1C2IA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2iA02
4X0WU 1N6YA 1AB9C 3URCA 4BNRA 2KAIB 2WYJA 5AFZH 1RS0A 3LGYA 2WV5A 2ZCHP 1GBLA 1TRNA 2SGAA 4FUEA 5HGGA 3SU6A 3NZIA 3GCNA 1KLTA 1NY22 4AN7A 1RIWB 3S7KB 1ELEE 4HGCA 2GTBA 3UY9A 4MPUA 1B0FA 4ASHA 2C3SA 1F0RA 1LQDB 3PLKA 3PV4A 5EXLA 2P93A 1O2GH 1O5EH 2ZQ2A 1AVGH 3SN8A 2GP9B 3HK6B 3ZVBA 1CT4E 2QCYA 4AGKA 1Y5BT 2G00A 1Y5AT 4DJZB 1EQ9A 1XX9A 3QO6A 4YOJA 1P11E 1SB1H 3W95A 1ZRKA 4F4OC 1O3DA 1SVPA 3ATLA 4Q7XA 3C1KA 2BXUH 1TGCA 3U9AH 1GL0E 4UFGH 4A92A 2ZGHA 2A0QB 2OD3B 2OBQA 4E7RG 2FM2A 1CU1A 3VPKA 3U8OH 1E37B 2FS9A 1AI8H 3QK1A 2BD5A 5DP7A 2FLRH 5DP6A 1K1JA 4J2YB 5FCRA 1WAYB 4RKOB 3EA8A 1GVLA 1DE7H 1MD7A 4H42U 4DT7B 1N6XA 3RXQA 4X1SU 3MU1A 2Z9KA 2D2DA 1ELGA 5EPNA 3MNSA 2O8WA 2GGVB 4CRDA 3RXIA 4WMEA 1GBTA 3QWCH 1IQLA 1DUAA 1L1JA 1TB6H 1VCWA 3HKJB 4I8KA 1MU8B 3HKIB 7GCHF 3UNRA 3D49H 1UVUH 1GJBB 3VGCC 1UHBB 1SQTA 4AG1A 1GHWH 1DOJA 1GHXH 2HWLB 3GDUA 4DVAU 1T31A 3UNQA 2ZG0H 4WJG2 2XTTB 1BRUP 3BF6H 3A7YA 2V6NA 1D9IA 1QIXB 1NU9A 1GI7B 3FAOA 3I29A 5C1XA 1E35B 2OC8A 1FONA 1T8MA 1O2JA 1TPOA 1YLDA 2ZF0H 3Q3KA 1IQJA 4ZXXH 5F8XA 4CR9A 2AGGX 1F5RA 2RG3A 2ZFQH 2GX4A 4FU9A 3LGIA 1AGJA 4MPXA 4CRBA 4ISLA 5GJ4B 3SJKA 3A8CA 1LPKB 5T3HA 2GCTC 2GT7A 1OWEA 3SO3A 1GMHG 1MKWK 2BD7A 4I32A 1ETTH 3SZNA 1S83A 5A0AE 2W3IA 3P17H 1JOUB 4CRCA 2W3KA 1VGCB 3PLBA 2PWXA 1T8LA 3ZZ6A 3RP2A 3SW2B 3ZZDA 2YNAA 2AIQA 1ZPBA 2ZP0H 4FUIA 2SGFE 5FX6A 1HPGA 2OC0A 4BXWA 2XYAA 3EYDA 4IMZA 3MO6A 1QTFA 1THSH 2FYRA 1FY5A 1FPCH 3L6PA 1A61H 1CGHA 1MTNC 5K7RA 2XNIA 1KDQA 1DWDH 1UTKA 4BXSA 3VFEA 1GHAG 1UVTH 5J4SA 3RC5A 2GCTB 3H7OA 3NUMA 1TX8A 1G37A 1C2MA 3ZZCA 5FCKA 1F7ZA 3BEFB 1UMAH 4LXBH 1FN6A 1UTNA 3LJJA 1QGFA 3SU1A 2G4UA 3EDXB 1DY9A 4WMDA 2C8XB 1UCYH 3MTYA 1O2NA 4JYTA 1V2OT 3BTHE 1O2TA 1T32A 4KTCA 1YCPH 5EG4A 1PPZA 4NWKA 1GBHA 2C8WB 4ISHH 3TJOA 3GICB 1W0ZU 2IPHA 1MTNB 1CSOE 2ZECA 1EB1H 3SBKA 1O2MA 2PHBA 3O8RA 2G55A 1DXPA 4INKA 1GBKA 4ABHA 5IDKA 2ZC9H 3QN7A 4NIVA 2WINI 1GPZA 4FVDA 3ZVGA 3SNCA 1C5LH 1NN6A 2KAIA 1SGRE 3DD2H 4AYVB 1H1BA 1RTLA 2WYGA 1O38A 2BDGA 2BLQA 4OS6A 3GY5A 2GKVE 3BTGE 1AKSB 1JIMA 5HYOA 1GHZA 5EQSA 1UK2A 2Z9LA 3RXEA 1KLJH 4MG3A 1WCZA 4YT6H 2AGEX 2IJOB 1WUNH 1K21H 3NWUA 1TX7A 1NS3A 1P3EA 4H6SB 3PMAB 2ZHEH 1Y59T 4K8BA 1QBVH 1A1RA 1GWAA 3AW1A 4CR5A 1KXAA 3RXDA 2PSYA 4X8TH 4NIWA 3VEQB 1DUEA 2BDYA 2V0BA 1MKXH 1ZHMA 4GHQA 2ZDAH 3ZZ3A 3P95A 2RCEA 3URDA 3RDZA 2BY7X 4TWWA 1TLDA 3RXBA 3SV6A 1O0DH 1FJSA 1BTZA 3UQOA 5DO4H 1G3DA 3UUZA 4K1TA 1V2VT 4JYVH 2ALVA 1GI8B 2SGQE 3SQEE 1OXGA 2EI6A 2BD3A 2D26C 1QA0A 3LGWA 3MHWU 3PTBA 3SU5A 1C2EA 2UWPA 1GI0A 3ZZ8A 1MH0A 2UUYA 1O3PB 2DUCA 1ANCA 2ZPSA 4X2YA 1AD8H 5ESBA 1ELDE 2BX3A 1GJCB 3T27A 5A09A 1IAUA 2QN5T 3LH1A 2GCHF 1G30B 1TIOA 2VIQA 4B76A 3SJIA 3TNSA 3BTKE 1EP5A 4IC5A 1A3EH 1WBGB 1UHBA 1QB9A 3ATMA 2UUFB 3RXLA 2BLOA 3HGPA 2O8MA 1Z8RA 3Q77A 1LVBA 3DFJA 4JCNA 1CO7E 4B74A 4XBBA 3ZZ4A 5LPEA 2CN0H 1HAGE 1SGFG 1YPGH 1O3HA 2DE8A 2F9OA 3A8AA 1SI5H 2WPIS 2JH0D 3BTEE 2BDBA 2YNBA 2ODPA 1KTTB 5LPRA 1Z71A 2FOEA 4X6OA 4Y6DA 5CE1A 3FVFB 4KKDA 1QQ4A 3PWCA 1EKBB 3BG8A 1FDPA 1J8AA 1QBOA 2NWNA 4NZQA 1E36B 3RLYH 1D6WA 1EZUC 1GDNA 1ZPZA 1IHSH 1OS8A 2CJIA 2SGPE 3MU8A 1BHXF 1C2IA 3N7OA 1P3CA 4D9RA 1ZLRA 4FUDA 1TNHA 1O2ZA 3CS0A 1H8IH 1V2TT 4AYYB 3SJ9A 5E2OA 2OBOA 3LDXH 4FUCA 3KF2A 1NFYA 2F9PA 1GJ8B 4NFEA 5LPFA 1C4Y2 3LGVA 5T6GA 2J4IA 2QXHA 3ELAH 1SPJA 3A82A 1Y3XA 4ESTE 1HAOH 3M35A 3UR6A 1FY3A 2FI5E 1FPHH 1LO6A 2ZZUH 5EPYA 2Y7XA 4QT8C 1GMCF 2BQWB 2AFQB 4WMFA 2THFB 1TONA 1QY6A 4WWYA 3PMJA 1EJAA 2QIQA 2ZDLA 4DW2U 3UOPA 2J9NA 4B71A 1XKAC 2RA3A 4ABEA 1NFUA 3GYMA 3SUGA 3MOCA 1F0TA 1NFXA 1P09A 2J94A 2A5IA 3M61U 2TGPZ 3V0XA 2QGRA 1O3AA 1SGFA 4LOYH 4BAOB 1VJAU 1GCDA 1HCGA 5EXNA 2RA0A 5GCHG 4X1NU 3SHAH 1FZZA 1C2DA 1K1NA 1K1IA 4UDWH 2FX4A 4UFDH 2HNTF 3MMGA 1WQSA 3SGAE 2H5CA 1W10U 2PV9B 5IYTA 1DITH 2Z3EA 1DPOA 1ESTA 5C67A 1O3MA 1C1SA 2Z9IA 1UO6A 3LONA 1O2UA 4YZUA 5C20A 2BVRH 2AGIX 3SHCH 1WQVH 1ESAA 3FZDA 1SR5C 3M3SA 1SQAA 1J9CH 3S9BA 2HPPH 2A4GA 2JETC 1AKSA 3ZZ5A 1RGQA 4ISNA 1HV7A 5AVDA 1NFWA 5AHGH 1HAVA 2FODA 3LOXA 2UWOA 4I7YH 2G81E 3TH3H 3R0FA 2BDHA 4U30A 3S9CA 3C27B 2J95A 4DGJA 3WY8A 3UREA 1BIOA 3F6UH 1P2KA 1BBRH 2FOFA 4BOHA 1O3GA 1C1VH 4I31A 5L30H 1CA8B 1KXDA 2ZPQA 2FOAA 1O33A 1C5SA 1TNKA 1FIWA 1GHYH 1C1TA 1PPGE 1XUHA 2A7JA 2JETB 2UUKB 1ORFA 2BVXH 4A6LA 1O3CA 3EA7A 3KQCA 4OGYA 4XOJA 1NRSH 3BTTE 2VU8E 3QUMP 2ZPRA 2CXVA 2PUXB 1UTPA 2AMPA 2ZCLP 3EE0B 2ZKSA 2ZHWH 4MTBA 5HM9A 3ZVCA 2BD2A 2XCNA 1UTOA 1LHCH 3SJ8A 2XWBI 3ZZAA 4E06H 2R2WU 1OWHA 5DGJA 4WVPE 2A1DB 4DG4A 1K9OE 1UTQA 1A0LA 2ZGCA 3VB7A 1FMGA 1TYNA 1W2KH 1GDUA 2H6MA 1S0RA 1OP8A 1BTPA 4KGAA 1JBUH 1MBQA 3RXFA 3ZYEA 4BTIB 2BTCE 3IWMA 2BB4A 1D3PB 2YOLA 4NIXA 3RXGA 3RXCA 1MTVA 1HAIH 3RXKA 6LPRA 2PKAA 1SHYA 4BTTB 1DWEH 1TQ0B 2VVUA 1C5MD 1HAXB 2ZGBH 3MNXA 1HXEH 2OCVB 1YCPM 2AEIH 2ZQ1A 1THRH 1RD3B 1W0YH 4JZIA 4B2AA 3ZZ7A 2ZNKH 4AFQA 5DP4A 1VR1H 6GCHG 1NZQH 3MO3A 1PJPA 3UWIA 2FX6A 2QAAA 1QJ1B 1S5SA 1TA2A 1BTUA 5EU8A 5F8TA 4NA9H 1LKAA 5FPTA 3OU0A 5GPIB 1NESE 4NFFA 1HUTH 2JKHA 2OTVA 3VB5A 2ASUB 4BANB 1WTGH 2UWLA 3BV9B 4NGAH 3ZVFA 1HLTH 5TCAA 1NM6A 4ZKOU 5J4QA 1AFEH 4WF8A 4CH8B 1IHTH 3E6PH 1O2HA 1VITG 2XWAA 4YTAA 1CVWH 1SC8U 4NWLA 5C2ZA 2GT8A 3I78A 1V2QT 4UD9H 1EPTC 2FIRH 2W7UA 4I8HA 3M5MA 1QURH 2BD9A 1FY8E 1O3JA 2BY8X 2H5DA 3GDSA 4U2WA 4Y0ZE 3RM0H 4MLFB 3RXMA 2D1JA 2VIVA 2Y80A 2Z6BD 1SFQB 1SLXB 1XM1A 3STIA 3CP7A 1BJVA 2AIPA 1NRQH 1OP2A 1ZRBA 4R0IA 3T28A 1YPHE 1AMHA 2XRCA 4H6TA 4AZ2B 2ANMH 1GI1A 2BQ7B 3LT3A 5JBBS 2Z94A 1S6HA 1VCQA 1ANBA 1C5RA 1C5NH 1GHAF 5I46H 1EPTB 2FZZA 3BSQA 4K8YA 3DHKH 1MMJN 2BLVA 2VB0A 1EOJA 1DX5M 2GD4B 5DP3A 3UR9A 7LPRA 1ZSJA 4KTSA 1G9IE 2XC0A 1ANEA 1EATA 4A1XA 3SORA 1UK3A 3RXUA 1CHOG 2A4RA 4MNWA 3FP8E 3GY6A 1GJ5H 2XBXA 2ODQA 3KNXA 5EQQA 3SJOA 3W94A 1DSUA 1EUFA 1OX1A 2R0KA 2TIOA 2F9VA 4RN6A 4X8SH 4F49A 3A8BA 5BRRE 2GDEH 3B9FH 1MKWH 3SU3A 4D7GA 1T8NA 3VB3A 1C2FA 1T4VH 1QB1A 4CREA 2STBE 9ESTA 2H9TH 2TGTA 1SHHB 5FBEA 1CHGA 1S0QA 3M7UA 3F1SB 1XXFA 1VGCC 2A4OA 1TBQH 4FU8A 1NPMA 2GDDA 2OP9A 3ZZBA 5LGOA 3BIVH 4Y7BA 1BDAA 1O3OA 3NK8A 1YGCH 4JZDH 1L4ZA 5A2MH 3TK5A 1SLWB 1LHEH 1MD8A 1KSNA 3PM3A 2PUQH 1C1OA 4AB8A 3TJVA 2OINA 3UOUA 1PPEE 2F9UA 3SNAA 1JRTA 3ZV8A 1W3CA 4INLA 2FPZA 1QBNA 4AFSA 1HGTH 2BDAA 1FLEE 1FN8A 2FTLE 2IN2A 1SFIA 4ABIA 1AVXA 3K65B 3SUFA 4UFFH 5DPAA 1P01A 5FHTA 2R3UA 1RRKA 2Q6FA 4A5TS 2BY6X 4YOIA 1ZYOA 3E8LA 1O5AB 4RSPA 3TGJE 3M3VA 4R8TB 3V13A 1WOFA 2P3FH 1TMBH 1C5QA 1WTHD 2EEKA 1AUJA 2HGTH 3KCGH 4Q7YA 5HMAA 1FY1A 3RC4A 3SV2H 1HAZB 1TGTA 2V3HH 6ESTA 1CGIE 1AE5A 1MTUA 4IN2A 4MPVA 4TPYA 2TPIZ 2LNCA 4ZUHA 4Q2KA 1BRCE 1U6QA 1G2LA 2P3TB 3Q00A 4HZHA 3AASA 3K6YA 1D6RA 3IG6B 2BDCA 4GPGA 2FOHA 2HLCA 3SV9A 1TRMA 5DK1A 1NRRH 2WPKS 1SQOA 1GBDA 3KEEA 1GVZA 1P9UA 4JMYA 1DWBH 1S81A 5HM2A 5JBCS 4TWYA 2A7HA 5TCCA 1IQHA 1A0HB 1YLCA 5GIBA 1W7XH 5L6NH 5C1YA 1RJXB 5GXPA 3HPTB 4B75A 4MNYA 3KHVA 3LGUA 4XDEA 4X2VA 3KQBA 5JYIA 1MCVA 1V2UT 2D8WA 1UVPA 1XKBC 2SNVA 4FUGA 2SGDE 1TA6A 3UNSA 1GJ6A 4CHAC 1F92A 2BD8A 2ULLA 4CBOA 3OYPA 2GVFA 1HAPH 2J34A 2G51A 3ITIA 4BAMB 4Y0YE 4BAKB 1YF4A 2Q6DA 1H8DH 3OY6U 4Z0KA 1P8VC 4NZLA 1ELFA 1O2LA 1YYY1 4D8NA 1HNEE 4FXGH 1KIGH 1EOLA 1ELVA 3TH4H 1Z6JH 1GHBG 3BTME 1O37A 1E34B 2FYQA 1C1WH 4U32A 1UTJA 4INHA 5JB9S 1O34A 3FP7E 1O35A 3UQVA 1P03A 2Q1JA 4HI3A 3VXEH 1LVYA 4YT7H 1HJAC 4X8UH 3QTVH 3RLWH 2ZFSA 2VIDA 1CBWC 4CHAB 1ARBA 2QC2A 1A46H 1AVWA 1LTOA 1KXCA 3PO1B 1C5PA 4NSVA 1QL8A 2Z7FE 1FAKH 4ZKRU 1EPTA 2P16A 2TRMA 4JZ1A 4MVNA 1UVOA 5GDSH 1TX6A 1TNIA 4K1SA 5ETXA 5C1UA 4I8JA 1NT1A 3MU5A 2BDIA 2ZU4A 4XFQA 1AHTH 1SBWA 2ANWA 5GWZA 1GMDF 1GHVH 3RMNH 3A86A 4NA8A 1CGJE 1FUJA 3QX5H 2BM2A 3SU4A 1P0SH 3D62A 2Q6GA 4CH2B 1GBBA 2QXGA 1HJAB 4FUBA 1FAXA 2WPJS 1O5DH 1CBWB 5GCHF 1A5IA 2A7CA 2AS9A 3K6ZA 2VWNA 3QDZB 4K5ZA 1V2JT 2A31A 5JBTA 2QF3A 5AFYH 3SU2A 2VH0A 2SGEE 1UJ1A 2BMGB 1ZSKA 1TAWA 4K3JA 3QZQA 4DCDA 2BOKA 4YESB 1K2I1 4OS2A 1CT2E 3V7TA 4YM9A 1BQYA 1ZTKA 5E0GA 4BTUB 3P8NA 2FS8A 2SNWA 1G36A 1GI5A 1O2SA 1GI3A 1ZTLA 2JH6D 1WU1A 5EOKA 3RU4E 5DP8A 3BTQE 4IC6A 2B0FA 1RTFB 1O31A 4KELA 5JB8S 4ISOA 1OSSA 2ZHQH 2FEQH 4MNVA 1TMTH 4UEHH 4GCHG 1GI9B 1H4WA 3A81A 3OSYA 4AX9H 2CF8H 1F5LA 4IS5A 4DIIH 1OWIA 2Y7ZA 2ZO3H 1KY9A 4FUJA 2ANKH 2EI7A 1IQNA 1V2PT 3U69H 1ABJH 1W13U 5EXMA 3D23A 3TK6A 3AW0A 2BZ6H 1CA0C 1W8BH 2CHAC 3TJNA 3BG4B 5C3NA 5JDUB 1D3DB 1XUFA 3FP6E 3F9GA 3K2UA 1WV7H 1MQ5A 2ZDKA 1ETSH 1C5YB 2ZU1A 3LU9B 1HIAB 3MI4A 3L3TA 3F9HA 2PKSC 3S0NA 1DT2A 1YPHC 2F91A 2W7SA 2ZGJA 1SGYE 1BMLA 3H7TA 3RXJA 1V6DA 5JPMH 1SGDE 4DY7B 1A5HA 1NRNH 5FPYA 1FI8A 4DURA 1EP6A 4OS1A 1CA0B 4ZH8A 2CHAB 2O8TA 2P3UB 2ZA5A 1DICA 2VINA 1O5BB 3RXSA 3MH6A 2NU4E 1S85A 1YBWA 4ZHAA 5L2ZH 1E0FD 2FO9A 1C5WB 4O97A 1K1PA 2VH6A 2PKSB 3PROA 5A0CA 1P2JA 2ZTZA 1P12E 1BB0B 4J1YA 3K9XB 1D3TB 2I6SA 2G5NA 1MBMA 4XE4A 1P04A 5ABWA 2G52A 2XCFA 1INCA 1W14U 3RM2H 3P8GA 2GV6A 3E3TA 1QNJA 1XXDA 5CHAB 3T29A 1L2EA 4ABAA 1GBMA 2P59A 1SOTA 3E91A 1W12U 4KP0A 2J2UA 2PR3A 1TBZH 2GCHG 6GCHF 2BY9X 1SGQE 1P2MA 2Z3DA 4IN1A 1BMMH 2H2ZA 2PTCE 1B0EA 1BA8B 1OYQA 1LKBA 3ZYDA 1BT7A 3AVZA 1A7SA 4U01A 1YPMH 1ABIH 5T6FA 2ZFTA 3IITA 4FUFA 2FI3E 2P8OC 3T25A 2K1QA 1O3FA 1QRXA 5TJXA 1C9PA 1HDTH 1ZHRA 1YP9A 1VITF 1P2IA 4BAQB 4IBLH 2VWLA 1Q3XA 4AGJA 2FOGA 3BEUA 5EODA 8ESTE 2ILNA 3A8DA 4YO9A 1SGEE 2FOMB 1P2QA 2F83A 1C4U2 1TABE 2XC4A 4DIHH 1ARCA 1ACBE 2G5VA 1W7GH 1PPBH 2FOCA 4NA7A 5F8ZA 3RU4T 3P92A 3Q3YA 2HOBA 2P8OB 4JZEH 4YOGA 1EAUA 1XVOA 4ZHLU 3GY2A 1FNIA 2J92A 3EGKH 3PLPA 8LPRA 1YPEH 4I33A 3ATIA 1C9TA 1BZXE 5DJ7A 4ZMAH 2HALA 4BAHB 3EQ0H 1AQ7A 2Y82A 4A1TA 1EZSC 5BPEA 3SOSA 2WV4A 1EJMA 3LC3A 2F3CE 3SGBE 2A2QH 1G3BA 3TGKE 1QL7A 3LJOA 1GJAB 1FQ3A 1P57B 1O2QA 3P6ZB 1JWTA 2O9QA 3GCTG 1V3XA 3TPIZ 1CHOF 2Z9JA 3SNEA 2W26A 3P8OA 1WYKA 3MH4A 3AAVA 2CV3A 3QLPH 2HRVA 3L33A 1AZ8A 3GCOA 4AB9A 2AYWA 1GI4A 1F2SE 2I6QA 1QJ6B 1MZDA 2QV1A 3M7TA 2FP7B 2Y81A 1DWCH 4E05H 1EAIA 1P05A 1JIRA 3GY4A 3OY5U 3RXPA 1K1MA 1XUKA 1P9SA 2Z3CA 1AWHB 2FDAA 1PYTC 2B5TB 4GLYA 1O5GH 1QQUA 1MAYA 1O36A 1PFXC 1HIAA 3V12A 1Y3WA 3LH3A 2QXJA 2VIOA 1TWXB 1C2KA 1LHDH 3RXRA 2FMJA 3U98H 1S6FA 3T5FH 3LC5A 3KQDA 1HAHH 4Y7AA 4KTUA 4ZKSU 1GMHF 3FZZA 1OP0A 4JZFH 2TGDA 3SI3H 1M9UA 3O8BA 2BOHB 4B73A 7ESTE 1HFDA 2BY5X 4O03A 3TIUA 5A0BA 1K1OA 3OX7U 1G32B 1B7XB 3SUEA 1GBJA 2ZEBA 1C5VA 2A4QA 3UIRA 1BRAA 3RU4D 1DDJA 1GJ9B 3RMOH 8KME2 3M5OA 1J15A 3TNTA 4NCYA 1GL1A 1ANDA 1N8OC 1C5ZB 3NKKA 3UTUH 4E7NA 4FVBA 2HVXA 2HNTE 5FX5A 3A89A 4IW4E 4ZAEA 1BTXA 3O8CA 1FY4A 1SLVB 1VJ9U 3M7QA 1GCTB 1SGPE 1DANH 1AIXH 1YPLH 3F68H 2BZAA 1ZOMA 1BJUA 1HAYB 3T26A 3T2NA 2Y5HA 4M7GA 4HTCH 2EA3A 1QA7A 4B1TA 1V2NT 1XUGA 1AB9B 3ZZ9A 4ABFA 1O5CB 1O2PA 1C4V2 3S7HB 1ID5H 1EZQA 1KYNA 4VGCC 3MFJA 1O2YA 1QCPA 1V2KT 2ZDNA 1C2HA 3SV8A 4GHTA 3ZVDA 4X2WA 1D3QB 1RXPA 3A84A 1P06A 1N8OB 1L4DA 1SSXA 1EX3A 4ZKNU 1C2GA 3TVJB 3ODFA 1CE5A 2ZIQH 5K0HA 5H4IB 1ZGVA 1GJDB 2O8UA 4Y8XA 2VNTA 3NCLA 4FUHA 3NPSA 3ATKA 4SGBE 1AWFH 3ENSB 2A5AA 4GUXA 1Y5UT 2V35A 1TBRH 1N1LA 1V2RT 5DG6A 5E0HA 1VITH 1YPJH 1ZHPA 1IQMA 1AY6H 1WSSH 4VGCB 3LKWA 1MCTA 1V2ST 1SGNE 5EW2H 3U8TH 5ESTE 4YLQH 3RMMH 2Y5FA 8GCHG 1LDTT 2ODYB 1B5GH 3GY8A 4NSYA 4RKJB 3QZRA 2EC9H 3PMBB 1C2LA 1SLUB 4ABBA 1GHBF 5FXLA 1Y3VA 2JH5D 2WPHS 1O32A 4AOQA 1C5UA 1G3EA 3I77A 2FOBA 2Y6TA 3PYHA 4XBCA 4AFUA 1TQ7B 3P70B 5C5OA 3A7XA 4UFEH 1A3BH 1UK4A 1UVSH 1QRWA 1EAXA 4Q7ZA 1OOKB 3STJA 1QR3E 2A5KA 1G2MA 3VB4A 1DM4B 4K1EA 3A80A 7KMEH 4WXIA 2VIWA 3VGCB 1THPB 1TNGA 2G4TA 1OWDA 1D4PB 5F03A 2ZTYA 3HGNA 3BTWE 2ALPA 3MU4A 4ABDA 3E90B 1LPZB 3OTJE 1BMNH 5EGMA 4UONA 3UWJH 2ANYA 3RXVA 2AMDA 3RUOA 1GG6C 1H9LB 3SGQE 2R3YA 1HJ8A 2QF0A 2PTNA 1UCYE 1MUEB 1AN1E 5B6OA 3A85A 3SU0A 1JXPA 1O39A 3GOVB 1YPKH 3A88A 1P02A 1GGDC 3GY7A 3QGJA 4XBDA 1HJ9A 4K2YA 1A5GH 1RTKA 3DFLA 4MNXA 1LHGH 2H1UA 1O2XA 1BTWA 1LVOA 2ZI2H 1C1QA 4Y79A 1AUTC 3ZVEA 1C5TA 1GG6B 5JBAS 3AAUA 2BYAX 4Y71A 3GDVA 2RDLA 2STAE 3M36A 3JZ1B 1Q31A 1YC0A 1O5FH 4GCHF 1C2JA 1EASA 2F9BH 3PO1C 1TE0A 1EAWA 3M5NA 1TNLA 2VWMA 2ESTE 1C1NA 7GCHG 2GZ8A 9LPRA 1J16A 1TFXA 1TGNA 1MTSA 3D65E 3M5LA 1GGDB 5T6DA 3KIDU 1Z8IB 3RXTA 2R9PA 4ZROA 2ZCKP 3S9AA 4TY6A 3DUXH 5AF9H 4YLUA 1GVKB 1GBIA 3JZ2B 3MYWA 4PROA 2XW9A 1Z6EA 1UCYK 1Y3YA 1Z1JA 1C5XB 1ESBA 1HAVB 5EQRA 1ELCA 1O3IA 1YKTA 4WH8A 1YCPK 4IGDA 2GMTC 1NO9H 5G4BA 1TRYA 1O2OA 2OC1A 1LMWB 1O2RA 3HATH 1S84A 1BTHH 3LPRA 4OGXA 1AZZA 4X1RU 2C4FH 4A1VA 2H9EH 4CBNA 2BHGA 3A83A 2ZFRH 3LGTA 2G8TA 3LIWA 1SGCA 2ZDMA 3BEIB 4CRGA 1QRZA 1L1NA 1TOMH 2WPMS 2DE9A 2C90B 1ELTA 2HPQH 2P94A 3TITA 1GI2A 3CS7A 1FXYA 1BOQA 1CQQA 3ZV9A 4TYDA 3BN9A 3FFGA 3R3GB 4LZ1H 4DOQA 1GI6A 2GMTB 3NXPA 1HRTH 4X1PU 1ZMNA 1GBEA 2FXRA 2VIPA 2FESH 3E0PB 4I8LA 3MU0A 1EZXC 1IQGA 1GJ4H 2P95A 3U1JB 1DSTA 3TJUA 1PQAA 3BG4C 1QFKH 1T4UH 1HYLA 1Z1IA 3CENA 1MZAA 3ATWA 1DLKB 3RXOA 1LCYA 1V2WT 4ZXYH 1ZTJA 4AORA 1AO5A 2WPLS 1IQKA 1MKXK 1MQ6A 1A2CH 2BXTH 1BUIA 1HXFH 1NTPA 1LQEA 2BVSH 4UE7H 1H9HE 2OQUA 4H4FA 2W5EA 3MNBA 2SFAA 3SUDA 5CMXH 1Z7KA 1ETRH 4TY7A 1BTYA 4B2BA 4X6PA 3Q3XA 2PKAB 1ZGIA 1SGIB 2OXSA 1O3EA 3A7WA 4GSOA 2A32A 4Q80A 4OS5A 5HXFA 1BHXB 2C93B 1OKXA 1AU8A 2B9LA 2A45B 3E0NB 4Y8YA 1IOEA 1OWJA 3Q76A 1OWKA 4Y10E 1C1PA 1C1UH 1HBTH 3ZVAA 1AFQC 2VGCC 1TPPA 1QL9A 2XBYA 3GCHC 3HK3B 1ZPCA 1C5OH 2PSXA 3F9EA 5E2PA 1PPHE 2C8YB 5DKMA 2ZTXA 4CRAA 4TPIZ 3KL6A 2ZGXH 1PQ7A 1TPAE 3QGNB 1DY8A 6CHAC 3RMLH 1XMNB 2WUBA 3T62A 3ESTA 1PPFE 4ISIH 1ZMJA 2TGAA 4WXVA 3B8JA 4NIYA 2HNTC 1NU7B 2ZHFH 1O2VA 1F0SA 1ELBA 1SOZA 5CHAC 2R0LA 4FU7A 3FANA 3QTOH 1TPSA 3A7VA 2OUAA 1ZMLA 4THNH 4MQAA 5FPSA 2VVCA 2M5TA 5FAHA 3TGIE 1O2IA 2ZWLH 1AFQB 1EJNA 1BCUH 1K1LA 2VGCB 2FTMA 3GCHB 1NC6A 2CGAA 2NU1E 3F9FA 3A7ZA 2EI8A 3TU7H 1F5KU 1DLEA 1E38B 1JMOH 3PWBA 4JK5A 6CHAB 3E16B 5A8YA 1J14A 2VWOA 1FIZA 2XC5A 1HB0B 1PQ8A 4Y76A 1GBAA 1BMAA 1DXWA 1GMDG 1SGTA 3GCTF 1GDQA 4SGAE 3MH5A 1VCPA 2GV7A 4OS7A 1KXEA 1EXFA 3MNCA 1PPCE 1UTMA 3BTDE 2AERH 3A87A 1G3CA 4I8GA 1O3NA 1AE8H 2A2XH 1F0UA 3S69A 3ODDA 1Z8JB 3O8DA 4JK6A 1NRPH 4OS4A 5C5NA 1A4WH 2ZU3A 2FWWA 1GJ7B 3SI4H 1ZZZA 2F9NA 4JYUH 2J38A 1SMFE 2XBWA 2QXIA 4K69A 4HFPB 1IQEA 2PW8H 2BD4A 4GVUA 2R2MB 3TK9A 5SGAE 5A8XA 5I25A 4WY3A 1KTSB 1Y3UA 1IQIA 1P2NA 1TOCB 1BBRE 1X7AC 2V3OH 3PB1E 2IOTA 5PTPA 3U1IB 3TLOA 1BRBE 2LPRA 4AFZA 1LHFH 4K60A 3EA9A 1LPGB 1O30A 1T7CA 3TH2H 2GZ7A 2BQ6B 2Y5GA 3P8FA 4X1QU 3U8RH 4ABJA 3SQHE 5E0JA 1OYTH 1V2MT 1MTWA 2CMYA 1ZJDA 2Z9GA 2XXLA 1KXFA 1TALA 4Y11E 5FBIA 2B8OH 2ZDVH 3E1XB 5DP9A 2AH4X 1EB2A 1O2KA 2XBVA 1LVMA 2WUCA 5L2YH 2ZU2A 1RFNA 1TGBA 3V3MA 1QHRB 4LK4A 2NU2E 4O9VA 1Z8GA 3VB6A 5LH8A 1XUJA 3VXFH 1ELAA 1TNJA 1XUIA 1FV9A 1P2OA 1MU6B 1Q2WA 3BTFE 1SG8B 4A7IB 4X6NA 2FI4E 1GBCA 1A0JA 1GBFA 3KN2A 1CT0E 2FLBH 3SNBA 1O3KA 2B7DH 4WH6A 1W11U 1GMCG 4O3TA 1SL3A 2H9HA 3M3TA 1NROH 4D7FA 4X2XA 4LZ4B 2BX4A 1KXBA 1PQ5A 1DS2E 2ZHDA 2GZ9A 3RXAA 3PMHB 1DVAH 1S82A 1P10A 1K22H 1BBRK 1UTLM 1PYTD 1V2LT 1XVMA 2AMQA 2UUJB 1Y8TA 3DA9B 3GY3A 4AG2A 1C1RA 2QYIA 1IQFA 3A7TA 1ZSLA 3SV7A 1H9IE 1L1GA 2PGQB 4MDSA 2ZFFH 1O2WA 1TMUH 1O3BA 3B23B 2QA9E 5EW1H 4ABGA 2QY0B 2OC7A 4GAWA 5E8EH 3MH7A 1JRSA 2NU0E 2VVVA 3RC6A 1KDQB 2OQ5A 5A8ZA 3UPEA 2TBSA 4X6MA 4IMQA 1MAXA 1QB6A 1C1MA 3RXHA 3UFAA 3PTNA 1YM0A 2PGBB 1J17T 3EAJA 2C8ZB 3KQEA 4D76A 3GISB 3M37A 1DFPA 2PFEA 2BLWA 4Y8ZA 3DT0H 1O3LA 4X8VH 4NG9H 1TGSZ 3GYLB 4B2CA 2ZU5A 3MO9A 1L0ZA 1OPHB 3KGPA 4ZHMU 1QJ7B 2ZFPH 8GCHF 1K28D 3H5CB 1ZR0A 3G01A 1ZJKA 2OLGA 1T8OA 1RIWC 1KLIH 3SNDA 4Z6AH 4MPWA 5F6MA 1VZQH 4CRFA 4XSKU 4D9QA 4O3UA 1BITA 1GCTC 2CF9H 2PLXA 3BIUH 2VJ1A 5DP5A 3MWIU 2NU3E 2O8LA
chains in the Genus database with same CATH superfamily
4X0WU 1N6YA 1AB9C 3URCA 4BNRA 2KAIB 2WYJA 5AFZH 1RS0A 2KM0A 3CNRA 3LGYA 2WV5A 2ZCHP 1GBLA 1TRNA 2SGAA 4FUEA 5HGGA 3SU6A 3NZIA 3GCNA 1KLTA 1NY22 4AN7A 1RIWB 3S7KB 5HKKD 1ELEE 4HGCA 2GTBA 3UY9A 4MPUA 1B0FA 4ASHA 2C3SA 2QF5A 1F0RA 1LQDB 3PLKA 3PV4A 5EXLA 2P93A 1O2GH 1O5EH 2ZQ2A 1AVGH 3SN8A 1W0JD 2GP9B 3HK6B 3ZVBA 1CT4E 2QCYA 4AGKA 1Y5BT 2G00A 1Y5AT 4DJZB 1EQ9A 1XX9A 1MABB 3QO6A 4YOJA 1P11E 1SB1H 3W95A 1ZRKA 4F4OC 1O3DA 1SVPA 3ATLA 4Q7XA 3C1KA 2BXUH 1TGCA 3U9AH 1GL0E 4UFGH 5F53A 2ZGHA 4A92A 1COWD 2A0QB 2OD3B 2OBQA 4E7RG 2FM2A 1CU1A 3VPKA 3U8OH 1E37B 2FS9A 1AI8H 3QK1A 2BD5A 5DP7A 2FLRH 5DP6A 1K1JA 4J2YB 5FCRA 1WAYB 4RKOB 3EA8A 1GVLA 2JJ1D 1DE7H 1MD7A 4H42U 4FOUC 4DT7B 1N6XA 3SYJA 3RXQA 4X1SU 3MU1A 2Z9KA 2D2DA 1ELGA 5EPNA 3MNSA 2O8WA 2GGVB 1WDIA 4CRDA 3RXIA 4WMEA 1GBTA 3QWCH 1IQLA 1DUAA 1L1JA 1TB6H 1VCWA 3HKJB 4I8KA 1MU8B 3HKIB 7GCHF 3UNRA 3D49H 1UVUH 1GJBB 3VGCC 1UHBB 1SQTA 4AG1A 1GHWH 1DOJA 1GHXH 2HWLB 3GDUA 4DVAU 1T31A 3UNQA 2ZG0H 4WJG2 2XTTB 1BRUP 3BF6H 3A7YA 2V6NA 2KR7A 1D9IA 1QIXB 1NU9A 1GI7B 3FAOA 3I29A 5C1XA 1E35B 2OC8A 3F2GA 1YY3A 1FONA 1T8MA 1O2JA 1TPOA 1YLDA 2ZF0H 3Q3KA 1IQJA 4ZXXH 5F8XA 4CR9A 2AGGX 1F5RA 1SQRA 2RG3A 2ZFQH 2GX4A 4FU9A 3LGIA 1AGJA 4MPXA 4CRBA 4ISLA 5GJ4B 3SJKA 3A8CA 1LPKB 5T3HA 2GCTC 2GT7A 1OWEA 4TT3D 1GMHG 1MKWK 2BD7A 4I32A 3SO3A 1ETTH 3SZNA 1S83A 5A0AE 2W3IA 3P17H 1JOUB 4CRCA 2W3KA 1VGCB 3PLBA 2PWXA 1T8LA 3ZZ6A 3RP2A 3SW2B 3ZZDA 2YNAA 2AIQA 5KEDA 1ZPBA 2ZP0H 4FUIA 2SGFE 5FX6A 1HPGA 2OC0A 4BXWA 2XYAA 3EYDA 3DSGA 2L6OA 4IMZA 3MO6A 1QTFA 1THSH 2FYRA 1FY5A 1FPCH 3L6PA 1A61H 1CGHA 1MTNC 5K7RA 2XNIA 1KDQA 1DWDH 1UTKA 4BXSA 3VFEA 1GHAG 1UVTH 3WW7A 5J4SA 3RC5A 2GCTB 3H7OA 3NUMA 1TX8A 1G37A 1C2MA 3ZZCA 5FCKA 1F7ZA 3BEFB 2XOKD 1UMAH 4LXBH 3N99A 1FN6A 2K0QA 1UTNA 3LJJA 1QGFA 3SU1A 2G4UA 3EDXB 1DY9A 4WMDA 2C8XB 1UCYH 3MTYA 1O2NA 4JYTA 1V2OT 3BTHE 1O2TA 1T32A 4KTCA 1YCPH 5EG4A 1PPZA 4NWKA 1GBHA 2C8WB 4ISHH 3TJOA 3GICB 1W0ZU 2IPHA 1MTNB 1CSOE 2ZECA 1EB1H 3SBKA 1O2MA 2PHBA 3O8RA 2G55A 1DXPA 4INKA 1GBKA 4ABHA 5IDKA 2ZC9H 3QN7A 4NIVA 2WINI 1GPZA 4FVDA 3ZVGA 3SNCA 1C5LH 1NN6A 2KAIA 1SGRE 3DD2H 4AYVB 1H1BA 1RTLA 2WYGA 1O38A 2BDGA 2BLQA 4OS6A 3GY5A 2GKVE 3BTGE 1AKSB 1JIMA 5HYOA 1GHZA 5EQSA 1UK2A 2Z9LA 3RXEA 5KGOA 1KLJH 4MG3A 1WCZA 4YT6H 2AGEX 2IJOB 1WUNH 1K21H 2KZ4A 3U28C 3NWUA 1TX7A 1NS3A 1P3EA 4H6SB 3PMAB 2ZHEH 3F2HA 1Y59T 4K8BA 1QBVH 1A1RA 1GWAA 3AW1A 4CR5A 1KXAA 3RXDA 2PSYA 4X8TH 4NIWA 3VEQB 1DUEA 2BDYA 2V0BA 1MKXH 1ZHMA 4GHQA 2ZDAH 3ZZ3A 3P95A 2RCEA 3URDA 3RDZA 2BY7X 4TWWA 1TLDA 3RXBA 3SV6A 1O0DH 1FJSA 1BTZA 3UQOA 5DO4H 1G3DA 3UUZA 4K1TA 1V2VT 4JYVH 2ALVA 1GI8B 2SGQE 3SQEE 1OXGA 2EI6A 2BD3A 2D26C 1QA0A 3LGWA 1H8HD 3MHWU 3PTBA 2QE7D 3SU5A 1C2EA 2UWPA 1GI0A 3ZZ8A 1MH0A 2UUYA 1O3PB 2DUCA 1ANCA 2ZPSA 4X2YA 1AD8H 5ESBA 1ELDE 2BX3A 1GJCB 3T27A 5A09A 1IAUA 2QN5T 3LH1A 2GCHF 1G30B 1TIOA 2VIQA 4B76A 3SJIA 3TNSA 3BTKE 1EP5A 4IC5A 1A3EH 1WBGB 1UHBA 1QB9A 3ATMA 2UUFB 3RXLA 2BLOA 3HGPA 2O8MA 1Z8RA 3Q77A 1LVBA 3DFJA 4JCNA 1CO7E 4ACAA 1S6LA 4B74A 4XBBA 3ZZ4A 5LPEA 2CN0H 4YXWD 1HAGE 1SGFG 1YPGH 1O3HA 2DE8A 2F9OA 3A8AA 1SI5H 2WPIS 2JH0D 3BTEE 2BDBA 2YNBA 2ODPA 1KTTB 5LPRA 1Z71A 2FOEA 4X6OA 4Y6DA 5CE1A 3FVFB 4KKDA 1QQ4A 3PWCA 1EKBB 3BG8A 1FDPA 1J8AA 1QBOA 2NWNA 4NZQA 1E36B 3RLYH 1D6WA 1EZUC 1GDNA 1ZPZA 1IHSH 1OS8A 2CJIA 2SGPE 3MU8A 1BHXF 1C2IA 3N7OA 1P3CA 4D9RA 1ZLRA 4FUDA 1TNHA 1O2ZA 3CS0A 1H8IH 1V2TT 2RDEA 4AYYB 3SJ9A 5E2OA 2OBOA 3LDXH 4FUCA 3KF2A 1NFYA 2F9PA 1GJ8B 4NFEA 5LPFA 1C4Y2 5T1VA 3LGVA 5T6GA 2J4IA 2QXHA 3ELAH 1SPJA 2F43B 3A82A 1Y3XA 4ESTE 1HAOH 3M35A 3UR6A 1FY3A 2FI5E 1FPHH 1LO6A 2ZZUH 5EPYA 2Y7XA 4QT8C 1GMCF 2BQWB 2AFQB 5DSFA 2LELA 4WMFA 2THFB 1TONA 1QY6A 4WWYA 3PMJA 1EJAA 2QIQA 2ZDLA 4DW2U 3UOPA 2J9NA 3F3BA 4B71A 1XKAC 2RA3A 4ABEA 1NFUA 3GYMA 3SUGA 3MOCA 1F0TA 1NFXA 1P09A 2J94A 2A5IA 3M61U 2TGPZ 5C0TA 3V0XA 2QGRA 1O3AA 1SGFA 4LOYH 4BAOB 1VJAU 1GCDA 1HCGA 5EXNA 3PRBA 2RA0A 5GCHG 3DSOA 4X1NU 3SHAH 1FZZA 1C2DA 1K1NA 1K1IA 4UDWH 2FX4A 4UFDH 2HNTF 3MMGA 1UW7A 1WQSA 3SGAE 1KMHB 2H5CA 1W10U 2PV9B 5IYTA 1DITH 2Z3EA 1DPOA 3GS9A 1ESTA 5KECA 5C67A 2KCAA 1O3MA 1C1SA 2Z9IA 1UO6A 3LONA 1O2UA 4YZUA 5C20A 2BVRH 2AGIX 3SHCH 1WQVH 1ESAA 3FZDA 1SR5C 3M3SA 1SQAA 1J9CH 3S9BA 2HPPH 2A4GA 2JETC 1AKSA 3ZZ5A 1RGQA 4ISNA 1HV7A 5AVDA 1NFWA 5AHGH 1HAVA 2FODA 3LOXA 2UWOA 4I7YH 2G81E 3TH3H 3R0FA 2BDHA 4U30A 3S9CA 3C27B 2J95A 4DGJA 3WY8A 3UREA 1BIOA 3F6UH 5EIYA 1P2KA 1BBRH 2FOFA 4BOHA 1O3GA 1C1VH 4I31A 5L30H 1CA8B 1KXDA 2ZPQA 2FOAA 1O33A 1C5SA 1TNKA 1FIWA 1GHYH 1C1TA 1PPGE 1XUHA 2A7JA 2JETB 2UUKB 3F0PA 1ORFA 2BVXH 4A6LA 1O3CA 3EA7A 3KQCA 4OGYA 4XOJA 1NRSH 2VBCA 3BTTE 2HVYB 2VU8E 3QUMP 2ZPRA 2CXVA 2PUXB 3WWFA 1UTPA 2AMPA 2ZCLP 3EE0B 2ZKSA 2ZHWH 4MTBA 5HM9A 2V7QD 3ZVCA 2BD2A 2XCNA 1UTOA 1LHCH 3SJ8A 2XWBI 3ZZAA 2KFWA 4E06H 2R2WU 3PV2A 1OWHA 5DGJA 4WVPE 2A1DB 4DG4A 1K9OE 1UTQA 1A0LA 2ZGCA 3VB7A 1FMGA 1TYNA 1W2KH 1GDUA 2H6MA 1S0RA 1OP8A 1BTPA 4KGAA 1JBUH 1MBQA 3RXFA 3ZYEA 4BTIB 2BTCE 3IWMA 2BB4A 1D3PB 2YOLA 4NIXA 3RXGA 3RXCA 1MTVA 1HAIH 3RXKA 6LPRA 3N7EA 2PKAA 1SHYA 4BTTB 1DWEH 1TQ0B 2VVUA 1C5MD 1HAXB 2ZGBH 3MNXA 1HXEH 2OCVB 4M9FA 1YCPM 2AEIH 2ZQ1A 1THRH 1RD3B 1W0YH 4JZIA 4B2AA 3ZZ7A 3DCLA 2ZNKH 4AFQA 5DP4A 1VR1H 6GCHG 1NZQH 3MO3A 1PJPA 3UWIA 2FX6A 2QAAA 1QJ1B 1S5SA 1TA2A 1BTUA 5EU8A 5F8TA 4NA9H 1LKAA 5FPTA 3OU0A 5GPIB 1NESE 4NFFA 1HUTH 2JKHA 2OTVA 3VB5A 2ASUB 4BANB 1WTGH 2UWLA 3BV9B 4NGAH 3ZVFA 1HLTH 2M2AA 5TCAA 1NM6A 4ZKOU 5J4QA 1AFEH 4WF8A 4CH8B 1IHTH 3E6PH 1O2HA 1VITG 2XWAA 4YTAA 1CVWH 1SC8U 4NWLA 5C2ZA 1H8ED 2GT8A 3I78A 1V2QT 4UD9H 1EPTC 2FIRH 2W7UA 4I8HA 3M5MA 1QURH 2BD9A 1FY8E 1O3JA 2BY8X 2H5DA 3GDSA 4U2WA 4Y0ZE 3RM0H 4MLFB 3RXMA 2D1JA 2VIVA 2Y80A 2Z6BD 1FX0B 1SFQB 1SLXB 1XM1A 3STIA 3CP7A 1BJVA 2AIPA 1NRQH 1OP2A 1ZRBA 4R0IA 3T28A 1YPHE 1AMHA 2XRCA 4H6TA 4AZ2B 2ANMH 1GI1A 2BQ7B 3LT3A 5JBBS 2Z94A 1S6HA 3ZIAD 1VCQA 1ANBA 1C5RA 1C5NH 1GHAF 5I46H 1EPTB 2FZZA 3BSQA 4K8YA 3DHKH 1MMJN 2BLVA 2VB0A 1EOJA 1DX5M 2GD4B 5DP3A 3UR9A 7LPRA 1ZSJA 4KTSA 1G9IE 2F4LA 2XC0A 1ANEA 1EATA 4A1XA 3SORA 1UK3A 3RXUA 1CHOG 2A4RA 4MNWA 3FP8E 2KCYA 1GJ5H 2XBXA 3GY6A 2ODQA 3KNXA 5EQQA 3SJOA 3W94A 1DSUA 1EUFA 1OX1A 3FOAA 1VKYA 2R0KA 2TIOA 2F9VA 4RN6A 4X8SH 4F49A 3A8BA 5BRRE 2GDEH 3B9FH 1MKWH 2AHME 3SU3A 4D7GA 1T8NA 3VB3A 1C2FA 1T4VH 1QB1A 4CREA 2L74A 2STBE 9ESTA 2H9TH 2TGTA 1SHHB 5FBEA 1CHGA 1S0QA 3M7UA 3F1SB 1XXFA 1VGCC 2EY4C 2A4OA 4XRNA 1TBQH 4FU8A 1NPMA 2GDDA 2OP9A 4HG6A 3ZZBA 3BIVH 4Y7BA 5LGOA 1BDAA 1O3OA 3NK8A 1YGCH 4JZDH 1L4ZA 5A2MH 3TK5A 1SLWB 1LHEH 1MD8A 1KSNA 4ZCNA 3PM3A 2PUQH 1C1OA 4AB8A 3TJVA 2OINA 3UOUA 1PPEE 2F9UA 3SNAA 1JRTA 3ZV8A 1W3CA 4INLA 2FPZA 1QBNA 4AFSA 1HGTH 2BDAA 1FLEE 1FN8A 2FTLE 2IN2A 1SFIA 4ABIA 1AVXA 3K65B 3SUFA 4UFFH 5DPAA 1P01A 5FHTA 2R3UA 1RRKA 2Q6FA 4A5TS 2BY6X 4YOIA 1ZYOA 3E8LA 1O5AB 4RSPA 3TGJE 3M3VA 4R8TB 3V13A 1WOFA 2P3FH 1TMBH 1C5QA 1WTHD 2EEKA 1AUJA 2HGTH 3KCGH 4Q7YA 5HMAA 1FY1A 3RC4A 3SV2H 1HAZB 1TGTA 2V3HH 6ESTA 1CGIE 1AE5A 1MTUA 4IN2A 4MPVA 4TPYA 2TPIZ 2LNCA 4ZUHA 4Q2KA 1BRCE 1U6QA 1G2LA 2P3TB 2W6ID 3Q00A 3AASA 3K6YA 4HZHA 1D6RA 3IG6B 2BDCA 4GPGA 2FOHA 2HLCA 3SV9A 1TRMA 5DK1A 1NRRH 2WPKS 1SQOA 5HIZA 1GBDA 3KEEA 1GVZA 1P9UA 4JMYA 3OEHD 1DWBH 1S81A 5HM2A 5JBCS 4TWYA 2A7HA 5TCCA 1IQHA 1A0HB 1YLCA 5GIBA 4FETA 1W7XH 5L6NH 5C1YA 1RJXB 5GXPA 3HPTB 4B75A 4MNYA 3KHVA 3LGUA 4XDEA 4X2VA 3KQBA 5JYIA 1MCVA 1V2UT 2D8WA 1UVPA 1XKBC 2SNVA 4FUGA 2SGDE 1TA6A 3UNSA 1GJ6A 4CHAC 3KQ5A 1F92A 2BD8A 2ULLA 4CBOA 3OYPA 2GVFA 1HAPH 2J34A 2G51A 3ITIA 4BAMB 4Y0YE 4BAKB 1YF4A 2Q6DA 1H8DH 3OY6U 4Z0KA 1P8VC 4NZLA 1ELFA 1O2LA 1YYY1 4D8NA 1HNEE 4FXGH 1KIGH 1EOLA 1ELVA 3TH4H 1NBME 2W6JD 2J97A 1Z6JH 1GHBG 3BTME 1O37A 1E34B 2FYQA 1C1WH 4F48B 4U32A 1UTJA 4INHA 5JB9S 1O34A 3FP7E 5B6LA 1O35A 3UQVA 1P03A 2Q1JA 4HI3A 3VXEH 1LVYA 4YT7H 1HJAC 4X8UH 3QTVH 3RLWH 2ZFSA 2VIDA 1CBWC 4CHAB 1ARBA 2QC2A 1A46H 1AVWA 1LTOA 1KXCA 3PO1B 1C5PA 4NSVA 1QL8A 2Z7FE 1FAKH 5EJZA 4ZKRU 1EPTA 2P16A 2TRMA 4JZ1A 4MVNA 1UVOA 5GDSH 1TX6A 1TNIA 4K1SA 5ETXA 5C1UA 4I8JA 1NT1A 3MU5A 2BDIA 2ZU4A 4XFQA 1AHTH 1SBWA 3F0OA 4Q63A 2ANWA 5GWZA 1GMDF 1GHVH 3RMNH 3A86A 4NA8A 1CGJE 1FUJA 3QX5H 2BM2A 3SU4A 1P0SH 3D62A 2Q6GA 4CH2B 1GBBA 2QXGA 1HJAB 4FUBA 1FAXA 2WPJS 1O5DH 1CBWB 5GCHF 1A5IA 2A7CA 2AS9A 2QF4A 3K6ZA 2VWNA 3QDZB 4K5ZA 1V2JT 1YLNA 3KYFA 2A31A 5JBTA 2QF3A 5AFYH 2J98B 3SU2A 2VH0A 2SGEE 4P02A 5HIYA 1UJ1A 2BMGB 1ZSKA 1TAWA 4K3JA 3QZQA 4DCDA 2BOKA 4YESB 1K2I1 4OS2A 1CT2E 3V7TA 4YM9A 1BQYA 1ZTKA 5E0GA 4BTUB 3P8NA 2FS8A 2SNWA 1G36A 1GI5A 1O2SA 1GI3A 1ZTLA 2JH6D 1WU1A 5EOKA 3RU4E 5DP8A 3BTQE 4IC6A 2B0FA 1RTFB 1O31A 4KELA 1QZ8A 5JB8S 4ISOA 1OSSA 2ZHQH 2FEQH 4MNVA 1TMTH 4UEHH 4GCHG 1GI9B 1H4WA 3A81A 3OSYA 4AX9H 2CF8H 1F5LA 4IS5A 4DIIH 1OWIA 2PP6A 2Y7ZA 2ZO3H 1KY9A 4FUJA 2ANKH 2EI7A 1IQNA 1V2PT 3U69H 1ABJH 1W13U 5EXMA 3D23A 3TK6A 3AW0A 2BZ6H 1CA0C 1W8BH 2CHAC 3TJNA 3BG4B 5C3NA 5JDUB 1D3DB 1XUFA 3FP6E 3F9GA 3K2UA 1WV7H 1MQ5A 2ZDKA 1ETSH 1C5YB 2ZU1A 3LU9B 1HIAB 3MI4A 3L3TA 2JIZD 2XNDD 3F9HA 2PKSC 3S0NA 1DT2A 1YPHC 2F91A 2W7SA 2ZGJA 2V3MA 1SGYE 1BMLA 3H7TA 3RXJA 3F2FA 1V6DA 5JPMH 1SGDE 4DY7B 1A5HA 1NRNH 5FPYA 1FI8A 4DURA 1EP6A 1W0KD 4OS1A 1CA0B 4ZH8A 2CHAB 2O8TA 2P3UB 2ZA5A 1DICA 2VINA 1O5BB 3RXSA 3MH6A 2LP6A 2NU4E 1S85A 1YBWA 4ZHAA 5L2ZH 1E0FD 2FO9A 1C5WB 4O97A 1K1PA 3UB0A 2VH6A 2PKSB 3PROA 5A0CA 1P2JA 2ZTZA 1P12E 1BB0B 4J1YA 3K9XB 1D3TB 2I6SA 3WWBA 2G5NA 1MBMA 4XE4A 1P04A 5ABWA 2G52A 2XCFA 1INCA 1W14U 3RM2H 3P8GA 2GV6A 3E3TA 1QNJA 1XXDA 5CHAB 3T29A 1L2EA 4ABAA 1GBMA 2P59A 1SOTA 3E91A 1W12U 5FL7D 4KP0A 2J2UA 2PR3A 3MQKC 1TBZH 2GCHG 6GCHF 2BY9X 1SGQE 1P2MA 2Z3DA 4IN1A 1BMMH 5CDFE 3OE7D 2H2ZA 2PTCE 1B0EA 1BA8B 1OYQA 1LKBA 3ZYDA 1BT7A 3AVZA 1A7SA 4U01A 1YPMH 2HLDD 1ABIH 5T6FA 4OM9A 2ZFTA 3IITA 4FUFA 2FI3E 5CHBA 2P8OC 3T25A 2K1QA 2YMSB 1O3FA 1QRXA 5TJXA 1C9PA 1HDTH 1ZHRA 1YP9A 1VITF 1P2IA 4BAQB 4IBLH 2VWLA 1Q3XA 4AGJA 2FOGA 3BEUA 5EODA 8ESTE 1E1RD 2ILNA 3A8DA 4YO9A 1SGEE 2FOMB 1P2QA 2EQNA 1C4U2 1TABE 2F83A 2XC4A 4DIHH 1ARCA 1ACBE 2G5VA 1W7GH 1PPBH 2FOCA 4NA7A 5F8ZA 3RU4T 3P92A 3Q3YA 2HOBA 2P8OB 4JZEH 4YOGA 1EAUA 1XVOA 4ZHLU 3GY2A 1FNIA 2J92A 3EGKH 3PLPA 8LPRA 1YPEH 4I33A 3ATIA 1C9TA 1BZXE 5DJ7A 4ZMAH 2HALA 2J98A 4BAHB 3EQ0H 1AQ7A 2Y82A 4A1TA 1EZSC 5BPEA 3SOSA 2WV4A 1EJMA 3LC3A 2F3CE 3SGBE 2A2QH 1G3BA 3TGKE 1QL7A 3LJOA 1NBMD 1GJAB 1FQ3A 4ACBA 1P57B 1O2QA 3P6ZB 1JWTA 2O9QA 2J5UA 3GCTG 1V3XA 2CK3D 3TPIZ 1CHOF 2Z9JA 3SNEA 2W26A 3P8OA 1WYKA 3MH4A 3AAVA 2CV3A 3QLPH 2HRVA 3L33A 1AZ8A 3GCOA 4AB9A 2AYWA 1GI4A 1F2SE 2I6QA 1QJ6B 1MZDA 2QV1A 3M7TA 2FP7B 2Y81A 1DWCH 4E05H 1EAIA 1P05A 1JIRA 3GY4A 3OY5U 4B6EA 3RXPA 5EJLA 1K1MA 1XUKA 1P9SA 2Z3CA 1AWHB 2FDAA 1PYTC 2B5TB 4GLYA 1O5GH 1QQUA 1MAYA 1O36A 1PFXC 1HIAA 3VG8A 3V12A 1Y3WA 3LH3A 2QXJA 2VIOA 4TSFD 1TWXB 1C2KA 1LHDH 3RXRA 1WXRA 2FMJA 3U98H 1S6FA 3KYGA 3T5FH 3LC5A 3KQDA 1HAHH 4Y7AA 3N7DA 4KTUA 4ZKSU 1GMHF 3FZZA 1OP0A 4RT1A 4JZFH 2TGDA 3SI3H 1M9UA 3O8BA 2BOHB 4B73A 7ESTE 1HFDA 2BY5X 4O03A 3TIUA 5A0BA 1K1OA 3OX7U 1G32B 1B7XB 3SUEA 1GBJA 2ZEBA 1C5VA 2A4QA 3UIRA 1BRAA 3RU4D 1DDJA 1GJ9B 3RMOH 8KME2 3M5OA 1J15A 3TNTA 4NCYA 1GL1A 1ANDA 1N8OC 1C5ZB 3NKKA 3UTUH 4E7NA 4FVBA 2HVXA 2HNTE 5FX5A 3A89A 4IW4E 4ZAEA 1BTXA 3O8CA 1FY4A 1SLVB 1VJ9U 3M7QA 1GCTB 1SGPE 1DANH 1AIXH 1YPLH 3F68H 2BZAA 1ZOMA 1BJUA 1HAYB 3T26A 3T2NA 2Y5HA 4M7GA 4HTCH 2EA3A 1QA7A 2JDID 4B1TA 1V2NT 1XUGA 1AB9B 3ZZ9A 4ABFA 1O5CB 1O2PA 1C4V2 3S7HB 1ID5H 1EZQA 1KYNA 4VGCC 3MFJA 1O2YA 1QCPA 1V2KT 2ZDNA 1C2HA 3SV8A 4GHTA 3ZVDA 4X2WA 1D3QB 1RXPA 3A84A 1P06A 1N8OB 1L4DA 1SSXA 1EX3A 4ZKNU 1C2GA 3TVJB 3ODFA 1CE5A 2ZIQH 5K0HA 5H4IB 1ZGVA 1GJDB 2O8UA 4Z1MD 4Y8XA 2VNTA 3NCLA 4FUHA 3NPSA 3ATKA 4SGBE 1AWFH 3ENSB 2A5AA 4GUXA 1Y5UT 2V35A 1TBRH 1N1LA 1V2RT 5DG6A 5E0HA 1VITH 1YPJH 1ZHPA 1IQMA 1AY6H 1WSSH 4AC9A 4VGCB 3LKWA 1MCTA 1V2ST 1SGNE 5EW2H 2RFKC 3U8TH 5ESTE 4YLQH 3RMMH 2Y5FA 8GCHG 3FO8D 1LDTT 2ODYB 1B5GH 3GY8A 4NSYA 4RKJB 3QZRA 2EC9H 3PMBB 1C2LA 1SLUB 4ABBA 1GHBF 5FXLA 1Y3VA 2JH5D 2WPHS 1O32A 3H09A 4AOQA 1C5UA 1G3EA 3I77A 2FOBA 3NRLA 2Y6TA 3PYHA 4XBCA 4AFUA 2WPDD 1TQ7B 3P70B 5C5OA 3A7XA 4UFEH 1A3BH 1UK4A 1UVSH 1QRWA 1EAXA 4Q7ZA 1OOKB 3STJA 1QR3E 2A5KA 1G2MA 3VB4A 1DM4B 4K1EA 3A80A 7KMEH 4WXIA 2VIWA 4RI0A 3VGCB 1THPB 1TNGA 2G4TA 2OK5A 1OWDA 1D4PB 5F03A 2ZTYA 3HGNA 3BTWE 2ALPA 3MU4A 4ABDA 3E90B 1LPZB 3OTJE 1BMNH 4B6FA 5EGMA 4UONA 3UWJH 2ANYA 3RXVA 1YWUA 2AMDA 3RUOA 1GG6C 1H9LB 3SGQE 2R3YA 1HJ8A 2QF0A 2PTNA 1UCYE 3OTPA 1MUEB 1AN1E 5B6OA 3A85A 3SU0A 1JXPA 5EJ1A 1O39A 3GOVB 1YPKH 3A88A 1P02A 1GGDC 3GY7A 3QGJA 4XBDA 1HJ9A 4K2YA 1A5GH 1RTKA 3DFLA 4MNXA 1LHGH 2H1UA 1O2XA 1BTWA 1LVOA 2ZI2H 1C1QA 4Y79A 1AUTC 3ZVEA 1C5TA 1GG6B 5JBAS 3AAUA 2BYAX 4Y71A 3GDVA 2RDLA 2STAE 3M36A 3JZ1B 1Q31A 1YC0A 1O5FH 4GCHF 1C2JA 1EASA 2F9BH 3PO1C 1TE0A 1EAWA 3M5NA 1TNLA 2VWMA 1SKYE 1C1NA 2ESTE 7GCHG 2GZ8A 9LPRA 1J16A 1TFXA 1TGNA 1MTSA 3D65E 4P00A 2K8IA 3M5LA 1GGDB 5T6DA 2KCOA 3KIDU 2IPQX 1Z8IB 3RXTA 2R9PA 4ZROA 2ZCKP 3S9AA 4TY6A 3DUXH 5AF9H 4YLUA 3DSPA 1GVKB 1GBIA 3JZ2B 3MYWA 4F55A 4PROA 2XW9A 1Z6EA 1UCYK 1Y3YA 1Z1JA 2WV9A 1C5XB 1ESBA 1HAVB 5EQRA 1ELCA 1O3IA 1YKTA 4WH8A 1YCPK 4IGDA 2GMTC 1NO9H 5G4BA 1TRYA 1O2OA 1K0HA 2OC1A 1LMWB 1O2RA 3HATH 1S84A 1BTHH 3LPRA 4OGXA 1AZZA 4X1RU 2C4FH 4A1VA 2H9EH 4CBNA 2BHGA 3A83A 2ZFRH 3LGTA 2G8TA 3LIWA 1SGCA 2ZDMA 3BEIB 4CRGA 1QRZA 1L1NA 1TOMH 2WPMS 2DE9A 2C90B 1ELTA 2HPQH 3EE7A 2P94A 3TITA 1GI2A 3CS7A 1FXYA 1BOQA 1CQQA 3ZV9A 4TYDA 3BN9A 3FFGA 3R3GB 5GNDA 4LZ1H 4DOQA 1GI6A 2GMTB 3NXPA 1HRTH 3PRDA 4X1PU 1ZMNA 1GBEA 2FXRA 2VIPA 2WZQA 2FESH 3E0PB 4I8LA 3MU0A 1EZXC 1IQGA 1GJ4H 2P95A 3U1JB 1DSTA 3TJUA 1PQAA 4DT4A 1BMFD 3BG4C 1QFKH 1T4UH 1HYLA 1Z1IA 3CENA 1MZAA 3ATWA 1DLKB 3RXOA 1LCYA 1V2WT 4ZXYH 1ZTJA 4AORA 1AO5A 2WPLS 1IQKA 1MKXK 1MQ6A 1A2CH 2BXTH 5C17A 1BUIA 1HXFH 1NTPA 1LQEA 2BVSH 4UE7H 1H9HE 2OQUA 4H4FA 2W5EA 3MNBA 2SFAA 3SUDA 5CMXH 1Z7KA 1ETRH 4TY7A 1BTYA 4B2BA 4X6PA 3Q3XA 2KCPA 3OAAD 2PKAB 1ZGIA 1SGIB 2OXSA 1O3EA 3A7WA 4GSOA 2A32A 4Q80A 5DN6D 4OS5A 5HXFA 1BHXB 2C93B 1OKXA 1AU8A 2B9LA 4RT0A 2A45B 3E0NB 4Y8YA 1IOEA 1OWJA 3Q76A 1OWKA 4XD7D 4Y10E 1C1PA 1C1UH 1HBTH 3SZEA 3ZVAA 1AFQC 2VGCC 1TPPA 1QL9A 2XBYA 3GCHC 3HK3B 1ZPCA 1C5OH 2PSXA 3F9EA 5E2PA 1PPHE 2C8YB 5DKMA 2ZTXA 4CRAA 4TPIZ 3KL6A 2ZGXH 1PQ7A 1TPAE 3QGNB 1DY8A 6CHAC 3RMLH 1XMNB 2IJD1 2WUBA 3T62A 3ESTA 1PPFE 4ISIH 3AK5A 1ZMJA 2TGAA 4WXVA 3B8JA 4NIYA 2HNTC 2YMSD 1NU7B 2ZHFH 1O2VA 1F0SA 1ELBA 1SOZA 5CHAC 2R0LA 4FU7A 3FANA 3QTOH 1TPSA 3A7VA 2OUAA 1ZMLA 4THNH 4MQAA 5FPSA 2VVCA 2M5TA 5FAHA 3TGIE 1O2IA 2ZWLH 1AFQB 1EJNA 1BCUH 1K1LA 2VGCB 2FTMA 3GCHB 1NC6A 2CGAA 2NU1E 3F9FA 3A7ZA 2EI8A 3TU7H 1F5KU 1DLEA 1E38B 1JMOH 3PWBA 4JK5A 6CHAB 3E16B 5A8YA 1J14A 2VWOA 1FIZA 2XC5A 1HB0B 1PQ8A 4Y76A 1GBAA 1BMAA 1DXWA 1GMDG 1SGTA 2YMSC 3GCTF 1GDQA 4SGAE 3MH5A 1VCPA 2GV7A 4OS7A 1KXEA 1EXFA 3MNCA 1PPCE 1UTMA 1OHHD 3BTDE 2AERH 3A87A 1G3CA 4I8GA 1O3NA 1AE8H 1E1QD 2A2XH 1F0UA 3S69A 3ODDA 1Z8JB 3O8DA 4JK6A 4Q4LA 1NRPH 4OS4A 5C5NA 1A4WH 2ZU3A 2FWWA 1GJ7B 3SI4H 1ZZZA 2F9NA 4JYUH 2J38A 2KX4A 1SMFE 2XBWA 3OFND 5IK2D 2QXIA 4K69A 4HFPB 1IQEA 2PW8H 2BD4A 4GVUA 2R2MB 3TK9A 5SGAE 5A8XA 5I25A 4WY3A 1KTSB 1Y3UA 1IQIA 1P2NA 1TOCB 1BBRE 1X7AC 2V3OH 3PB1E 5C0UA 2IOTA 5PTPA 3U1IB 3TLOA 1BRBE 2LPRA 4AFZA 1LHFH 3OEED 4K60A 3EA9A 1LPGB 1O30A 1T7CA 3TH2H 2GZ7A 2BQ6B 2Y5GA 3P8FA 4X1QU 3U8RH 4ABJA 3SQHE 5E0JA 1OYTH 1V2MT 1MTWA 2CMYA 1ZJDA 2Z9GA 2XXLA 1KXFA 1TALA 4Y11E 5FBIA 2WSSD 2B8OH 2ZDVH 3W1EA 3E1XB 5DP9A 2AH4X 1EB2A 1O2KA 2XBVA 1LVMA 2WUCA 5L2YH 2ZU2A 1RFNA 1TGBA 3V3MA 1QHRB 4LK4A 2NU2E 4O9VA 1Z8GA 3VB6A 5LH8A 1XUJA 3VXFH 1ELAA 1TNJA 1XUIA 1FV9A 1P2OA 1MU6B 1Q2WA 1EFRD 3BTFE 3FN8A 1SG8B 4A7IB 4X6NA 2FI4E 1GBCA 1A0JA 1GBFA 3KN2A 1CT0E 2JJ2D 2FLBH 3SNBA 1O3KA 2B7DH 4WH6A 1W11U 1GMCG 4O3TA 1SL3A 2H9HA 3M3TA 1NROH 4D7FA 4X2XA 4LZ4B 2BX4A 1KXBA 1PQ5A 1DS2E 2ZHDA 2GZ9A 3RXAA 3PMHB 4ASUD 1DVAH 1S82A 1P10A 1K22H 1BBRK 1UTLM 1PYTD 1V2LT 1XVMA 2AMQA 2UUJB 1Y8TA 3DA9B 3GY3A 4AG2A 1C1RA 2QYIA 1IQFA 3A7TA 1ZSLA 3SV7A 1H9IE 1L1GA 2PGQB 4MDSA 2ZFFH 1O2WA 1TMUH 1O3BA 3B23B 2QA9E 5EW1H 4ABGA 2QY0B 2OC7A 4GAWA 5E8EH 3MH7A 1JRSA 2NU0E 4I86A 2VVVA 3RC6A 1KDQB 2OQ5A 5A8ZA 3UPEA 2WHXA 2TBSA 4X6MA 3UAIC 4IMQA 1MAXA 1QB6A 1C1MA 3RXHA 3UFAA 3PTNA 1E79D 1YM0A 2PGBB 1J17T 3EAJA 2C8ZB 3KQEA 4D76A 3GISB 3M37A 1DFPA 3PV5A 2PFEA 2BLWA 4Y8ZA 3DT0H 1O3LA 4X8VH 4NG9H 1TGSZ 3GYLB 4B2CA 2ZU5A 3MO9A 1L0ZA 3FKSD 1OPHB 3KGPA 4ZHMU 1QJ7B 2ZFPH 8GCHF 1K28D 3H5CB 1ZR0A 3G01A 1ZJKA 2OLGA 1T8OA 1RIWC 1KLIH 3SNDA 4Z6AH 4MPWA 5F6MA 1VZQH 4CRFA 4XSKU 4D9QA 4O3UA 5C94A 1BITA 1GCTC 2CF9H 2PLXA 2GJGA 3BIUH 2VJ1A 5DP5A 3MWIU 2NU3E 2O8LA
chains in the Genus database with same CATH topology
4X0WU 1N6YA 1AB9C 3URCA 4BNRA 2KAIB 2WYJA 5AFZH 1RS0A 3LGYA 2WV5A 2ZCHP 1GBLA 1TRNA 2SGAA 4FUEA 5HGGA 3SU6A 3NZIA 3GCNA 1KLTA 1NY22 4AN7A 1RIWB 3S7KB 1ELEE 4HGCA 2GTBA 3UY9A 4MPUA 1B0FA 4ASHA 2C3SA 1F0RA 1LQDB 3PLKA 3PV4A 5EXLA 2P93A 1O2GH 1O5EH 2ZQ2A 1AVGH 3SN8A 2GP9B 3HK6B 3ZVBA 1CT4E 2QCYA 4AGKA 1Y5BT 2G00A 1Y5AT 4DJZB 1EQ9A 1XX9A 3QO6A 4YOJA 1P11E 1SB1H 3W95A 1ZRKA 4F4OC 1O3DA 1SVPA 3ATLA 4Q7XA 3C1KA 2BXUH 1TGCA 3U9AH 1GL0E 4UFGH 4A92A 2ZGHA 2A0QB 2OD3B 2OBQA 4E7RG 2FM2A 1CU1A 3VPKA 3U8OH 1E37B 2FS9A 1AI8H 3QK1A 2BD5A 5DP7A 2FLRH 5DP6A 1K1JA 4J2YB 5FCRA 1WAYB 4RKOB 3EA8A 1GVLA 1DE7H 1MD7A 4H42U 4DT7B 1N6XA 3RXQA 4X1SU 3MU1A 2Z9KA 2D2DA 1ELGA 5EPNA 3MNSA 2O8WA 2GGVB 4CRDA 3RXIA 4WMEA 1GBTA 3QWCH 1IQLA 1DUAA 1L1JA 1TB6H 1VCWA 3HKJB 4I8KA 1MU8B 3HKIB 7GCHF 3UNRA 3D49H 1UVUH 1GJBB 3VGCC 1UHBB 1SQTA 4AG1A 1GHWH 1DOJA 1GHXH 2HWLB 3GDUA 4DVAU 1T31A 3UNQA 2ZG0H 4WJG2 2XTTB 1BRUP 3BF6H 3A7YA 2V6NA 1D9IA 1QIXB 1NU9A 1GI7B 3FAOA 3I29A 5C1XA 1E35B 2OC8A 1FONA 1T8MA 1O2JA 1TPOA 1YLDA 2ZF0H 3Q3KA 1IQJA 4ZXXH 5F8XA 4CR9A 2AGGX 1F5RA 2RG3A 2ZFQH 2GX4A 4FU9A 3LGIA 1AGJA 4MPXA 4CRBA 4ISLA 5GJ4B 3SJKA 3A8CA 1LPKB 5T3HA 2GCTC 2GT7A 1OWEA 3SO3A 1GMHG 1MKWK 2BD7A 4I32A 1ETTH 3SZNA 1S83A 5A0AE 2W3IA 3P17H 1JOUB 4CRCA 2W3KA 1VGCB 3PLBA 2PWXA 1T8LA 3ZZ6A 3RP2A 3SW2B 3ZZDA 2YNAA 2AIQA 1ZPBA 2ZP0H 4FUIA 2SGFE 5FX6A 1HPGA 2OC0A 4BXWA 2XYAA 3EYDA 4IMZA 3MO6A 1QTFA 1THSH 2FYRA 1FY5A 1FPCH 3L6PA 1A61H 1CGHA 1MTNC 5K7RA 2XNIA 1KDQA 1DWDH 1UTKA 4BXSA 3VFEA 1GHAG 1UVTH 5J4SA 3RC5A 2GCTB 3H7OA 3NUMA 1TX8A 1G37A 1C2MA 3ZZCA 5FCKA 1F7ZA 3BEFB 1UMAH 4LXBH 1FN6A 1UTNA 3LJJA 1QGFA 3SU1A 2G4UA 3EDXB 1DY9A 4WMDA 2C8XB 1UCYH 3MTYA 1O2NA 4JYTA 1V2OT 3BTHE 1O2TA 1T32A 4KTCA 1YCPH 5EG4A 1PPZA 4NWKA 1GBHA 2C8WB 4ISHH 3TJOA 3GICB 1W0ZU 2IPHA 1MTNB 1CSOE 2ZECA 1EB1H 3SBKA 1O2MA 2PHBA 3O8RA 2G55A 1DXPA 4INKA 1GBKA 4ABHA 5IDKA 2ZC9H 3QN7A 4NIVA 2WINI 1GPZA 4FVDA 3ZVGA 3SNCA 1C5LH 1NN6A 2KAIA 1SGRE 3DD2H 4AYVB 1H1BA 1RTLA 2WYGA 1O38A 2BDGA 2BLQA 4OS6A 3GY5A 2GKVE 3BTGE 1AKSB 1JIMA 5HYOA 1GHZA 5EQSA 1UK2A 2Z9LA 3RXEA 1KLJH 4MG3A 1WCZA 4YT6H 2AGEX 2IJOB 1WUNH 1K21H 3NWUA 1TX7A 1NS3A 1P3EA 4H6SB 3PMAB 2ZHEH 1Y59T 4K8BA 1QBVH 1A1RA 1GWAA 3AW1A 4CR5A 1KXAA 3RXDA 2PSYA 4X8TH 4NIWA 3VEQB 1DUEA 2BDYA 2V0BA 1MKXH 1ZHMA 4GHQA 2ZDAH 3ZZ3A 3P95A 2RCEA 3URDA 3RDZA 2BY7X 4TWWA 1TLDA 3RXBA 3SV6A 1O0DH 1FJSA 1BTZA 3UQOA 5DO4H 1G3DA 3UUZA 4K1TA 1V2VT 4JYVH 2ALVA 1GI8B 2SGQE 3SQEE 1OXGA 2EI6A 2BD3A 2D26C 1QA0A 3LGWA 3MHWU 3PTBA 3SU5A 1C2EA 2UWPA 1GI0A 3ZZ8A 1MH0A 2UUYA 1O3PB 2DUCA 1ANCA 2ZPSA 4X2YA 1AD8H 5ESBA 1ELDE 2BX3A 1GJCB 3T27A 5A09A 1IAUA 2QN5T 3LH1A 2GCHF 1G30B 1TIOA 2VIQA 4B76A 3SJIA 3TNSA 3BTKE 1EP5A 4IC5A 1A3EH 1WBGB 1UHBA 1QB9A 3ATMA 2UUFB 3RXLA 2BLOA 3HGPA 2O8MA 1Z8RA 3Q77A 1LVBA 3DFJA 4JCNA 1CO7E 4B74A 4XBBA 3ZZ4A 5LPEA 2CN0H 1HAGE 1SGFG 1YPGH 1O3HA 2DE8A 2F9OA 3A8AA 1SI5H 2WPIS 2JH0D 3BTEE 2BDBA 2YNBA 2ODPA 1KTTB 5LPRA 1Z71A 2FOEA 4X6OA 4Y6DA 5CE1A 3FVFB 4KKDA 1QQ4A 3PWCA 1EKBB 3BG8A 1FDPA 1J8AA 1QBOA 2NWNA 4NZQA 1E36B 3RLYH 1D6WA 1EZUC 1GDNA 1ZPZA 1IHSH 1OS8A 2CJIA 2SGPE 3MU8A 1BHXF 1C2IA 3N7OA 1P3CA 4D9RA 1ZLRA 4FUDA 1TNHA 1O2ZA 3CS0A 1H8IH 1V2TT 4AYYB 3SJ9A 5E2OA 2OBOA 3LDXH 4FUCA 3KF2A 1NFYA 2F9PA 1GJ8B 4NFEA 5LPFA 1C4Y2 3LGVA 5T6GA 2J4IA 2QXHA 3ELAH 1SPJA 3A82A 1Y3XA 4ESTE 1HAOH 3M35A 3UR6A 1FY3A 2FI5E 1FPHH 1LO6A 2ZZUH 5EPYA 2Y7XA 4QT8C 1GMCF 2BQWB 2AFQB 4WMFA 2THFB 1TONA 1QY6A 4WWYA 3PMJA 1EJAA 2QIQA 2ZDLA 4DW2U 3UOPA 2J9NA 4B71A 1XKAC 2RA3A 4ABEA 1NFUA 3GYMA 3SUGA 3MOCA 1F0TA 1NFXA 1P09A 2J94A 2A5IA 3M61U 2TGPZ 3V0XA 2QGRA 1O3AA 1SGFA 4LOYH 4BAOB 1VJAU 1GCDA 1HCGA 5EXNA 2RA0A 5GCHG 4X1NU 3SHAH 1FZZA 1C2DA 1K1NA 1K1IA 4UDWH 2FX4A 4UFDH 2HNTF 3MMGA 1WQSA 3SGAE 2H5CA 1W10U 2PV9B 5IYTA 1DITH 2Z3EA 1DPOA 1ESTA 5C67A 1O3MA 1C1SA 2Z9IA 1UO6A 3LONA 1O2UA 4YZUA 5C20A 2BVRH 2AGIX 3SHCH 1WQVH 1ESAA 3FZDA 1SR5C 3M3SA 1SQAA 1J9CH 3S9BA 2HPPH 2A4GA 2JETC 1AKSA 3ZZ5A 1RGQA 4ISNA 1HV7A 5AVDA 1NFWA 5AHGH 1HAVA 2FODA 3LOXA 2UWOA 4I7YH 2G81E 3TH3H 3R0FA 2BDHA 4U30A 3S9CA 3C27B 2J95A 4DGJA 3WY8A 3UREA 1BIOA 3F6UH 1P2KA 1BBRH 2FOFA 4BOHA 1O3GA 1C1VH 4I31A 5L30H 1CA8B 1KXDA 2ZPQA 2FOAA 1O33A 1C5SA 1TNKA 1FIWA 1GHYH 1C1TA 1PPGE 1XUHA 2A7JA 2JETB 2UUKB 1ORFA 2BVXH 4A6LA 1O3CA 3EA7A 3KQCA 4OGYA 4XOJA 1NRSH 3BTTE 2VU8E 3QUMP 2ZPRA 2CXVA 2PUXB 1UTPA 2AMPA 2ZCLP 3EE0B 2ZKSA 2ZHWH 4MTBA 5HM9A 3ZVCA 2BD2A 2XCNA 1UTOA 1LHCH 3SJ8A 2XWBI 3ZZAA 4E06H 2R2WU 1OWHA 5DGJA 4WVPE 2A1DB 4DG4A 1K9OE 1UTQA 1A0LA 2ZGCA 3VB7A 1FMGA 1TYNA 1W2KH 1GDUA 2H6MA 1S0RA 1OP8A 1BTPA 4KGAA 1JBUH 1MBQA 3RXFA 3ZYEA 4BTIB 2BTCE 3IWMA 2BB4A 1D3PB 2YOLA 4NIXA 3RXGA 3RXCA 1MTVA 1HAIH 3RXKA 6LPRA 2PKAA 1SHYA 4BTTB 1DWEH 1TQ0B 2VVUA 1C5MD 1HAXB 2ZGBH 3MNXA 1HXEH 2OCVB 1YCPM 2AEIH 2ZQ1A 1THRH 1RD3B 1W0YH 4JZIA 4B2AA 3ZZ7A 2ZNKH 4AFQA 5DP4A 1VR1H 6GCHG 1NZQH 3MO3A 1PJPA 3UWIA 2FX6A 2QAAA 1QJ1B 1S5SA 1TA2A 1BTUA 5EU8A 5F8TA 4NA9H 1LKAA 5FPTA 3OU0A 5GPIB 1NESE 4NFFA 1HUTH 2JKHA 2OTVA 3VB5A 2ASUB 4BANB 1WTGH 2UWLA 3BV9B 4NGAH 3ZVFA 1HLTH 5TCAA 1NM6A 4ZKOU 5J4QA 1AFEH 4WF8A 4CH8B 1IHTH 3E6PH 1O2HA 1VITG 2XWAA 4YTAA 1CVWH 1SC8U 4NWLA 5C2ZA 2GT8A 3I78A 1V2QT 4UD9H 1EPTC 2FIRH 2W7UA 4I8HA 3M5MA 1QURH 2BD9A 1FY8E 1O3JA 2BY8X 2H5DA 3GDSA 4U2WA 4Y0ZE 3RM0H 4MLFB 3RXMA 2D1JA 2VIVA 2Y80A 2Z6BD 1SFQB 1SLXB 1XM1A 3STIA 3CP7A 1BJVA 2AIPA 1NRQH 1OP2A 1ZRBA 4R0IA 3T28A 1YPHE 1AMHA 2XRCA 4H6TA 4AZ2B 2ANMH 1GI1A 2BQ7B 3LT3A 5JBBS 2Z94A 1S6HA 1VCQA 1ANBA 1C5RA 1C5NH 1GHAF 5I46H 1EPTB 2FZZA 3BSQA 4K8YA 3DHKH 1MMJN 2BLVA 2VB0A 1EOJA 1DX5M 2GD4B 5DP3A 3UR9A 7LPRA 1ZSJA 4KTSA 1G9IE 2XC0A 1ANEA 1EATA 4A1XA 3SORA 1UK3A 3RXUA 1CHOG 2A4RA 4MNWA 3FP8E 3GY6A 1GJ5H 2XBXA 2ODQA 3KNXA 5EQQA 3SJOA 3W94A 1DSUA 1EUFA 1OX1A 2R0KA 2TIOA 2F9VA 4RN6A 4X8SH 4F49A 3A8BA 5BRRE 2GDEH 3B9FH 1MKWH 3SU3A 4D7GA 1T8NA 3VB3A 1C2FA 1T4VH 1QB1A 4CREA 2STBE 9ESTA 2H9TH 2TGTA 1SHHB 5FBEA 1CHGA 1S0QA 3M7UA 3F1SB 1XXFA 1VGCC 2A4OA 1TBQH 4FU8A 1NPMA 2GDDA 2OP9A 3ZZBA 5LGOA 3BIVH 4Y7BA 1BDAA 1O3OA 3NK8A 1YGCH 4JZDH 1L4ZA 5A2MH 3TK5A 1SLWB 1LHEH 1MD8A 1KSNA 3PM3A 2PUQH 1C1OA 4AB8A 3TJVA 2OINA 3UOUA 1PPEE 2F9UA 3SNAA 1JRTA 3ZV8A 1W3CA 4INLA 2FPZA 1QBNA 4AFSA 1HGTH 2BDAA 1FLEE 1FN8A 2FTLE 2IN2A 1SFIA 4ABIA 1AVXA 3K65B 3SUFA 4UFFH 5DPAA 1P01A 5FHTA 2R3UA 1RRKA 2Q6FA 4A5TS 2BY6X 4YOIA 1ZYOA 3E8LA 1O5AB 4RSPA 3TGJE 3M3VA 4R8TB 3V13A 1WOFA 2P3FH 1TMBH 1C5QA 1WTHD 2EEKA 1AUJA 2HGTH 3KCGH 4Q7YA 5HMAA 1FY1A 3RC4A 3SV2H 1HAZB 1TGTA 2V3HH 6ESTA 1CGIE 1AE5A 1MTUA 4IN2A 4MPVA 4TPYA 2TPIZ 2LNCA 4ZUHA 4Q2KA 1BRCE 1U6QA 1G2LA 2P3TB 3Q00A 4HZHA 3AASA 3K6YA 1D6RA 3IG6B 2BDCA 4GPGA 2FOHA 2HLCA 3SV9A 1TRMA 5DK1A 1NRRH 2WPKS 1SQOA 1GBDA 3KEEA 1GVZA 1P9UA 4JMYA 1DWBH 1S81A 5HM2A 5JBCS 4TWYA 2A7HA 5TCCA 1IQHA 1A0HB 1YLCA 5GIBA 1W7XH 5L6NH 5C1YA 1RJXB 5GXPA 3HPTB 4B75A 4MNYA 3KHVA 3LGUA 4XDEA 4X2VA 3KQBA 5JYIA 1MCVA 1V2UT 2D8WA 1UVPA 1XKBC 2SNVA 4FUGA 2SGDE 1TA6A 3UNSA 1GJ6A 4CHAC 1F92A 2BD8A 2ULLA 4CBOA 3OYPA 2GVFA 1HAPH 2J34A 2G51A 3ITIA 4BAMB 4Y0YE 4BAKB 1YF4A 2Q6DA 1H8DH 3OY6U 4Z0KA 1P8VC 4NZLA 1ELFA 1O2LA 1YYY1 4D8NA 1HNEE 4FXGH 1KIGH 1EOLA 1ELVA 3TH4H 1Z6JH 1GHBG 3BTME 1O37A 1E34B 2FYQA 1C1WH 4U32A 1UTJA 4INHA 5JB9S 1O34A 3FP7E 1O35A 3UQVA 1P03A 2Q1JA 4HI3A 3VXEH 1LVYA 4YT7H 1HJAC 4X8UH 3QTVH 3RLWH 2ZFSA 2VIDA 1CBWC 4CHAB 1ARBA 2QC2A 1A46H 1AVWA 1LTOA 1KXCA 3PO1B 1C5PA 4NSVA 1QL8A 2Z7FE 1FAKH 4ZKRU 1EPTA 2P16A 2TRMA 4JZ1A 4MVNA 1UVOA 5GDSH 1TX6A 1TNIA 4K1SA 5ETXA 5C1UA 4I8JA 1NT1A 3MU5A 2BDIA 2ZU4A 4XFQA 1AHTH 1SBWA 2ANWA 5GWZA 1GMDF 1GHVH 3RMNH 3A86A 4NA8A 1CGJE 1FUJA 3QX5H 2BM2A 3SU4A 1P0SH 3D62A 2Q6GA 4CH2B 1GBBA 2QXGA 1HJAB 4FUBA 1FAXA 2WPJS 1O5DH 1CBWB 5GCHF 1A5IA 2A7CA 2AS9A 3K6ZA 2VWNA 3QDZB 4K5ZA 1V2JT 2A31A 5JBTA 2QF3A 5AFYH 3SU2A 2VH0A 2SGEE 1UJ1A 2BMGB 1ZSKA 1TAWA 4K3JA 3QZQA 4DCDA 2BOKA 4YESB 1K2I1 4OS2A 1CT2E 3V7TA 4YM9A 1BQYA 1ZTKA