1C2HA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2hA02
1XVOA 2B8OH 4KTCA 3RC4A 5E2PA 1MKXK 1XUHA 4I8GA 2O8UA 3BEIB 1X7AC 3O8CA 3RU4E 1FNIA 3ATWA 1TBQH 3RXIA 1YBWA 2P8OB 1GHVH 2FESH 3GDVA 1GHAF 1UHBB 1BMAA 4D9QA 2FX6A 3E91A 1L4ZA 4YLQH 2LPRA 1Z8IB 1W2KH 1DM4B 2A4RA 4ZROA 1BBRE 4K1EA 4U30A 1ZHPA 3D49H 1O2MA 4NA9H 1KDQB 2IOTA 1AFQB 1DVAH 2ODYB 1V2JT 1V2UT 1QHRB 3RLYH 3QWCH 4ISOA 2ZDAH 5LPEA 2ZFPH 3QDZB 3LOXA 1GI7B 2BDYA 3RXVA 2Y7XA 3A7YA 1C9TA 1DXWA 2I6SA 1TALA 4OS4A 3BTQE 4ASHA 3RXSA 4JK6A 3RC6A 3SI3H 3ZYEA 5TJXA 3PMHB 2H2ZA 1XKAC 2ZG0H 1VJ9U 4KGAA 4CHAB 7GCHF 2EC9H 3SGAE 1E38B 5A8ZA 1BQYA 3BTDE 1QFKH 2ZHEH 1MD7A 3ZZ9A 3ZZCA 1PPEE 2NU0E 2FO9A 2Z9LA 3N7OA 3SUFA 3SN8A 2BD9A 4DIIH 3S9BA 2F3CE 3UR9A 1MQ6A 1SI5H 2TBSA 1LHCH 4A92A 4ISNA 1UTOA 2TGTA 1WU1A 2A0QB 1C1OA 3SNBA 4YOGA 2P93A 5C1UA 3EDXB 1C2MA 1E36B 2FX4A 1PPZA 1DY8A 3I77A 2P95A 2Y80A 1DANH 3HKJB 2R0KA 2GDDA 2TIOA 2VVVA 3B23B 4Y71A 1L2EA 2G51A 2YOLA 3M61U 4I8JA 1WUNH 4BTIB 2XXLA 1G32B 4I32A 1ARBA 1HB0B 3E0NB 4X1QU 1D3TB 4E7RG 1GVKB 1C5WB 1UTLM 1VGCB 3TPIZ 1GJ4H 2VIPA 5GDSH 3SHCH 3CENA 4AOQA 3DD2H 4FVDA 1SGPE 1QA0A 2RG3A 3TNSA 4LZ1H 1P3EA 4H6TA 1UHBA 1HXFH 4Y8YA 1SQOA 2Y82A 2V0BA 1IQGA 1QB1A 4XFQA 1N8OB 1O3CA 1D3PB 3GCNA 2QIQA 3T25A 1S0QA 4A6LA 1Q2WA 5F6MA 1O3FA 1LTOA 4CREA 5C3NA 3A84A 1A0LA 5DKMA 2HNTE 1P11E 1CHGA 1O33A 4LXBH 1VITG 1MTWA 1GDQA 4LZ4B 2AEIH 1P09A 1IQEA 1G3BA 4Z6AH 4ZHLU 3ZVEA 1UMAH 1GHWH 4GSOA 1ELGA 4BTTB 1GBJA 2H1UA 1KXBA 1HAVA 1LHEH 1Z71A 1YPKH 2G81E 1AD8H 1ZYOA 1KXEA 3BSQA 2J92A 1P2OA 5ESBA 1MUEB 3GDUA 1TNLA 1Y3VA 2BDCA 2FOMB 5EQSA 1CGHA 1O2ZA 5SGAE 3K6ZA 2G00A 5HM2A 1O2QA 2HPPH 2VIOA 3E90B 4OS6A 2WPHS 1LPKB 2QCYA 2EEKA 1THRH 2G4UA 3M7UA 1L0ZA 1C5YB 1YLDA 1QURH 3NPSA 4FVBA 4B2CA 3E16B 1BCUH 1TABE 3KQDA 3NCLA 1V2QT 1K28D 1JBUH 4MPWA 3T29A 2VIWA 5DK1A 1BZXE 2W5EA 3GICB 1EQ9A 4CBNA 1FY5A 1HRTH 4YO9A 2P3FH 2J4IA 3UREA 1E34B 4FUGA 3EYDA 1GJ6A 5EW1H 1O3BA 3F68H 2XWBI 4ZMAH 5C67A 4FUEA 5GCHF 3S0NA 5HM9A 2BOHB 2HNTF 5CHAB 1AUTC 1MCVA 3UUZA 1MU6B 4FUBA 4JYVH 3VFEA 1GBKA 1SPJA 4X2YA 1O5DH 4ABFA 2R2MB 2ZIQH 1GJ8B 4RKOB 2XCNA 1UVPA 1K1OA 3LGYA 5A8XA 3QLPH 3SJIA 4DG4A 7GCHG 5FHTA 2GZ8A 2SGQE 5AVDA 1AVGH 1UVTH 2QXGA 4ZKNU 2QY0B 1AVWA 2WPMS 4OS5A 1GJ5H 8KME2 1GHYH 1QQ4A 2A32A 2ZDVH 1QB6A 1B5GH 3ELAH 1NRNH 4AFZA 2Q6FA 4K69A 1O5GH 1P12E 4O9VA 2CGAA 2VU8E 4B73A 3SO3A 3PM3A 1TX7A 1GCDA 1M9UA 2F9BH 4X6OA 3UR6A 4O97A 4WH6A 3RMNH 2H9EH 4HTCH 1SGRE 1O0DH 1KYNA 3LU9B 1Q31A 1GBMA 2WV5A 5AFYH 1EOJA 1O3MA 5C20A 1MBQA 4XBCA 1TNHA 3SHAH 4GCHF 1YKTA 2R3YA 1P10A 3LJOA 1DXPA 4U01A 2XBWA 1IQMA 4Y7AA 1BA8B 3W94A 1O2KA 3SI4H 3GOVB 2ZZUH 3T26A 4UFDH 3EA7A 1P2IA 1QJ7B 3NWUA 3K2UA 1CA8B 1O2YA 3RMMH 4Y0YE 1OWKA 2A2QH 4WXIA 1AI8H 1KIGH 3MFJA 1J17T 1J9CH 3SJKA 5DG6A 3SNAA 8LPRA 1GBDA 2PV9B 5E0HA 2VINA 2CN0H 1CT4E 1RXPA 4MLFB 3TJOA 4IMZA 3F9GA 1QL8A 3U98H 1ZJDA 2OBQA 1EB1H 3NKKA 1PYTC 1Y3YA 1QJ1B 1PFXC 3RMOH 4MDSA 1ZGVA 2BY7X 2ZU5A 3SQHE 5A0BA 1E0FD 1O3EA 1QBOA 1TRYA 5A2MH 1EB2A 3ZYDA 3O8RA 3SOSA 3Q3XA 4ISLA 2ALVA 4K1TA 4TYDA 3S7KB 1C1UH 3M37A 2XC5A 1O32A 1RTKA 2K1QA 3LJJA 2FYRA 1NU9A 3SV7A 3QZRA 1DUEA 3KQBA 4HI3A 1FN8A 1O2UA 3VGCB 1K21H 4B75A 2DUCA 4Q80A 1YPGH 4TY7A 4IMQA 4KTSA 4CH8B 1G37A 3SU4A 2LNCA 2J9NA 3HATH 1NFWA 1JXPA 2GGVB 3EA9A 2ILNA 2XRCA 5FX6A 1O3KA 2VGCB 5K7RA 1O2GH 1O30A 2BHGA 5T6GA 3SORA 1ZPCA 2PWXA 4MG3A 3FZDA 3EE0B 1RJXB 1SQAA 5H4IB 1ZMLA 2A4QA 4XDEA 4J2YB 3HK6B 4GHQA 3TNTA 5T6DA 4FUHA 1EP6A 2WYJA 4DGJA 1QB9A 3BTME 2A5AA 1NROH 2ZFFH 1GI2A 1G9IE 2D8WA 3VB6A 3RXAA 4BAOB 4GVUA 1MTVA 2ZDNA 1LDTT 1QL9A 2FOAA 2BB4A 3MH5A 2A2XH 1ABJH 3PB1E 1CHOG 3GCTG 1FI8A 1FXYA 2ANWA 3SNCA 1BDAA 3SBKA 4MQAA 3BF6H 1HBTH 1AWHB 1GI0A 1B0FA 1DOJA 1GBAA 2C8YB 1TMTH 1T7CA 1JRTA 1FV9A 2ZU1A 2BVXH 1UTNA 3SU6A 3A87A 4IBLH 5DP7A 3U1IB 1AQ7A 1P8VC 1LVOA 3R0FA 1TMUH 1OYTH 1PQ5A 4BXWA 4Q7YA 3RU4T 2G8TA 1SB1H 3VB4A 4B74A 2ZDLA 3Q00A 1O3LA 3FVFB 3URCA 1N8OC 3MNCA 1HAXB 3BTKE 2W7SA 1WAYB 1C1WH 4FUCA 3PYHA 3ZV8A 2ZF0H 1T32A 4A5TS 2Z9JA 3HPTB 2ZFRH 3STJA 1BMMH 1BOQA 2BY5X 1V3XA 1GPZA 4WMEA 3M5LA 1GG6B 4X8VH 3QUMP 3E8LA 4BAQB 2BYAX 3ZVGA 3LH1A 1G2LA 3HK3B 1J8AA 2VH6A 1ELAA 2QF0A 3RXLA 2ZHWH 2R3UA 4DIHH 1GBCA 4B2BA 4X8UH 1C5SA 2R0LA 2WV4A 1Z8GA 2GX4A 3SV2H 2GZ7A 4NGAH 1OWDA 1HIAA 1MTSA 4H42U 1Y59T 2BXUH 1XMNB 1A0JA 4H6SB 2HLCA 1XKBC 1QR3E 2ZGCA 3VXFH 4JYTA 1IQJA 3TK5A 1IQLA 2Y6TA 1KTTB 1O2RA 1GI5A 5C5OA 3RM0H 2C8XB 1O3HA 3UY9A 4DCDA 2ZGJA 4WF8A 4CRCA 6ESTA 2A5KA 1ELDE 5L2YH 5HGGA 1O3GA 4NWLA 4UFGH 3ZVCA 4OGXA 1J15A 8ESTE 1ELEE 3U1JB 4AFSA 1O2VA 1W7XH 1O3PB 3KEEA 3UWJH 2GCHF 2FODA 3SW2B 1HUTH 1ZMNA 4DOQA 5A0AE 1IHTH 1QQUA 2ZWLH 3P17H 4FUDA 2UWOA 2NU2E 4ZUHA 1V2ST 1NRRH 3WY8A 1Z1IA 3F1SB 1PPFE 1P9SA 5EQQA 3LC3A 2TGPZ 3RXTA 3LGIA 5CHAC 1GBHA 3ESTA 1Z8JB 1MD8A 3RM2H 1O2HA 2UUYA 1SLWB 4K1SA 3LONA 3A8BA 3FZZA 1O3JA 2GTBA 1MKWK 2Z94A 4NIXA 1HJ8A 5TCAA 4KKDA 1W0YH 3TJUA 4YM9A 1CT0E 2A7HA 5EQRA 3NZIA 4RSPA 5DP3A 1GMDF 1LPGB 3VB3A 3PMBB 4CR9A 2BDAA 3GCOA 2GCTC 4O03A 2BD2A 2TGAA 4ZH8A 1BRUP 4MPXA 2AGEX 3MO6A 1TQ7B 2RA3A 5JB9S 3PLKA 1EJMA 4BANB 1ELVA 1GL0E 1TGNA 5HXFA 1EAWA 2AH4X 2VWNA 2Z9KA 2AIQA 4DW2U 4Z0KA 4F4OC 1HJ9A 4WVPE 2Q6GA 1ZOMA 3RXRA 1O5AB 2JH0D 1A4WH 1S83A 3RXEA 4E05H 4IS5A 1TX6A 1SGYE 3B9FH 2ZECA 2C90B 4R8TB 3W95A 2QN5T 3KNXA 1Z6JH 2B7DH 1O36A 4AG1A 2ZA5A 5CMXH 1GJAB 4X1SU 2ZFQH 3MH7A 1LQDB 1S0RA 1JMOH 3QTOH 2BD5A 1T8LA 1ZZZA 1DWCH 1HXEH 4U2WA 2Z6BD 1NZQH 4CR5A 3TGJE 2PKSB 3MYWA 5JPMH 1TIOA 1TNKA 1IHSH 1XM1A 2GD4B 2WPLS 3HGNA 2D2DA 1C4V2 1GG6C 3Q3YA 3T62A 1A5HA 2CHAB 3M5OA 1OKXA 4ZKOU 1RS0A 1THSH 4QT8C 3P8GA 4NA8A 5HMAA 4MNWA 2AFQB 1HLTH 2H9HA 3GY8A 1ID5H 4WWYA 4Y11E 3D65E 3U8TH 1GJ9B 1SGIB 1BB0B 4XBBA 1NFUA 3KQEA 4XE4A 4WH8A 2ZCLP 1VCWA 4JK5A 5FXLA 1P04A 1Y3UA 1ESAA 1NM6A 1O31A 3DT0H 3EGKH 3ZZ3A 1C1PA 2F91A 3JZ1B 1TGTA 6CHAC 1WYKA 5HYOA 3ODFA 1HAZB 4HFPB 1OXGA 3MTYA 3BTHE 3MU4A 1EZXC 4X8TH 1SGEE 1T4UH 2G4TA 2FOFA 1YPHE 1CE5A 3RUOA 3SJOA 1AB9B 4GPGA 3S9AA 2M5TA 3D62A 1XUJA 3ODDA 5L2ZH 1KLTA 3CS7A 1GCTB 1FZZA 1K1MA 2ZTZA 5DP6A 2BDHA 1QRXA 1EOLA 1TOCB 4YOIA 4Q2KA 1FY1A 1AZZA 3ITIA 4UFFH 1NFYA 4DURA 3HKIB 1F0UA 2AGGX 2VGCC 1C2DA 3TVJB 1PQ7A 2SGDE 3BTFE 1OWHA 5DP9A 3M36A 1UK4A 1UVOA 4JMYA 1SGCA 3SJ9A 1D4PB 4X0WU 4E7NA 1C5MD 4UEHH 2JETC 1Z1JA 3A8AA 2F9NA 2KAIA 3A85A 1ZHMA 1A0HB 2PUQH 3C1KA 2GCHG 2B5TB 3LIWA 4Y8XA 1HAHH 3MU1A 3F9HA 1H9IE 4I31A 2O8MA 4I8KA 1INCA 5K0HA 3UNSA 1A1RA 2QV1A 1H1BA 1SBWA 1WTHD 3ATLA 2BD4A 1W10U 5DP5A 1IQIA 2OQUA 1TGBA 7KMEH 4AFUA 2XC4A 1GI9B 1FPCH 2ZPQA 3TH2H 3U8RH 4VGCB 3HGPA 4X2VA 1YCPM 4AB8A 2HOBA 1LPZB 1ZMJA 4NIYA 4CRDA 1PPHE 2ZCHP 4UE7H 1QGFA 1SLXB 1BTPA 2ZO3H 1N6YA 5ESTE 2HWLB 4JZDH 2FPZA 1QBVH 4YLUA 4KTUA 1O39A 2J95A 3RXJA 2AMDA 2WUCA 1H4WA 2ZTYA 4X1NU 2BQWB 3GY2A 1O3DA 4K8BA 4WXVA 2PKSC 1P01A 2SGFE 1AIXH 1OPHB 4Y79A 2ASUB 1YLCA 1S5SA 1GJCB 1XXFA 3BTWE 2VIQA 2C3SA 2C93B 5GIBA 2R2WU 1C5RA 3EA8A 1ELBA 3A7XA 4FUJA 5L30H 3O8BA 5FPSA 3G01A 1UCYH 4O3TA 4AGKA 2QXHA 1E37B 1FUJA 4MPVA 3H7TA 2BX3A 1C5QA 3GYMA 1YCPK 2SGEE 2BLVA 1TMBH 2TPIZ 1KTSB 3A81A 3E1XB 3I78A 2ZGHA 1Y5BT 2PFEA 2SNVA 1GI8B 1DSTA 1CBWB 1ZJKA 4MNVA 1NY22 3VB5A 1BITA 4ABBA 3MNSA 1BMLA 3OTJE 3R3GB 3MU5A 4UD9H 3RU4D 1KSNA 4Y6DA 3P70B 1PJPA 3ZZBA 4UONA 1UO6A 1PQ8A 2GT8A 3A8CA 2GV7A 5J4SA 1C4Y2 1CQQA 1DLKB 5FCKA 5F8ZA 3A88A 2ZTXA 2CXVA 1O2TA 2FYQA 4J1YA 3RMLH 2JKHA 3UOUA 3SU3A 3UFAA 1HNEE 4Y8ZA 3GISB 3T2NA 1HAOH 3C27B 3PWCA 1JWTA 4BAKB 1SOTA 3UQVA 3TH3H 1MKXH 1F0RA 1Z7KA 1GJ7B 3LC5A 2BDGA 2PHBA 3SU5A 2QC2A 5GCHG 5B6OA 1FDPA 1TNIA 2BXTH 2GMTB 5BPEA 1GMHF 1GL1A 3A7VA 1JIMA 1TWXB 1NRPH 1AFEH 3VEQB 3FP6E 4DT7B 1AKSB 4FU8A 4K2YA 4U32A 1AZ8A 5FBIA 3F6UH 3A7WA 1C2JA 4ABDA 3KHVA 2VJ1A 2O8WA 1EP5A 2P59A 3LT3A 4X8SH 1YPHC 1HCGA 2ZHFH 3RXKA 5A09A 1ZRKA 3IWMA 4ZXXH 2B0FA 2UUFB 3EQ0H 1W7GH 1O2JA 1PPBH 4MNYA 1DSUA 3P8FA 1K2I1 2ZP0H 1O5CB 1C1RA 3AAUA 1ELFA 1GCTC 2GCTB 1ZPBA 1D3QB 5DJ7A 1V2KT 4XSKU 1UTQA 4AORA 2XTTB 3SZNA 3I29A 4JZFH 2Z3CA 1IQHA 2W3IA 2RCEA 2IN2A 4Y7BA 1P2NA 3BEFB 3LPRA 2QF3A 2F9OA 1PYTD 2WPKS 3P8OA 2ZC9H 5ETXA 4CRAA 3MH4A 2NU1E 1CHOF 1EUFA 1GVZA 3SNEA 1IQKA 2ZPSA 3T28A 3F9EA 3DUXH 2QXJA 3M7TA 1GHBG 1P3CA 2FOBA 3UWIA 1GDUA 1MMJN 1K1JA 2THFB 1BHXB 1P2QA 3QTVH 1O5FH 1GI4A 3MHWU 3T27A 4B2AA 1DY9A 1U6QA 3TU7H 1C1TA 1LHGH 1OP2A 4IC5A 1QBNA 2EA3A 5T3HA 1SMFE 2FZZA 2OLGA 1SGFG 1A7SA 2WPJS 1HV7A 4D9RA 1T8NA 4NCYA 1O3IA 3LGWA 2VWOA 1BJVA 1SR5C 1RFNA 2FI3E 4TWYA 5JBAS 3D23A 1UK2A 1LHDH 1KXCA 4F49A 5DP4A 1CA0C 1AE5A 2H9TH 4IW4E 1XUKA 4WY3A 1DUAA 1O38A 1ANBA 1W11U 2ESTE 1UCYE 4Y76A 3STIA 2FS8A 2BDBA 1O5EH 1CBWC 2FI5E 4D8NA 1P02A 3ZZ8A 1Y5UT 1QCPA 1BT7A 1TLDA 3SGBE 4D76A 1ZHRA 1FMGA 2Z3DA 3IITA 2WYGA 4YTAA 1C5OH 1SGFA 2PKAB 1SGDE 1L1NA 1YF4A 2V6NA 1FY8E 2O9QA 1YYY1 4CH2B 1V2VT 2GDEH 3SUDA 2GP9B 2FLRH 1WTGH 1AWFH 2FWWA 1S85A 3OY6U 3BIVH 3SUEA 3A89A 2GZ9A 5G4BA 1P2JA 1AU8A 1D6WA 2FIRH 2BM2A 4LOYH 2JH5D 5EODA 1QIXB 3RXOA 2SFAA 2FTLE 1Z8RA 5JDUB 2G55A 2HNTC 3AW1A 2C8WB 1HAGE 1S82A 5C1XA 4BAMB 4AN7A 5A8YA 2AIPA 3PV4A 1TE0A 1O2SA 1HJAC 3LDXH 1ORFA 2FOHA 3SJ8A 1RRKA 2BDIA 1T31A 2TGDA 4K60A 1T4VH 4ZXYH 3UIRA 2OXSA 1F5KU 2BQ6B 3SV9A 3PMAB 3SU1A 3MO9A 3TGIE 2C4FH 3ZVDA 1EAUA 1TQ0B 5EGMA 1MTNB 4K5ZA 2QYIA 2Q6DA 2D1JA 3SUGA 1WV7H 2ANKH 1G3CA 1OWJA 3PROA 1C1NA 1P2MA 4IC6A 1OX1A 3DFJA 2ZHQH 2FMJA 1UTKA 1PQAA 1NC6A 1TPPA 4ISHH 1RGQA 1AB9C 1DICA 1G3DA 3MU0A 3UTUH 1ARCA 4TY6A 5JB8S 1MCTA 5E8EH 4ABJA 3TJNA 1P03A 3KF2A 5E2OA 4ISIH 2ANMH 1AHTH 4I7YH 4SGBE 3ZV9A 1BUIA 2PSYA 3M5NA 4O3UA 1H8IH 3QN7A 1KXFA 2PKAA 1O3AA 1GHAG 4X1PU 1K1PA 4IN1A 5DP8A 1H8DH 1XUFA 3RXFA 3RLWH 1NO9H 1V6DA 3LH3A 1GDNA 1KXDA 3L6PA 1GBBA 5GJ4B 3T5FH 2BOKA 1ABIH 4GHTA 5TCCA 1F5LA 3E3TA 2VWLA 1KXAA 1XUIA 1NTPA 3GYLB 5EPNA 1O2WA 1G3EA 2BLOA 2IPHA 3KN2A 1EKBB 1C9PA 1LVMA 1P9UA 2UWPA 2ZFTA 3DA9B 1CT2E 5F8XA 5EXMA 1TNJA 1VR1H 4NFFA 2VIVA 1EXFA 1TONA 6LPRA 1C5ZB 1SGQE 3PMJA 5ABWA 4B1TA 1BRBE 3UNRA 1F5RA 3A80A 1HYLA 5IDKA 1D3DB 3UQOA 1GVLA 2WUBA 3BG8A 4A1VA 1PPGE 1ACBE 2J94A 4OS1A 4ABAA 2P8OC 2A7JA 1C2LA 4ZHAA 1O3OA 3QK1A 4WJG2 3CS0A 1NU7B 1CGIE 3RXUA 1K1IA 1P0SH 4BOHA 4TWWA 2NU3E 1BMNH 1GBEA 4NIWA 4JYUH 2BY8X 1XUGA 1FY3A 1TAWA 4CRGA 1IOEA 2H5CA 4SGAE 5FPYA 1O2PA 1HIAB 1O2IA 1FQ3A 3BTEE 3LGVA 3TIUA 1WCZA 1DWDH 4A7IB 1GHZA 2RDLA 4KP0A 1JIRA 1QA7A 1HJAB 4K3JA 1C1QA 3P95A 1SGNE 2GMTC 1MTNC 4NA7A 2PGQB 3A82A 5FX5A 1FIZA 1AN1E 4YOJA 8GCHG 4K8YA 4AGJA 1DS2E 2B9LA 2TRMA 1SOZA 2ZGXH 3JZ2B 4FU7A 1ZSJA 1TPOA 1A46H 1O34A 3FP7E 4H4FA 3B8JA 5LH8A 3KIDU 1J14A 6GCHG 4MVNA 1GJBB 3U69H 1NS3A 4IN2A 1IQNA 1XX9A 4BNRA 2DE8A 3U8OH 2VNTA 2ZU4A 1ESTA 4CHAC 2XBVA 1EATA 5DO4H 3NK8A 4THNH 3V13A 4RN6A 1DITH 4YT6H 1GMCF 2ZU2A 1RIWC 4NG9H 4GUXA 1O2LA 5LGOA 1OP8A 2Z7FE 1YPLH 1GHBF 2H6MA 2IJOB 4I8LA 5IYTA 1B7XB 1KY9A 2PR3A 2FEQH 3TK9A 1N1LA 1GMHG 2SGPE 3A83A 1EAIA 2BY6X 2PSXA 2QA9E 3RXBA 2HALA 1ANDA 2XCFA 5EU8A 3ZZ6A 5EXNA 3SGQE 2UWLA 1O5BB 3GY5A 1AE8H 5J4QA 3P92A 1K1NA 2JH6D 5E0GA 3TGKE 3U9AH 1S6HA 1ANCA 3A8DA 4ZHMU 1ZGIA 3DFLA 5AF9H 2Y5GA 3GY7A 5A0CA 1YGCH 2O8LA 4JCNA 1O2XA 2F83A 1RTLA 4X1RU 1BTYA 4DY7B 2OBOA 5FPTA 3PO1B 1BTUA 1EPTB 1ETRH 1A3EH 2NU4E 1W12U 4OS2A 4AB9A 2VH0A 1Q3XA 3ATMA 2PTNA 4B76A 4ABHA 2Y5HA 1ETSH 2A5IA 5LPFA 1ETTH 5EG4A 2AYWA 2W26A 2J38A 1SLUB 1TA6A 2FOEA 1AGJA 1P05A 1EPTA 2FOCA 1FIWA 1SHHB 3ZZAA 3SV6A 3GY6A 2J34A 1GI6A 1EZUC 1QY6A 2PGBB 2FP7B 1O2NA 1DFPA 1O37A 4YT7H 3FP8E 5C5NA 5GXPA 5JBCS 4PROA 2ODPA 1A5GH 4DVAU 3RXCA 3K6YA 2ULLA 4DJZB 2OC7A 1QJ6B 1V2OT 1UVUH 3FAOA 3LKWA 4D7FA 1DPOA 4I8HA 2FDAA 2R9PA 9LPRA 3VGCC 2ZFSA 1G2MA 2VWMA 1SGTA 4A1TA 1AO5A 1C2HA 3AW0A 1K22H 4NFEA 3V3MA 4GLYA 2XBXA 3QO6A 1L1GA 1W3CA 2AMPA 3S7HB 1W0ZU 3E0PB 5BRRE 1BTXA 1FN6A 2BD7A 3PTNA 4ABEA 1WSSH 1RIWB 2HGTH 2OUAA 2ODQA 1MU8B 5C1YA 5AFZH 3OSYA 3GY3A 5I25A 1FJSA 5AHGH 2QXIA 3OY5U 1SC8U 3E6PH 2AMQA 1E35B 1GHXH 1FLEE 3ZZ7A 1XVMA 4YESB 1Y8TA 1QRZA 4I33A 4CRBA 2XW9A 3NUMA 1HAVB 1LHFH 4D7GA 1H9HE 1YM0A 4BAHB 1VITH 1NRSH 1A5IA 3BG4B 1CSOE 3Q76A 2OTVA 1WBGB 1EJNA 3S9CA 2G52A 4NZLA 3MWIU 2ZKSA 4WMDA 1TRMA 2P3TB 4JZEH 1C5UA 2EI7A 3IG6B 1BBRH 1F0TA 2Y5FA 1TNGA 5JBTA 3BV9B 2AERH 2ZDKA 1SLVB 2OC8A 2VIDA 4NWKA 2A7CA 3BTTE 4INLA 2BLWA 2A45B 4AFQA 4IGDA 1HAYB 1SFIA 5E0JA 3V0XA 4UFEH 1C5TA 2G5VA 4VGCC 1C1MA 4TPIZ 1C1SA 1EX3A 4R0IA 1B0EA 3KL6A 1AVXA 1K1LA 1TBRH 1LVYA 3KCGH 3MOCA 3NXPA 1LQEA 1ZTJA 1T8MA 3ZVAA 1UCYK 1V2TT 3ZZDA 2GKVE 4ABGA 4Y10E 1Y3WA 3M3TA 1OWEA 1V2NT 3PO1C 1AFQC 4JZ1A 1BIOA 3SQEE 1F0SA 2GV6A 2GT7A 3M7QA 2HPQH 2F9VA 2HRVA 3GCHC 1W8BH 1UTMA 1CU1A 2BVRH 1C5LH 1HPGA 3QX5H 4GAWA 3ZZ5A 2A31A 3RXPA 1KLJH 4TPYA 1AKSA 1TBZH 2C8ZB 1OP0A 4NSYA 1RD3B 3FFGA 2BX4A 1N6XA 1YP9A 2WPIS 1VJAU 2J2UA 1ZR0A 1WQVH 1EPTC 1IQFA 2Z3EA 3UOPA 2O8TA 7LPRA 3LGTA 1S6FA 2CMYA 4NSVA 1EAXA 2D26C 1ZPZA 2Z9GA 4X6MA 1HGTH 4KELA 3RP2A 1A2CH 5JYIA 4FXGH 1EJAA 5JBBS 5F8TA 1C5VA 1TA2A 3V12A 1YC0A 1TPAE 2XC0A 3TK6A 3MMGA 4ABIA 3MNBA 2BVSH 1CGJE 1BRCE 1SL3A 3H7OA 1FPHH 1CVWH 1XXDA 1BRAA 1O3NA 1NT1A 4X6PA 2OQ5A 2KAIB 5DGJA 1A3BH 3AASA 3RDZA 1AY6H 2UUKB 2I6QA 2ZU3A 2YNBA 4CRFA 1FAXA 3P8NA 1GBTA 1L1JA 3K65B 2XBYA 2Q1JA 3QGJA 4NZQA 2ZDMA 5FCRA 4X2WA 3BG4C 3RXQA 1P2KA 1NPMA 1MTUA 1TPSA 2BMGB 2G5NA 4Y0ZE 1Y5AT 3PWBA 1QL7A 1ELCA 1GMCG 1CO7E 3L3TA 4X2XA 2AGIX 1LKBA 1SG8B 1GGDC 3CP7A 5F03A 1O2OA 2CHAC 1ZSKA 2EI8A 2ALPA 1V2LT 3MU8A 1DWEH 4INHA 2ZNKH 2FLBH 2F9PA 1ZTLA 2W3KA 3OX7U 2BTCE 3ZVBA 6CHAB 2BD3A 4OGYA 8GCHF 2F9UA 1CA0B 1LMWB 5EOKA 3TH4H 3BTGE 2CF8H 2V3HH 1OOKB 3P6ZB 3S69A 1V2WT 3A7ZA 3GY4A 4B71A 5DPAA 5FAHA 1C4U2 5PTPA 1A61H 2BY9X 3RXGA 3V7TA 1QTFA 2V35A 3ATIA 4BXSA 2DE9A 2STBE 1IAUA 2CV3A 1TX8A 1LCYA 3ENSB 4FU9A 2OP9A 1GWAA 2BQ7B 4Q7ZA 1GBLA 1YCPH 1TOMH 3RXHA 3URDA 3F9FA 4AG2A 2OC0A 2VB0A 1OWIA 1T8OA 1C2EA 2P16A 3OU0A 1TFXA 1DX5M 1AMHA 1TRNA 1EZQA 1V2MT 2NWNA 2AS9A 1ESBA 2OD3B 2PLXA 3QZQA 2CF9H 3SV8A 1TYNA 2CJIA 1FONA 3Q77A 3RC5A 1ANEA 4ZKSU 3GDSA 4FUFA 3BN9A 1SHYA 3GCHB 1AUJA 4ZAEA 1GI1A 4UDWH 4ESTE 1SSXA 1QNJA 1DDJA 1NFXA 2FM2A 1YPEH 1DLEA 1GI3A 1OYQA 3TITA 1FAKH 3SU0A 1HAPH 1D9IA 1VITF 2W7UA 1C5NH 5C2ZA 1F92A 1G36A 1SVPA 1WOFA 3A86A 2WINI 2JETB 5GPIB 2FS9A 1UVSH 2XNIA 2QAAA 4LK4A 2OINA 1KLIH 3QGNB 1LKAA 1O35A 1MAXA 3RXDA 2ZQ1A 1VCPA 2P94A 1Z6EA 3KQCA 1H9LB 2OC1A 1OS8A 3BIUH 3M3SA 1C2FA 1GBFA 1BBRK 1S84A 3M5MA 1OSSA 4HGCA 2FOGA 3UNQA 1J16A 2H5DA 3LGUA 1MKWH 3VB7A 5EXLA 1MAYA 2BZ6H 2UUJB 2Z9IA 3AVZA 1BHXF 1ZRBA 4BTUB 5EW2H 1ZLRA 4ZKRU 5FBEA 4E06H 1EZSC 1THPB 1V2RT 4HZHA 3BEUA 3RXMA 1F2SE 2ZGBH 1UTJA 1BTZA 1ZTKA 1MZAA 4XOJA 1ZSLA 4M7GA 3OYPA 2ZEBA 4YZUA 3M3VA 4XBDA 1HDTH 3O8DA 1C2GA 4RKJB 3MO3A 4AYYB 6GCHF 3Q3KA 1HAIH 2BZAA 1C2KA 1NRQH 2ZHDA 2BD8A 1L4DA 2P3UB 2ZPRA 5L6NH 1TGCA 1F7ZA 3H5CB 2A1DB 4Q7XA 2GVFA 4JZIA 1MH0A 3A7TA 3ATKA 1GGDB 1FY4A 4FUIA 2STAE 1C1VH 2A4GA 4A1XA 1UJ1A 1MBMA 1VCQA 4MPUA 4WMFA 3MH6A 1BTHH 2Y81A 1NESE 4MNXA 5LPRA 2HVXA 2QGRA 3TLOA 3GCTF 1G30B 1C2IA 3PTBA 2RA0A 2PUXB 9ESTA 1C5XB 1GMDG 1KDQA 3UPEA 3SNDA 1BTWA 1D6RA 3KGPA 1HFDA 1MZDA 2SGAA 2ANYA 1EASA 3VPKA 5EPYA 1SQTA 1W13U 2PTCE 2FI4E 2BLQA 3MI4A 1VGCC 1C5PA 3FANA 3PLPA 4OS7A 4MTBA 1MQ5A 4AX9H 1BJUA 1WQSA 1UTPA 3ZVFA 2FTMA 2YNAA 1GBIA 1DT2A 3ZZ4A 4AYVB 1SFQB 1V2PT 3PLBA 1TGSZ 1NN6A 4NIVA 2VVCA 2Y7ZA 3SU2A 1P06A 1PPCE 1TB6H 4CBOA 2PW8H 1YPMH 4INKA 2ZI2H 5T6FA 1RTFB 1S81A 2FXRA 3TJVA 1Y3XA 7ESTE 5GWZA 3L33A 2VVUA 3EAJA 1W14U 2ZQ2A 1P57B 1JRSA 2XWAA 3K9XB 1DE7H 1K9OE 3DHKH 2XYAA 2SNWA 1LVBA 1YPJH 2ZCKP 3M35A 2OCVB 2V3OH 5CE1A 3MNXA 1QRWA 1JOUB 1GJDB 1ELTA 1LO6A 3AAVA 4X6NA 1VZQH 1UK3A 1DWBH 3VXEH 5I46H 2A4OA 4GCHG 4AZ2B 2EI6A
chains in the Genus database with same CATH superfamily
2K8IA 1XVOA 2B8OH 4KTCA 3RC4A 5E2PA 1MKXK 1XUHA 4I8GA 2O8UA 3BEIB 1X7AC 3O8CA 3RU4E 1FNIA 3ATWA 1TBQH 3RXIA 1YBWA 2P8OB 1GHVH 2FESH 3GDVA 1GHAF 1UHBB 1BMAA 4D9QA 5DN6D 2FX6A 3E91A 1L4ZA 4YLQH 2LPRA 1Z8IB 1W2KH 1DM4B 2A4RA 4ZROA 1BBRE 4K1EA 1K0HA 3KQ5A 4U30A 1ZHPA 3D49H 3N7EA 3AK5A 1O2MA 4NA9H 1KDQB 2IOTA 1AFQB 1DVAH 2ODYB 1V2JT 1V2UT 1QHRB 3RLYH 3QWCH 4ISOA 2ZDAH 2WZQA 5LPEA 2F43B 2ZFPH 3QDZB 3LOXA 1GI7B 2BDYA 3RXVA 2Y7XA 1FX0B 3A7YA 1C9TA 1DXWA 2I6SA 1TALA 4OS4A 3BTQE 4ASHA 3RXSA 4JK6A 3RC6A 3SI3H 3ZYEA 5TJXA 4Z1MD 3PMHB 2H2ZA 1XKAC 2ZG0H 1VJ9U 4KGAA 4CHAB 7GCHF 2EC9H 3SGAE 1E38B 5A8ZA 1BQYA 3BTDE 1QFKH 2ZHEH 1MD7A 3ZZ9A 3ZZCA 1PPEE 2NU0E 2FO9A 2Z9LA 3N7OA 3SUFA 3SN8A 5HIZA 2BD9A 2J5UA 4DIIH 3S9BA 2F3CE 3UR9A 1MQ6A 1SI5H 2TBSA 1LHCH 1E79D 4A92A 4Q63A 4ISNA 1UTOA 2TGTA 1WU1A 2A0QB 1C1OA 3SNBA 4YOGA 5CDFE 2P93A 5C1UA 3EDXB 1C2MA 1E36B 2FX4A 1PPZA 1DY8A 3I77A 2P95A 2Y80A 3UB0A 1DANH 3HKJB 2R0KA 2GDDA 2TIOA 2VVVA 3B23B 4Y71A 1L2EA 2G51A 2YOLA 3M61U 4I8JA 1WUNH 4BTIB 2XXLA 1G32B 4I32A 1ARBA 1HB0B 3E0NB 4X1QU 1D3TB 4E7RG 1GVKB 1C5WB 1UTLM 1VGCB 3TPIZ 1GJ4H 1SKYE 2VIPA 5GDSH 3SHCH 3CENA 4AOQA 3DD2H 4FVDA 1SGPE 1QA0A 2RG3A 3TNSA 4LZ1H 1P3EA 4H6TA 1UHBA 1HXFH 3DCLA 4Y8YA 1SQOA 2Y82A 2V0BA 1IQGA 1QB1A 4XFQA 1N8OB 1O3CA 1D3PB 3GCNA 2QIQA 3T25A 1S0QA 4A6LA 1Q2WA 5F6MA 1O3FA 1LTOA 4CREA 5C3NA 3A84A 1A0LA 5DKMA 2HNTE 1P11E 5CHBA 1CHGA 1O33A 4LXBH 1VITG 1MTWA 1GDQA 4LZ4B 2AEIH 1P09A 1IQEA 1G3BA 4Z6AH 4ZHLU 3ZVEA 1UMAH 1GHWH 4GSOA 1ELGA 2M2AA 4BTTB 1GBJA 2H1UA 1KXBA 1HAVA 1LHEH 1Z71A 1H8ED 1YPKH 2G81E 1AD8H 1ZYOA 1KXEA 5IK2D 3BSQA 2J92A 1P2OA 5ESBA 1MUEB 3GDUA 1TNLA 1Y3VA 2BDCA 2FOMB 2EQNA 5EQSA 1CGHA 3F2FA 1O2ZA 5SGAE 3K6ZA 2G00A 5HM2A 1O2QA 2HPPH 2VIOA 3E90B 4OS6A 2WPHS 4ACAA 1LPKB 2QCYA 2EEKA 1THRH 2G4UA 4F48B 3M7UA 1L0ZA 1C5YB 1YLDA 3DSGA 1QURH 3PV5A 5EJZA 3NPSA 4FVBA 4B2CA 3E16B 1BCUH 1TABE 3KQDA 3NCLA 1V2QT 1K28D 1JBUH 4MPWA 3T29A 2VIWA 4FOUC 5DK1A 1BZXE 2W5EA 3GICB 1EQ9A 4CBNA 1FY5A 1HRTH 4YO9A 2P3FH 2J4IA 3UREA 1E34B 4FUGA 3EYDA 1GJ6A 2PP6A 5EW1H 1O3BA 2K0QA 3F68H 2XWBI 4ZMAH 5C67A 4FUEA 5GCHF 3S0NA 5HM9A 2BOHB 2HNTF 5CHAB 1AUTC 1MCVA 2V3MA 3UUZA 1MU6B 4FUBA 4JYVH 3VFEA 1GBKA 1SPJA 4X2YA 1O5DH 4ABFA 2R2MB 2ZIQH 2JDID 1GJ8B 4RKOB 2XCNA 1UVPA 5EJLA 1NBMD 1K1OA 3LGYA 5A8XA 3QLPH 3SJIA 4DG4A 7GCHG 5FHTA 2GZ8A 2SGQE 5AVDA 1AVGH 1UVTH 3WWFA 2QXGA 4ZKNU 2QY0B 1AVWA 2WPMS 4OS5A 1GJ5H 8KME2 1GHYH 1QQ4A 2KCPA 2A32A 2ZDVH 1QB6A 1B5GH 3ELAH 1NRNH 4AFZA 2Q6FA 4K69A 1O5GH 1P12E 4O9VA 2CGAA 5KECA 2VU8E 4B73A 3SO3A 3PM3A 1TX7A 1GCDA 1M9UA 2F9BH 4X6OA 3UR6A 4O97A 4WH6A 3RMNH 2H9EH 4HTCH 1SGRE 1O0DH 1KYNA 3LU9B 1Q31A 1GBMA 2WV5A 5AFYH 1EOJA 3CNRA 1O3MA 5C20A 1MBQA 4XBCA 1TNHA 3SHAH 4GCHF 1YKTA 2R3YA 1P10A 3LJOA 1DXPA 4U01A 2XBWA 1IQMA 4Y7AA 1BA8B 3W94A 1O2KA 1H8HD 3SI4H 3GOVB 2ZZUH 3T26A 4UFDH 3EA7A 1P2IA 1QJ7B 3NWUA 3K2UA 1CA8B 1O2YA 3RMMH 4Y0YE 1OWKA 2A2QH 4WXIA 1AI8H 1KIGH 3MFJA 1J17T 1J9CH 3SJKA 5DG6A 3SNAA 8LPRA 1GBDA 2PV9B 5E0HA 2VINA 2CN0H 1CT4E 1RXPA 4MLFB 3TJOA 4IMZA 3F9GA 1QL8A 2KM0A 1ZJDA 3U98H 2OBQA 1EB1H 3NKKA 1PYTC 1Y3YA 1QJ1B 1PFXC 3RMOH 4MDSA 1ZGVA 2BY7X 2ZU5A 3SQHE 5A0BA 1E0FD 1O3EA 1QBOA 1TRYA 5A2MH 1EB2A 3ZYDA 3O8RA 3SOSA 3Q3XA 4ISLA 2ALVA 2KFWA 4K1TA 4TYDA 3S7KB 1C1UH 3M37A 2XC5A 1O32A 1RTKA 2K1QA 3LJJA 4M9FA 2FYRA 1NU9A 3SV7A 5B6LA 3QZRA 1DUEA 3KQBA 4HI3A 1FN8A 1O2UA 3VGCB 1K21H 4B75A 2DUCA 4Q80A 1YPGH 4TY7A 4IMQA 4KTSA 3UAIC 4CH8B 1G37A 3SU4A 2LNCA 2J9NA 3HATH 1NFWA 1JXPA 2GGVB 3EA9A 2ILNA 2XRCA 5FX6A 1O3KA 2VGCB 5K7RA 1O2GH 1O30A 2BHGA 5T6GA 1E1RD 3SORA 1ZPCA 2PWXA 4MG3A 3FZDA 3EE0B 1RJXB 1SQAA 5H4IB 1ZMLA 2A4QA 3OEHD 4XDEA 4J2YB 3HK6B 4GHQA 3TNTA 5T6DA 4FUHA 1EP6A 2WYJA 4DGJA 1QB9A 3BTME 2A5AA 1NROH 2ZFFH 1GI2A 1G9IE 2D8WA 3VB6A 1YWUA 3RXAA 4GVUA 4BAOB 1MTVA 2ZDNA 1LDTT 1QL9A 2FOAA 2BB4A 3MH5A 2A2XH 1ABJH 3PB1E 1CHOG 3GCTG 1FI8A 1FXYA 2ANWA 3SNCA 1BDAA 3SBKA 4MQAA 3BF6H 1HBTH 1AWHB 1GI0A 1B0FA 1DOJA 1GBAA 2C8YB 1TMTH 1T7CA 1JRTA 1FV9A 2ZU1A 2BVXH 1UTNA 3SU6A 3A87A 4IBLH 5DP7A 3U1IB 1AQ7A 1P8VC 1LVOA 3R0FA 1TMUH 1OYTH 1PQ5A 4BXWA 2KCOA 4Q7YA 3RU4T 2G8TA 1SB1H 2J98A 3VB4A 4B74A 2ZDLA 3Q00A 1O3LA 3FVFB 3URCA 1N8OC 3MNCA 1HAXB 3BTKE 2W7SA 3F0PA 1WAYB 1C1WH 4FUCA 3PYHA 3ZV8A 2ZF0H 1T32A 4A5TS 2Z9JA 3HPTB 2ZFRH 3STJA 1BMMH 1BOQA 2BY5X 1V3XA 2YMSB 1GPZA 4WMEA 3M5LA 1GG6B 3DSPA 3QUMP 4X8VH 3E8LA 2WV9A 4BAQB 2BYAX 3ZVGA 3LH1A 1G2LA 3HK3B 1J8AA 1COWD 2VH6A 1ELAA 2QF0A 3RXLA 2ZHWH 2R3UA 4DIHH 1GBCA 4B2BA 4X8UH 4DT4A 1C5SA 2R0LA 2WV4A 1Z8GA 2GX4A 3SV2H 2GZ7A 4NGAH 1OWDA 1HIAA 3FKSD 1MTSA 4H42U 1Y59T 2BXUH 1XMNB 1A0JA 4H6SB 2HLCA 1XKBC 1QR3E 2ZGCA 3VXFH 4JYTA 1IQJA 3TK5A 1IQLA 2Y6TA 3F2HA 1KTTB 1O2RA 1GI5A 5C5OA 3RM0H 2C8XB 1O3HA 3UY9A 4DCDA 2ZGJA 4WF8A 4CRCA 6ESTA 2A5KA 1ELDE 5KGOA 5L2YH 5HGGA 1O3GA 4NWLA 4UFGH 3ZVCA 2QF4A 4OGXA 1J15A 8ESTE 1ELEE 3U1JB 4AFSA 1O2VA 1W7XH 1O3PB 3KEEA 3UWJH 2GCHF 2FODA 3SW2B 1HUTH 2KCYA 1ZMNA 4DOQA 5A0AE 1IHTH 1QQUA 2ZWLH 3P17H 4FUDA 2UWOA 2NU2E 4ZUHA 1V2ST 1NRRH 3WY8A 1Z1IA 3F1SB 1PPFE 1P9SA 1VKYA 5EQQA 3LC3A 2TGPZ 3RXTA 3LGIA 5CHAC 1GBHA 3ESTA 1Z8JB 1MD8A 3RM2H 1O2HA 2UUYA 1SLWB 4K1SA 3LONA 5DSFA 2JJ1D 3A8BA 3FZZA 1O3JA 2GTBA 1MKWK 2Z94A 4NIXA 1HJ8A 3OFND 4KKDA 1W0YH 5TCAA 3TJUA 4YM9A 1CT0E 2A7HA 3KYFA 5EQRA 3NZIA 4RSPA 5DP3A 1GMDF 1LPGB 3VB3A 3OAAD 3PMBB 4CR9A 2BDAA 3GCOA 2GCTC 2J97A 4O03A 2BD2A 2TGAA 4ZH8A 1BRUP 4MPXA 2AGEX 3MO6A 1TQ7B 2RA3A 5JB9S 3PLKA 1EJMA 4BANB 1ELVA 1GL0E 1TGNA 5HXFA 1EAWA 2AHME 2AH4X 2VWNA 2Z9KA 2AIQA 2VBCA 4DW2U 4Z0KA 4F4OC 1HJ9A 4WVPE 2Q6GA 1ZOMA 3RXRA 1O5AB 2JH0D 1A4WH 1S83A 3RXEA 4E05H 4IS5A 1TX6A 1SGYE 3B9FH 2ZECA 2C90B 4R8TB 3W95A 2QN5T 3KNXA 1Z6JH 2B7DH 4P00A 1O36A 4AG1A 2ZA5A 5CMXH 1GJAB 4X1SU 2ZFQH 3MH7A 1LQDB 1S0RA 1JMOH 3QTOH 2BD5A 1T8LA 1ZZZA 1DWCH 1HXEH 4U2WA 2Z6BD 1NZQH 4CR5A 3TGJE 2PKSB 3MYWA 5JPMH 1TIOA 1TNKA 1IHSH 1XM1A 2GD4B 2WPLS 3HGNA 2D2DA 1C4V2 1GG6C 3Q3YA 3T62A 1A5HA 2CHAB 3M5OA 1OKXA 3WWBA 4ZKOU 1RS0A 2WSSD 1THSH 4TSFD 4QT8C 3P8GA 4NA8A 5HMAA 4MNWA 5EIYA 2AFQB 1HLTH 2H9HA 3GY8A 1ID5H 4WWYA 4Y11E 3D65E 3U8TH 1GJ9B 1SGIB 1BB0B 4XBBA 1NFUA 3KQEA 4XE4A 4WH8A 2ZCLP 1VCWA 4JK5A 5FXLA 1P04A 3DSOA 1EFRD 1Y3UA 1ESAA 1NM6A 1O31A 3SYJA 3DT0H 3EGKH 3ZZ3A 1C1PA 2F91A 3JZ1B 1TGTA 6CHAC 1WYKA 5HYOA 3ODFA 1HAZB 4XD7D 4HFPB 1E1QD 1OXGA 3MTYA 3BTHE 3MU4A 1EZXC 4X8TH 1SGEE 1T4UH 2G4TA 4TT3D 4B6EA 2FOFA 1YPHE 1CE5A 2KX4A 3RUOA 3SJOA 1AB9B 4GPGA 3S9AA 2M5TA 3D62A 1XUJA 3ODDA 5L2ZH 1KLTA 3CS7A 1GCTB 1FZZA 1K1MA 2ZTZA 5DP6A 2BDHA 1QRXA 1EOLA 1TOCB 4YOIA 4Q2KA 1FY1A 1AZZA 3ITIA 4UFFH 1NFYA 2RFKC 4DURA 3HKIB 1F0UA 2AGGX 2VGCC 1C2DA 3TVJB 1PQ7A 2SGDE 3BTFE 1OWHA 5DP9A 3M36A 1UK4A 1UVOA 4JMYA 1SGCA 3SJ9A 1D4PB 4X0WU 4E7NA 1C5MD 4UEHH 2JETC 1Z1JA 3A8AA 2F9NA 2KAIA 3A85A 1ZHMA 1A0HB 2V7QD 2PUQH 3C1KA 2GCHG 2B5TB 3LIWA 4Y8XA 1HAHH 3MU1A 3F9HA 1H9IE 4I31A 2O8MA 4I8KA 1INCA 5K0HA 3UNSA 1A1RA 2QV1A 1H1BA 1SBWA 1WTHD 3ATLA 2BD4A 5C0UA 1W10U 5DP5A 1IQIA 2OQUA 1TGBA 7KMEH 4AFUA 1GI9B 2XC4A 1FPCH 2ZPQA 3TH2H 3U8RH 4VGCB 3HGPA 4X2VA 1YCPM 4AB8A 4FETA 2HOBA 1LPZB 1ZMJA 4NIYA 4CRDA 1PPHE 2ZCHP 4UE7H 1QGFA 1SLXB 1BTPA 2ZO3H 1N6YA 5ESTE 2HWLB 4JZDH 2FPZA 1QBVH 4YLUA 4KTUA 1O39A 2J95A 3RXJA 2AMDA 2WUCA 1H4WA 2ZTYA 4X1NU 2BQWB 3GY2A 1O3DA 4K8BA 4WXVA 3F2GA 2PKSC 1P01A 2SGFE 1AIXH 1OPHB 4Y79A 2ASUB 1YLCA 1S5SA 1GJCB 1XXFA 3BTWE 2VIQA 2C3SA 2C93B 5GIBA 2R2WU 1C5RA 3EA8A 1ELBA 3A7XA 4FUJA 5L30H 3O8BA 5FPSA 3G01A 1UCYH 4O3TA 4AGKA 2QXHA 1MABB 1E37B 1FUJA 4MPVA 3H09A 3H7TA 2BX3A 1C5QA 3GYMA 1YCPK 2SGEE 2BLVA 1TMBH 2TPIZ 1KTSB 3A81A 3E1XB 3I78A 2ZGHA 1Y5BT 2PFEA 2SNVA 4B6FA 2XOKD 1GI8B 1DSTA 1CBWB 1ZJKA 4MNVA 1NY22 3VB5A 1BITA 4ABBA 3MNSA 1BMLA 3OTJE 3R3GB 3WW7A 3MU5A 4UD9H 3RU4D 1KSNA 4Y6DA 3P70B 1PJPA 3ZZBA 4UONA 1UO6A 1PQ8A 2GT8A 2JJ2D 3A8CA 2W6ID 2GV7A 5J4SA 1C4Y2 1CQQA 1DLKB 5FCKA 5F8ZA 3A88A 2ZTXA 2CXVA 1O2TA 2FYQA 4J1YA 3RMLH 2JKHA 3UOUA 3SU3A 3UFAA 1HNEE 4Y8ZA 1YY3A 3GISB 3T2NA 1HAOH 3C27B 3PWCA 4RT1A 1JWTA 1SQRA 4BAKB 1SOTA 2IPQX 2KR7A 3UQVA 3TH3H 1MKXH 1F0RA 1Z7KA 1GJ7B 3LC5A 2BDGA 2PHBA 3SU5A 2QC2A 5GCHG 5B6OA 1FDPA 1TNIA 2BXTH 2GMTB 5BPEA 1GMHF 1GL1A 3A7VA 1JIMA 1TWXB 1WXRA 1NRPH 1AFEH 3VEQB 3FP6E 4DT7B 1AKSB 4FU8A 4K2YA 4U32A 1AZ8A 5FBIA 3F6UH 3OTPA 3A7WA 1C2JA 4ABDA 3KHVA 2VJ1A 2O8WA 1EP5A 2P59A 3LT3A 4X8SH 1YPHC 1HCGA 2ZHFH 3RXKA 5A09A 1ZRKA 3IWMA 4ZXXH 2B0FA 2CK3D 2UUFB 3EQ0H 1W7GH 1O2JA 1PPBH 4MNYA 1DSUA 3P8FA 1K2I1 2ZP0H 1O5CB 1C1RA 3AAUA 1ELFA 2LP6A 1GCTC 4AC9A 2GCTB 1ZPBA 1D3QB 5DJ7A 1V2KT 4XSKU 1UTQA 4AORA 2XTTB 3SZNA 3I29A 2J98B 4JZFH 2Z3CA 1IQHA 2W3IA 2RCEA 2IN2A 3OEED 4Y7BA 1P2NA 3BEFB 3LPRA 2QF3A 2F9OA 1PYTD 2WPKS 3P8OA 2ZC9H 5ETXA 4CRAA 3MH4A 2NU1E 1CHOF 1EUFA 1GVZA 3SNEA 1IQKA 2ZPSA 3T28A 3F9EA 3DUXH 2IJD1 2QXJA 3M7TA 1GHBG 1P3CA 2FOBA 3UWIA 1GDUA 1MMJN 1K1JA 2THFB 1BHXB 1P2QA 3QTVH 1O5FH 1GI4A 3MHWU 3T27A 4B2AA 1DY9A 1U6QA 3TU7H 1C1TA 1LHGH 1OP2A 4IC5A 1QBNA 2EA3A 5FL7D 5T3HA 1SMFE 2FZZA 2OLGA 1SGFG 5HIYA 1A7SA 2WPJS 1HV7A 4D9RA 1T8NA 4NCYA 1O3IA 3LGWA 2VWOA 1BJVA 1SR5C 1RFNA 2FI3E 4TWYA 5T1VA 5JBAS 3D23A 1UK2A 1LHDH 1KXCA 4F49A 2QF5A 5DP4A 1CA0C 1AE5A 2H9TH 4IW4E 1XUKA 4WY3A 1DUAA 1O38A 1ANBA 1W11U 2ESTE 1UCYE 4Y76A 3STIA 2FS8A 2BDBA 5GNDA 1O5EH 3FO8D 4P02A 1CBWC 2FI5E 4D8NA 1BMFD 1P02A 3OE7D 3ZZ8A 1Y5UT 1QCPA 1BT7A 1TLDA 3SGBE 4D76A 1ZHRA 1FMGA 2Z3DA 3IITA 2WYGA 4YTAA 4I86A 1C5OH 1SGFA 2PKAB 3W1EA 1SGDE 1L1NA 1YF4A 2V6NA 5KEDA 1FY8E 2O9QA 3U28C 1YYY1 4CH2B 1V2VT 2GDEH 3SUDA 2GP9B 2FLRH 1WTGH 1AWFH 2FWWA 1S85A 3OY6U 3BIVH 3SUEA 3A89A 2GZ9A 3NRLA 5G4BA 1P2JA 1AU8A 1D6WA 2FIRH 2BM2A 4LOYH 2JH5D 5EODA 1QIXB 3RXOA 2SFAA 2FTLE 1Z8RA 5JDUB 2G55A 2HNTC 3AW1A 2C8WB 5HKKD 1HAGE 1S82A 5C1XA 4BAMB 4AN7A 5A8YA 2AIPA 3PV4A 1TE0A 1O2SA 1HJAC 3LDXH 1ORFA 2FOHA 3SJ8A 1RRKA 2BDIA 1T31A 2TGDA 4K60A 1T4VH 4ZXYH 3UIRA 2OXSA 1F5KU 2BQ6B 3SV9A 3PMAB 3SU1A 3MO9A 3TGIE 2C4FH 3ZVDA 2KCAA 1EAUA 1TQ0B 5EGMA 1MTNB 4K5ZA 2QYIA 4ACBA 2Q6DA 3F0OA 2D1JA 3SUGA 1WV7H 2ANKH 1G3CA 1OWJA 2YMSC 3PROA 1C1NA 1P2MA 2XNDD 4IC6A 1OX1A 3DFJA 2ZHQH 2FMJA 1UTKA 1PQAA 1NC6A 1TPPA 4ISHH 1RGQA 1AB9C 1DICA 1G3DA 3MU0A 3UTUH 1ARCA 4TY6A 5JB8S 1MCTA 5E8EH 4ABJA 3TJNA 1P03A 3KF2A 5E2OA 4ISIH 2ANMH 1AHTH 4I7YH 4SGBE 3ZV9A 1BUIA 2PSYA 3M5NA 4O3UA 1H8IH 3QN7A 4RT0A 1KXFA 2PKAA 1O3AA 1GHAG 4X1PU 1K1PA 4IN1A 5DP8A 1H8DH 1XUFA 3RXFA 3RLWH 1NO9H 1V6DA 3LH3A 1GDNA 1KXDA 3L6PA 1GBBA 5GJ4B 3T5FH 2BOKA 1ABIH 4GHTA 5TCCA 1F5LA 3E3TA 2VWLA 1KXAA 1XUIA 1NTPA 3GYLB 5EPNA 1O2WA 1G3EA 2BLOA 2IPHA 3KN2A 1EKBB 1C9PA 1LVMA 1P9UA 2UWPA 2ZFTA 3DA9B 1CT2E 5F8XA 5EXMA 1TNJA 1VR1H 4NFFA 2VIVA 1EXFA 1TONA 6LPRA 1C5ZB 1SGQE 3PMJA 5ABWA 4B1TA 1BRBE 3UNRA 1F5RA 5C17A 3A80A 1HYLA 5IDKA 1D3DB 3UQOA 1GVLA 2WUBA 3BG8A 4A1VA 1PPGE 1ACBE 2J94A 4OS1A 4ABAA 2P8OC 2A7JA 1C2LA 4ZHAA 1O3OA 3QK1A 4WJG2 3CS0A 1NU7B 1CGIE 3RXUA 1K1IA 1P0SH 4BOHA 4TWWA 2NU3E 1BMNH 1GBEA 4NIWA 1QZ8A 4JYUH 2BY8X 1XUGA 1FY3A 1TAWA 4CRGA 1IOEA 2H5CA 4SGAE 5FPYA 1O2PA 1HIAB 1O2IA 1OHHD 3FOAA 1FQ3A 3BTEE 3LGVA 2W6JD 3TIUA 1WCZA 1DWDH 4A7IB 1GHZA 2RDLA 4KP0A 1JIRA 1QA7A 4ZCNA 1HJAB 4K3JA 1C1QA 3P95A 1SGNE 2GMTC 1MTNC 3N7DA 4NA7A 2PGQB 3A82A 5FX5A 1FIZA 1AN1E 4YOJA 8GCHG 4K8YA 3VG8A 4AGJA 2KZ4A 1DS2E 2B9LA 2TRMA 1SOZA 2ZGXH 3JZ2B 4FU7A 1ZSJA 1TPOA 1A46H 1O34A 3FP7E 4H4FA 1W0JD 3B8JA 5LH8A 3KIDU 1J14A 6GCHG 4MVNA 1GJBB 3U69H 1NS3A 4IN2A 1IQNA 1XX9A 4BNRA 2DE8A 3U8OH 2VNTA 2ZU4A 1ESTA 4CHAC 2XBVA 5EJ1A 1EATA 5DO4H 3NK8A 4THNH 3V13A 4RN6A 1DITH 4YT6H 1GMCF 2ZU2A 1RIWC 4NG9H 4GUXA 1O2LA 5LGOA 1OP8A 2Z7FE 1YPLH 1GHBF 2H6MA 2IJOB 3PRBA 4I8LA 5IYTA 1B7XB 1KY9A 2PR3A 2FEQH 3TK9A 1N1LA 1GMHG 1NBME 2SGPE 3A83A 1EAIA 2QA9E 2PSXA 2BY6X 3RXBA 2HALA 1ANDA 2XCFA 4XRNA 5EU8A 3ZZ6A 5EXNA 3SGQE 3GS9A 2UWLA 1O5BB 3GY5A 1AE8H 5J4QA 3P92A 1K1NA 2JH6D 5E0GA 3TGKE 3U9AH 1S6HA 1ANCA 3A8DA 4ZHMU 1ZGIA 3DFLA 5AF9H 2Y5GA 3GY7A 5A0CA 1YGCH 2O8LA 4JCNA 1O2XA 2F83A 1RTLA 4X1RU 1BTYA 4DY7B 2OBOA 5FPTA 3PO1B 1BTUA 1EPTB 1ETRH 1A3EH 2NU4E 1W12U 4OS2A 4AB9A 2VH0A 1Q3XA 3ATMA 2PTNA 4B76A 4ABHA 2Y5HA 1ETSH 2A5IA 5LPFA 1ETTH 5EG4A 2AYWA 2W26A 2J38A 1SLUB 1TA6A 2FOEA 1AGJA 1P05A 1EPTA 2FOCA 1FIWA 1SHHB 3ZZAA 3SV6A 3GY6A 2J34A 1GI6A 1EZUC 1QY6A 2PGBB 2FP7B 1O2NA 1DFPA 1O37A 4YT7H 3FP8E 5C5NA 5GXPA 5JBCS 4PROA 2ODPA 1A5GH 2GJGA 4DVAU 3RXCA 3K6YA 2ULLA 4DJZB 2OC7A 1QJ6B 1V2OT 1UVUH 3FAOA 3LKWA 4D7FA 1DPOA 4I8HA 2FDAA 2R9PA 9LPRA 2RDEA 3VGCC 2ZFSA 1G2MA 2VWMA 1SGTA 4A1TA 1AO5A 1C2HA 3AW0A 1K22H 4NFEA 3V3MA 4GLYA 2XBXA 3QO6A 1L1GA 1W3CA 2AMPA 3S7HB 1W0ZU 3E0PB 5BRRE 1BTXA 1FN6A 2BD7A 3PTNA 4ABEA 1WSSH 1RIWB 1YLNA 2HGTH 2OUAA 2ODQA 1MU8B 5C1YA 2YMSD 3OSYA 3GY3A 5AFZH 5I25A 1FJSA 5AHGH 2QXIA 3OY5U 1SC8U 3E6PH 2AMQA 1E35B 1GHXH 1FLEE 3ZZ7A 1XVMA 4YESB 1Y8TA 1QRZA 4I33A 4CRBA 2XW9A 3NUMA 1HAVB 1LHFH 4D7GA 1H9HE 1YM0A 4BAHB 1VITH 1NRSH 1A5IA 3BG4B 1CSOE 3Q76A 2OTVA 1WBGB 1EJNA 3S9CA 2G52A 4NZLA 3MWIU 2ZKSA 4WMDA 1TRMA 2P3TB 4JZEH 1C5UA 2EI7A 3IG6B 1BBRH 1F0TA 2Y5FA 1TNGA 5JBTA 3BV9B 2AERH 2ZDKA 1SLVB 2OC8A 2VIDA 4NWKA 2A7CA 3BTTE 4INLA 2BLWA 2A45B 4AFQA 4IGDA 1HAYB 1SFIA 5E0JA 3V0XA 4UFEH 1C5TA 2G5VA 4VGCC 1C1MA 4TPIZ 1C1SA 1EX3A 4R0IA 3N99A 1B0EA 3KL6A 1AVXA 1K1LA 1TBRH 1LVYA 3KCGH 3MOCA 3KYGA 3NXPA 1LQEA 1ZTJA 1T8MA 3ZVAA 1UCYK 1V2TT 3ZZDA 2GKVE 4ABGA 4Y10E 1Y3WA 3M3TA 1OWEA 1V2NT 3PO1C 1AFQC 4JZ1A 1BIOA 3SQEE 1F0SA 2GV6A 2GT7A 3M7QA 2HPQH 2F9VA 2HRVA 3GCHC 1W8BH 1UTMA 1CU1A 2BVRH 1C5LH 1HPGA 3QX5H 4GAWA 1WDIA 3ZZ5A 2A31A 1S6LA 3RXPA 1KLJH 4TPYA 1AKSA 1TBZH 2C8ZB 1OP0A 4NSYA 1RD3B 3FFGA 2HVYB 2BX4A 1N6XA 1YP9A 2WPIS 1VJAU 2J2UA 1ZR0A 1WQVH 1EPTC 1IQFA 2Z3EA 3UOPA 2O8TA 7LPRA 3LGTA 1S6FA 2CMYA 4NSVA 1EAXA 2D26C 1ZPZA 2Z9GA 4X6MA 1HGTH 4KELA 3RP2A 1A2CH 1KMHB 5JYIA 2OK5A 3PV2A 1EJAA 4FXGH 5JBBS 5F8TA 1C5VA 1TA2A 3V12A 1YC0A 1TPAE 2XC0A 3TK6A 3MMGA 4ABIA 3MNBA 2BVSH 1CGJE 1BRCE 1SL3A 3H7OA 1FPHH 1CVWH 1XXDA 1BRAA 1O3NA 2F4LA 1NT1A 4X6PA 2OQ5A 2KAIB 5DGJA 1A3BH 3AASA 3RDZA 1AY6H 2UUKB 3EE7A 2I6QA 2ZU3A 2YNBA 4CRFA 2WHXA 1FAXA 3P8NA 1GBTA 1L1JA 3K65B 2XBYA 2Q1JA 3QGJA 2HLDD 2ZDMA 4NZQA 5FCRA 4X2WA 3BG4C 3RXQA 1P2KA 1NPMA 1MTUA 1TPSA 2BMGB 2G5NA 4Y0ZE 1Y5AT 3PWBA 1QL7A 1ELCA 1GMCG 3FN8A 1CO7E 3L3TA 4X2XA 2AGIX 1LKBA 1SG8B 1GGDC 3CP7A 5F03A 1O2OA 2CHAC 1ZSKA 2EI8A 2ALPA 1V2LT 3MU8A 4HG6A 1DWEH 4INHA 2ZNKH 2FLBH 3PRDA 2F9PA 1ZTLA 2W3KA 3OX7U 2BTCE 3ZVBA 6CHAB 2BD3A 4OGYA 8GCHF 2F9UA 1CA0B 1LMWB 5EOKA 3TH4H 3BTGE 2CF8H 2V3HH 1OOKB 3P6ZB 3S69A 4Q4LA 1V2WT 3A7ZA 3GY4A 4B71A 5DPAA 5FAHA 1C4U2 5PTPA 4ASUD 1A61H 2BY9X 4RI0A 3RXGA 3V7TA 1QTFA 2V35A 3ATIA 4BXSA 2DE9A 2STBE 1IAUA 2CV3A 1TX8A 1LCYA 5F53A 3ENSB 4FU9A 2OP9A 1GWAA 2BQ7B 4Q7ZA 1GBLA 1YCPH 1TOMH 3RXHA 3URDA 3F9FA 4AG2A 2EY4C 2OC0A 2VB0A 1OWIA 1T8OA 1C2EA 2P16A 3OU0A 1TFXA 2NWNA 1DX5M 2QE7D 1AMHA 1EZQA 1TRNA 1V2MT 2AS9A 1ESBA 2OD3B 2PLXA 3QZQA 2CF9H 3SV8A 1TYNA 2CJIA 1FONA 3Q77A 3RC5A 1ANEA 4ZKSU 3GDSA 4FUFA 3BN9A 1SHYA 3GCHB 4F55A 1AUJA 4ZAEA 1GI1A 4UDWH 4ESTE 1SSXA 1QNJA 1DDJA 1NFXA 2FM2A 1YPEH 1DLEA 1GI3A 1OYQA 3TITA 1FAKH 3SU0A 1HAPH 1D9IA 1VITF 2W7UA 1C5NH 5C2ZA 1F92A 1G36A 1SVPA 1WOFA 3A86A 2WINI 2JETB 5GPIB 2FS9A 1UVSH 2XNIA 2QAAA 4LK4A 2OINA 1KLIH 3QGNB 1LKAA 1O35A 1MAXA 3RXDA 2ZQ1A 1VCPA 2P94A 1Z6EA 3KQCA 1H9LB 2OC1A 1OS8A 3BIUH 3M3SA 1C2FA 1GBFA 1BBRK 1S84A 3M5MA 1OSSA 4HGCA 2FOGA 3UNQA 1J16A 2H5DA 3LGUA 1MKWH 3VB7A 5EXLA 1MAYA 2LELA 2BZ6H 2UUJB 2Z9IA 3AVZA 1BHXF 1ZRBA 4BTUB 5EW2H 1ZLRA 3F3BA 4ZKRU 5FBEA 4E06H 1EZSC 1THPB 1V2RT 4HZHA 3BEUA 3RXMA 1F2SE 2ZGBH 1UTJA 1BTZA 1ZTKA 1MZAA 4XOJA 1ZSLA 4M7GA 3OYPA 2ZEBA 4YZUA 2L6OA 3M3VA 4XBDA 1HDTH 3O8DA 1C2GA 4RKJB 3MO3A 4AYYB 6GCHF 3Q3KA 5C0TA 1HAIH 2BZAA 1C2KA 1NRQH 2ZHDA 2BD8A 1L4DA 2P3UB 2ZPRA 5L6NH 1TGCA 1F7ZA 3H5CB 2A1DB 4Q7XA 4YXWD 2GVFA 4JZIA 1MH0A 3A7TA 3ATKA 1GGDB 1FY4A 4FUIA 2STAE 4OM9A 1C1VH 2A4GA 4A1XA 1UJ1A 1MBMA 1VCQA 3ZIAD 4MPUA 4WMFA 3MH6A 1BTHH 2Y81A 1NESE 4MNXA 5LPRA 2HVXA 2QGRA 3TLOA 3GCTF 1G30B 1C2IA 3PTBA 2RA0A 2PUXB 2WPDD 9ESTA 1C5XB 1GMDG 1KDQA 3UPEA 3SNDA 1BTWA 1D6RA 3KGPA 1HFDA 1MZDA 2SGAA 2ANYA 1EASA 3VPKA 5EPYA 1SQTA 1W13U 2PTCE 2FI4E 2BLQA 3MI4A 1VGCC 1C5PA 3FANA 3PLPA 4OS7A 4MTBA 1MQ5A 4AX9H 1BJUA 1WQSA 1UTPA 3ZVFA 2FTMA 2YNAA 1GBIA 1DT2A 1UW7A 3ZZ4A 4AYVB 3SZEA 1SFQB 1V2PT 3PLBA 1TGSZ 1NN6A 2JIZD 4NIVA 2VVCA 2Y7ZA 3SU2A 1P06A 1PPCE 1TB6H 4CBOA 5C94A 2PW8H 3MQKC 1YPMH 4INKA 2ZI2H 5T6FA 1RTFB 1S81A 2FXRA 3TJVA 1Y3XA 7ESTE 5GWZA 3L33A 2VVUA 3EAJA 1W14U 2ZQ2A 1P57B 1JRSA 2XWAA 3K9XB 1DE7H 1K9OE 3DHKH 2XYAA 2L74A 1W0KD 2SNWA 1LVBA 1YPJH 2ZCKP 3M35A 2OCVB 2V3OH 5CE1A 3MNXA 1QRWA 1JOUB 1GJDB 1ELTA 1LO6A 3AAVA 4X6NA 1VZQH 1UK3A 1DWBH 3VXEH 5I46H 2A4OA 4GCHG 4AZ2B 2EI6A
chains in the Genus database with same CATH topology
1XVOA 2B8OH 4KTCA 3RC4A 5E2PA 1MKXK 1XUHA 4I8GA 2O8UA 3BEIB 1X7AC 3O8CA 3RU4E 1FNIA 3ATWA 1TBQH 3RXIA 1YBWA 2P8OB 1GHVH 2FESH 3GDVA 1GHAF 1UHBB 1BMAA 4D9QA 2FX6A 3E91A 1L4ZA 4YLQH 2LPRA 1Z8IB 1W2KH 1DM4B 2A4RA 4ZROA 1BBRE 4K1EA 4U30A 1ZHPA 3D49H 1O2MA 4NA9H 1KDQB 2IOTA 1AFQB 1DVAH 2ODYB 1V2JT 1V2UT 1QHRB 3RLYH 3QWCH 4ISOA 2ZDAH 5LPEA 2ZFPH 3QDZB 3LOXA 1GI7B 2BDYA 3RXVA 2Y7XA 3A7YA 1C9TA 1DXWA 2I6SA 1TALA 4OS4A 3BTQE 4ASHA 3RXSA 4JK6A 3RC6A 3SI3H 3ZYEA 5TJXA 3PMHB 2H2ZA 1XKAC 2ZG0H 1VJ9U 4KGAA 4CHAB 7GCHF 2EC9H 3SGAE 1E38B 5A8ZA 1BQYA 3BTDE 1QFKH 2ZHEH 1MD7A 3ZZ9A 3ZZCA 1PPEE 2NU0E 2FO9A 2Z9LA 3N7OA 3SUFA 3SN8A 2BD9A 4DIIH 3S9BA 2F3CE 3UR9A 1MQ6A 1SI5H 2TBSA 1LHCH 4A92A 4ISNA 1UTOA 2TGTA 1WU1A 2A0QB 1C1OA 3SNBA 4YOGA 2P93A 5C1UA 3EDXB 1C2MA 1E36B 2FX4A 1PPZA 1DY8A 3I77A 2P95A 2Y80A 1DANH 3HKJB 2R0KA 2GDDA 2TIOA 2VVVA 3B23B 4Y71A 1L2EA 2G51A 2YOLA 3M61U 4I8JA 1WUNH 4BTIB 2XXLA 1G32B 4I32A 1ARBA 1HB0B 3E0NB 4X1QU 1D3TB 4E7RG 1GVKB 1C5WB 1UTLM 1VGCB 3TPIZ 1GJ4H 2VIPA 5GDSH 3SHCH 3CENA 4AOQA 3DD2H 4FVDA 1SGPE 1QA0A 2RG3A 3TNSA 4LZ1H 1P3EA 4H6TA 1UHBA 1HXFH 4Y8YA 1SQOA 2Y82A 2V0BA 1IQGA 1QB1A 4XFQA 1N8OB 1O3CA 1D3PB 3GCNA 2QIQA 3T25A 1S0QA 4A6LA 1Q2WA 5F6MA 1O3FA 1LTOA 4CREA 5C3NA 3A84A 1A0LA 5DKMA 2HNTE 1P11E 1CHGA 1O33A 4LXBH 1VITG 1MTWA 1GDQA 4LZ4B 2AEIH 1P09A 1IQEA 1G3BA 4Z6AH 4ZHLU 3ZVEA 1UMAH 1GHWH 4GSOA 1ELGA 4BTTB 1GBJA 2H1UA 1KXBA 1HAVA 1LHEH 1Z71A 1YPKH 2G81E 1AD8H 1ZYOA 1KXEA 3BSQA 2J92A 1P2OA 5ESBA 1MUEB 3GDUA 1TNLA 1Y3VA 2BDCA 2FOMB 5EQSA 1CGHA 1O2ZA 5SGAE 3K6ZA 2G00A 5HM2A 1O2QA 2HPPH 2VIOA 3E90B 4OS6A 2WPHS 1LPKB 2QCYA 2EEKA 1THRH 2G4UA 3M7UA 1L0ZA 1C5YB 1YLDA 1QURH 3NPSA 4FVBA 4B2CA 3E16B 1BCUH 1TABE 3KQDA 3NCLA 1V2QT 1K28D 1JBUH 4MPWA 3T29A 2VIWA 5DK1A 1BZXE 2W5EA 3GICB 1EQ9A 4CBNA 1FY5A 1HRTH 4YO9A 2P3FH 2J4IA 3UREA 1E34B 4FUGA 3EYDA 1GJ6A 5EW1H 1O3BA 3F68H 2XWBI 4ZMAH 5C67A 4FUEA 5GCHF 3S0NA 5HM9A 2BOHB 2HNTF 5CHAB 1AUTC 1MCVA 3UUZA 1MU6B 4FUBA 4JYVH 3VFEA 1GBKA 1SPJA 4X2YA 1O5DH 4ABFA 2R2MB 2ZIQH 1GJ8B 4RKOB 2XCNA 1UVPA 1K1OA 3LGYA 5A8XA 3QLPH 3SJIA 4DG4A 7GCHG 5FHTA 2GZ8A 2SGQE 5AVDA 1AVGH 1UVTH 2QXGA 4ZKNU 2QY0B 1AVWA 2WPMS 4OS5A 1GJ5H 8KME2 1GHYH 1QQ4A 2A32A 2ZDVH 1QB6A 1B5GH 3ELAH 1NRNH 4AFZA 2Q6FA 4K69A 1O5GH 1P12E 4O9VA 2CGAA 2VU8E 4B73A 3SO3A 3PM3A 1TX7A 1GCDA 1M9UA 2F9BH 4X6OA 3UR6A 4O97A 4WH6A 3RMNH 2H9EH 4HTCH 1SGRE 1O0DH 1KYNA 3LU9B 1Q31A 1GBMA 2WV5A 5AFYH 1EOJA 1O3MA 5C20A 1MBQA 4XBCA 1TNHA 3SHAH 4GCHF 1YKTA 2R3YA 1P10A 3LJOA 1DXPA 4U01A 2XBWA 1IQMA 4Y7AA 1BA8B 3W94A 1O2KA 3SI4H 3GOVB 2ZZUH 3T26A 4UFDH 3EA7A 1P2IA 1QJ7B 3NWUA 3K2UA 1CA8B 1O2YA 3RMMH 4Y0YE 1OWKA 2A2QH 4WXIA 1AI8H 1KIGH 3MFJA 1J17T 1J9CH 3SJKA 5DG6A 3SNAA 8LPRA 1GBDA 2PV9B 5E0HA 2VINA 2CN0H 1CT4E 1RXPA 4MLFB 3TJOA 4IMZA 3F9GA 1QL8A 3U98H 1ZJDA 2OBQA 1EB1H 3NKKA 1PYTC 1Y3YA 1QJ1B 1PFXC 3RMOH 4MDSA 1ZGVA 2BY7X 2ZU5A 3SQHE 5A0BA 1E0FD 1O3EA 1QBOA 1TRYA 5A2MH 1EB2A 3ZYDA 3O8RA 3SOSA 3Q3XA 4ISLA 2ALVA 4K1TA 4TYDA 3S7KB 1C1UH 3M37A 2XC5A 1O32A 1RTKA 2K1QA 3LJJA 2FYRA 1NU9A 3SV7A 3QZRA 1DUEA 3KQBA 4HI3A 1FN8A 1O2UA 3VGCB 1K21H 4B75A 2DUCA 4Q80A 1YPGH 4TY7A 4IMQA 4KTSA 4CH8B 1G37A 3SU4A 2LNCA 2J9NA 3HATH 1NFWA 1JXPA 2GGVB 3EA9A 2ILNA 2XRCA 5FX6A 1O3KA 2VGCB 5K7RA 1O2GH 1O30A 2BHGA 5T6GA 3SORA 1ZPCA 2PWXA 4MG3A 3FZDA 3EE0B 1RJXB 1SQAA 5H4IB 1ZMLA 2A4QA 4XDEA 4J2YB 3HK6B 4GHQA 3TNTA 5T6DA 4FUHA 1EP6A 2WYJA 4DGJA 1QB9A 3BTME 2A5AA 1NROH 2ZFFH 1GI2A 1G9IE 2D8WA 3VB6A 3RXAA 4BAOB 4GVUA 1MTVA 2ZDNA 1LDTT 1QL9A 2FOAA 2BB4A 3MH5A 2A2XH 1ABJH 3PB1E 1CHOG 3GCTG 1FI8A 1FXYA 2ANWA 3SNCA 1BDAA 3SBKA 4MQAA 3BF6H 1HBTH 1AWHB 1GI0A 1B0FA 1DOJA 1GBAA 2C8YB 1TMTH 1T7CA 1JRTA 1FV9A 2ZU1A 2BVXH 1UTNA 3SU6A 3A87A 4IBLH 5DP7A 3U1IB 1AQ7A 1P8VC 1LVOA 3R0FA 1TMUH 1OYTH 1PQ5A 4BXWA 4Q7YA 3RU4T 2G8TA 1SB1H 3VB4A 4B74A 2ZDLA 3Q00A 1O3LA 3FVFB 3URCA 1N8OC 3MNCA 1HAXB 3BTKE 2W7SA 1WAYB 1C1WH 4FUCA 3PYHA 3ZV8A 2ZF0H 1T32A 4A5TS 2Z9JA 3HPTB 2ZFRH 3STJA 1BMMH 1BOQA 2BY5X 1V3XA 1GPZA 4WMEA 3M5LA 1GG6B 4X8VH 3QUMP 3E8LA 4BAQB 2BYAX 3ZVGA 3LH1A 1G2LA 3HK3B 1J8AA 2VH6A 1ELAA 2QF0A 3RXLA 2ZHWH 2R3UA 4DIHH 1GBCA 4B2BA 4X8UH 1C5SA 2R0LA 2WV4A 1Z8GA 2GX4A 3SV2H 2GZ7A 4NGAH 1OWDA 1HIAA 1MTSA 4H42U 1Y59T 2BXUH 1XMNB 1A0JA 4H6SB 2HLCA 1XKBC 1QR3E 2ZGCA 3VXFH 4JYTA 1IQJA 3TK5A 1IQLA 2Y6TA 1KTTB 1O2RA 1GI5A 5C5OA 3RM0H 2C8XB 1O3HA 3UY9A 4DCDA 2ZGJA 4WF8A 4CRCA 6ESTA 2A5KA 1ELDE 5L2YH 5HGGA 1O3GA 4NWLA 4UFGH 3ZVCA 4OGXA 1J15A 8ESTE 1ELEE 3U1JB 4AFSA 1O2VA 1W7XH 1O3PB 3KEEA 3UWJH 2GCHF 2FODA 3SW2B 1HUTH 1ZMNA 4DOQA 5A0AE 1IHTH 1QQUA 2ZWLH 3P17H 4FUDA 2UWOA 2NU2E 4ZUHA 1V2ST 1NRRH 3WY8A 1Z1IA 3F1SB 1PPFE 1P9SA 5EQQA 3LC3A 2TGPZ 3RXTA 3LGIA 5CHAC 1GBHA 3ESTA 1Z8JB 1MD8A 3RM2H 1O2HA 2UUYA 1SLWB 4K1SA 3LONA 3A8BA 3FZZA 1O3JA 2GTBA 1MKWK 2Z94A 4NIXA 1HJ8A 5TCAA 4KKDA 1W0YH 3TJUA 4YM9A 1CT0E 2A7HA 5EQRA 3NZIA 4RSPA 5DP3A 1GMDF 1LPGB 3VB3A 3PMBB 4CR9A 2BDAA 3GCOA 2GCTC 4O03A 2BD2A 2TGAA 4ZH8A 1BRUP 4MPXA 2AGEX 3MO6A 1TQ7B 2RA3A 5JB9S 3PLKA 1EJMA 4BANB 1ELVA 1GL0E 1TGNA 5HXFA 1EAWA 2AH4X 2VWNA 2Z9KA 2AIQA 4DW2U 4Z0KA 4F4OC 1HJ9A 4WVPE 2Q6GA 1ZOMA 3RXRA 1O5AB 2JH0D 1A4WH 1S83A 3RXEA 4E05H 4IS5A 1TX6A 1SGYE 3B9FH 2ZECA 2C90B 4R8TB 3W95A 2QN5T 3KNXA 1Z6JH 2B7DH 1O36A 4AG1A 2ZA5A 5CMXH 1GJAB 4X1SU 2ZFQH 3MH7A 1LQDB 1S0RA 1JMOH 3QTOH 2BD5A 1T8LA 1ZZZA 1DWCH 1HXEH 4U2WA 2Z6BD 1NZQH 4CR5A 3TGJE 2PKSB 3MYWA 5JPMH 1TIOA 1TNKA 1IHSH 1XM1A 2GD4B 2WPLS 3HGNA 2D2DA 1C4V2 1GG6C 3Q3YA 3T62A 1A5HA 2CHAB 3M5OA 1OKXA 4ZKOU 1RS0A 1THSH 4QT8C 3P8GA 4NA8A 5HMAA 4MNWA 2AFQB 1HLTH 2H9HA 3GY8A 1ID5H 4WWYA 4Y11E 3D65E 3U8TH 1GJ9B 1SGIB 1BB0B 4XBBA 1NFUA 3KQEA 4XE4A 4WH8A 2ZCLP 1VCWA 4JK5A 5FXLA 1P04A 1Y3UA 1ESAA 1NM6A 1O31A 3DT0H 3EGKH 3ZZ3A 1C1PA 2F91A 3JZ1B 1TGTA 6CHAC 1WYKA 5HYOA 3ODFA 1HAZB 4HFPB 1OXGA 3MTYA 3BTHE 3MU4A 1EZXC 4X8TH 1SGEE 1T4UH 2G4TA 2FOFA 1YPHE 1CE5A 3RUOA 3SJOA 1AB9B 4GPGA 3S9AA 2M5TA 3D62A 1XUJA 3ODDA 5L2ZH 1KLTA 3CS7A 1GCTB 1FZZA 1K1MA 2ZTZA 5DP6A 2BDHA 1QRXA 1EOLA 1TOCB 4YOIA 4Q2KA 1FY1A 1AZZA 3ITIA 4UFFH 1NFYA 4DURA 3HKIB 1F0UA 2AGGX 2VGCC 1C2DA 3TVJB 1PQ7A 2SGDE 3BTFE 1OWHA 5DP9A 3M36A 1UK4A 1UVOA 4JMYA 1SGCA 3SJ9A 1D4PB 4X0WU 4E7NA 1C5MD 4UEHH 2JETC 1Z1JA 3A8AA 2F9NA 2KAIA 3A85A 1ZHMA 1A0HB 2PUQH 3C1KA 2GCHG 2B5TB 3LIWA 4Y8XA 1HAHH 3MU1A 3F9HA 1H9IE 4I31A 2O8MA 4I8KA 1INCA 5K0HA 3UNSA 1A1RA 2QV1A 1H1BA 1SBWA 1WTHD 3ATLA 2BD4A 1W10U 5DP5A 1IQIA 2OQUA 1TGBA 7KMEH 4AFUA 2XC4A 1GI9B 1FPCH 2ZPQA 3TH2H 3U8RH 4VGCB 3HGPA 4X2VA 1YCPM 4AB8A 2HOBA 1LPZB 1ZMJA 4NIYA 4CRDA 1PPHE 2ZCHP 4UE7H 1QGFA 1SLXB 1BTPA 2ZO3H 1N6YA 5ESTE 2HWLB 4JZDH 2FPZA 1QBVH 4YLUA 4KTUA 1O39A 2J95A 3RXJA 2AMDA 2WUCA 1H4WA 2ZTYA 4X1NU 2BQWB 3GY2A 1O3DA 4K8BA 4WXVA 2PKSC 1P01A 2SGFE 1AIXH 1OPHB 4Y79A 2ASUB 1YLCA 1S5SA 1GJCB 1XXFA 3BTWE 2VIQA 2C3SA 2C93B 5GIBA 2R2WU 1C5RA 3EA8A 1ELBA 3A7XA 4FUJA 5L30H 3O8BA 5FPSA 3G01A 1UCYH 4O3TA 4AGKA 2QXHA 1E37B 1FUJA 4MPVA 3H7TA 2BX3A 1C5QA 3GYMA 1YCPK 2SGEE 2BLVA 1TMBH 2TPIZ 1KTSB 3A81A 3E1XB 3I78A 2ZGHA 1Y5BT 2PFEA 2SNVA 1GI8B 1DSTA 1CBWB 1ZJKA 4MNVA 1NY22 3VB5A 1BITA 4ABBA 3MNSA 1BMLA 3OTJE 3R3GB 3MU5A 4UD9H 3RU4D 1KSNA 4Y6DA 3P70B 1PJPA 3ZZBA 4UONA 1UO6A 1PQ8A 2GT8A 3A8CA 2GV7A 5J4SA 1C4Y2 1CQQA 1DLKB 5FCKA 5F8ZA 3A88A 2ZTXA 2CXVA 1O2TA 2FYQA 4J1YA 3RMLH 2JKHA 3UOUA 3SU3A 3UFAA 1HNEE 4Y8ZA 3GISB 3T2NA 1HAOH 3C27B 3PWCA 1JWTA 4BAKB 1SOTA 3UQVA 3TH3H 1MKXH 1F0RA 1Z7KA 1GJ7B 3LC5A 2BDGA 2PHBA 3SU5A 2QC2A 5GCHG 5B6OA 1FDPA 1TNIA 2BXTH 2GMTB 5BPEA 1GMHF 1GL1A 3A7VA 1JIMA 1TWXB 1NRPH 1AFEH 3VEQB 3FP6E 4DT7B 1AKSB 4FU8A 4K2YA 4U32A 1AZ8A 5FBIA 3F6UH 3A7WA 1C2JA 4ABDA 3KHVA 2VJ1A 2O8WA 1EP5A 2P59A 3LT3A 4X8SH 1YPHC 1HCGA 2ZHFH 3RXKA 5A09A 1ZRKA 3IWMA 4ZXXH 2B0FA 2UUFB 3EQ0H 1W7GH 1O2JA 1PPBH 4MNYA 1DSUA 3P8FA 1K2I1 2ZP0H 1O5CB 1C1RA 3AAUA 1ELFA 1GCTC 2GCTB 1ZPBA 1D3QB 5DJ7A 1V2KT 4XSKU 1UTQA 4AORA 2XTTB 3SZNA 3I29A 4JZFH 2Z3CA 1IQHA 2W3IA