1C2FA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2fA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2fA02
3F6UH 3TGJE 4D8NA 2Z9LA 1BTPA 3MFJA 5PTPA 1P11E 4WY3A 1T8LA 1AVWA 3HK3B 4A6LA 4FUJA 1T4VH 4YLUA 1BMNH 4D7GA 1DXWA 1B7XB 1GJDB 2XBXA 3LKWA 1TQ0B 2FOBA 5FHTA 1P04A 2C3SA 3UREA 1LKAA 1C2MA 4K8YA 2Q6GA 1SL3A 3MI4A 3UR9A 4RSPA 1KTSB 2YOLA 2F9PA 4FUBA 4IS5A 3SU3A 2GDDA 4AB9A 2OTVA 1O5AB 4X8UH 2YNBA 1TFXA 1T8MA 2K1QA 1GMDF 4OS7A 1VITF 1UK4A 3GYLB 4LZ4B 4Y0YE 4GHTA 1QB9A 3P92A 1D3QB 1C2IA 4MPVA 4Y76A 1UTLM 1ZZZA 1O3IA 3VFEA 5A8XA 3QZRA 1FIWA 1G36A 4MNWA 4CRFA 2J2UA 2UUKB 4GSOA 2FESH 3ESTA 3V12A 3SU0A 1ARCA 2GCHF 3K9XB 2OBQA 1N8OC 3EAJA 3B9FH 2A4QA 1F7ZA 1K1MA 4ISOA 2ZHEH 3TIUA 2FP7B 4YM9A 1D3PB 3A89A 3RC6A 1DY9A 5G4BA 1YLCA 3DHKH 4SGBE 1C5NH 3TITA 2GCHG 2FYRA 1XUKA 2EI6A 1BTUA 2BD3A 4UFEH 4WJG2 3SNCA 1TA2A 4HGCA 5EU8A 1ARBA 1Q31A 3E1XB 4XBDA 2W7SA 2ZHDA 4O9VA 1J15A 1MZAA 1P12E 4XBCA 1FNIA 1D3TB 4JZ1A 2OC8A 2ZFSA 3BTHE 1O0DH 4MQAA 3SW2B 1W3CA 4TY6A 1KXFA 3ZVCA 2CF8H 3BTGE 3FZZA 2O8UA 1F5KU 1TGCA 2GDEH 3EA7A 3Q3YA 4U30A 4UDWH 3ZZ8A 2XC0A 2HALA 4Y8YA 1GCTC 1GBHA 4NSYA 1AUTC 2ZHWH 3PLBA 2FLBH 3MNCA 1MKWH 3BTDE 1S84A 1QB1A 1SGFA 2J4IA 5LH8A 1SOTA 1P2KA 1O3BA 1S83A 1CO7E 1TRYA 1DFPA 3VPKA 1TGBA 2QAAA 3MO9A 4R8TB 1HXEH 1FY5A 1O5DH 2ZCKP 3HKJB 2ASUB 2H5DA 1KXDA 3RXBA 4ZKNU 1C1TA 2ZI2H 1SLWB 2AIQA 2FDAA 1BMAA 1CHOG 1C2GA 4INLA 3TPIZ 1ELAA 3U69H 2FXRA 1A61H 3BG4B 3U98H 1P9SA 2XCNA 1G32B 2NU4E 4JCNA 2B8OH 4XE4A 2FS9A 2VIOA 2BOKA 1GJCB 5EQQA 1QHRB 1QL9A 3SGBE 4X1RU 1PQ8A 1UVOA 1BTHH 3MU0A 4YLQH 4HTCH 2FZZA 2BX3A 1W10U 1C1VH 3MTYA 1CSOE 2ZHFH 1TMBH 1QR3E 1MU6B 1C9TA 2Z9GA 2NU2E 3ZZ3A 1AVGH 1TBZH 3M5MA 1FIZA 4K60A 1OWIA 4HZHA 3VB5A 1RXPA 2BDIA 2H6MA 1DLEA 3E3TA 1F0RA 5J4SA 1P2MA 1Z8GA 4AGJA 2P93A 2FOGA 3RC5A 2CXVA 3QZQA 3VEQB 2VH6A 1J17T 2ZGXH 2EEKA 4TWYA 2ALPA 1QRXA 3RXKA 1GHVH 1EAXA 1LVOA 1HJ8A 2FOCA 1P09A 1BRUP 5AFZH 1GJ6A 1RTLA 3FFGA 5ESBA 4ABBA 2PFEA 1P03A 1LCYA 2HNTF 4GAWA 4I32A 1SGTA 1C5LH 3QTOH 4X2YA 2STBE 3A7WA 3VB6A 3PM3A 4ZHMU 4DOQA 2VGCB 2PW8H 3VXFH 1DT2A 2RA0A 3A8AA 1YPHE 3U8TH 3SNBA 1S6FA 3FAOA 4PROA 1SQTA 2TIOA 2QXJA 1LHEH 2GCTC 2V3OH 5A8YA 3K2UA 8KME2 3SHAH 2SNVA 1HBTH 1TOMH 4Q7ZA 4CHAC 3RU4T 2SGAA 4MLFB 3EE0B 4Y10E 1NU9A 4GUXA 3KQDA 1QB6A 1XVMA 4IC6A 1TNJA 1PJPA 3LGIA 2P3FH 3P70B 1W11U 3KNXA 4ISLA 1V6DA 1AWHB 1EPTA 1UHBB 2CF9H 1FXYA 1H9HE 1GVKB 5C2ZA 1W0ZU 2OXSA 2BD2A 2FOMB 1O3NA 2RDLA 1HCGA 1ZHRA 4K3JA 1INCA 5FCRA 2XCFA 1AMHA 1JXPA 3BF6H 1Q2WA 3MYWA 1O3HA 1ZR0A 1XXDA 1SHHB 3MH7A 2ZU4A 1FI8A 3E16B 1O2SA 1GI3A 1TPSA 3LDXH 1BHXB 1TNHA 1IQHA 1GMHG 1MQ6A 1ZSKA 3KQBA 1O32A 1AB9C 3EYDA 4ZXYH 1WAYB 1MU8B 1UVSH 3ODDA 3RXCA 4JZIA 2OP9A 1A0HB 1TYNA 3ZZDA 1ELDE 3C1KA 1O2NA 4IN1A 1GI6A 4CR5A 2SGDE 1F5RA 2H9EH 1EPTB 1V2VT 3HATH 5E0HA 4D7FA 4F49A 1IQNA 1W12U 2A32A 3LC5A 1YPKH 5JYIA 5DO4H 1FQ3A 4J1YA 1C5ZB 2QA9E 1SPJA 5HM9A 1FV9A 2WINI 2TGPZ 3PLPA 3PO1B 1TGTA 1SGPE 2R0KA 3RXDA 2KAIA 4CBNA 5FX6A 4CRAA 1E34B 1EJMA 4BNRA 4AGKA 1PQ5A 3RXFA 1GHXH 3ZVEA 3SQEE 3UOUA 1GPZA 4IMQA 1LQDB 2A5IA 1SQOA 4Q80A 1KYNA 5BRRE 5A2MH 1DWEH 1FUJA 3B8JA 3RLWH 2G52A 1O2LA 3S69A 1FPCH 2H1UA 1G2LA 2ZPQA 4I8JA 1NRSH 3UQOA 1GI4A 4U32A 5FPYA 2RA3A 3RXMA 3E0NB 3RXJA 4CRCA 2QCYA 1Z1IA 8GCHG 1TMTH 3GY6A 3A85A 4ISNA 1TABE 1V2KT 2GZ8A 5ESTE 3BTQE 3RM0H 4ABAA 2BMGB 4OGXA 4JYVH 2VIWA 3P95A 3W95A 2BHGA 1QQ4A 3ATLA 1O39A 2RCEA 3ATWA 2ANKH 1V2UT 2PSXA 5LGOA 2PUQH 4K2YA 3U9AH 3QTVH 2CJIA 1O3JA 2QF3A 1SMFE 3P8NA 2AGGX 3NWUA 3IG6B 3P6ZB 2XBYA 2BVXH 1S82A 5IYTA 1D3DB 5GIBA 1HLTH 3M7TA 4X2VA 4AB8A 1TBQH 4ZKOU 3AAUA 3OYPA 5EODA 1EZSC 1V2JT 1GBDA 1QIXB 4BANB 2XWBI 2Z3EA 5AF9H 1CT4E 1D9IA 1VCQA 1P2JA 1GJ9B 1EP6A 5FX5A 1UTJA 5E2PA 6ESTA 1VJAU 5EW1H 1C4U2 1C1QA 3TH3H 3QLPH 2LNCA 1W13U 1OWEA 4Y79A 5DP8A 1SSXA 4ZROA 1NFWA 3M61U 1LQEA 4CRBA 1RGQA 1ID5H 4FUFA 3MNBA 4BXSA 2OQ5A 4O03A 1V3XA 5TCCA 3SJ8A 1Y3YA 1FONA 1OS8A 4Q7XA 4J2YB 1O3FA 2BVSH 3TVJB 2ZPRA 3Q76A 3ZZCA 1G2MA 1DE7H 1Z6JH 2A7JA 4B74A 2TBSA 1K9OE 3Q77A 4AG1A 2ZDAH 2ZC9H 1FJSA 1IQFA 2HGTH 3QN7A 3RMLH 2CV3A 2A4GA 4LXBH 2PLXA 4I8HA 1B5GH 1HXFH 2VWLA 5JBAS 3RMOH 1PPEE 1NPMA 1AI8H 1H9IE 3SUEA 2OQUA 1LVBA 4KTUA 1LPZB 2BYAX 4CRDA 4K1EA 7GCHF 3AW1A 3AASA 3NXPA 3DFJA 3T62A 3KQCA 1IQLA 1XUFA 5EXMA 2OBOA 1FLEE 4WMDA 2GT8A 1DWCH 1CGHA 4NFEA 3M5NA 4FXGH 3T2NA 2B7DH 4GVUA 1UTMA 1NN6A 1LHCH 1CHGA 4X6OA 3SUFA 5SGAE 4DG4A 4WVPE 1GHAF 1CVWH 3QX5H 3KCGH 1UMAH 3P17H 4GCHF 1O3LA 1O2MA 1P8VC 1W0YH 1TMUH 3A7TA 4LK4A 1GJAB 4A1TA 1WUNH 1LKBA 3QDZB 1JOUB 1KLJH 1P3CA 1XKBC 1DS2E 2WYJA 1OP2A 3UFAA 4YOIA 4Z6AH 3MNSA 1TX8A 4KTCA 1THPB 2JH0D 5EG4A 2G55A 2FI5E 2P3TB 9ESTA 3M3VA 4ZKRU 1H9LB 2HPQH 2H9TH 3RXTA 1MTNC 4MNXA 2WPKS 2F91A 7GCHG 2FLRH 1NRNH 4CR9A 2C4FH 2FOFA 2EI8A 1AD8H 2XTTB 4IW4E 2PGQB 1JRSA 2XNIA 5EOKA 3RMMH 4CRGA 1P0SH 3SNEA 3BSQA 2R0LA 1DICA 1EPTC 6LPRA 2R9PA 3V7TA 1QTFA 3TJUA 4ISHH 1F92A 2HOBA 4Y7BA 3PMAB 4Y0ZE 1NT1A 4DURA 2H2ZA 3M36A 4X8TH 3D49H 4NA9H 5CE1A 3QWCH 3SU1A 4X6PA 4DVAU 1JWTA 1GJ4H 1LVYA 1SG8B 1ZPZA 2ZNKH 2O8LA 4H4FA 2Y80A 2G81E 3LH3A 1GBAA 1O2RA 2ZQ2A 5F6MA 4X2WA 4IMZA 1BBRE 3NKKA 2M5TA 1YYY1 3FP6E 4TY7A 6GCHG 1A3EH 1QA0A 1YCPH 2F9BH 2IJOB 5C3NA 1YF4A 3A80A 1A0JA 1GBLA 1ACBE 2P59A 4FU8A 2J38A 1BMMH 4X1NU 4B1TA 1GJBB 3TK6A 4OGYA 1OWKA 5EGMA 1L0ZA 1HFDA 1O3EA 2PKAB 3LGVA 3ZYEA 3SV7A 1WQVH 3RXIA 1Y8TA 5H4IB 1SGNE 1Z8JB 1UTOA 4XFQA 2Q6DA 4XSKU 1LPGB 1BBRK 1D4PB 4ABGA 4BAKB 7ESTE 3RXSA 1J14A 1QNJA 4E05H 1IAUA 4BTUB 1H8IH 4HI3A 1ELVA 2GGVB 3M5OA 2R3UA 2SGFE 3P8FA 1O30A 1TIOA 3FP7E 3MO3A 2SFAA 1K1NA 1XM1A 3SU4A 4NCYA 4A5TS 2OCVB 1EZQA 2FOEA 5JBTA 2FOAA 1OXGA 5JBCS 1RTFB 3RMNH 1BBRH 1PPGE 1O2IA 1WQSA 2P3UB 1F2SE 3RUOA 1GHAG 2G51A 2AEIH 1O3MA 4NSVA 1F0TA 3BTTE 1O2QA 1O2HA 3ZZ4A 3SJIA 4AFSA 3L6PA 5C1UA 3NZIA 2CHAB 1ANEA 1MMJN 4A7IB 2NU3E 3HGPA 3NCLA 3O8RA 5A0CA 3LGWA 3SU6A 1UO6A 2WPLS 2UWPA 1YKTA 4YT7H 1NY22 1IQMA 2P8OB 1N6XA 1AE8H 3ZZ7A 3SV9A 1T31A 1HYLA 3DT0H 2IOTA 3TNSA 5F8TA 2C8YB 1GBKA 5B6OA 5C20A 4FUHA 1XUIA 3HGNA 1C2JA 4HFPB 3A7VA 3EDXB 3PTNA 4ZAEA 3A84A 1RRKA 3T26A 1W7XH 2TGAA 1QQUA 1C5OH 1HAHH 1EX3A 3A7ZA 2QF0A 2GX4A 1FPHH 3C27B 3E0PB 1S0RA 3PV4A 3STIA 4INKA 2BY5X 2ZDNA 1YPHC 2ZU1A 1YPJH 3CS7A 1GI2A 2VWOA 2ZECA 2BB4A 1TE0A 2WUCA 3JZ2B 3S7KB 3UTUH 2OC0A 4AX9H 2Z3DA 3BTEE 1VCWA 2W3KA 2Y5GA 1BTXA 3MU8A 2VIVA 1YPGH 1A46H 1C4V2 1QJ6B 1K21H 1EB2A 2D2DA 2ZIQH 2F83A 3EQ0H 4BAOB 3H7TA 1O3PB 5E2OA 1TGSZ 5HMAA 2HNTC 4JZEH 3SJOA 2Z6BD 3E91A 1GI5A 3EA9A 3ITIA 1SVPA 1HDTH 8GCHF 3B23B 4MG3A 1DVAH 3LGUA 3QGJA 3ZZBA 1BRBE 1Y59T 2A5AA 2VU8E 1AZZA 5DP4A 1BHXF 1C5XB 1EZXC 4ZKSU 4E7NA 1BZXE 1RD3B 1AE5A 3BG4C 4SGAE 1GMCF 1WU1A 4CBOA 3KN2A 2O8WA 1BCUH 4K1TA 1K2I1 2BD7A 4NA7A 1S85A 2ZCHP 1TWXB 1N8OB 3GY3A 1BTYA 3RLYH 1BJUA 1SLXB 3GCTF 2PSYA 2G4UA 3UR6A 4IBLH 4NWKA 1EAIA 2G8TA 2WUBA 2Y7ZA 3I78A 3ENSB 3GISB 2IN2A 5DKMA 1HB0B 3O8DA 2ZGBH 1AFQB 1NFUA 3GDSA 1EP5A 1SGYE 1W14U 3UNQA 1GHWH 2BDAA 4GLYA 1VITG 1K1IA 2FTMA 1UHBA 1ZGVA 1L1JA 1TPAE 4Q7YA 3HPTB 1LPKB 1OYTH 3GY2A 4AFQA 4IN2A 1GBCA 1C1NA 4I8LA 1SLUB 3LJJA 1NESE 1V2NT 1AFEH 3NUMA 1A5GH 1OYQA 1KLTA 4H6SB 5EW2H 2QC2A 5FBIA 1BTWA 5K7RA 3MH4A 1GBTA 1LHFH 1NFXA 2AMDA 2TRMA 5AVDA 3PWBA 4CREA 3TNTA 2FX4A 3H7OA 1O31A 3GY8A 1ZTJA 4ZH8A 4FUEA 4RKJB 1THSH 1YPLH 1TNIA 4X8VH 2CN0H 1KXCA 2IPHA 1V2QT 5I46H 3DUXH 2FEQH 1O5CB 4LOYH 1TPOA 5BPEA 4K5ZA 2GZ9A 4AFUA 3M3SA 1IQKA 1UK2A 3ZZAA 5FBEA 3TJNA 6CHAC 4YESB 3D23A 1S6HA 1NC6A 1MKWK 3A83A 2VNTA 3ZVBA 4B71A 1EASA 2AMQA 2TGTA 1MKXK 1E35B 1YCPM 1D6RA 2QN5T 3AAVA 2ZFQH 4ESTE 1A1RA 1GMHF 3UIRA 3S9AA 1C5QA 5LPFA 2WPMS 1A0LA 4H42U 1OPHB 2BLVA 1KSNA 2AFQB 1MBQA 1UTPA 2ZU5A 1GHZA 4FUCA 4YZUA 3SBKA 2H9HA 1IQJA 1VR1H 1C1PA 4AFZA 1DITH 3AVZA 3F68H 3SI3H 1Z1JA 3ODFA 2ZTYA 3PMBB 2XRCA 4ABHA 3BG8A 1J16A 3TK9A 1P06A 3TH4H 1FN6A 1WTHD 5GJ4B 2A7HA 3BTWE 1O2WA 2BXUH 1ABIH 4AYVB 4NWLA 3RP2A 3ZV9A 2ZCLP 3Q3XA 3T25A 1GL1A 1GI0A 3GCHC 5DK1A 1HJ9A 2UWLA 2GP9B 4I8GA 7KMEH 1LHDH 2FX6A 1U6QA 1AUJA 2VWNA 1FZZA 5JDUB 1SFQB 1OOKB 3VXEH 3BN9A 3G01A 5K0HA 1O36A 3BEFB 1GI7B 2G5VA 3GCTG 1HV7A 1XXFA 8LPRA 1MUEB 1CT2E 3BIVH 1IHSH 1BJVA 1ELGA 1DANH 1O2XA 3S0NA 3A8CA 3A88A 2PV9B 1BA8B 2QIQA 1Z6EA 2Z7FE 1AY6H 2OC7A 2FM2A 1BITA 2XW9A 3UY9A 2ZDLA 3A87A 1D6WA 4BXWA 2XBWA 2FMJA 3L3TA 4CHAB 2Q1JA 3UOPA 4OS6A 4I7YH 1ELCA 2HNTE 2SGPE 4DIHH 5DP7A 1IQEA 1A2CH 1O3OA 3CP7A 5AFYH 2O9QA 2AIPA 1O35A 5FXLA 2BDBA 1CGIE 1SR5C 3D62A 3KIDU 3PB1E 2Z3CA 3EGKH 3LOXA 2PWXA 1HAYB 5I25A 1P3EA 4THNH 2QV1A 1IHTH 1DPOA 1HNEE 3ZZ5A 1NRRH 2GTBA 4ZMAH 5E0GA 1GVLA 1FY3A 3PYHA 1O2VA 5CMXH 1GI9B 1HAOH 1UCYH 1A7SA 1E38B 3DFLA 1XX9A 1O38A 1GVZA 2STAE 1TNLA 3MWIU 2AH4X 2ILNA 5DP3A 1QBNA 1QL7A 5EPYA 4MDSA 3ZVAA 1T8NA 2VGCC 1P02A 2ZO3H 1CA0B 1ESAA 2YNAA 1DUEA 1CHOF 1Z8IB 3KQEA 1LVMA 1P05A 2OC1A 3A7XA 1NFYA 2ZF0H 5EXNA 1VJ9U 2CHAC 1C2HA 3K6YA 3BEIB 2HWLB 3KL6A 1G30B 5L2YH 1KXBA 1V2MT 3RXQA 2ODQA 2J9NA 3AW0A 2ODPA 1YP9A 3WY8A 5DP5A 2BZAA 1NZQH 1BT7A 2V6NA 1FAXA 1UVPA 1NS3A 3PMHB 1Y5UT 3GDVA 3MOCA 1A4WH 3A8DA 4K69A 3KEEA 6CHAB 4MNVA 1DLKB 1NO9H 5L6NH 3Q3KA 1P57B 2GD4B 2FTLE 3JZ1B 5FCKA 3SN8A 1CQQA 5EPNA 2ZG0H 4OS4A 1B0FA 1BTZA 1SC8U 2PGBB 1NRPH 1XUGA 3LC3A 1UTNA 1ELBA 1EAUA 1VZQH 2CMYA 3DD2H 1GBFA 3ZZ9A 1NM6A 3SV2H 2BY8X 4BOHA 2VH0A 4A92A 5DP9A 3RM2H 1EZUC 2PKSB 3LIWA 3ZVFA 5JB9S 1MCTA 5F8ZA 3T29A 1FY4A 5GDSH 1AZ8A 3A86A 2AGIX 2ZGHA 1TONA 5ETXA 9LPRA 3LJOA 1N1LA 3RXHA 2EC9H 2SGQE 4YTAA 3SZNA 1UCYK 2ZWLH 1KDQB 4B2BA 1O5FH 4VGCB 1VCPA 3PWCA 2A4OA 1MTVA 2PKAA 4B2AA 1V2TT 4NIXA 2BD4A 2UUJB 5IDKA 3ELAH 2BX4A 3STJA 2VVVA 3SV8A 3RU4D 1GG6B 5GWZA 3DA9B 1YPEH 4BAHB 1AHTH 2BM2A 2BDCA 1JIMA 3E90B 3RXPA 4VGCC 3A81A 2W26A 1GGDC 3LPRA 1ANBA 2V0BA 1O33A 1FY1A 1FY8E 1MAXA 1Y3UA 1OSSA 2AERH 1XVOA 4OS1A 2ZDVH 3VB3A 3GY4A 1DY8A 3RC4A 1FMGA 2F9VA 1EAWA 3URDA 5C5OA 5C5NA 1TAWA 4UFDH 4OS2A 4IGDA 4X8SH 2QXIA 2XWAA 1ANDA 1TB6H 2ZHQH 2ZZUH 1CBWB 2H5CA 1OP8A 1G3EA 1JIRA 4Y71A 4I31A 3SUDA 1O2ZA 2FYQA 5CHAB 4NIWA 2EI7A 5L30H 1DWBH 4CH8B 3MU1A 1XUJA 5GPIB 2OINA 1MAYA 1T8OA 2GCTB 1GL0E 2Z9IA 1VGCC 1PPZA 2BTCE 4WXIA 1QURH 2I6SA 3OY5U 1FDPA 1A5HA 1UTKA 4X2XA 2O8TA 1L4ZA 1W7GH 3RXUA 2F9NA 3MMGA 1VGCB 1C5PA 1PYTC 1KXEA 4M7GA 1GDNA 1OWJA 1O3DA 1C1WH 4NIYA 4E7RG 1MTNB 3PLKA 1YGCH 2XC5A 4Y8XA 3V3MA 4GPGA 2ZU2A 3SOSA 3TJOA 3M7QA 2P16A 1ZTKA 4AG2A 3OTJE 3URCA 1SOZA 1DSTA 1NRQH 1SGFG 1TGNA 4YOGA 1C5RA 1GMCG 1EOJA 1O34A 1SGQE 3P8GA 4X1QU 3K65B 2J94A 3A7YA 4D9RA 3TGKE 1AGJA 1F0SA 1SGRE 3T28A 2ODYB 2BVRH 1IOEA 4UFFH 2XBVA 1KXAA 1LHGH 2SNWA 2B5TB 2BOHB 4A1VA 1ETRH 3F9FA 2F9OA 2BLOA 1C1MA 3SU5A 1DDJA 5A09A 1ZMNA 3BTME 1ZSLA 3BTKE 1QY6A 2A2QH 2B0FA 4Z0KA 3SNAA 3SGQE 3BTFE 4X6MA 1AQ7A 3LH1A 5A8ZA 1DX5M 2FO9A 1EATA 1GDQA 1ZOMA 1AO5A 4D9QA 1CGJE 4GHQA 3UWIA 2XYAA 1TRMA 3OX7U 2HVXA 2F9UA 2J92A 2A2XH 1ETTH 1QFKH 1F0UA 1HPGA 3LGTA 1O3AA 1RJXB 1TX7A 2AMPA 4DIIH 1TNKA 1TQ7B 3U1JB 4UE7H 1V2ST 3SU2A 5JBBS 1TALA 3BV9B 1GHYH 2BQ6B 4H6TA 2BD5A 1CU1A 2V3HH 4ABDA 5J4QA 3GCHB 4WMFA 4INHA 2C8ZB 3MHWU 4BTIB 3S7HB 5TCAA 5A0BA 1UCYE 4NZLA 2A5KA 2Q6FA 3QK1A 1HJAB 1KIGH 1O2PA 2DE9A 1CT0E 3PMJA 4JMYA 1DUAA 2A45B 4MPUA 1QL8A 2ZKSA 1ABJH 1GBIA 1K1LA 1P2NA 1BRAA 1YLDA 2W7UA 1WV7H 5GCHG 5T6FA 2PTNA 4ZXXH 1BIOA 3CS0A 3UQVA 1ELTA 4K8BA 1PQ7A 1ZLRA 2GV7A 2VIDA 1ZJDA 2R3YA 4WH8A 3RXRA 2BQ7B 1CE5A 3ZZ6A 5T6DA 3VGCB 1K1JA 2UWOA 2GZ7A 5T6GA 1ZYOA 4ABFA 1QJ1B 1EOLA 2Y81A 1L2EA 1ZHMA 1GBJA 4FU7A 1JBUH 1W8BH 1GBBA 4UD9H 4Y6DA 3D65E 4O97A 3MU5A 1O3CA 1J8AA 3VB4A 1P10A 2VINA 1UK3A 3F9HA 2ULLA 4FUGA 4I8KA 3RXGA 2AGEX 2FOHA 4AORA 1IQGA 1ZGIA 4TYDA 1ETSH 2Z9KA 2OD3B 1MKXH 2FPZA 3HK6B 3TJVA 2RG3A 3SGAE 4FU9A 8ESTE 5HGGA 4NG9H 4U01A 2R2WU 2ANWA 1SGEE 5LPEA 3UNSA 2C90B 3QGNB 1UVTH 2JH6D 2XXLA 1RIWB 2A7CA 5GCHF 1CBWC 1O2UA 1ZRKA 2VWMA 4YO9A 3RXOA 1WTGH 4TWWA 2GVFA 4FUIA 1C2EA 1O2TA 2VIPA 2BLQA 1MD8A 3UWJH 3RXAA 1NROH 2Y7XA 2EA3A 1O2KA 3SQHE 1C5MD 2G5NA 5F03A 4FUDA 1V2OT 1GJ8B 4MPXA 2ESTE 1OWDA 4BAQB 3QO6A 4MPWA 1Y5AT 1Z71A 3TU7H 1ESBA 3RXLA 2WPIS 3F9GA 3GOVB 2BDGA 5TJXA 5T3HA 3M7UA 4B75A 1C1OA 1TLDA 1V2RT 1OWHA 1RS0A 5DPAA 3PROA 2Y5FA 4B73A 1Q3XA 1PPCE 2ZGCA 2GMTB 2ZQ1A 1ZTLA 4CH2B 4X1PU 1BMLA 1VITH 1EB1H 1TX6A 4JZDH 4E06H 4ABEA 4RKOB 2QGRA 3ZV8A 3V0XA 1O5GH 1NU7B 3R3GB 4B76A 4ZHAA 5DG6A 4MVNA 3OU0A 1XMNB 4UEHH 2A4RA 1FN8A 1GDUA 1C2FA 5EQSA 3SJKA 1AKSB 1K22H 2G00A 5A0AE 2TPIZ 4U2WA 2ZA5A 3ZYDA 1Z7KA 3IWMA 4NIVA 4NA8A 1C4Y2 1YM0A 4O3UA 1C2DA 1SHYA 1GJ5H 1GG6C 4JYUH 1EQ9A 2QY0B 3K6ZA 4Y11E 2NWNA 2R2MB 1SGDE 3E8LA 1N6YA 5DJ7A 3W94A 1P2QA 1B0EA 5LPRA 1AFQC 2V35A 2ZTZA 4AOQA 1GWAA 3T5FH 4WH6A 2JETC 3MO6A 2WV5A 1HRTH 1HIAA 1OX1A 2BXTH 5AHGH 1A3BH 2XC4A 3RXVA 5HXFA 3GICB 4UONA 1ZJKA 1RFNA 2TGDA 3ATMA 2C93B 2ZTXA 3TLOA 1L1GA 2FS8A 3EA8A 3U1IB 1GBMA 2JH5D 4RN6A 5HYOA 1L1NA 1QJ7B 1TPPA 2ANMH 2BY7X 4UFGH 4XDEA 1RIWC 3GDUA 1MZDA 2B9LA 2J34A 3LGYA 2D26C 4ABJA 2P8OC 1TOCB 3FP8E 3KHVA 3A8BA 1QA7A 1KY9A 1S0QA 1SFIA 3T27A 4KTSA 2BDYA 4DT7B 1C5YB 1CA0C 1C2LA 1O2GH 2D8WA 1O37A 5CHAC 1SB1H 1MBMA 1J9CH 1ZHPA 2ANYA 2VIQA 1T32A 1KTTB 3E6PH 3ZVDA 4TPYA 1P01A 2QXHA 1WYKA 1HAZB 4ISIH 1G3BA 1GCDA 1ZSJA 4BTTB 3RU4E 3I77A 1DSUA 4ABIA 4NGAH 4XBBA 4A1XA 3O8BA 3OY6U 4KP0A 3O8CA 1HAVA 1TBRH 2G4TA 2W3IA 3VGCC 4ASHA 1EJAA 1EJNA 2ZPSA 1C5WB 1KDQA 1UJ1A 1HUTH 3SUGA 1HAXB 1P2OA 1G3DA 1OKXA 3KGPA 4JK6A 3FANA 1AKSA 3PO1C 3ATKA 1QRZA 1C5SA 1HJAC 1YBWA 1C1UH 3TGIE 4BAMB 3I29A 5EQRA 5ABWA 4B2CA 1BRCE 1BOQA 1JMOH 1GCTB 2FWWA 1PQAA 4WWYA 4ZUHA 3FZDA 3MH6A 1V2PT 1Y5BT 1P2IA 1PPBH 2Y6TA 2CGAA 2THFB 4JYTA 4TPIZ 1FAKH 1CA8B 1K1PA 5C1XA 2VVUA 2ZDKA 2C8WB 2ALVA 1XUHA 3MU4A 3SJ9A 1ELFA 1O5EH 1WSSH 1WCZA 4Y8ZA 4ZHLU 1C9PA 1G3CA 1T7CA 1C2KA 1O3GA 2FI3E 1IQIA 3RXEA 1GI8B 1HGTH 3QUMP 2ZFRH 2A1DB 1C1RA 5C1YA 3U8RH 1E0FD 4DW2U 3S9BA 4X0WU 3KF2A 1H4WA 1V2WT 4Q2KA 2WYGA 3CENA 3GCNA 1SGCA 2Z9JA 1K1OA 3GY5A 3M3TA 1MQ5A 2AYWA 1S5SA 1LO6A 1A5IA 1T4UH 2P95A 5E8EH 2JETB 3GYMA 1PPFE 1GGDB 1F5LA 1K28D 5GXPA 2VB0A 3NPSA 2BD9A 1BDAA 1BUIA 5C67A 3PTBA 3HKIB 2PR3A 2WV4A 1PPHE 1WBGB 2OUAA 2PKSC 4NFFA 3H5CB 2ZDMA 2OLGA 1W2KH 2F3CE 1KLIH 1PFXC 2FIRH 2A0QB 4KKDA 3UPEA 3UNRA 1BB0B 1QCPA 5E0JA 2WPJS 5F8XA 7LPRA 2ZGJA 1GI1A 4O3TA 1Y3WA 1YPMH 4X1SU 3OSYA 2VVCA 1V2LT 3MH5A 1ELEE 2VJ1A 5HM2A 3SORA 3F1SB 1C5VA 2BLWA 4WXVA 1C5UA 4DGJA 1GHBG 2PHBA 4YOJA 2LPRA 5FPTA 4DCDA 3TK5A 1QBOA 4AZ2B 1P9UA 1AU8A 2UUYA 1GJ7B 4F4OC 1YCPK 1WOFA 1Z8RA 5FPSA 2NU1E 3ZVGA 4R0IA 2BD8A 1AIXH 1O2JA 1EKBB 1UTQA 3M5LA 3GCOA 2ZU3A 2GV6A 4Y7AA 1G37A 2Z94A 4I33A 2GKVE 4AYYB 1PYTD 6GCHF 1DM4B 2KAIB 1ZRBA 1L4DA 4JK5A 1DWDH 2JKHA 3RDZA 1ZPCA 2A31A 4MNYA 3LT3A 3P8OA 1MCVA 2BZ6H 3IITA 2BY9X 2DE8A 1TRNA 2C8XB 2WPHS 2AS9A 1AB9B 4WMEA 1Y3VA 2UUFB 4K1SA 2BQWB 5FAHA 2Y82A 1H8DH 5DGJA 1HAIH 2NU0E 2HLCA 1DXPA 1MTUA 1MD7A 1O5BB 1SGIB 1Y3XA 1MH0A 2P94A 3L33A 4AN7A 2FODA 5JPMH 4IC5A 5EXLA 1ESTA 1C5TA 1BQYA 1H1BA 1ORFA 1QRWA 1AVXA 3FVFB 4FVDA 1ANCA 1O3KA 4OS5A 1GHBF 2HPPH 2SGEE 5L2ZH 4D76A 4XOJA 2J95A 1OP0A 2Y5HA 3V13A 4KELA 1AN1E 3N7OA 2BY6X 4FVBA 1MTWA 1O2OA 4DJZB 2BDHA 3SHCH 2ZFPH 3LU9B 3SI4H 1DOJA 1LMWB 2ZFTA 1S81A 3VB7A 2O8MA 1XKAC 3S9CA 2QYIA 1G9IE 5JB8S 1C1SA 3R0FA 1THRH 1SQAA 1LTOA 1SBWA 4X6NA 1RTKA 3SO3A 2QXGA 4YT6H 4LZ1H 1ZMJA 4MTBA 1AWFH 4GCHG 1NTPA 1QGFA 2ZP0H 4DY7B 1TNGA 2ZEBA 1O2YA 3SV6A 1HAVB 3ATIA 2D1JA 3M37A 2PUXB 3LONA 3M35A 1GMDG 1HIAB 2GMTC 1TA6A 1M9UA 3BEUA 4JZFH 1EXFA 2I6QA 1SI5H 1UVUH 1X7AC 2HRVA 2DUCA 3MNXA 1E36B 1HAGE 1EUFA 4QT8C 3TH2H 3GY7A 3SNDA 2FI4E 2W5EA 1GBEA 1ZPBA 4KGAA 1HAPH 2ZFFH 3BIUH 3A82A 4WF8A 3U8OH 1MTSA 5DP6A 1YC0A 3F9EA 2PTCE 3UUZA 3Q00A 1JRTA 2GT7A 1ZMLA 1QBVH 3NK8A 4NZQA 1LDTT 1E37B 1SLVB
chains in the Genus database with same CATH superfamily
3EE7A 3F6UH 3TGJE 5KGOA 4D8NA 2L6OA 2Z9LA 1BTPA 3MFJA 5PTPA 1P11E 4WY3A 1T8LA 1AVWA 3HK3B 4A6LA 4FUJA 1T4VH 4YLUA 1BMNH 4D7GA 1DXWA 1B7XB 1GJDB 2XBXA 3LKWA 1TQ0B 2FOBA 5FHTA 1P04A 2C3SA 3UREA 5C17A 1LKAA 1C2MA 4K8YA 2Q6GA 1SL3A 3MI4A 3UR9A 4RSPA 1KTSB 2YOLA 2F9PA 4FUBA 4IS5A 3SU3A 2GDDA 4AB9A 2OTVA 1O5AB 4X8UH 2YNBA 1TFXA 1T8MA 2K1QA 1GMDF 4OS7A 1VITF 1UK4A 3GYLB 4LZ4B 4Y0YE 4GHTA 1QB9A 3P92A 1D3QB 1C2IA 4MPVA 4Y76A 1UTLM 3W1EA 1ZZZA 1O3IA 3VFEA 5A8XA 3QZRA 1FIWA 1G36A 4MNWA 4CRFA 2J2UA 2UUKB 4GSOA 2FESH 3UAIC 3ESTA 3V12A 3SU0A 1ARCA 2GCHF 3K9XB 2OBQA 1N8OC 3EAJA 3B9FH 2A4QA 1F7ZA 1K1MA 4ISOA 2ZHEH 3TIUA 2FP7B 4YM9A 5HIYA 1D3PB 3A89A 3RC6A 1DY9A 5G4BA 1YLCA 3DHKH 4SGBE 1C5NH 3TITA 2PP6A 2GCHG 2FYRA 1XUKA 2EI6A 1BTUA 2BD3A 4UFEH 4WJG2 3AK5A 3SNCA 4Z1MD 1TA2A 4HGCA 5EU8A 1ARBA 1Q31A 3E1XB 4XBDA 2W7SA 2ZHDA 4O9VA 1J15A 1MZAA 1P12E 4XBCA 1FNIA 1D3TB 4JZ1A 2OC8A 2ZFSA 3BTHE 1O0DH 4MQAA 3SW2B 1W3CA 4TY6A 1KXFA 3ZVCA 2CF8H 3BTGE 3FZZA 2J97A 2JJ1D 2O8UA 1F5KU 1TGCA 2GDEH 3EA7A 3Q3YA 4U30A 4UDWH 3ZZ8A 2XC0A 2HALA 4Y8YA 1GCTC 1GBHA 4NSYA 1AUTC 2ZHWH 3PLBA 2FLBH 3MNCA 1MKWH 3BTDE 1S84A 1QB1A 1SGFA 2J4IA 5LH8A 1SOTA 1P2KA 1O3BA 1S83A 1CO7E 1TRYA 1DFPA 3VPKA 1TGBA 2QAAA 3MO9A 4R8TB 1HXEH 1FY5A 1O5DH 2ZCKP 3HKJB 2ASUB 2H5DA 1KXDA 1H8HD 3RXBA 4ZKNU 1C1TA 2ZI2H 1SLWB 2AIQA 2FDAA 1BMAA 1CHOG 1C2GA 4INLA 3TPIZ 1ELAA 3N7DA 3U69H 2FXRA 1A61H 3BG4B 3U98H 1P9SA 4DT4A 2XCNA 2WHXA 2NU4E 1G32B 2LP6A 4JCNA 2B8OH 4XE4A 2FS9A 2VIOA 2BOKA 1GJCB 5EQQA 1QHRB 1QL9A 3SGBE 4X1RU 1PQ8A 1UVOA 1BTHH 3MU0A 4YLQH 4HTCH 2FZZA 2BX3A 1W10U 1C1VH 3MTYA 1CSOE 2ZHFH 1TMBH 1QR3E 1MU6B 1C9TA 3WWFA 2Z9GA 2NU2E 3ZZ3A 1AVGH 1TBZH 3M5MA 1FIZA 3DSOA 4K60A 1OWIA 4HZHA 3VB5A 2H6MA 1RXPA 2BDIA 1DLEA 3E3TA 1F0RA 5J4SA 1P2MA 1Z8GA 4AGJA 2P93A 2FOGA 3F0PA 3RC5A 2CXVA 3QZQA 3VEQB 2VH6A 1J17T 2ZGXH 2EEKA 4TWYA 2ALPA 1QRXA 3RXKA 1GHVH 1EAXA 1LVOA 1HJ8A 2FOCA 1P09A 1BRUP 5AFZH 1GJ6A 5KEDA 1RTLA 3FFGA 5ESBA 3DSPA 4ABBA 2PFEA 1P03A 1LCYA 2HNTF 4GAWA 4I32A 1SGTA 1C5LH 3QTOH 4X2YA 2STBE 3A7WA 3VB6A 3PM3A 4ZHMU 4DOQA 2VGCB 2PW8H 3VXFH 1DT2A 2RA0A 3A8AA 1YPHE 3U8TH 3SNBA 1S6FA 3FAOA 4PROA 1SQTA 2TIOA 2QXJA 1LHEH 2GCTC 2V3OH 5A8YA 3K2UA 8KME2 3SHAH 2SNVA 1HBTH 1TOMH 4Q7ZA 4CHAC 3RU4T 2SGAA 4MLFB 3FO8D 3EE0B 4Y10E 1NU9A 4GUXA 3KQDA 1QB6A 1XVMA 4IC6A 1TNJA 1PJPA 3LGIA 5IK2D 2P3FH 3P70B 1W11U 3KNXA 4ISLA 4AC9A 1V6DA 1AWHB 1EPTA 1UHBB 2CF9H 1FXYA 1H9HE 5HKKD 1GVKB 5C2ZA 1W0ZU 2OXSA 2BD2A 2FOMB 1O3NA 2RDLA 1HCGA 1ZHRA 4K3JA 1INCA 5FCRA 2XCFA 1AMHA 1JXPA 3BF6H 1Q2WA 2KCPA 3MYWA 1O3HA 2KR7A 1ZR0A 1XXDA 1SHHB 3MH7A 2ZU4A 1FI8A 3E16B 1O2SA 1GI3A 1TPSA 3LDXH 1BHXB 1TNHA 1IQHA 1GMHG 1MQ6A 1ZSKA 3KQBA 1O32A 1AB9C 3EYDA 4ZXYH 1WAYB 1MU8B 1UVSH 3ODDA 3RXCA 4JZIA 2OP9A 1A0HB 1TYNA 3ZZDA 1ELDE 3C1KA 1O2NA 4IN1A 1GI6A 4CR5A 2SGDE 1F5RA 2H9EH 1EPTB 3OFND 1V2VT 3HATH 5E0HA 4D7FA 4F49A 1IQNA 1W12U 2A32A 3LC5A 1YPKH 5JYIA 5DO4H 1FQ3A 4J1YA 1C5ZB 2QA9E 1SPJA 5HM9A 1FV9A 2WINI 2TGPZ 3PLPA 3PO1B 1TGTA 1SGPE 2R0KA 3RXDA 1UW7A 2KAIA 4CBNA 5FX6A 4CRAA 1E34B 1EJMA 4BNRA 4AGKA 1PQ5A 3RXFA 1GHXH 3ZVEA 3SQEE 3UOUA 1GPZA 4IMQA 1LQDB 2A5IA 1SQOA 4Q80A 1KYNA 5BRRE 4I86A 5A2MH 1DWEH 1FUJA 3B8JA 3RLWH 2G52A 1O2LA 3S69A 1FPCH 2H1UA 1G2LA 2ZPQA 4I8JA 1NRSH 3UQOA 1GI4A 4U32A 5FPYA 2RA3A 3RXMA 3E0NB 3RXJA 4CRCA 2QCYA 1Z1IA 8GCHG 5DN6D 1TMTH 3GY6A 3A85A 4ISNA 1TABE 1V2KT 2GZ8A 5ESTE 3BTQE 3RM0H 4ABAA 2BMGB 4OGXA 4JYVH 2VIWA 3P95A 3W95A 2BHGA 2YMSD 1QQ4A 3ATLA 1O39A 2KFWA 2RCEA 3ATWA 2ANKH 1V2UT 2PSXA 5LGOA 2PUQH 4K2YA 3U9AH 3QTVH 2CJIA 1O3JA 2QF3A 1SMFE 3P8NA 2AGGX 3NWUA 2KCYA 3IG6B 3P6ZB 2XBYA 2BVXH 1S82A 5IYTA 1D3DB 2W6JD 5GIBA 1HLTH 3M7TA 4X2VA 4AB8A 1TBQH 4ZKOU 3AAUA 3OYPA 5EODA 1EZSC 1V2JT 1GBDA 1QIXB 4BANB 2XWBI 4FETA 2Z3EA 5AF9H 1CT4E 1D9IA 1VCQA 1P2JA 1GJ9B 1EP6A 5FX5A 1UTJA 5E2PA 4FOUC 1VJAU 6ESTA 5EW1H 1C4U2 1C1QA 3TH3H 3QLPH 2LNCA 1W13U 1OWEA 4Y79A 5DP8A 1SSXA 4ZROA 1NFWA 3M61U 3PV2A 1LQEA 4CRBA 1RGQA 1ID5H 4FUFA 3MNBA 4BXSA 3PRDA 2OQ5A 4O03A 1V3XA 2M2AA 5TCCA 3SJ8A 1Y3YA 1FONA 1OS8A 4Q7XA 4J2YB 1O3FA 2BVSH 3TVJB 2ZPRA 3Q76A 3ZZCA 1G2MA 1DE7H 1Z6JH 2A7JA 4B74A 2TBSA 1K9OE 3Q77A 4AG1A 2ZDAH 2ZC9H 1FJSA 1IQFA 2HGTH 3QN7A 3RMLH 2CV3A 2A4GA 4LXBH 2PLXA 4I8HA 1B5GH 1HXFH 2VWLA 5JBAS 3RMOH 1PPEE 1NPMA 1AI8H 1H9IE 3SUEA 2OQUA 1LVBA 4KTUA 1LPZB 2BYAX 4CRDA 4K1EA 7GCHF 3AW1A 3AASA 3NXPA 3DFJA 3T62A 3KQCA 1IQLA 1XUFA 5EXMA 2OBOA 1FLEE 4WMDA 2GT8A 1DWCH 1CGHA 4NFEA 3M5NA 4FXGH 3T2NA 2B7DH 4GVUA 1UTMA 1NN6A 1LHCH 1CHGA 4X6OA 3SUFA 5SGAE 4DG4A 5EIYA 4WVPE 1GHAF 1CVWH 3QX5H 3KCGH 1UMAH 3P17H 4GCHF 1O3LA 1O2MA 1P8VC 1W0YH 1TMUH 3A7TA 4LK4A 1GJAB 4A1TA 2V7QD 1WUNH 1LKBA 3QDZB 1JOUB 1KLJH 1P3CA 1XKBC 2YMSC 1DS2E 2WYJA 1OP2A 3UFAA 4YOIA 4Z6AH 3MNSA 1TX8A 4KTCA 1THPB 3VG8A 2JH0D 5EG4A 2G55A 2OK5A 2FI5E 2P3TB 9ESTA 3M3VA 4ZKRU 1H9LB 2HPQH 2H9TH 3RXTA 1MTNC 4MNXA 2WPKS 2F91A 7GCHG 2FLRH 1NRNH 4CR9A 2C4FH 2FOFA 2EI8A 1AD8H 2XTTB 4IW4E 2PGQB 1JRSA 2XNIA 5EOKA 2K8IA 3RMMH 4CRGA 1P0SH 3SNEA 3F2HA 3BSQA 2R0LA 1DICA 1EPTC 6LPRA 2R9PA 3V7TA 1QTFA 3TJUA 4ISHH 1F92A 2HOBA 4Y7BA 3PMAB 4Y0ZE 1NT1A 4DURA 2H2ZA 3M36A 4X8TH 3D49H 4NA9H 5CE1A 3QWCH 3SU1A 4X6PA 4DVAU 1JWTA 1GJ4H 1LVYA 5C94A 1SG8B 1ZPZA 2ZNKH 2KCOA 2O8LA 4H4FA 2Y80A 2G81E 3LH3A 1GBAA 5T1VA 1O2RA 2ZQ2A 5F6MA 4X2WA 4IMZA 1BBRE 3NKKA 2M5TA 1YYY1 3FP6E 4TY7A 6GCHG 2KCAA 1A3EH 1QA0A 1YCPH 2F9BH 2IJOB 4YXWD 5C3NA 1YF4A 3A80A 1A0JA 1GBLA 1ACBE 2P59A 4FU8A 2J38A 1BMMH 4X1NU 4B1TA 1GJBB 5EJ1A 3TK6A 4OGYA 1OWKA 5EGMA 1L0ZA 1HFDA 1O3EA 1E1QD 2PKAB 3LGVA 3ZYEA 3SV7A 1WQVH 3RXIA 1Y8TA 5H4IB 1SGNE 1Z8JB 1UTOA 4XFQA 2Q6DA 4XSKU 1LPGB 1BBRK 1D4PB 4ABGA 4BAKB 7ESTE 3RXSA 1J14A 1QNJA 4E05H 1IAUA 4BTUB 1H8IH 4HI3A 1ELVA 2GGVB 3M5OA 2R3UA 3KYGA 2SGFE 3P8FA 1O30A 1TIOA 3FP7E 3MO3A 2SFAA 1K1NA 1XM1A 3SU4A 2V3MA 4NCYA 4A5TS 2OCVB 1EZQA 2FOEA 5JBTA 2FOAA 3OEHD 2YMSB 1OXGA 5JBCS 1RTFB 3RMNH 1BBRH 1PPGE 1O2IA 1WQSA 2P3UB 1F2SE 3RUOA 1GHAG 2G51A 2AEIH 1O3MA 4NSVA 1F0TA 2KX4A 3BTTE 1O2QA 1O2HA 3ZZ4A 3SJIA 4AFSA 3L6PA 5C1UA 3NZIA 2CHAB 1ANEA 1MMJN 4A7IB 2NU3E 3HGPA 3NCLA 3O8RA 5A0CA 3LGWA 3SU6A 1UO6A 5F53A 4RT0A 2WPLS 3KQ5A 2UWPA 1YKTA 4YT7H 1NY22 1IQMA 2P8OB 1N6XA 1AE8H 3ZZ7A 3SV9A 1T31A 1HYLA 3DT0H 2IOTA 3TNSA 5F8TA 2C8YB 1GBKA 5B6OA 5C20A 4FUHA 1XUIA 3HGNA 1C2JA 4HFPB 1OHHD 3A7VA 3EDXB 1NBMD 3PTNA 4ZAEA 3A84A 1RRKA 3T26A 1W7XH 2TGAA 1QQUA 1C5OH 1HAHH 1EX3A 3A7ZA 2QF0A 2GX4A 1FPHH 3SZEA 3C27B 3E0PB 1S0RA 3PV4A 3STIA 4INKA 2BY5X 2ZDNA 1YPHC 2ZU1A 1YPJH 3CS7A 1GI2A 2VWOA 1SQRA 2ZECA 2BB4A 1TE0A 2WUCA 3JZ2B 3S7KB 3UTUH 2OC0A 4AX9H 2Z3DA 3BTEE 1VCWA 2W3KA 2Y5GA 1BTXA 3MU8A 2VIVA 1YPGH 1A46H 1C4V2 1QJ6B 1K21H 1EB2A 2D2DA 2ZIQH 2F83A 3EQ0H 4RI0A 5C0UA 4BAOB 3H7TA 1O3PB 5E2OA 1TGSZ 5HMAA 2HNTC 4JZEH 3SJOA 2Z6BD 3E91A 1GI5A 3EA9A 3ITIA 1SVPA 1HDTH 8GCHF 3B23B 4MG3A 1DVAH 3LGUA 3QGJA 3ZIAD 1BRBE 1Y59T 3ZZBA 2A5AA 2VU8E 1AZZA 3OEED 5DP4A 1BHXF 1C5XB 1EZXC 4ZKSU 4E7NA 1BZXE 1RD3B 1AE5A 3BG4C 2KM0A 1GMCF 1WU1A 4SGAE 4CBOA 3KN2A 2O8WA 1BCUH 4K1TA 1K2I1 2BD7A 4NA7A 1S85A 2ZCHP 1TWXB 1N8OB 3GY3A 1BTYA 3RLYH 1BJUA 1SLXB 3GCTF 2PSYA 2G4UA 3UR6A 4IBLH 4NWKA 1EAIA 2G8TA 2WUBA 2Y7ZA 3I78A 3ENSB 3GISB 2IN2A 5DKMA 3WWBA 1HB0B 3O8DA 2ZGBH 1AFQB 1NFUA 3GDSA 1EP5A 1SGYE 1W14U 3UNQA 1GHWH 2BDAA 4GLYA 1VITG 1K1IA 2FTMA 1UHBA 1ZGVA 1L1JA 1TPAE 4Q7YA 3HPTB 1LPKB 1OYTH 3GY2A 4AFQA 4IN2A 1GBCA 1C1NA 4I8LA 1SLUB 3LJJA 1NESE 2WZQA 1V2NT 1AFEH 3NUMA 1A5GH 1OYQA 1KLTA 4H6SB 5EW2H 2QC2A 5FBIA 1BTWA 5K7RA 3MH4A 1GBTA 1LHFH 1NFXA 2AMDA 2TRMA 5AVDA 3PWBA 4CREA 3TNTA 2FX4A 1MABB 1O31A 3GY8A 3H7OA 4M9FA 1ZTJA 4ZH8A 4FUEA 4RKJB 1THSH 1YPLH 1TNIA 1K0HA 4X8VH 2CN0H 1KXCA 2IPHA 1V2QT 5I46H 3DUXH 2FEQH 1O5CB 4LOYH 1TPOA 5BPEA 4K5ZA 3N99A 2GZ9A 4AFUA 3M3SA 1IQKA 1UK2A 3ZZAA 1COWD 5FBEA 3TJNA 6CHAC 4YESB 3D23A 1S6HA 1NC6A 1MKWK 3A83A 2VNTA 3ZVBA 4B71A 1EASA 2AMQA 2TGTA 1MKXK 1E35B 1YCPM 1D6RA 2QN5T 3AAVA 2ZFQH 4ESTE 1A1RA 1GMHF 3UIRA 3S9AA 1C5QA 5LPFA 2WPMS 1A0LA 4H42U 1OPHB 2BLVA 1KSNA 2AFQB 1MBQA 1UTPA 2ZU5A 1GHZA 4FUCA 4YZUA 3SBKA 2H9HA 1IQJA 1VR1H 1C1PA 4AFZA 1DITH 3AVZA 3F68H 3SI3H 1Z1JA 3ODFA 2ZTYA 3PMBB 2XRCA 4ABHA 3BG8A 1J16A 3TK9A 1P06A 3TH4H 1FN6A 1WTHD 5GJ4B 2A7HA 3BTWE 3F2FA 1O2WA 2BXUH 1ABIH 4AYVB 4NWLA 3RP2A 3ZV9A 2ZCLP 3Q3XA 3T25A 1GL1A 1GI0A 3GCHC 5DK1A 1HJ9A 2UWLA 2GP9B 4I8GA 7KMEH 1LHDH 2FX6A 1U6QA 1AUJA 2VWNA 3FN8A 1FZZA 5JDUB 5EJZA 1SFQB 1OOKB 3VXEH 3BN9A 3G01A 5K0HA 4TT3D 1O36A 3BEFB 1GI7B 2G5VA 3GCTG 1HV7A 1XXFA 8LPRA 1MUEB 1CT2E 3BIVH 1IHSH 3U28C 1S6LA 1BJVA 1ELGA 1DANH 3FKSD 1O2XA 3S0NA 3A8CA 3A88A 1FX0B 2PV9B 1BA8B 2QIQA 1Z6EA 2Z7FE 1AY6H 2OC7A 2FM2A 1BITA 2XW9A 3UY9A 2ZDLA 3A87A 1D6WA 4BXWA 2XBWA 4P00A 2FMJA 3L3TA 4CHAB 2Q1JA 3UOPA 4OS6A 4I7YH 1ELCA 2HNTE 2SGPE 4DIHH 5DP7A 1IQEA 1A2CH 1O3OA 3CP7A 5AFYH 2O9QA 2AIPA 1O35A 5FXLA 2BDBA 1CGIE 1SR5C 3D62A 3KIDU 3PB1E 2Z3CA 3EGKH 3LOXA 2PWXA 1HAYB 5I25A 1P3EA 4THNH 2QV1A 1IHTH 1DPOA 1HNEE 5CHBA 3ZZ5A 1NRRH 2GTBA 4ZMAH 5E0GA 1GVLA 2KZ4A 1FY3A 3CNRA 3PYHA 1O2VA 2LELA 5CMXH 1GI9B 1HAOH 1UCYH 1A7SA 2QF5A 1E38B 3DFLA 1XX9A 1O38A 1GVZA 2STAE 1TNLA 3MWIU 2AH4X 2ILNA 5DP3A 1YWUA 1QBNA 1QL7A 5EPYA 4MDSA 3ZVAA 1T8NA 2VGCC 1P02A 2ZO3H 1CA0B 1ESAA 2YNAA 1DUEA 1CHOF 1Z8IB 3KQEA 1LVMA 1P05A 2OC1A 3A7XA 1NFYA 2ZF0H 5EXNA 1VJ9U 2CHAC 1C2HA 3K6YA 3BEIB 2HWLB 3KL6A 1G30B 5L2YH 1KXBA 1V2MT 4ACBA 3RXQA 2ODQA 2J9NA 3AW0A 2ODPA 1YP9A 3WY8A 5DP5A 1NBME 5KECA 2BZAA 1NZQH 3PRBA 1BT7A 2V6NA 1FAXA 1UVPA 1NS3A 3PMHB 1Y5UT 3GDVA 3MOCA 1A4WH 3A8DA 4K69A 3KEEA 6CHAB 4MNVA 1DLKB 1NO9H 5L6NH 3Q3KA 1P57B 2GD4B 2XNDD 2FTLE 3JZ1B 5FCKA 3SN8A 1CQQA 2K0QA 5EPNA 2ZG0H 4OS4A 1B0FA 1BTZA 1SC8U 2PGBB 1NRPH 1XUGA 3LC3A 1UTNA 1ELBA 1EAUA 1VZQH 2CMYA 3DD2H 1GBFA 3ZZ9A 1NM6A 3SV2H 2BY8X 4BOHA 2VH0A 4A92A 5DP9A 3RM2H 1EZUC 2PKSB 3LIWA 3ZVFA 5JB9S 1MCTA 5F8ZA 3T29A 1FY4A 5GDSH 1AZ8A 3A86A 2AGIX 2ZGHA 1TONA 5ETXA 9LPRA 3LJOA 1N1LA 1BMFD 3UB0A 3RXHA 2EC9H 2SGQE 4YTAA 3SZNA 1UCYK 2ZWLH 1KDQB 4B2BA 1O5FH 4VGCB 2EQNA 1VCPA 3PWCA 2A4OA 1MTVA 1W0KD 2F4LA 2PKAA 4B2AA 1V2TT 4NIXA 2BD4A 2UUJB 5IDKA 3ELAH 2BX4A 3STJA 2VVVA 3SV8A 3RU4D 1GG6B 5GWZA 2XOKD 1YPEH 3DA9B 4BAHB 1AHTH 2BM2A 2BDCA 1JIMA 3E90B 3RXPA 4VGCC 3A81A 2W26A 1GGDC 3LPRA 1ANBA 2V0BA 1O33A 1FY1A 1FY8E 1MAXA 1Y3UA 1OSSA 2AERH 1XVOA 4OS1A 2ZDVH 3VB3A 3GY4A 1DY8A 3RC4A 1FMGA 2F9VA 1EAWA 3URDA 5C5OA 5C5NA 1TAWA 4UFDH 4OS2A 4IGDA 4X8SH 2QXIA 2XWAA 1ANDA 1TB6H 2ZHQH 2ZZUH 1CBWB 2H5CA 1OP8A 4OM9A 1G3EA 1JIRA 4Y71A 4I31A 1E79D 3SUDA 1O2ZA 2FYQA 5CHAB 4NIWA 2EI7A 5L30H 1DWBH 4CH8B 3MU1A 1XUJA 3NRLA 5GPIB 2OINA 1MAYA 1T8OA 2GCTB 1GL0E 2Z9IA 1VGCC 1PPZA 2BTCE 4WXIA 1QURH 1YLNA 2I6SA 3OY5U 1FDPA 1A5HA 1UTKA 4X2XA 2O8TA 1L4ZA 1W7GH 3RXUA 2F9NA 3MMGA 1VGCB 1C5PA 1PYTC 1KXEA 4M7GA 3OAAD 1GDNA 1OWJA 1O3DA 1C1WH 4NIYA 4E7RG 1MTNB 3PLKA 1YGCH 2XC5A 4Y8XA 3V3MA 4GPGA 2ZU2A 3SOSA 2J98A 3TJOA 3M7QA 2P16A 1ZTKA 4AG2A 3OTJE 3URCA 1SOZA 1DSTA 1NRQH 1SGFG 1TGNA 4YOGA 1C5RA 1GMCG 1EOJA 1O34A 1SGQE 3P8GA 3GS9A 4X1QU 3K65B 2J94A 3A7YA 4D9RA 3TGKE 1AGJA 1F0SA 1SGRE 3T28A 2ODYB 2BVRH 1IOEA 4UFFH 2XBVA 1KXAA 1LHGH 2SNWA 2B5TB 2BOHB 4A1VA 1ETRH 3F9FA 4ACAA 2F9OA 2BLOA 1C1MA 3SU5A 1DDJA 5A09A 1ZMNA 4Q63A 3BTME 1ZSLA 3BTKE 1QY6A 2A2QH 2B0FA 3DSGA 2GJGA 4Z0KA 3SNAA 3SGQE 3BTFE 4X6MA 1AQ7A 3LH1A 5A8ZA 1DX5M 2FO9A 1EATA 1GDQA 1ZOMA 1AO5A 4D9QA 1CGJE 4GHQA 3UWIA 2XYAA 1TRMA 3OX7U 2HVXA 2F9UA 3F0OA 2J92A 2A2XH 1ETTH 1QFKH 1F0UA 1HPGA 3LGTA 1O3AA 1RJXB 1TX7A 2AMPA 4DIIH 1TNKA 1TQ7B 3U1JB 4UE7H 1V2ST 2W6ID 3SU2A 5JBBS 1TALA 3BV9B 1H8ED 1GHYH 2BQ6B 4H6TA 2BD5A 1CU1A 2V3HH 4ABDA 5J4QA 3GCHB 4WMFA 4INHA 2C8ZB 3MHWU 4BTIB 3S7HB 5TCAA 5A0BA 1UCYE 4NZLA 2A5KA 2Q6FA 3QK1A 1HJAB 1KIGH 1O2PA 2DE9A 1CT0E 3PMJA 4JMYA 1DUAA 2A45B 4MPUA 1QL8A 2ZKSA 1ABJH 4RT1A 1GBIA 1K1LA 1P2NA 1BRAA 1YLDA 2W7UA 1WV7H 5GCHG 5T6FA 2PTNA 4ZXXH 1BIOA 3CS0A 5C0TA 3UQVA 1ELTA 4K8BA 1PQ7A 1ZLRA 2GV7A 2VIDA 1ZJDA 2R3YA 4WH8A 3RXRA 1WXRA 2BQ7B 1CE5A 3ZZ6A 5T6DA 2HVYB 2WPDD 3VGCB 1K1JA 2UWOA 2GZ7A 5T6GA 1ZYOA 4ABFA 1QJ1B 1EOLA 2Y81A 1L2EA 1ZHMA 1GBJA 4FU7A 1JBUH 1W8BH 1GBBA 4UD9H 4Y6DA 3D65E 2QE7D 1QZ8A 4O97A 3MU5A 1O3CA 1J8AA 3VB4A 1P10A 2VINA 1UK3A 3F9HA 2ULLA 4FUGA 4I8KA 3RXGA 2AGEX 4B6FA 2FOHA 4AORA 1IQGA 4ASUD 3F2GA 1ZGIA 4TYDA 1ETSH 2Z9KA 2OD3B 1MKXH 2FPZA 3HK6B 3TJVA 2RG3A 5FL7D 3SGAE 4FU9A 8ESTE 3KYFA 5HGGA 4NG9H 4U01A 2R2WU 2ANWA 1SGEE 5LPEA 3UNSA 2C90B 3QGNB 1UVTH 2JH6D 2XXLA 1RIWB 2A7CA 5GCHF 1CBWC 1O2UA 1ZRKA 2VWMA 4YO9A 3RXOA 1WTGH 2JIZD 4TWWA 2GVFA 4FUIA 1C2EA 1O2TA 2VIPA 2BLQA 2JDID 1MD8A 3UWJH 3RXAA 1NROH 2Y7XA 2EA3A 1O2KA 3SQHE 1C5MD 2G5NA 5F03A 4FUDA 2AHME 1V2OT 1GJ8B 4MPXA 2ESTE 1OWDA 4BAQB 3QO6A 4MPWA 1Y5AT 1Z71A 3TU7H 1ESBA 3RXLA 2WPIS 3F9GA 3GOVB 2BDGA 5TJXA 5T3HA 3M7UA 4B75A 1C1OA 1TLDA 1V2RT 1OWHA 1RS0A 5DPAA 3PROA 2Y5FA 4B73A 1Q3XA 1PPCE 2ZGCA 2GMTB 2ZQ1A 1ZTLA 4CH2B 4X1PU 1BMLA 1VITH 1EB1H 1TX6A 4JZDH 4E06H 4ABEA 3PV5A 4RKOB 2QGRA 3ZV8A 3V0XA 1O5GH 1NU7B 3R3GB 4B76A 4ZHAA 5DG6A 4MVNA 3OU0A 1XMNB 4UEHH 2A4RA 1FN8A 1GDUA 1C2FA 5EQSA 3SJKA 1AKSB 1K22H 2G00A 5A0AE 2TPIZ 4U2WA 2ZA5A 4F48B 3ZYDA 1Z7KA 3IWMA 4NIVA 4NA8A 1C4Y2 1YM0A 4O3UA 1C2DA 4XRNA 1SHYA 1GJ5H 1GG6C 4JYUH 1EQ9A 2QY0B 3K6ZA 4Y11E 2NWNA 2R2MB 1SGDE 3E8LA 1N6YA 5DJ7A 3W94A 1P2QA 1B0EA 5LPRA 1AFQC 2V35A 2ZTZA 4AOQA 1GWAA 5CDFE 3T5FH 4WH6A 2JETC 3MO6A 2WV5A 1HRTH 1HIAA 1OX1A 2BXTH 5AHGH 1A3BH 2XC4A 3RXVA 5HXFA 3GICB 4UONA 1ZJKA 1RFNA 2TGDA 3ATMA 2C93B 2ZTXA 3TLOA 1L1GA 2FS8A 3EA8A 3U1IB 1GBMA 2JH5D 4RN6A 5HYOA 1L1NA 1QJ7B 1TPPA 2ANMH 2BY7X 4UFGH 1E1RD 4XDEA 1RIWC 3GDUA 4TSFD 1MZDA 2B9LA 2J34A 3LGYA 2D26C 4ABJA 2P8OC 3WW7A 1TOCB 3FP8E 2IPQX 3KHVA 3A8BA 1VKYA 1QA7A 1KY9A 1S0QA 1SFIA 3T27A 4KTSA 2BDYA 4DT7B 1C5YB 1CA0C 1C2LA 1O2GH 2D8WA 1O37A 5CHAC 1SB1H 1MBMA 1J9CH 1ZHPA 2ANYA 5EJLA 2VIQA 3F3BA 1T32A 2WSSD 1KTTB 3E6PH 3ZVDA 4TPYA 1P01A 3MQKC 2QXHA 1WYKA 1HAZB 4ISIH 1G3BA 1GCDA 1ZSJA 4BTTB 3OTPA 3RU4E 3I77A 4ZCNA 1DSUA 4ABIA 4NGAH 2J98B 4XBBA 4A1XA 2L74A 3O8BA 3OY6U 4KP0A 3O8CA 1HAVA 1TBRH 2G4TA 2W3IA 3VGCC 4ASHA 1EJAA 1EJNA 2CK3D 2ZPSA 1C5WB 1KDQA 1UJ1A 1HUTH 2WV9A 3SUGA 1HAXB 1P2OA 1G3DA 1OKXA 3FOAA 3KGPA 4JK6A 3FANA 1AKSA 3PO1C 3ATKA 1QRZA 1C5SA 1HJAC 3OE7D 1YBWA 3DCLA 1C1UH 3TGIE 4BAMB 3I29A 5EQRA 5ABWA 4B2CA 1BRCE 1BOQA 1JMOH 1GCTB 2FWWA 1PQAA 4WWYA 4ZUHA 3FZDA 3MH6A 1V2PT 1Y5BT 1P2IA 1PPBH 1W0JD 2Y6TA 2CGAA 2THFB 4JYTA 4TPIZ 1FAKH 1CA8B 2F43B 1K1PA 5C1XA 2VVUA 2ZDKA 2C8WB 2ALVA 1XUHA 3MU4A 3SJ9A 1ELFA 1O5EH 1WSSH 1WCZA 5DSFA 4Y8ZA 4ZHLU 1C9PA 1G3CA 1T7CA 1C2KA 1O3GA 2FI3E 1IQIA 3RXEA 1GI8B 1HGTH 3QUMP 4B6EA 2ZFRH 2A1DB 1C1RA 5C1YA 3U8RH 1E0FD 4DW2U 3S9BA 4X0WU 3KF2A 1H4WA 1V2WT 4Q2KA 2WYGA 3CENA 3GCNA 1SGCA 2Z9JA 1K1OA 3GY5A 3M3TA 1MQ5A 2AYWA 1S5SA 1LO6A 1A5IA 1T4UH 2P95A 5E8EH 2JETB 3GYMA 1PPFE 1GGDB 1F5LA 1K28D 5GXPA 2VB0A 1WDIA 3NPSA 2BD9A 1BDAA 1BUIA 5C67A 3PTBA 3HKIB 2PR3A 2WV4A 1PPHE 1WBGB 2OUAA 2PKSC 4NFFA 3H5CB 2ZDMA 2OLGA 1W2KH 2F3CE 4Q4LA 4XD7D 1KLIH 1PFXC 2FIRH 2A0QB 4KKDA 3UPEA 3UNRA 1BB0B 1QCPA 5E0JA 2HLDD 2WPJS 5F8XA 7LPRA 2ZGJA 1GI1A 4O3TA 1Y3WA 1YPMH 4X1SU 3OSYA 2VVCA 1V2LT 3MH5A 1ELEE 4F55A 2VJ1A 5HM2A 3SORA 3F1SB 1C5VA 2BLWA 4WXVA 1C5UA 4DGJA 2QF4A 1GHBG 2PHBA 4YOJA 2LPRA 5FPTA 4DCDA 3TK5A 1QBOA 4AZ2B 1P9UA 1AU8A 2UUYA 1GJ7B 4F4OC 1YCPK 1WOFA 1Z8RA 2VBCA 5FPSA 2NU1E 3ZVGA 4R0IA 2BD8A 1AIXH 1O2JA 1EKBB 1UTQA 3M5LA 3GCOA 2ZU3A 2GV6A 4Y7AA 1G37A 2Z94A 4I33A 2GKVE 5HIZA 4AYYB 1PYTD 6GCHF 1DM4B 2KAIB 1ZRBA 5GNDA 1L4DA 4JK5A 1DWDH 2JKHA 3RDZA 1ZPCA 2A31A 4MNYA 3LT3A 3P8OA 1MCVA 2BZ6H 3IITA 2BY9X 2DE8A 1TRNA 2C8XB 2WPHS 2AS9A 1AB9B 4WMEA 1KMHB 1Y3VA 2UUFB 4K1SA 2BQWB 5FAHA 2Y82A 1H8DH 5DGJA 1HAIH 2NU0E 4P02A 1YY3A 2JJ2D 2HLCA 1DXPA 1MTUA 1MD7A 1O5BB 1SGIB 1Y3XA 1MH0A 2P94A 3L33A 3N7EA 4AN7A 1SKYE 2FODA 5JPMH 4IC5A 5EXLA 1ESTA 1C5TA 1BQYA 1H1BA 1ORFA 1QRWA 2RFKC 1AVXA 3FVFB 4FVDA 1ANCA 1O3KA 4OS5A 1GHBF 2HPPH 2SGEE 5L2ZH 4D76A 4XOJA 2J95A 1OP0A 2Y5HA 3V13A 4KELA 1AN1E 3N7OA 2BY6X 4FVBA 1MTWA 1O2OA 4DJZB 2BDHA 4HG6A 2ZFPH 3LU9B 3SHCH 3SI4H 1DOJA 1LMWB 2ZFTA 1S81A 3H09A 3VB7A 2O8MA 1XKAC 3S9CA 2QYIA 1G9IE 5JB8S 1C1SA 3R0FA 1THRH 1SQAA 2IJD1 1LTOA 1SBWA 4X6NA 1RTKA 3SO3A 2QXGA 4YT6H 4LZ1H 1ZMJA 4MTBA 1AWFH 3SYJA 4GCHG 1NTPA 1QGFA 2ZP0H 4DY7B 1TNGA 2ZEBA 1O2YA 3SV6A 1HAVB 1EFRD 3ATIA 2D1JA 3M37A 2PUXB 3LONA 3M35A 1GMDG 1HIAB 2GMTC 1TA6A 1M9UA 3BEUA 4JZFH 1EXFA 2I6QA 1SI5H 1UVUH 1X7AC 2HRVA 2DUCA 2RDEA 3MNXA 1E36B 1HAGE 1EUFA 4QT8C 3TH2H 3GY7A 3SNDA 2FI4E 2W5EA 1GBEA 1ZPBA 4KGAA 1HAPH 2ZFFH 3BIUH 3A82A 4WF8A 3U8OH 1MTSA 5DP6A 2EY4C 1YC0A 5B6LA 3F9EA 2PTCE 3UUZA 3Q00A 1JRTA 2GT7A 1ZMLA 1QBVH 3NK8A 4NZQA 1LDTT 2J5UA 1E37B 1SLVB
chains in the Genus database with same CATH topology
3F6UH 3TGJE 4D8NA 2Z9LA 1BTPA 3MFJA 5PTPA 1P11E 4WY3A 1T8LA 1AVWA 3HK3B 4A6LA 4FUJA 1T4VH 4YLUA 1BMNH 4D7GA 1DXWA 1B7XB 1GJDB 2XBXA 3LKWA 1TQ0B 2FOBA 5FHTA 1P04A 2C3SA 3UREA 1LKAA 1C2MA 4K8YA 2Q6GA 1SL3A 3MI4A 3UR9A 4RSPA 1KTSB 2YOLA 2F9PA 4FUBA 4IS5A 3SU3A 2GDDA 4AB9A 2OTVA 1O5AB 4X8UH 2YNBA 1TFXA 1T8MA 2K1QA 1GMDF 4OS7A 1VITF 1UK4A 3GYLB 4LZ4B 4Y0YE 4GHTA 1QB9A 3P92A 1D3QB 1C2IA 4MPVA 4Y76A 1UTLM 1ZZZA 1O3IA 3VFEA 5A8XA 3QZRA 1FIWA 1G36A 4MNWA 4CRFA 2J2UA 2UUKB 4GSOA 2FESH 3ESTA 3V12A 3SU0A 1ARCA 2GCHF 3K9XB 2OBQA 1N8OC 3EAJA 3B9FH 2A4QA 1F7ZA 1K1MA 4ISOA 2ZHEH 3TIUA 2FP7B 4YM9A 1D3PB 3A89A 3RC6A 1DY9A 5G4BA 1YLCA 3DHKH 4SGBE 1C5NH 3TITA 2GCHG 2FYRA 1XUKA 2EI6A 1BTUA 2BD3A 4UFEH 4WJG2 3SNCA 1TA2A 4HGCA 5EU8A 1ARBA 1Q31A 3E1XB 4XBDA 2W7SA 2ZHDA 4O9VA 1J15A 1MZAA 1P12E 4XBCA 1FNIA 1D3TB 4JZ1A 2OC8A 2ZFSA 3BTHE 1O0DH 4MQAA 3SW2B 1W3CA 4TY6A 1KXFA 3ZVCA 2CF8H 3BTGE 3FZZA 2O8UA 1F5KU 1TGCA 2GDEH 3EA7A 3Q3YA 4U30A 4UDWH 3ZZ8A 2XC0A 2HALA 4Y8YA 1GCTC 1GBHA 4NSYA 1AUTC 2ZHWH 3PLBA 2FLBH 3MNCA 1MKWH 3BTDE 1S84A 1QB1A 1SGFA 2J4IA 5LH8A 1SOTA 1P2KA 1O3BA 1S83A 1CO7E 1TRYA 1DFPA 3VPKA 1TGBA 2QAAA 3MO9A 4R8TB 1HXEH 1FY5A 1O5DH 2ZCKP 3HKJB 2ASUB 2H5DA 1KXDA 3RXBA 4ZKNU 1C1TA 2ZI2H 1SLWB 2AIQA 2FDAA 1BMAA 1CHOG 1C2GA 4INLA 3TPIZ 1ELAA 3U69H 2FXRA 1A61H 3BG4B 3U98H 1P9SA 2XCNA 1G32B 2NU4E 4JCNA 2B8OH 4XE4A 2FS9A 2VIOA 2BOKA 1GJCB 5EQQA 1QHRB 1QL9A 3SGBE 4X1RU 1PQ8A 1UVOA 1BTHH 3MU0A 4YLQH 4HTCH 2FZZA 2BX3A 1W10U 1C1VH 3MTYA 1CSOE 2ZHFH 1TMBH 1QR3E 1MU6B 1C9TA 2Z9GA 2NU2E 3ZZ3A 1AVGH 1TBZH 3M5MA 1FIZA 4K60A 1OWIA 4HZHA 3VB5A 1RXPA 2BDIA 2H6MA 1DLEA 3E3TA 1F0RA 5J4SA 1P2MA 1Z8GA 4AGJA 2P93A 2FOGA 3RC5A 2CXVA 3QZQA 3VEQB 2VH6A 1J17T 2ZGXH 2EEKA 4TWYA 2ALPA 1QRXA 3RXKA 1GHVH 1EAXA 1LVOA 1HJ8A 2FOCA 1P09A 1BRUP 5AFZH 1GJ6A 1RTLA 3FFGA 5ESBA 4ABBA 2PFEA 1P03A 1LCYA 2HNTF 4GAWA 4I32A 1SGTA 1C5LH 3QTOH 4X2YA 2STBE 3A7WA 3VB6A 3PM3A 4ZHMU 4DOQA 2VGCB 2PW8H 3VXFH 1DT2A 2RA0A 3A8AA 1YPHE 3U8TH 3SNBA 1S6FA 3FAOA 4PROA 1SQTA 2TIOA 2QXJA 1LHEH 2GCTC 2V3OH 5A8YA 3K2UA 8KME2 3SHAH 2SNVA 1HBTH 1TOMH 4Q7ZA 4CHAC 3RU4T 2SGAA 4MLFB 3EE0B 4Y10E 1NU9A 4GUXA 3KQDA 1QB6A 1XVMA 4IC6A 1TNJA 1PJPA 3LGIA 2P3FH 3P70B 1W11U 3KNXA 4ISLA 1V6DA 1AWHB 1EPTA 1UHBB 2CF9H 1FXYA 1H9HE 1GVKB 5C2ZA 1W0ZU 2OXSA 2BD2A 2FOMB 1O3NA 2RDLA 1HCGA 1ZHRA 4K3JA 1INCA 5FCRA 2XCFA 1AMHA 1JXPA 3BF6H 1Q2WA 3MYWA 1O3HA 1ZR0A 1XXDA 1SHHB 3MH7A 2ZU4A 1FI8A 3E16B 1O2SA 1GI3A 1TPSA 3LDXH 1BHXB 1TNHA 1IQHA 1GMHG 1MQ6A 1ZSKA 3KQBA 1O32A 1AB9C 3EYDA 4ZXYH 1WAYB 1MU8B 1UVSH 3ODDA 3RXCA 4JZIA 2OP9A 1A0HB 1TYNA 3ZZDA 1ELDE 3C1KA 1O2NA 4IN1A 1GI6A 4CR5A 2SGDE 1F5RA 2H9EH 1EPTB 1V2VT 3HATH 5E0HA 4D7FA 4F49A 1IQNA 1W12U 2A32A 3LC5A 1YPKH 5JYIA 5DO4H 1FQ3A 4J1YA 1C5ZB 2QA9E 1SPJA 5HM9A 1FV9A 2WINI 2TGPZ 3PLPA 3PO1B 1TGTA 1SGPE 2R0KA 3RXDA 2KAIA 4CBNA 5FX6A 4CRAA 1E34B 1EJMA 4BNRA 4AGKA 1PQ5A 3RXFA 1GHXH 3ZVEA 3SQEE 3UOUA 1GPZA 4IMQA 1LQDB 2A5IA 1SQOA 4Q80A 1KYNA 5BRRE 5A2MH 1DWEH 1FUJA 3B8JA 3RLWH 2G52A 1O2LA 3S69A 1FPCH 2H1UA 1G2LA 2ZPQA 4I8JA 1NRSH 3UQOA 1GI4A 4U32A 5FPYA 2RA3A 3RXMA 3E0NB 3RXJA 4CRCA 2QCYA 1Z1IA 8GCHG 1TMTH 3GY6A 3A85A 4ISNA 1TABE 1V2KT 2GZ8A 5ESTE 3BTQE 3RM0H 4ABAA 2BMGB 4OGXA 4JYVH 2VIWA 3P95A 3W95A 2BHGA 1QQ4A 3ATLA 1O39A 2RCEA 3ATWA 2ANKH 1V2UT 2PSXA 5LGOA 2PUQH 4K2YA 3U9AH 3QTVH 2CJIA 1O3JA 2QF3A 1SMFE 3P8NA 2AGGX 3NWUA 3IG6B 3P6ZB 2XBYA 2BVXH 1S82A 5IYTA 1D3DB 5GIBA 1HLTH 3M7TA 4X2VA 4AB8A 1TBQH 4ZKOU 3AAUA 3OYPA 5EODA 1EZSC 1V2JT 1GBDA 1QIXB 4BANB 2XWBI 2Z3EA 5AF9H 1CT4E 1D9IA 1VCQA 1P2JA 1GJ9B 1EP6A 5FX5A 1UTJA 5E2PA 6ESTA 1VJAU 5EW1H 1C4U2 1C1QA 3TH3H 3QLPH 2LNCA 1W13U 1OWEA 4Y79A 5DP8A 1SSXA 4ZROA 1NFWA 3M61U 1LQEA 4CRBA 1RGQA 1ID5H 4FUFA 3MNBA 4BXSA 2OQ5A 4O03A 1V3XA 5TCCA 3SJ8A 1Y3YA 1FONA 1OS8A 4Q7XA 4J2YB 1O3FA 2BVSH 3TVJB 2ZPRA 3Q76A 3ZZCA 1G2MA 1DE7H 1Z6JH 2A7JA 4B74A 2TBSA 1K9OE 3Q77A 4AG1A 2ZDAH 2ZC9H 1FJSA 1IQFA 2HGTH 3QN7A 3RMLH 2CV3A 2A4GA 4LXBH 2PLXA 4I8HA 1B5GH 1HXFH 2VWLA 5JBAS 3RMOH 1PPEE 1NPMA 1AI8H 1H9IE 3SUEA 2OQUA 1LVBA 4KTUA 1LPZB 2BYAX 4CRDA 4K1EA 7GCHF 3AW1A 3AASA 3NXPA 3DFJA 3T62A 3KQCA 1IQLA 1XUFA 5EXMA 2OBOA 1FLEE 4WMDA 2GT8A 1DWCH 1CGHA 4NFEA 3M5NA 4FXGH 3T2NA 2B7DH 4GVUA 1UTMA 1NN6A 1LHCH 1CHGA 4X6OA 3SUFA 5SGAE 4DG4A 4WVPE 1GHAF 1CVWH 3QX5H 3KCGH 1UMAH 3P17H 4GCHF 1O3LA 1O2MA 1P8VC 1W0YH 1TMUH 3A7TA 4LK4A 1GJAB 4A1TA 1WUNH 1LKBA 3QDZB 1JOUB 1KLJH 1P3CA 1XKBC 1DS2E 2WYJA 1OP2A 3UFAA 4YOIA 4Z6AH 3MNSA 1TX8A 4KTCA 1THPB 2JH0D 5EG4A 2G55A 2FI5E 2P3TB 9ESTA 3M3VA 4ZKRU 1H9LB 2HPQH 2H9TH 3RXTA 1MTNC 4MNXA 2WPKS 2F91A 7GCHG 2FLRH 1NRNH 4CR9A 2C4FH 2FOFA 2EI8A 1AD8H 2XTTB 4IW4E 2PGQB 1JRSA 2XNIA 5EOKA 3RMMH 4CRGA 1P0SH 3SNEA 3BSQA 2R0LA 1DICA 1EPTC 6LPRA 2R9PA 3V7TA 1QTFA 3TJUA 4ISHH 1F92A 2HOBA 4Y7BA 3PMAB 4Y0ZE 1NT1A 4DURA 2H2ZA 3M36A 4X8TH 3D49H 4NA9H 5CE1A 3QWCH 3SU1A 4X6PA 4DVAU 1JWTA 1GJ4H 1LVYA 1SG8B 1ZPZA 2ZNKH 2O8LA 4H4FA 2Y80A 2G81E 3LH3A 1GBAA 1O2RA 2ZQ2A 5F6MA 4X2WA 4IMZA 1BBRE 3NKKA 2M5TA 1YYY1 3FP6E 4TY7A 6GCHG 1A3EH 1QA0A 1YCPH 2F9BH 2IJOB 5C3NA 1YF4A 3A80A 1A0JA 1GBLA 1ACBE 2P59A 4FU8A 2J38A 1BMMH 4X1NU 4B1TA 1GJBB 3TK6A 4OGYA 1OWKA 5EGMA 1L0ZA 1HFDA 1O3EA 2PKAB 3LGVA 3ZYEA 3SV7A 1WQVH 3RXIA 1Y8TA 5H4IB 1SGNE 1Z8JB 1UTOA 4XFQA 2Q6DA 4XSKU 1LPGB 1BBRK 1D4PB 4ABGA 4BAKB 7ESTE 3RXSA 1J14A 1QNJA 4E05H 1IAUA 4BTUB 1H8IH 4HI3A 1ELVA 2GGVB 3M5OA 2R3UA 2SGFE 3P8FA 1O30A 1TIOA 3FP7E 3MO3A 2SFAA 1K1NA 1XM1A 3SU4A 4NCYA 4A5TS 2OCVB 1EZQA 2FOEA 5JBTA 2FOAA 1OXGA 5JBCS 1RTFB 3RMNH 1BBRH 1PPGE 1O2IA 1WQSA 2P3UB 1F2SE 3RUOA 1GHAG 2G51A 2AEIH 1O3MA 4NSVA 1F0TA 3BTTE 1O2QA 1O2HA 3ZZ4A 3SJIA 4AFSA 3L6PA 5C1UA 3NZIA 2CHAB 1ANEA 1MMJN 4A7IB 2NU3E 3HGPA 3NCLA 3O8RA 5A0CA 3LGWA 3SU6A 1UO6A 2WPLS 2UWPA 1YKTA 4YT7H 1NY22 1IQMA 2P8OB 1N6XA 1AE8H 3ZZ7A 3SV9A 1T31A 1HYLA 3DT0H 2IOTA 3TNSA 5F8TA 2C8YB 1GBKA 5B6OA 5C20A 4FUHA 1XUIA 3HGNA 1C2JA 4HFPB 3A7VA 3EDXB 3PTNA 4ZAEA 3A84A 1RRKA 3T26A 1W7XH 2TGAA 1QQUA 1C5OH 1HAHH 1EX3A 3A7ZA 2QF0A 2GX4A 1FPHH 3C27B 3E0PB 1S0RA 3PV4A 3STIA 4INKA 2BY5X 2ZDNA 1YPHC 2ZU1A 1YPJH 3CS7A 1GI2A 2VWOA 2ZECA 2BB4A 1TE0A 2WUCA 3JZ2B 3S7KB 3UTUH 2OC0A 4AX9H 2Z3DA 3BTEE 1VCWA 2W3KA 2Y5GA 1BTXA 3MU8A 2VIVA 1YPGH 1A46H 1C4V2 1QJ6B 1K21H 1EB2A 2D2DA 2ZIQH 2F83A 3EQ0H 4BAOB 3H7TA 1O3PB 5E2OA 1TGSZ 5HMAA 2HNTC 4JZEH 3SJOA 2Z6BD 3E91A 1GI5A 3EA9A 3ITIA 1SVPA 1HDTH 8GCHF 3B23B 4MG3A 1DVAH 3LGUA 3QGJA 3ZZBA 1BRBE 1Y59T 2A5AA 2VU8E 1AZZA 5DP4A 1BHXF 1C5XB 1EZXC 4ZKSU 4E7NA 1BZXE 1RD3B 1AE5A 3BG4C 4SGAE 1GMCF 1WU1A 4CBOA 3KN2A 2O8WA 1BCUH 4K1TA 1K2I1 2BD7A 4NA7A 1S85A 2ZCHP 1TWXB 1N8OB 3GY3A 1BTYA 3RLYH 1BJUA 1SLXB 3GCTF 2PSYA 2G4UA 3UR6A 4IBLH 4NWKA 1EAIA 2G8TA 2WUBA 2Y7ZA 3I78A 3ENSB 3GISB 2IN2A 5DKMA 1HB0B 3O8DA 2ZGBH 1AFQB 1NFUA 3GDSA 1EP5A 1SGYE 1W14U 3UNQA 1GHWH 2BDAA 4GLYA 1VITG 1K1IA 2FTMA 1UHBA 1ZGVA 1L1JA 1TPAE 4Q7YA 3HPTB 1LPKB 1OYTH 3GY2A 4AFQA 4IN2A 1GBCA 1C1NA 4I8LA 1SLUB 3LJJA 1NESE 1V2NT 1AFEH 3NUMA 1A5GH 1OYQA 1KLTA 4H6SB 5EW2H 2QC2A 5FBIA 1BTWA 5K7RA 3MH4A 1GBTA 1LHFH 1NFXA 2AMDA 2TRMA 5AVDA 3PWBA 4CREA 3TNTA 2FX4A 3H7OA 1O31A 3GY8A 1ZTJA 4ZH8A 4FUEA 4RKJB 1THSH 1YPLH 1TNIA 4X8VH 2CN0H 1KXCA 2IPHA 1V2QT 5I46H 3DUXH 2FEQH 1O5CB 4LOYH 1TPOA 5BPEA 4K5ZA 2GZ9A 4AFUA 3M3SA 1IQKA 1UK2A 3ZZAA 5FBEA 3TJNA 6CHAC 4YESB 3D23A 1S6HA 1NC6A 1MKWK 3A83A 2VNTA 3ZVBA 4B71A 1EASA 2AMQA 2TGTA 1MKXK 1E35B 1YCPM 1D6RA 2QN5T 3AAVA 2ZFQH 4ESTE 1A1RA 1GMHF 3UIRA 3S9AA 1C5QA 5LPFA 2WPMS 1A0LA 4H42U 1OPHB 2BLVA 1KSNA 2AFQB 1MBQA 1UTPA 2ZU5A 1GHZA 4FUCA 4YZUA 3SBKA 2H9HA 1IQJA 1VR1H 1C1PA 4AFZA 1DITH 3AVZA 3F68H 3SI3H 1Z1JA 3ODFA 2ZTYA 3PMBB 2XRCA 4ABHA 3BG8A 1J16A 3TK9A 1P06A 3TH4H 1FN6A 1WTHD 5GJ4B 2A7HA 3BTWE 1O2WA 2BXUH 1ABIH 4AYVB 4NWLA 3RP2A 3ZV9A 2ZCLP 3Q3XA 3T25A 1GL1A 1GI0A 3GCHC 5DK1A 1HJ9A 2UWLA 2GP9B 4I8GA 7KMEH 1LHDH 2FX6A 1U6QA 1AUJA 2VWNA 1FZZA 5JDUB 1SFQB 1OOKB 3VXEH 3BN9A 3G01A 5K0HA