1ZMNA 7KMEH 1QCPA 1SGPE 2TGAA 1LO6A 4H4FA 4AX9H 3KHVA 4X2XA 1XX9A 3NK8A 2WPMS 1YM0A 2FI3E 2STAE 1QL8A 1KXFA 4TT3D 1JRSA 2FOEA 5DP8A 5DGJA 1DITH 2V3HH 4KGAA 3QX5H 1QRXA 1O2KA 2ZU1A 4WF8A 1FI8A 3FP8E 1UTOA 1Y3XA 2HLCA 1ZTLA 3T25A 1YPLH 3TNTA 1JBUH 1FONA 4Y7AA 2NU1E 4Y8XA 6GCHG 1UVUH 2ZCKP 4JZDH 1RIWB 2JKHA 2RCEA 3PTNA 4FUCA 4Q7XA 3SUFA 5DP4A 1BJVA 3M3VA 4CRGA 2Z6BD 1DWDH 3UUZA 1ZSKA 1S6LA 4FOUC 2J2UA 3P6ZB 1IHTH 1P2MA 2Y82A 5F8XA 2BY7X 2CGAA 3KQEA 3SV7A 4H6TA 2YNBA 1EAUA 3RXPA 2F83A 2BDIA 1TOCB 2A2QH 3WY8A 2Y6TA 1VZQH 4I86A 3ZZDA 4E7RG 2F91A 2HWLB 4B73A 1GMHG 4X6MA 5C5NA 5DP6A 3OYPA 1U6QA 1DANH 1FXYA 4XRNA 1K0HA 5C1YA 1UCYK 2PFEA 3UR6A 2BDAA 1V2RT 2ZF0H 4K5ZA 4WXVA 3TH2H 1LHEH 1G30B 3I29A 2BZ6H 2ZECA 1W8BH 2AYWA 2ZCHP 3RLWH 2F9VA 4X8UH 1O3LA 4JK6A 5J4SA 1TPOA 1PPBH 4AB9A 4J1YA 2OP9A 4ZKRU 1BITA 3OX7U 4AORA 3RXTA 2FO9A 3HATH 4B75A 4F4OC 1KXEA 3S0NA 4OS4A 3BTWE 1FMGA 2QGRA 1GI3A 1BB0B 1KLJH 1K1IA 4ZROA 3FP6E 2ZTXA 4E7NA 3A83A 3SORA 1O37A 2C8YB 2VGCC 3ITIA 3ZVGA 4WMEA 6CHAC 1GBHA 4MNXA 4DY7B 3OY6U 2Y7XA 3U1IB 2ZFSA 1GGDB 1HGTH 2ZU3A 4RKOB 5JBTA 1SBWA 2WUCA 2WV4A 1AWHB 4UFDH 4LOYH 4A5TS 1L1GA 2A7JA 1ANCA 1HIAB 1QRZA 2EI8A 5FX5A 3ZVEA 5AHGH 5HXFA 1C5LH 4RT1A 2NU2E 5HM9A 4BTUB 3UPEA 1K9OE 3SV2H 1SOZA 1YPHC 3ZVDA 1OX1A 1ZGVA 1O2PA 2B0FA 5A8YA 3S9CA 5ESBA 2KCAA 1S0QA 2QF3A 1MZAA 2G5VA 3GICB 1DUEA 1BT7A 2ZU4A 5BRRE 1AN1E 1GBFA 4NIVA 7LPRA 1XKAC 2FDAA 2ZA5A 3DSPA 3PMBB 1OYTH 4NFFA 2HPQH 3SI4H 3RXQA 1Z8IB 3U28C 1CA8B 3D62A 2WINI 1S6HA 2ZPQA 3LONA 1AWFH 4I8KA 3DSGA 1MD7A 3ZZ9A 4H42U 4OM9A 1TBRH 1BTXA 4WXIA 5EGMA 1GVKB 2ZDNA 2XBXA 3GYLB 2EY4C 1OSSA 3OY5U 1D3DB 1B0FA 1IHSH 2ZHDA 4DIHH 3MNSA 3PLKA 1FIZA 1P57B 2TGDA 3ENSB 3LOXA 1C1QA 3RXMA 2R9PA 1Y3YA 2XWAA 1AKSB 3R3GB 5EW2H 1MAXA 5AFYH 2F9BH 2Z9JA 2ZU2A 4MNYA 3DFJA 1C2HA 3UB0A 2QE7D 4JZ1A 1GHAF 2PSXA 3VB6A 2K8IA 3LC5A 4OS5A 4QT8C 3UY9A 4TYDA 1XXFA 1NS3A 1O5GH 1ELFA 2I6QA 1F7ZA 3LH1A 4Z6AH 3BTDE 1RRKA 1XVMA 1TRNA 5FBEA 2ZFTA 2SNWA 4DCDA 4NFEA 1ID5H 2HNTC 2ZGBH 3H7TA 1VGCB 2VWLA 1AFQB 2A32A 1W0ZU 1BA8B 3TVJB 1H8HD 5G4BA 2PKAB 5KEDA 2DUCA 1BRUP 2C4FH 2VIQA 4NG9H 5C3NA 1VR1H 2PUQH 3D23A 5FCRA 3ATIA 1MTNC 3SUEA 1CBWC 3F0OA 2UUYA 1MTWA 1MH0A 1O3NA 4AC9A 2GP9B 1DLKB 2VIWA 3RU4D 1J8AA 1GJ7B 1SGDE 3ZZBA 2KX4A 4DGJA 2J5UA 2RA3A 1O3FA 2FMJA 3W94A 1SI5H 1VJAU 2GX4A 3KIDU 3Q00A 5JB9S 1TX6A 2VIPA 1LMWB 6LPRA 3UNSA 5FAHA 1YCPM 3TH3H 5K0HA 2L6OA 1W7XH 4B2BA 1AHTH 1QL9A 3E90B 1GI2A 3TK5A 1ZPZA 1ACBE 1EZXC 3EAJA 2H1UA 5TCAA 1V2WT 3SNCA 2UUKB 1PJPA 1HB0B 3FN8A 2AMPA 4Y6DA 4AZ2B 2YNAA 3Q77A 4E06H 2C8ZB 1QL7A 3ZZ8A 3PWCA 3FZDA 1F0SA 2BVXH 3A8CA 2BX3A 3EGKH 1HJAB 3ESTA 3AASA 3ELAH 1S85A 1GL0E 2D2DA 4TPYA 3RDZA 2PR3A 4X6OA 2J98A 1TX8A 3M7TA 2VB0A 4R0IA 2M5TA 1MU8B 1GJCB 1NU9A 1W3CA 1NRSH 4X8SH 1GHBF 3E16B 1C2JA 1E1QD 4A92A 1MABB 1ARCA 4B2CA 2V6NA 2Z7FE 2V0BA 1EZSC 3ZVBA 1SKYE 1SPJA 1V2QT 3LKWA 4IN1A 4YLUA 3LU9B 2O8WA 2WSSD 3I77A 4D76A 2WZQA 1UTLM 4NIWA 3KQBA 2IPHA 2SFAA 2SGFE 1C1TA 3EA7A 5EOKA 3URDA 1IQLA 1MMJN 1O2JA 3LGTA 1TA6A 1ZPCA 5EJZA 2BQ7B 3TK6A 1UCYH 2JETC 4K60A 4M7GA 3T62A 2GDDA 1SFIA 3K9XB 3PV2A 2FLRH 2QF5A 3A8DA 1C4Y2 1O32A 4CRCA 1CVWH 3RXCA 2FZZA 3FANA 1DS2E 2GGVB 4RKJB 1O2XA 5A09A 1GBCA 1DWBH 2BDYA 4FUIA 1MQ6A 1YF4A 1PYTC 3LDXH 1T8LA 2Y5GA 2GJGA 1LHDH
chains in the Genus database with same CATH topology
2VWNA 3QTOH 1F0UA 3SUDA 1UO6A 3STIA 3LIWA 2Z3DA 2Q6GA 3HGPA 4A7IB 4FUBA 4U01A 3LT3A 3KQDA 2WPKS 1BTPA 2UUJB 1W14U 4ISIH 1DICA 1GJ4H 3F9HA 4I8JA 4I8GA 3TJUA 1OP0A 3U1JB 2C90B 2SNVA 4JYUH 4HFPB 2ZCLP 1LHFH 1DXWA 1Y59T 3RMOH 5HGGA 1D6RA 1DPOA 3AVZA 4ISLA 3GY4A 3OTJE 2QXGA 2ZGCA 2TRMA 3BV9B 1JXPA 1NN6A 1O2NA 3DFLA 3PM3A 5CHAC 3SQEE 4AFUA 1K1MA 4OGYA 1V2NT 1O3HA 4Y11E 1KIGH 1GMDF 3SW2B 2XXLA 5A0CA 1AI8H 1E35B 2G81E 2G51A 1O2WA 3IITA 4OGXA 1AU8A 5BPEA 4XDEA 1TIOA 2AGGX 1ZTKA 3F9GA 3KEEA 1O3EA 1QBOA 4Y79A 3TGIE 4B76A 2W7SA 2A5KA 3A80A 3VXFH 2PWXA 3P92A 3LGWA 4KP0A 1HAPH 1W10U 3EQ0H 1A0HB 1O3AA 1H8DH 4DG4A 1OP2A 2D1JA 1F0RA 2BVSH 2R2WU 1DY8A 2IN2A 1Y3WA 1KLIH 1AB9B 3SHAH 3GCTF 2ESTE 4I33A 4ISNA 1ELBA 2VVVA 2BY6X 5DG6A 1HJ8A 1TPAE 2PLXA 2BXTH 1GHXH 1LPGB 3BN9A 4Y0ZE 1GJAB 1GCDA 5IDKA 2TGTA 7GCHG 1P11E 1UTJA 1G3BA 1XM1A 2XYAA 2PKSC 2GV6A 1AVWA 2R0LA 1G9IE 4X6PA 2EC9H 5AVDA 1C2IA 1WYKA 2A31A 1FY1A 1GBLA 1GI1A 4BTTB 2XBYA 1CT4E 4INHA 2TPIZ 1IQHA 5K7RA 4YT7H 2QA9E 1A3BH 3E0PB 3F9EA 1WQSA 3ATWA 4GCHG 1MCVA 3HK6B 4NSVA 1DY9A 1J15A 5ETXA 1Y5AT 1B0EA 4SGBE 1Y3UA 2BTCE 3BTTE 1LHGH 1EPTA 1NM6A 2GT7A 5DKMA 3UREA 4Y8YA 2GZ9A 1TNHA 4Y10E 1EP5A 4BOHA 4FXGH 3PO1B 4AYYB 2GT8A 1OWEA 3A85A 3SU4A 1O34A 2P3UB 1EJNA 1YC0A 3DD2H 2H2ZA 4FUEA 1EJAA 1ZRBA 3RC5A 2ILNA 3PYHA 3GDUA 3KF2A 3B9FH 3SO3A 1C1OA 1CA0B 3KGPA 2J9NA 1WU1A 3NPSA 1UTQA 1EXFA 1TGBA 3MH7A 2ALVA 1P04A 2EEKA 2YOLA 2QYIA 2FIRH 5HM2A 1GJBB 1MAYA 3SOSA 1AUJA 3QO6A 4IC6A 3FP7E 2ZDKA 1O3KA 2P93A 3M3SA 3TLOA 1BMAA 3QUMP 1O35A 2FXRA 3SJKA 1AZZA 2BLOA 1GJ6A 1NC6A 3SU5A 4BAOB 2R2MB 3QLPH 3U8RH 1C5PA 1HAZB 1P02A 4K69A 1Q3XA 5JBBS 3SZNA 1CQQA 1J17T 4NA7A 2ODYB 1UK4A 3A7VA 1S84A 4ESTE 1Z6JH 1O2UA 1BBRK 4ABEA 3M3TA 2BD7A 1GBJA 3SNAA 4CH2B 2A2XH 4ZAEA 4KELA 4WMFA 3UIRA 2A5IA 1O5BB 2ASUB 4WVPE 1V2ST 2TGPZ 2QY0B 3NUMA 3SUGA 4B74A 4I8HA 1A46H 1CSOE 2BMGB 2QAAA 4IN2A 1SHHB 5EU8A 3K65B 2OBOA 2ANWA 3MYWA 5T3HA 1F0TA 8LPRA 1CHOG 1C5NH 3DUXH 1A3EH 4Q80A 2SGAA 5E2OA 5DPAA 1SQTA 4CHAB 1A61H 3ZV8A 2ZEBA 2BD8A 2JH0D 1SSXA 1TB6H 1AGJA 4AGJA 1QHRB 3A81A 5F8ZA 1QBVH 3LC3A 3ATLA 3BTKE 1EKBB 1GDUA 2PHBA 1O3PB 2OQUA 1MBMA 1EX3A 1TX7A 3GY2A 4FUDA 1EAXA 2EA3A 2CF9H 1Q2WA 1SGRE 2CN0H 5AF9H 3M36A 4BAMB 1PPFE 4FVDA 1Q31A 2D26C 2BXUH 1C9TA 1SGIB 2ZKSA 4J2YB 3QGJA 1QTFA 7ESTE 2FS9A 1SGFA 1TRMA 1W7GH 4MPWA 4X1NU 5LPEA 1THPB 1C2KA 1TMUH 5ESTE 1GHWH 3BTME 3M7QA 1QR3E 1YKTA 4AG2A 1UCYE 3A89A 1SB1H 1P2JA 1CE5A 1O2GH 1F2SE 2XNIA 3GY8A 3VGCB 2Z94A 1SGNE 3E1XB 1EOLA 5F8TA 1F5RA 4Y71A 1ETTH 2P8OB 1NFUA 1OP8A 4ABIA 1TPSA 3RU4E 1O3JA 1Y5BT 3T5FH 1BIOA 2NU3E 3LGIA 1GI7B 4SGAE 4XE4A 3LJJA 3QZRA 3SNBA 1FUJA 2FOFA 5A0BA 2BM2A 4DJZB 4X8VH 4OS7A 1TGTA 3A8BA 2BD5A 2FTLE 1AMHA 3QTVH 2A4RA 1ZR0A 1GPZA 2OD3B 4ABHA 2FI5E 4MTBA 1BMMH 2FWWA 4HZHA 5FCKA 3MMGA 1GJDB 1GMCF 2XBVA 3RLYH 3B8JA 1NRNH 4D8NA 4MVNA 3SV8A 2ZGHA 4ABGA 3K6YA 1AIXH 4BAHB 4YO9A 3SJIA 3O8DA 3VFEA 5L2YH 4O3UA 5CE1A 1SFQB 1TPPA 1BMLA 1QNJA 2K1QA 3P8GA 5PTPA 4O03A 4BAKB 5L2ZH 1GBEA 1MKXH 1KXCA 3VB7A 3RMNH 1QJ1B 1G36A 2XCFA 2ZFRH 4AOQA 1TMBH 1O2YA 4JYTA 1MKWK 2ZG0H 4NSYA 1A5IA 5DP7A 4GPGA 4ZUHA 3F1SB 2GCTC 1MUEB 3MH5A 1DXPA 1PQ7A 1JOUB 5EPNA 1GBDA 1ABJH 2NU4E 2SGEE 2ZQ2A 1ZMLA 3T27A 4BXWA 4JYVH 4WJG2 4CRBA 1T31A 4FU8A 5JYIA 1ZSLA 2GZ8A 1QFKH 3P17H 1GVLA 3F68H 2EI7A 2CHAB 2O8LA 3ZVAA 3GY3A 3NCLA 1TABE 3ZYDA 1KDQA 2DE8A 4U32A 1YLCA 1C5XB 1ESAA 1GVZA 4DOQA 1F5KU 3GYMA 1IQGA 2C3SA 2GMTB 1GCTB 2P16A 2FOAA 3TJOA 1A7SA 4FU9A 5F6MA 2V3OH 1C5WB 4FUHA 5E0HA 1ELVA 1H9HE 5LPFA 1S5SA 4AN7A 3K6ZA 2OXSA 1C1PA 3TH4H 1RTFB 5GJ4B 1L1NA 1O30A 2ODQA 4VGCB 2RA0A 2W5EA 1N8OB 5DK1A 3BSQA 1AQ7A 1DFPA 3RXDA 1N1LA 1TGNA 1A0LA 4MLFB 1SHYA 2FP7B 1TOMH 2HALA 1C1NA 1WV7H 4XSKU 1BRAA 4HTCH 3QWCH 1B7XB 2SGQE 2BLVA 1OS8A 4CH8B 3I78A 2FYRA 3RXIA 1IQKA 4O9VA 3N7OA 1XUIA 2H6MA 4X2VA 3RMLH 1MU6B 3A84A 5FXLA 5GCHG 3BTQE 1PQAA 4GVUA 3ZZ6A 3RXHA 1A0JA 2BZAA 1GBIA 1TA2A 2QCYA 3BTFE 4JMYA 1P06A 5E2PA 4HGCA 4YT6H 5A2MH 4X1RU 1V2VT 1UJ1A 1TWXB 1C5MD 3KCGH 1IQEA 2WPJS 3M5OA 1ZZZA 4BTIB 1JIMA 1UTMA 4MDSA 1O2LA 4ZXYH 1O2RA 1O39A 1ZJKA 2GCHF 1BBRH 1XUGA 3STJA 1GDQA 1CT0E 1T7CA 1Z8RA 2OC7A 3GCHB 3S69A 1F92A 1HFDA 5FPTA 2ZHQH 4IMZA 2SGPE 4NIXA 1EOJA 2GKVE 3M5MA 1SR5C 3IWMA 4ZHAA 3U8TH 1RIWC 3L6PA 1QIXB 3MU1A 3UTUH 4FUFA 2BDHA 1SGYE 1UTNA 2H5DA 2WPIS 3SGBE 1O2VA 4A6LA 3ZVFA 2O8UA 3SU3A 2XTTB 3G01A 3P8NA 2FOHA 3U9AH 3BG4B 1ZYOA 2IJOB 1GDNA 3CENA 9LPRA 2BDGA 1D9IA 1ZOMA 2Z3CA 3SNEA 4H6SB 8ESTE 4LK4A 5AFZH 3NKKA 4LXBH 3HKIB 3UR9A 1QJ7B 1XVOA 3TK9A 1ELGA 1A4WH 1RTLA 2H9TH 1MD8A 1W12U 3U98H 1BQYA 1EQ9A 1G3EA 2FOBA 1YP9A 2ANYA 2O8TA 4IMQA 3VB3A 1THRH 1BMNH 4X1SU 1C1UH 2VIDA 3Q76A 4Y76A 3PLPA 2BHGA 2BQ6B 5LH8A 3URCA 1C5QA 4YESB 3UOPA 4DT7B 5GWZA 5E8EH 2A5AA 3A7YA 4D7FA 3M35A 1TNKA 4A1TA 1QY6A 3ZZAA 1W13U 1H9LB 1FN6A 2Y80A 1Y8TA 3S9BA 3RXKA 3ATKA 1NFXA 2VIOA 2ZFFH 1KSNA 3TIUA 3VB4A 3LGYA 5DJ7A 3RXAA 1UK2A 1KYNA 2BDCA 3KNXA 3VXEH 1GMHF 1O2TA 1NPMA 4AYVB 3SU2A 3M7UA 2G4UA 4AGKA 3MHWU 1ELCA 3EA9A 3GISB 2SGDE 4K1SA 5EQQA 1K1OA 1EAIA 1SLXB 2GZ7A 1FPHH 1RXPA 4XBCA 1EPTB 1ELEE 1GGDC 1QB9A 1P05A 4UDWH 4ABJA 1V2PT 5FPYA 5EXLA 1G37A 1RFNA 2HRVA 4YM9A 4AFSA 1SMFE 1E0FD 1FN8A 1OKXA 4I8LA 1LTOA 2Q1JA 2BLWA 4KKDA 1ZHMA 3T28A 1ANDA 1BRCE 2OUAA 3SQHE 2UWLA 3GY5A 1S83A 4XBBA 5CMXH 2PV9B 1Z8GA 3EE0B 4THNH 1TGSZ 3MI4A 3GDSA 4Q7ZA 1FIWA 1UVOA 2OTVA 3RUOA 5L30H 2BY8X 1G32B 2G8TA 1AE5A 4YOIA 3PLBA 1O2OA 2Z9GA 1OWKA 3A8AA 3OU0A 3E0NB 1HV7A 3QN7A 2FOCA 2HOBA 3BEUA 1DDJA 1FNIA 4ASHA 5T6FA 1MKWH 1PFXC 1QA0A 3OSYA 1SLVB 3ATMA 1O3BA 3E3TA 2OBQA 3AAUA 1SOTA 5EXMA 1IQJA 3BIUH 1G3DA 2QN5T 1JRTA 1P2NA 1Z6EA 3PMJA 4K8BA 1UTKA 3MO9A 2B7DH 1DLEA 1O38A 1UTPA 3TJNA 3QDZB 1IOEA 2VH0A 4NCYA 1T4UH 4TWYA 3GCNA 3UWIA 5J4QA 1K1NA 1NRRH 3MU8A 3RU4T 2ZZUH 4ZMAH 3P8FA 1SLUB 2WPLS 4JZFH 3SJ9A 4B2AA 4FUGA 1O5AB 1ELAA 3VEQB 1C5UA 1LKAA 5IYTA 1RTKA 1ZLRA 1T8NA 4YLQH 4CBOA 1GJ9B 1T8MA 2R3YA 1GMCG 2XC4A 4Z0KA 1VGCC 3SI3H 3LH3A 1AFQC 1Z1JA 4GHQA 3LGUA 3FVFB 4O3TA 2F9OA 4X2YA 4I7YH 2Y5HA 2G00A 3RC4A 2P94A 1BJUA 1X7AC 2ZHEH 1NROH 4ZKSU 3TJVA 4IW4E 2A0QB 2JH6D 3RM0H 4DW2U 8GCHF 1CHGA 2ZGXH 1C5TA 3H7OA 2AMQA 1Z1IA 4K1EA 1V2KT 1J16A 1PPZA 1C5SA 4RN6A 4ABAA 1ELDE 2XRCA 2BD2A 1P2IA 1EASA 1PPHE 2QC2A 3K2UA 2P59A 3PMHB 2H9HA 3Q3KA 4CR5A 4K2YA 2G5NA 3MNCA 1HAGE 4MPVA 2RG3A 8KME2 1BZXE 3PB1E 3RXBA 4HI3A 1QRWA 3MNXA 1DOJA 5TJXA 5FX6A 1RGQA 5LGOA 2QIQA 1IQFA 1HXFH 4KTSA 1ZGIA 1HAIH 3MO3A 1NTPA 1MTUA 1SVPA 1KXDA 4CR9A 3BIVH 1HJAC 1QQ4A 1GJ5H 2QXHA 1PQ5A 6ESTA 2VGCB 6CHAB 1A5GH 2BDBA 4Q7YA 3BTGE 2DE9A 2G55A 2AMDA 3RC6A 1SGQE 3SU6A 2AGEX 1BHXB 1C4U2 3A7XA 1W0YH 2GDEH 1WUNH 2HGTH 2VWOA 2J95A 2GD4B 4CRAA 1K1PA 1GBBA 1O3DA 1ZJDA 3QK1A 4NA8A 5ABWA 2OC1A 2ZIQH 1EB2A 2F9UA 1O31A 1YGCH 3U8OH 1OWDA 1MBQA 3R0FA 3O8CA 4MQAA 4O97A 1GHAG 1TGCA 1WCZA 3LJOA 1LVOA 1V3XA 1VCPA 1BBRE 1O36A 1WTHD 3ZZ7A 3KL6A 1AY6H 1ORFA 1P03A 1TYNA 1UMAH 2G52A 5C1UA 1LVMA 3A82A 2CV3A 4ZHLU 2P3FH 2Y81A 4NZQA 2FYQA 5C5OA 1GHZA 1UVSH 1HYLA 1TNIA 4U2WA 1V2JT 1G3CA 4ZXXH 1O2MA 2ZDLA 1Z71A 1K2I1 4TPIZ 2UUFB 3MNBA 2ZDVH 2WPHS 2F3CE 1THSH 2J92A 3SU1A 1D6WA 4IS5A 1V2OT 3SV9A 1FY8E 3MFJA 3SNDA 3SJOA 4IGDA 1N6XA 3CS0A 2BYAX 2J4IA 2VH6A 3SN8A 3SV6A 1HAOH 1JIRA 2GVFA 1YPKH 1HNEE 4GUXA 2BY9X 1SQOA 5JB8S 4CRFA 1AO5A 2PGBB 2LPRA 5C67A 1BDAA 3P95A 1S6FA 3BEFB 1CT2E 4AB8A 1KDQB 4WY3A 4MNWA 4ISOA 3KN2A 1P9SA 1J14A 2FX4A 1XUKA 4Q2KA 3TU7H 1XUHA 3D49H 1MTNB 4K8YA 3O8RA 2AEIH 1CBWB 1O2SA 2ZGJA 3RXEA 3GY6A 4XFQA 3HPTB 4Y8ZA 4AFZA 2FODA 1HAHH 4UFGH 1IQNA 4X2WA 1QBNA 1KXBA 3DHKH 1MZDA 3H5CB 4WH8A 1QQUA 3UQOA 5EXNA 1L4DA 2ZC9H 3AW0A 5GDSH 1O5FH 3F9FA 2W7UA 1C9PA 1GHBG 4GHTA 1ELTA 1OOKB 4R8TB 2ZFQH 3HK3B 4TWWA 1TNLA 1PPCE 3TPIZ 4WH6A 3Q3YA 1C1WH 4F49A 1GJ8B 2W3KA 1GI0A 4I32A 2HPPH 1EATA 3IG6B 1SGTA 1AB9C 3V3MA 2BOHB 2ZTZA 1P01A 2BY5X 3EYDA 1DE7H 1VITH 1SG8B 5EQSA 1TBQH 1QB1A 3ODFA 1NU7B 1WAYB 2WV5A 1Y3VA 3VB5A 3M5LA