1C2IA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2iA02
4MNXA 4BOHA 1XMNB 1ZTLA 2ASUB 2H5CA 3NPSA 1ELCA 4AN7A 2QXIA 4Q7YA 1C2MA 2VH6A 3UWIA 3RXRA 3C27B 1TAWA 3ZYDA 1NFXA 5BRRE 1EZUC 3M5MA 2A4OA 1O0DH 4J2YB 4UFDH 1IQLA 2XC4A 1GMCG 2A4GA 5DP4A 1Z6JH 1T8MA 1WAYB 2Z3DA 4HZHA 1O2YA 1NFWA 1GGDC 4R0IA 4HTCH 4I8JA 1PPEE 4FUIA 3RMNH 3L6PA 5ETXA 4WWYA 2ZO3H 3VXFH 1ANBA 4I8HA 2QF0A 3PWCA 2BVSH 1TX7A 3GISB 3QX5H 5G4BA 2P16A 4Y8YA 4ABDA 1CT4E 2ZTZA 3TIUA 2EI6A 2G55A 2OINA 2NU3E 3P8FA 4CR9A 2ZF0H 3UR9A 1F0RA 5TCAA 3GCOA 3EA7A 3VB4A 1NN6A 1GHXH 1NTPA 2QXJA 1H9LB 4I8LA 4MPUA 1GVLA 3M7TA 4X1QU 1S0RA 4AG2A 2NU4E 3URCA 2ZI2H 2THFB 4FU8A 4TWWA 2WPMS 5AF9H 1SGRE 4CRGA 3OSYA 1B0EA 1IQJA 2GDDA 1YPJH 1LPZB 1TNHA 1AGJA 3UNSA 1G3CA 1LKBA 2FI5E 3PLPA 3STJA 3JZ1B 3UNQA 2ZNKH 1BT7A 3S9AA 4IGDA 3S69A 2ANKH 2BVXH 1C5ZB 5FPTA 5B6OA 1GBJA 5DPAA 4JZDH 2DE9A 4ZHLU 7LPRA 1YCPH 3RXBA 3EDXB 2ZEBA 1VZQH 2ZGBH 1AWHB 1GMCF 1ZRBA 1SB1H 3L33A 2PW8H 3A86A 3BTME 3LGUA 3UY9A 1P12E 1NROH 2OXSA 1AVGH 3FP8E 1O3PB 3Q77A 1RGQA 3RC6A 4YT6H 1G3BA 2PKAB 5GDSH 4NA9H 3MO9A 1LVMA 1YPGH 2Y5HA 2GTBA 2ZHFH 3RXDA 2FXRA 3IWMA 1RXPA 5F6MA 1GMDG 3MO3A 1C5MD 2FPZA 1K21H 2G4UA 1HJAB 1O3IA 5GXPA 4VGCB 1ANDA 4WJG2 3RXUA 4DCDA 5TCCA 3BEIB 1OP8A 1ESBA 3ATLA 2WINI 3TITA 1ZTKA 1L4DA 3FZDA 2ZZUH 5JBAS 4J1YA 4CH2B 1T4VH 1RTLA 3IG6B 2J38A 1FI8A 2FP7B 2ZHEH 1QNJA 2PFEA 2BD5A 3R0FA 2GZ9A 4OS7A 2UUFB 3H7TA 1O2IA 1ZPBA 1HAVA 1FONA 1K9OE 3MU5A 1RFNA 4UONA 3S0NA 2VGCC 1O36A 2WPHS 1O5GH 4Y10E 1S83A 1QIXB 5A8XA 2A7JA 4D7FA 4YOGA 1ZYOA 1LPKB 1O3LA 3U98H 1M9UA 2WV5A 1CSOE 1O5FH 2D2DA 1OP2A 3UUZA 2A31A 2OP9A 3E16B 1DPOA 1OOKB 2ZWLH 2BDIA 2H9TH 3UQVA 2ZDNA 4NZQA 2FLRH 2Z7FE 1UTOA 4WH6A 3W95A 4CHAB 3RXOA 3DUXH 3M36A 5DP8A 4JYUH 2ZA5A 4DIHH 1FN8A 1QA0A 1BRAA 1TX8A 4BNRA 2TRMA 4ZXYH 5J4SA 2ZQ1A 2V6NA 2WUCA 5E0JA 4ASHA 6CHAB 1TGTA 3PM3A 1Y3VA 1BMNH 1P04A 3F9HA 1WSSH 3EYDA 1UTMA 3TU7H 1CU1A 3ZVBA 1D6WA 2TGAA 6LPRA 1Y3WA 2VIWA 2BXTH 2ZU5A 1FY5A 1MU6B 2VJ1A 3NCLA 3BTHE 4Z6AH 1GMHG 3LC3A 4KP0A 1ZSJA 2QY0B 4K1TA 2SGPE 4SGBE 4O97A 3RXIA 4X2VA 1AE5A 3QDZB 1GPZA 1S85A 2GT7A 1TMTH 4K8YA 1BOQA 4E7RG 2CJIA 4FVDA 3LU9B 1F0SA 2XBWA 1C2FA 3UQOA 1TRYA 1SGDE 3KHVA 4YO9A 4Y71A 4AYYB 1ELAA 1EPTA 2OQ5A 4NFEA 2OD3B 2GP9B 3Q3XA 2F9OA 1XUHA 1NRSH 4CREA 1Y5UT 4AGJA 1O3DA 1GHBG 2IPHA 1GL0E 3RXEA 2BZAA 1VITH 1C5LH 3SGQE 1TPSA 3N7OA 4MPVA 3RXMA 2TGPZ 1GI3A 5CMXH 3T25A 1YGCH 4IS5A 2BY6X 1RJXB 1GCTB 1XKAC 1EJMA 3LC5A 1FIZA 2D8WA 3M7UA 2WUBA 3V7TA 3LPRA 1ZJKA 4ZMAH 3M35A 1DS2E 1ABJH 1G2LA 1HAXB 1NRQH 1IHSH 5GWZA 1MH0A 2ZTYA 3DD2H 1LHEH 4Q80A 1FUJA 3BTWE 4AZ2B 2A7HA 1C9TA 3PTBA 3P8GA 1DUAA 1O31A 1ELFA 1GJAB 1RIWB 1V2ST 3A8AA 2AMPA 2WPJS 3SV2H 1BCUH 5LPFA 5DKMA 1CGHA 5FX6A 1SSXA 1PPBH 2GX4A 1Y59T 1PQ8A 2ZIQH 1YCPM 3FFGA 4XBBA 1OYQA 2YNBA 3EA8A 1OWIA 5DO4H 4FUEA 1KIGH 1K1NA 1QA7A 1TNJA 1Y3UA 1JRSA 4AG1A 3BTFE 1UTQA 2Y6TA 5GCHF 1GBAA 1ZMLA 3T27A 2XXLA 1AE8H 1H8IH 3GY6A 3DHKH 1AD8H 3Q3KA 1GI5A 1BTHH 1GDNA 3LT3A 3SUFA 4FUBA 3GDUA 3T2NA 1QJ7B 1IHTH 2P3UB 1BZXE 3MWIU 4YLUA 1AKSB 2VWNA 3TJVA 3RXQA 4UDWH 1FY4A 1SOZA 4IN2A 3U1IB 3LKWA 2Q6GA 1C4V2 1GL1A 2BD9A 1FPCH 3MU4A 3CP7A 4BAOB 3PROA 2AEIH 1HCGA 2VVUA 2BZ6H 4GSOA 2JH0D 2BX3A 3DFJA 2ZFPH 2Z9GA 3C1KA 4MNWA 3A81A 2FTLE 1NU7B 5HMAA 3R3GB 1E38B 1ZGIA 1MAYA 2Z3EA 3B9FH 3MU8A 4Q7ZA 4B2BA 1ZPCA 2TPIZ 1GHYH 5C67A 3S7HB 2XBXA 1K1MA 2ZDAH 1SFQB 1A4WH 3QGNB 1GWAA 1G30B 1TQ0B 2D26C 3ZV8A 2H9HA 1V2NT 1OP0A 2ZU2A 1ARBA 4B2AA 4ZUHA 1FY3A 3VGCB 3UOPA 1VJ9U 2VIDA 2XC0A 1MQ5A 4H42U 3TK5A 1BQYA 4ISIH 1GHAG 5AHGH 3LGTA 3A7YA 5DK1A 3TGKE 3SU2A 2PUXB 1C1OA 1O5AB 2B5TB 2VB0A 1CO7E 4CBNA 1GJDB 1GJ9B 1GI4A 5E0GA 4X2YA 2PKSB 1LQEA 1TFXA 1GDUA 4X6OA 3ZZ8A 1HRTH 2OC1A 4TY6A 2QV1A 3T29A 8GCHF 2FOBA 4F4OC 4VGCC 1H8DH 1S6FA 5ESTE 2CV3A 3BF6H 3F9EA 3ODFA 3SHCH 1O3JA 2DE8A 2HPQH 1GJ5H 1AVXA 4WMDA 3PLBA 3LJOA 4H4FA 2BYAX 1O2UA 5EOKA 5K0HA 1TQ7B 4FUCA 1LHFH 2KAIB 1QB9A 5AVDA 3QZQA 1LTOA 4MVNA 1SGPE 1CGJE 1GDQA 3UREA 5JPMH 3ZVAA 5T6GA 3RXGA 3H5CB 3RDZA 1EZQA 4KTSA 1O3HA 4I33A 3LGIA 3A88A 5C2ZA 1UTLM 1D4PB 1SPJA 1ZR0A 1HBTH 3ZZ9A 3S9CA 1QBNA 1VJAU 2A2QH 2ALVA 1NY22 1QCPA 1UVSH 3A87A 2BY8X 3HKIB 2BOKA 3HGNA 4UD9H 1AFEH 2CHAB 5I25A 2ZPSA 5K7RA 4B1TA 4NIVA 4DT7B 1P06A 4NWLA 4CR5A 1DUEA 1YPHE 1EJNA 1QGFA 4RSPA 1G3EA 1XM1A 5I46H 5CE1A 3BG4B 2Z9KA 1KLTA 3PWBA 1C4Y2 3BTTE 3FAOA 4XFQA 3F9FA 1UK4A 3VB7A 1CQQA 3PV4A 5A0BA 1ZPZA 3K65B 4UFGH 6CHAC 3ZZ4A 3ITIA 1BMLA 3RLYH 3SW2B 4FUFA 1TBZH 3SJ8A 2A0QB 2FO9A 1ABIH 1A46H 1SGFG 1T7CA 2GD4B 1P01A 2AGGX 1GI8B 1THRH 3M61U 5FPYA 1YBWA 1D3DB 2JETC 4O9VA 1TPAE 2FMJA 6ESTA 1A5GH 2ZDVH 1O3CA 4U32A 1O5DH 3PO1B 4ABAA 1HAVB 3ZZ5A 9LPRA 3SI4H 1O34A 1C1TA 1L1JA 1EAWA 1A1RA 3P8NA 3B23B 3P92A 1WU1A 5FXLA 1LVOA 2QXHA 3RXFA 3LH3A 3OU0A 3SZNA 4K2YA 3PTNA 3URDA 3RU4E 4AB9A 3D65E 1FNIA 1CA0B 2A32A 1SGQE 5EQRA 2EA3A 1EOLA 2LNCA 3A8BA 3F6UH 4JZEH 2BDAA 5EG4A 3FANA 5E0HA 1A3BH 4SGAE 1SGNE 4B2CA 4IW4E 2FOCA 3WY8A 2VIQA 3M5NA 1P11E 1D3TB 3QK1A 3V12A 1AMHA 2Y81A 4GCHF 2AH4X 2AS9A 1MTVA 1C5WB 4K1SA 2BLOA 2XTTB 1DOJA 1YLCA 2FIRH 4FUDA 1UTJA 1UJ1A 1THPB 1V2RT 1HIAA 2CGAA 2BB4A 2NU2E 1ZZZA 1EAUA 4INLA 1DITH 2NWNA 1DSTA 5EQSA 1GJ8B 1DFPA 1D3QB 3QLPH 1TOMH 1TABE 4NFFA 1AZZA 1T8LA 3MNBA 1H1BA 1NM6A 2OC8A 1HLTH 4MDSA 1NC6A 5F8TA 2XCFA 1RTFB 3EQ0H 1UTNA 3TJUA 1GJBB 1C1QA 1K2I1 4OS5A 3SJIA 3KNXA 4GVUA 3SN8A 3SUEA 3SOSA 1EJAA 4LZ4B 3ZV9A 2P3TB 1KXCA 2FEQH 3RMMH 3VEQB 1AWFH 3MH4A 3EA9A 1GG6C 2ANMH 1HNEE 5LH8A 5EXLA 1E37B 2HOBA 2UUYA 1B0FA 2FWWA 3RMLH 3ATKA 3HPTB 5F8XA 3T26A 1NU9A 4WMEA 3H7OA 2F91A 4UE7H 3AW1A 2Y80A 2FYQA 1P2IA 1A5IA 1LHDH 1TNIA 2R3YA 1V2UT 1Z8JB 5LPEA 1N6XA 1V2KT 2O8UA 1MCTA 1AB9B 3GY3A 1PFXC 3SNBA 3RXSA 2WV4A 2V3HH 3VB3A 1IQKA 3PB1E 2W3KA 1QY6A 5DP5A 1F92A 3NXPA 4ABGA 4RKJB 2ZPQA 2GDEH 1OWEA 2UUKB 1ELDE 1IQEA 1DDJA 1FDPA 2FYRA 1V2QT 2AFQB 1IQMA 2XC5A 5C1YA 1W0ZU 2Q1JA 2LPRA 4GHTA 1MAXA 3LGVA 2GZ7A 1Z8IB 1HJ9A 1EZXC 3A7XA 4YZUA 4Y7AA 2F9PA 4MPXA 5EGMA 5EPYA 3O8RA 3UFAA 3BIUH 1GHWH 1PPGE 2FX6A 1FMGA 1W7XH 3OYPA 3A7WA 2FLBH 2FESH 3T28A 1LPGB 2GGVB 4XSKU 2BDGA 1W2KH 1AY6H 1H9HE 5EXMA 4WF8A 1BB0B 2GMTC 2QAAA 5C1UA 5HXFA 1N8OC 1Z8RA 1TNLA 3TLOA 1FXYA 5A0CA 2C8YB 3I29A 1HPGA 5CHAB 4NG9H 1KYNA 5FBIA 1KY9A 1YC0A 1QBVH 1GCDA 3BTKE 1GGDB 1TE0A 4IC5A 3Q00A 3HK6B 2OBOA 1K22H 3QUMP 1L4ZA 4DJZB 1GI7B 1EB1H 5DP6A 1DY9A 4WMFA 3ATMA 1V2WT 3OY6U 2FS9A 2O8LA 4O3UA 5J4QA 4BTIB 2WYGA 3NWUA 3VFEA 3UNRA 1P3CA 5LPRA 1O2SA 2BVRH 2W5EA 1J15A 2P93A 2OTVA 1O2HA 1EP6A 1UO6A 1KXBA 1CBWB 2A2XH 1DXPA 1GBLA 4GLYA 3V3MA 3BEUA 1UHBB 3GDSA 2ZGJA 1UTPA 1P10A 1SGYE 1V2VT 2K1QA 4Q7XA 1T8NA 4XBCA 2J92A 4AGKA 1P2OA 1L1GA 2PWXA 4K60A 2RA3A 4A6LA 1MZAA 4JYTA 7ESTE 3S7KB 4IBLH 3E91A 1QR3E 3MH7A 3SV7A 1WTHD 3M3VA 1HAZB 4B74A 2AMQA 1V2PT 1K1PA 2BXUH 4OS1A 4BAQB 3I78A 4UEHH 5TJXA 2BDYA 5EPNA 1XKBC 1AI8H 4AFSA 1W8BH 1CGIE 1C1NA 3RC5A 3ZVEA 2SNWA 2EEKA 2CF9H 3K2UA 5DJ7A 3U69H 1FLEE 4WVPE 1ZHMA 1GHAF 1PPHE 3CS0A 1FN6A 1SLUB 1GVZA 2VVVA 1SQTA 3ZVCA 1UVPA 1GBFA 2BLVA 3O8CA 4Y7BA 1O3GA 4JMYA 1P2MA 2GCTC 1D9IA 1BRBE 1O5CB 1SBWA 2GKVE 3BTEE 2R3UA 4RKOB 3ZZAA 1K28D 2H5DA 1F2SE 1YP9A 2JH5D 1NT1A 1C5RA 3BTQE 3PO1C 1KTSB 3K9XB 3RXLA 1ID5H 2P95A 4KGAA 1ZGVA 2Z9JA 4WXVA 2BHGA 1Q31A 2F3CE 4M7GA 1O2PA 1E35B 8LPRA 1G3DA 1O3MA 2BY9X 2C8WB 5IDKA 3SU0A 3RXTA 3A82A 2P8OB 4NWKA 4OS6A 4AX9H 1TGBA 1DANH 2Q6DA 3QGJA 1MTWA 1N6YA 1FAKH 3GOVB 5C3NA 1IOEA 1ESAA 2A5IA 4X8SH 3PLKA 1Z71A 3ZVFA 5FHTA 1P9UA 1SL3A 1O5BB 1PYTC 1S5SA 4UFEH 1EPTC 1DICA 1EUFA 1O3BA 2GV7A 4FXGH 3LH1A 4IC6A 1GJ6A 2UWPA 2ALPA 5C1XA 4YM9A 1FZZA 2ZDKA 2G5NA 1MTNC 3A7VA 4X8TH 3QTOH 3NK8A 2OC7A 5BPEA 1P9SA 1OWDA 1RIWC 2VWMA 1OXGA 3EE0B 8KME2 1MCVA 1FQ3A 2SGDE 1S84A 1MTUA 4K69A 4AFQA 1C5YB 1RD3B 2FDAA 1C5VA 1C1VH 1O2XA 2UWOA 2PGBB 1S0QA 1G32B 4O03A 1XXFA 3UWJH 3P95A 2ANYA 1ESTA 3UIRA 3SGAE 4HI3A 1ZTJA 1UCYE 1FPHH 2BDHA 4D9QA 2BD4A 4JK6A 2ZU4A 3ZVDA 4R8TB 4YOIA 3NUMA 9ESTA 5LGOA 1MUEB 1VGCC 1QJ1B 1MKWH 1N1LA 2XWBI 2CMYA 2A5KA 1UTKA 2C8ZB 3M5OA 1P2JA 3BTDE 1QFKH 5GIBA 1ELTA 3MMGA 1O33A 3A8CA 1BRUP 2ZFFH 4ZKRU 3SORA 1OPHB 2OBQA 1NRRH 1W13U 1J17T 1TNKA 1G37A 2G8TA 2VNTA 3ATWA 1P09A 2Y7XA 4H6TA 3SUGA 1TBQH 2W7UA 3M3TA 2TGTA 2J9NA 2G51A 1GBBA 4X8VH 3MNCA 5EU8A 1KLJH 3M3SA 1EKBB 1ANEA 1J8AA 2R0LA 4GPGA 1HIAB 1UVOA 1QB6A 4I32A 2EI8A 1KXDA 3BG8A 1AQ7A 4Y0ZE 3GCHB 2YNAA 3GY8A 1FV9A 1GJ4H 2FTMA 2HWLB 2QN5T 1JXPA 4CBOA 4WH8A 1O3NA 1C2EA 1MTSA 1ZOMA 1Z8GA 2F9BH 4MG3A 1QTFA 1AKSA 1JBUH 1UHBA 3TH3H 4WY3A 1SR5C 4JZFH 4FU9A 2GVFA 3GYLB 1EAIA 2XBYA 2ZCHP 1BTWA 2ZHWH 2XBVA 5DP7A 5F03A 7GCHG 2BDCA 2AGIX 3MYWA 2AIQA 3HKJB 5A09A 3MU1A 1TGCA 3Q76A 2H1UA 1S6HA 2VGCB 1BTYA 1C4U2 1HXFH 1O2LA 1QRWA 4INKA 4A5TS 2FS8A 2A4QA 3ODDA 4X6MA 1EP5A 1L0ZA 2Z9LA 3ELAH 3LIWA 5FPSA 1GI6A 2WPLS 4DY7B 4WXIA 2H6MA 3D23A 2J4IA 2PKSC 3ZVGA 1RRKA 3I77A 3SNAA 1BTUA 1GJ7B 3ATIA 2F83A 1YPEH 3E8LA 1K1LA 2J95A 1DWEH 1C2DA 1SMFE 1QURH 3PMJA 2HALA 1Y8TA 3MO6A 1VITG 1A5HA 2GZ8A 1DSUA 2PUQH 3BN9A 3KQDA 4XDEA 1LO6A 5HGGA 4JK5A 1YF4A 2QF3A 1KTTB 2GV6A 3LONA 3A7TA 2PKAA 4UFFH 4GHQA 2HNTC 1VITF 4D7GA 5FCKA 4IMQA 1WTGH 5H4IB 2SGQE 2F9VA 3M5LA 2VWLA 1NRNH 4I31A 4E05H 1UVUH 1VR1H 5JBTA 3FZZA 1SFIA 2PSYA 3A85A 4DIIH 5FCRA 5A8ZA 1QB1A 2FOGA 2FODA 4FVBA 4A7IB 1DT2A 1LHCH 1F5RA 1LVYA 2V0BA 3SV6A 4ABFA 1KXAA 5JBCS 1PQ5A 1K1OA 1O2NA 2OQUA 1AVWA 3K6ZA 1G2MA 1Q3XA 3HGPA 1O2RA 1DLEA 3Q3YA 2ZECA 3MH5A 4A1TA 1HYLA 4X1PU 2VWOA 2SFAA 2PTNA 1THSH 2B0FA 4ABBA 1DWCH 2ZGHA 4OS2A 1NZQH 1MKWK 1OS8A 1AZ8A 4LOYH 3RLWH 1BMAA 1E34B 4GAWA 3SJ9A 1OWKA 1GI1A 4JZ1A 4AORA 3SV9A 1V3XA 1EAXA 1SC8U 2TGDA 4I7YH 5DP9A 1GBMA 1HAHH 4KKDA 1GCTC 1Z1IA 1DWDH 2G5VA 4X1RU 2O9QA 3SGBE 2VIPA 2G52A 1C1UH 3RUOA 4PROA 4A1XA 2FZZA 4X1SU 3QO6A 1KDQB 3PMHB 4MTBA 5HM9A 5C5OA 1B7XB 4O3TA 3AW0A 2W7SA 2FOFA 2ODPA 2ZFRH 2B7DH 3A84A 2A45B 1GBEA 1ELEE 4ISHH 2AMDA 2AERH 2FOMB 1UK3A 3AASA 3RC4A 1CA0C 1FAXA 3OX7U 3P17H 1Y3YA 1O2MA 1O2KA 1W10U 2FI3E 2RG3A 4ZXXH 4Q2KA 1CA8B 6GCHF 1IAUA 2HVXA 2V35A 2BLWA 3GICB 5GPIB 3TGJE 1P8VC 4X2XA 2ODQA 4TPYA 3KQBA 2FOEA 3PMBB 2ZG0H 5T6FA 2JKHA 4BAMB 2ZPRA 4B71A 3DFLA 1LVBA 3E6PH 3VB6A 4OGXA 1BTPA 2VIOA 3K6YA 2ZQ2A 3GY4A 3M37A 3SNEA 2J34A 3AAUA 4DW2U 1MKXK 3E0PB 4ZHMU 1EOJA 1D6RA 2C90B 1QL7A 5EODA 1T32A 3SO3A 4BXWA 1Y5AT 1PQ7A 3KEEA 1ZMJA 1SLWB 1UK2A 2Q6FA 1CHOG 1W7GH 1NFYA 4NCYA 1NO9H 2JH6D 4D8NA 4DG4A 1TA6A 1AIXH 1C5UA 4DGJA 3LGYA 1O3AA 2FOAA 1H4WA 2XYAA 2TIOA 1L2EA 3AAVA 2G81E 4X8UH 2OLGA 1XUFA 2P94A 2Y7ZA 3VB5A 2ZKSA 1YM0A 2QC2A 3STIA 2HGTH 1O30A 4K5ZA 4LXBH 4E7NA 5JYIA 1KDQA 3SV8A 1BBRK 5GJ4B 1YPHC 1Y5BT 3A89A 5PTPA 1C2IA 4Y79A 2KAIA 1ARCA 1GMDF 1SHHB 2STBE 3L3TA 1SQOA 3TH2H 3ZZCA 4ISOA 1O2QA 1MMJN 1Q2WA 2BX4A 3BV9B 1F7ZA 2A1DB 1TWXB 3SJKA 4ABIA 1XVOA 2CF8H 1Z7KA 4NIXA 3UR6A 5E8EH 4NIWA 1QJ6B 4MLFB 1BUIA 5L6NH 3ZYEA 3ZZBA 2O8MA 4YOJA 1GHVH 2PLXA 2XW9A 3SQHE 1O35A 2ZU1A 4HGCA 1INCA 1PJPA 2ZFQH 1LHGH 4Y11E 2VIVA 1BHXB 1HAOH 1EQ9A 6GCHG 1VCQA 3TJNA 1HDTH 2I6QA 4NA8A 1OWHA 1SLXB 8GCHG 1O32A 1XUJA 1UCYK 1W11U 1XUIA 2ODYB 1O2OA 1ZSLA 2CXVA 3NKKA 1XXDA 1TALA 5ABWA 2VINA 3F9GA 2PHBA 1XVMA 5E2PA 5C20A 1OSSA 3SQEE 1FY8E 1NESE 5AFYH 2I6SA 1QL9A 2XRCA 2WYJA 2HRVA 3BEFB 1C1MA 1FY1A 4HFPB 3KIDU 3ZZDA 1W0YH 1SGTA 2GMTB 2W3IA 1SQAA 4TYDA 3SUDA 3MNSA 3SJOA 1P2KA 1O2VA 1SVPA 1T31A 3GYMA 5T6DA 4I8GA 4LK4A 1P2NA 4ZROA 4MPWA 2ULLA 1BHXF 3V0XA 1C2JA 2PSXA 3SBKA 1BRCE 2A4RA 1BITA 3TPIZ 2HPPH 1SHYA 1TB6H 2C93B 1P02A 2Z94A 4ABJA 3BIVH 3MHWU 3SU4A 2BD8A 1Z1JA 4BXSA 1AFQB 1C5NH 1TMUH 4QT8C 3KL6A 2Z3CA 1P57B 2ZFTA 1HAYB 3GY7A 1HFDA 4NSYA 1YLDA 1C9PA 4ISLA 2ZU3A 2QCYA 1GG6B 2BMGB 1TX6A 1BBRE 1PPCE 1A3EH 4X6NA 4OGYA 2PV9B 1TBRH 1EASA 3BTGE 2Y5FA 3MI4A 1TRNA 1GJCB 5EXNA 2STAE 1TOCB 2JETB 2C3SA 2UWLA 1TMBH 1TYNA 3D62A 4KTCA 1RTKA 1QQ4A 4ZHAA 3LDXH 3UOUA 1LCYA 1VCPA 3QN7A 3IITA 3V13A 2G00A 2BTCE 2ZDMA 1O2GH 1TA2A 3PMAB 2PGQB 4ZH8A 4K3JA 1WQVH 1AO5A 1AB9C 3W94A 1NFUA 5ESBA 2V3OH 4CH8B 4XOJA 2R0KA 1ZHRA 3TNTA 1O5EH 1Z6EA 1BJVA 2J94A 3U9AH 3EAJA 4AYVB 2ZHDA 1QBOA 3SHAH 1QL8A 5FAHA 2HNTF 3A7ZA 4OS4A 3A80A 1OX1A 2BD7A 1TNGA 3VGCC 4F49A 2ZCKP 2C8XB 4YT7H 1SLVB 4ABHA 1WCZA 1AU8A 1F5LA 2A5AA 2BQ7B 2R2WU 5A8YA 3B8JA 2GCTB 1ZHPA 3RU4D 3E0NB 3LJJA 2M5TA 1ZSKA 2XWAA 2EC9H 1ANCA 1BBRH 3SU5A 4XBDA 3GCTG 2Z6BD 3SU1A 4Y0YE 2QA9E 3GCTF 5L2ZH 2RDLA 3KF2A 4INHA 7GCHF 1KXFA 5JBBS 1ETRH 2BOHB 2O8TA 5AFZH 2DUCA 4JYVH 2P59A 2HNTE 1V2TT 1N8OB 1C1SA 2P3FH 5CHAC 4NIYA 3LOXA 1EXFA 4E06H 1C2LA 4H6SB 1ZLRA 2PTCE 1IQHA 2RCEA 5SGAE 1MQ6A 2AYWA 4ISNA 2NU1E 1EPTB 3P8OA 1AN1E 1VCWA 5C5NA 1CVWH 2BDBA 2ZFSA 4AFUA 2BD3A 1P2QA 3UPEA 1WOFA 1XUGA 3ENSB 3U1JB 1RS0A 1XUKA 1GBKA 1CBWC 1A0HB 1QQUA 2WPKS 2SGAA 5A0AE 2SGEE 2CHAC 1O3EA 5DP3A 1O2WA 2WPIS 4Y76A 3DA9B 1D3PB 1P05A 1GVKB 3QTVH 4ESTE 2BY5X 1AHTH 4D9RA 4DVAU 2ESTE 5DGJA 1GBCA 2QIQA 4KELA 4B73A 1C1RA 1OKXA 5EQQA 2O8WA 1C5PA 2BQ6B 1AUTC 2VU8E 3GCNA 4CRFA 3SI3H 1VGCB 1ORFA 4ZKOU 4RN6A 1P03A 2OC0A 2B9LA 3PYHA 3DT0H 1H9IE 2FI4E 3RXJA 1HGTH 3TJOA 1ZJDA 3KQCA 1QRZA 5L30H 1P3EA 1A0LA 1CT2E 4YESB 1SI5H 1ELGA 5E2OA 4NA7A 1L1NA 1TONA 1BMMH 1YPMH 3SNDA 4XE4A 1V2JT 4U2WA 3KGPA 3ZZ6A 4IN1A 4MQAA 2GCHG 1DX5M 2VVCA 3JZ2B 5T3HA 3P6ZB 2A7CA 2ZHQH 1BJUA 1P0SH 5FBEA 1YCPK 1HAPH 1HUTH 1ELBA 3RMOH 1BTZA 4BANB 4DURA 1IQNA 3OY5U 1B5GH 4A92A 4FUGA 4TWYA 2Z9IA 4FU7A 1XX9A 4BAKB 4X1NU 1YPKH 1T4UH 1BDAA 2EI7A 2ZCLP 1V6DA 5F8ZA 5HYOA 1MD7A 2HLCA 1LKAA 1TRMA 1HAIH 1DWBH 2ZP0H 3RXHA 7KMEH 1SG8B 4TPIZ 1O37A 1IQGA 3RP2A 3RXPA 2TBSA 3LGWA 3F68H 3AVZA 3M7QA 2AGEX 3CS7A 4LZ1H 1ACBE 3HATH 5DG6A 1JRTA 1DVAH 2BQWB 1WV7H 1SOTA 4MNYA 3MOCA 4I8KA 3RU4T 2J2UA 1S82A 1F0TA 4D76A 2RA0A 4YTAA 5EW2H 1C5OH 4AFZA 2SNVA 2UUJB 4DOQA 3ZZ7A 1IQIA 3MNXA 1OWJA 1C2KA 3BG4C 1F0UA 1UVTH 1OYTH 1LDTT 1C2GA 1TLDA 3KCGH 3U8OH 1UCYH 1GI0A 2FM2A 1GBTA 2FX4A 1O38A 3QWCH 1ZRKA 3U8RH 3NZIA 3S9BA 4BAHB 1G9IE 1SGFA 2QGRA 1BA8B 2F9NA 3MU0A 1EX3A 4CRDA 4AB8A 1CE5A 3G01A 3MTYA 1GI2A 3TK9A 1AFQC 2IOTA 1SGIB 1O2JA 5JB9S 1YPLH 1JIMA 1ZMNA 3A83A 1J14A 1EATA 3TNSA 4NSVA 3P70B 2ANWA 4THNH 1G36A 1O2TA 4U30A 2ZDLA 1YYY1 4K1EA 2Y5GA 4Y8XA 1PYTD 2B8OH 5FX5A 1NS3A 3GY5A 1DY8A 1JIRA 2G4TA 4MNVA 3VPKA 4K8BA 1CHOF 1HJAC 1O3FA 1YKTA 2CN0H 4JZIA 4CRAA 3TH4H 2H2ZA 1NPMA 5L2YH 2GCHF 2R2MB 1V2OT 3TVJB 2ZGXH 4GUXA 1C5TA 3VXEH 4A1VA 3F1SB 3E90B 1SGCA 2F9UA 4B75A 3O8DA 4ZKSU 1CT0E 1BTXA 1TPPA 1EB2A 3RXKA 1UMAH 2BM2A 1J9CH 2XNIA 3RM0H 3GDVA 1Y3XA 4B76A 1QHRB 1PPFE 1MU8B 1TGNA 2QXGA 1E36B 2AIPA 1IQFA 4AOQA 8ESTE 4ZKNU 1LQDB 3E3TA 2P8OC 4X0WU 1DE7H 1C5QA 1O39A 1C1WH 1CHGA 1A0JA 4IMZA 1MZDA 4ABEA 4BTTB 4Y6DA 1PPZA 4GCHG 1FJSA 1GMHF 3OTJE 1C1PA 1FIWA 1MBMA 2QYIA 2H9EH 1S81A 1GHZA 1AUJA 5JDUB 5IYTA 1E0FD 3QZRA 1W3CA 2D1JA 1EZSC 1MKXH 5EW1H 1MTNB 4CRCA 4U01A 3TK6A 4JCNA 4CHAC 3T5FH 1K1JA 1LMWB 2OUAA 1GI9B 2C4FH 2SGFE 1O3OA 2IN2A 1DM4B 2BY7X 1O3KA 5GCHG 3D49H 4Z0KA 1O2ZA 3RM2H 2ZC9H 1V2MT 3ZZ3A 3SU6A 1JOUB 1KXEA 2W26A 3HK3B 1ETTH 4NGAH 3T62A 1T8OA 2R9PA 3SNCA 3U8TH 1TIOA 3O8BA 3E1XB 4X2WA 1JWTA 3GY2A 1DXWA 1HJ8A 1W12U 1W14U 4BTUB 3FP7E 1C5XB 3MH6A 1HAGE 2ZTXA 1WQSA 3RXAA 3TGIE 2PR3A 1C5SA 1MBQA 4TY7A 1WYKA 1MD8A 5HM2A 1JMOH 1TGSZ 1J16A 1SGEE 3BSQA 1A61H 3RXVA 1DLKB 1GBIA 1KSNA 3ESTA 1ELVA 2VH0A 3KN2A 3SU3A 4ZAEA 1X7AC 3RXCA 2BLQA 3KQEA 1NRPH 1HB0B 3FVFB 1F5KU 2GT8A 1A7SA 1GBHA 4Y8ZA 2OCVB 1V2LT 2BD2A 4FUJA 1ETSH 1BIOA 3EGKH 1K1IA 3GCHC 2FOHA 1GBDA 2NU0E 1GHBF 3CENA 5A2MH 1QRXA 1WBGB 4YLQH 1WUNH 2Y82A 1A2CH 1TPOA 1U6QA 2ZGCA 4X6PA 2YOLA 4FUHA 1HV7A 1KLIH 1PQAA 3MFJA 4KTUA 4NZLA 4CRBA 2ILNA 3A8DA 1C2HA 3UTUH 5JB8S 2IJOB 1HXEH 2XCNA 3FP6E
chains in the Genus database with same CATH superfamily
4MNXA 4BOHA 1XMNB 1ZTLA 2ASUB 2H5CA 3NPSA 1ELCA 4AN7A 2QXIA 4Q7YA 1C2MA 2VH6A 3UWIA 3RXRA 3C27B 1E1RD 1TAWA 3ZYDA 1NFXA 5BRRE 1EZUC 3M5MA 2A4OA 1O0DH 4J2YB 4UFDH 1IQLA 3FKSD 2XC4A 1GMCG 2A4GA 5DP4A 1Z6JH 1T8MA 1WAYB 2Z3DA 4HZHA 5DSFA 1O2YA 1NFWA 1GGDC 4R0IA 4HTCH 4I8JA 1PPEE 4FUIA 3RMNH 3L6PA 3UAIC 5ETXA 4WWYA 2ZO3H 2VBCA 3VXFH 1ANBA 4I8HA 2QF0A 3PWCA 5HIYA 2BVSH 1TX7A 3GISB 3QX5H 5G4BA 2P16A 4Y8YA 4ABDA 1CT4E 2ZTZA 3TIUA 2EI6A 2G55A 2OINA 2NU3E 3P8FA 4CR9A 2ZF0H 3UR9A 1F0RA 5TCAA 3GCOA 3EA7A 3VB4A 1NN6A 1GHXH 1NTPA 2QXJA 1H9LB 4I8LA 4MPUA 1GVLA 3M7TA 4X1QU 1S0RA 4XRNA 4AG2A 4B6FA 2NU4E 3URCA 2ZI2H 2THFB 4FU8A 4TWWA 2WPMS 2KX4A 1SGRE 5AF9H 4CRGA 3OSYA 1B0EA 1IQJA 2GDDA 1YPJH 1LPZB 1TNHA 1AGJA 2JIZD 3UNSA 4RI0A 1G3CA 1LKBA 2FI5E 3PLPA 3STJA 3JZ1B 3UNQA 2ZNKH 1BT7A 3MQKC 3S9AA 4IGDA 3S69A 2ANKH 2BVXH 1C5ZB 5FPTA 5B6OA 1GBJA 5DPAA 4JZDH 2DE9A 4ZHLU 7LPRA 1YCPH 3RXBA 3EDXB 2ZEBA 1VZQH 2ZGBH 1AWHB 1GMCF 1ZRBA 1SB1H 3L33A 2PW8H 3A86A 3BTME 3LGUA 3UY9A 1P12E 1NROH 2OXSA 1AVGH 3FP8E 1O3PB 3Q77A 1RGQA 3RC6A 4YT6H 1G3BA 2PKAB 5GDSH 4NA9H 3MO9A 1LVMA 1YPGH 2Y5HA 2GTBA 2ZHFH 3RXDA 2FXRA 3IWMA 1RXPA 5F6MA 1GMDG 3MO3A 1C5MD 2FPZA 1K21H 2G4UA 1HJAB 1O3IA 5GXPA 4VGCB 1ANDA 4WJG2 3RXUA 4DCDA 5TCCA 3BEIB 1OP8A 1ESBA 3ATLA 2WINI 3TITA 3PRDA 1ZTKA 1L4DA 3FZDA 2ZZUH 5JBAS 4J1YA 4CH2B 1T4VH 1RTLA 3IG6B 2J38A 1FI8A 2FP7B 2ZHEH 1QNJA 2PFEA 5KGOA 2BD5A 3R0FA 2GZ9A 4OS7A 2UUFB 3H7TA 1O2IA 1ZPBA 1HAVA 1FONA 1K9OE 3MU5A 1RFNA 4UONA 3S0NA 2VGCC 1O36A 2WPHS 1O5GH 4Y10E 1S83A 1QIXB 5A8XA 2A7JA 4D7FA 4YOGA 1ZYOA 1LPKB 1O3LA 3U98H 1M9UA 2WV5A 1CSOE 1O5FH 2D2DA 1OP2A 3UUZA 2A31A 2OP9A 5C0UA 3E16B 1DPOA 1OOKB 3OEHD 2ZWLH 2BDIA 2H9TH 3UQVA 2ZDNA 4NZQA 2FLRH 2Z7FE 1UTOA 4WH6A 2RFKC 3W95A 4CHAB 3RXOA 3DUXH 3M36A 5DP8A 4JYUH 2ZA5A 4DIHH 1FN8A 1QA0A 3SYJA 1BRAA 1TX8A 3N7DA 2TRMA 4BNRA 4ZXYH 5J4SA 2ZQ1A 2V6NA 2WUCA 5E0JA 4ASHA 6CHAB 1TGTA 3PM3A 1Y3VA 1BMNH 1P04A 3F9HA 1WSSH 3EYDA 1UTMA 3TU7H 1CU1A 3ZVBA 1D6WA 2TGAA 6LPRA 1Y3WA 2VIWA 2BXTH 2ZU5A 1FY5A 1MU6B 2VJ1A 5GNDA 3NCLA 3BTHE 4Z6AH 1GMHG 3LC3A 4KP0A 1ZSJA 2QY0B 1WDIA 4K1TA 2SGPE 4SGBE 4O97A 3RXIA 4X2VA 1AE5A 3QDZB 1GPZA 1S85A 2GT7A 1TMTH 4K8YA 1BOQA 4E7RG 2CJIA 1NBMD 4FVDA 3LU9B 1F0SA 2XBWA 1C2FA 3UQOA 1TRYA 1SGDE 3KHVA 4YO9A 4Y71A 4AYYB 1ELAA 1EPTA 2OQ5A 4NFEA 2OD3B 2GP9B 3Q3XA 2F9OA 1XUHA 2LP6A 1NRSH 4CREA 1Y5UT 4AGJA 1O3DA 1GHBG 2IPHA 1GL0E 3RXEA 2BZAA 1VITH 1C5LH 3SGQE 1TPSA 3N7OA 4MPVA 3RXMA 2TGPZ 1GI3A 5CMXH 3T25A 1YGCH 4IS5A 2BY6X 1RJXB 1GCTB 1XKAC 1EJMA 3LC5A 1FIZA 2D8WA 3M7UA 2WUBA 3V7TA 3LPRA 1ZJKA 4ZMAH 3M35A 1DS2E 1ABJH 1G2LA 1HAXB 1NRQH 1IHSH 5GWZA 1MH0A 2ZTYA 3DD2H 1LHEH 5EJZA 2YMSB 4Q80A 1FUJA 3H09A 3BTWE 4AZ2B 2A7HA 1C9TA 3PTBA 3P8GA 1DUAA 1O31A 1ELFA 1GJAB 1RIWB 1V2ST 3A8AA 2AMPA 2WPJS 3SV2H 1BCUH 5LPFA 5DKMA 1CGHA 5FX6A 1SSXA 1PPBH 2GX4A 1Y59T 1PQ8A 2ZIQH 1YCPM 3FFGA 4XBBA 1OYQA 2YNBA 3EA8A 1OWIA 5DO4H 4FUEA 1KIGH 1K1NA 1QA7A 1TNJA 1Y3UA 1JRSA 4AG1A 3BTFE 1UTQA 2Y6TA 5GCHF 1GBAA 1ZMLA 3T27A 2XXLA 1AE8H 1H8IH 3GY6A 3DHKH 1AD8H 3Q3KA 1GI5A 1BTHH 1GDNA 3LT3A 3SUFA 4FUBA 3GDUA 3T2NA 1QJ7B 1IHTH 4TT3D 2P3UB 1BZXE 3MWIU 4YLUA 1AKSB 2VWNA 3TJVA 3RXQA 4UDWH 1FY4A 1SOZA 4IN2A 1COWD 3U1IB 3FN8A 3LKWA 1C4V2 2Q6GA 1GL1A 2BD9A 1FPCH 3MU4A 3CP7A 4BAOB 3PROA 2AEIH 1HCGA 2VVUA 2BZ6H 4GSOA 2JH0D 2BX3A 3DFJA 2ZFPH 2Z9GA 3C1KA 4MNWA 3A81A 2FTLE 1NU7B 5HMAA 3R3GB 1E38B 1ZGIA 1MAYA 2Z3EA 3B9FH 3MU8A 4Q7ZA 4B2BA 1ZPCA 2TPIZ 1GHYH 5C67A 3S7HB 2XBXA 1K1MA 2ZDAH 1SFQB 1A4WH 3QGNB 1GWAA 1G30B 1TQ0B 2D26C 3ZV8A 2H9HA 1V2NT 1OP0A 2ZU2A 1ARBA 4B2AA 4ZUHA 1FY3A 3VGCB 3UOPA 1VJ9U 2WZQA 2VIDA 2XC0A 1MQ5A 4H42U 2M2AA 3TK5A 1BQYA 4ISIH 1GHAG 5AHGH 3LGTA 3A7YA 5DK1A 3TGKE 3SU2A 2PUXB 1C1OA 1O5AB 2B5TB 2VB0A 1CO7E 4CBNA 1GJDB 1GJ9B 1GI4A 5E0GA 1SKYE 4X2YA 4DT4A 2PKSB 1LQEA 1TFXA 1GDUA 2CK3D 2V7QD 4X6OA 3ZZ8A 1HRTH 2OC1A 4TY6A 2QV1A 3F0PA 3T29A 8GCHF 2FOBA 4F4OC 4VGCC 1H8DH 1S6FA 5ESTE 2CV3A 3BF6H 3F9EA 3ODFA 3SHCH 1O3JA 2DE8A 2HPQH 1GJ5H 1AVXA 4WMDA 3PLBA 3LJOA 4H4FA 2BYAX 1O2UA 5EOKA 5K0HA 1TQ7B 4FUCA 2LELA 1LHFH 2KAIB 3CNRA 1QB9A 5AVDA 3QZQA 1LTOA 4MVNA 1SGPE 1CGJE 1GDQA 3UREA 4F55A 5JPMH 3ZIAD 3ZVAA 5T6GA 3RXGA 3H5CB 3RDZA 1EZQA 4KTSA 1O3HA 4AC9A 4I33A 3LGIA 3A88A 5C2ZA 1UTLM 1D4PB 1SPJA 1ZR0A 1HBTH 3ZZ9A 3S9CA 1QBNA 1VJAU 2A2QH 3W1EA 2ALVA 1NY22 1QCPA 1UVSH 3A87A 2BY8X 3KQ5A 3HKIB 2BOKA 3HGNA 4UD9H 1AFEH 2CHAB 3OFND 5I25A 2ZPSA 3DCLA 5K7RA 4B1TA 4NIVA 4DT7B 1P06A 4NWLA 4CR5A 1DUEA 1YPHE 1EJNA 4YXWD 1QGFA 4RSPA 2WHXA 1G3EA 1XM1A 5I46H 5CE1A 3BG4B 2Z9KA 1KLTA 3PWBA 1C4Y2 3BTTE 3FAOA 4XFQA 3F9FA 1UK4A 3VB7A 1CQQA 3PV4A 5A0BA 1ZPZA 3K65B 4UFGH 6CHAC 3ZZ4A 3ITIA 1BMLA 3RLYH 3SW2B 4FUFA 1TBZH 3SJ8A 2A0QB 2FO9A 1ABIH 1A46H 1SGFG 1T7CA 2GD4B 1P01A 2AGGX 1GI8B 1THRH 3M61U 5FPYA 1YBWA 1D3DB 2JETC 4O9VA 1TPAE 2FMJA 6ESTA 1A5GH 2ZDVH 1O3CA 4U32A 1O5DH 3PO1B 4ABAA 1HAVB 3ZZ5A 9LPRA 3SI4H 1O34A 1C1TA 1L1JA 1EAWA 1A1RA 3P8NA 3B23B 3P92A 1WU1A 5FXLA 1LVOA 4B6EA 2QXHA 3RXFA 3LH3A 3OU0A 3SZNA 4P00A 4K2YA 3PTNA 3URDA 2KCYA 3RU4E 4AB9A 3D65E 1FNIA 1CA0B 2A32A 3SZEA 1SGQE 5EQRA 2EA3A 1EOLA 2LNCA 3A8BA 3F6UH 4JZEH 2BDAA 5EG4A 3FANA 5E0HA 1A3BH 4SGAE 1SGNE 4B2CA 4IW4E 2FOCA 3WY8A 2VIQA 3M5NA 1P11E 1D3TB 3VG8A 3QK1A 3V12A 1AMHA 2Y81A 4GCHF 2AH4X 2AS9A 1MTVA 1C5WB 4K1SA 2BLOA 2XTTB 1DOJA 1YLCA 2FIRH 4FUDA 1UTJA 1UJ1A 1THPB 1V2RT 1HIAA 2CGAA 2BB4A 2NU2E 2HLDD 1ZZZA 1EAUA 4INLA 1DITH 2NWNA 2XNDD 1DSTA 2J97A 5EQSA 1GJ8B 1DFPA 1D3QB 3QLPH 1TOMH 1TABE 4NFFA 1AZZA 1T8LA 3MNBA 1H1BA 1NM6A 2OC8A 1HLTH 4MDSA 1NC6A 5F8TA 2XCFA 1RTFB 3EQ0H 1UTNA 3TJUA 1GJBB 1C1QA 1K2I1 4OS5A 3SJIA 3KNXA 1MABB 4GVUA 3SN8A 3SOSA 1EJAA 3SUEA 4LZ4B 3ZV9A 5HKKD 2P3TB 1KXCA 2FEQH 3RMMH 2L74A 3VEQB 1AWFH 3MH4A 3EA9A 1FX0B 1GG6C 2ANMH 1HNEE 5LH8A 5EXLA 1E37B 2HOBA 2UUYA 1B0FA 2FWWA 3RMLH 3ATKA 3HPTB 4Q4LA 5F8XA 3T26A 1NU9A 3F2GA 3H7OA 4WMEA 2F91A 4UE7H 3AW1A 2Y80A 2FYQA 1P2IA 1A5IA 1LHDH 3FOAA 1TNIA 2R3YA 1V2UT 1Z8JB 4TSFD 5LPEA 1N6XA 1V2KT 2O8UA 1MCTA 1AB9B 1OHHD 3GY3A 1PFXC 3SNBA 3RXSA 2WV4A 2V3HH 3VB3A 1IQKA 3PB1E 2W3KA 1QY6A 5DP5A 1F92A 3NXPA 4ABGA 4RKJB 2ZPQA 2GDEH 1OWEA 2UUKB 1ELDE 1IQEA 1DDJA 1FDPA 2FYRA 1V2QT 2AFQB 1IQMA 2XC5A 5C1YA 1W0ZU 2Q1JA 2LPRA 4GHTA 1MAXA 3LGVA 2GZ7A 1YY3A 1Z8IB 1HJ9A 1EZXC 3A7XA 2JJ1D 4YZUA 3PV2A 4Y7AA 2F9PA 4MPXA 5EGMA 5EPYA 3O8RA 3UFAA 3BIUH 1GHWH 1PPGE 2FX6A 1FMGA 1W7XH 3OYPA 3A7WA 2FLBH 2FESH 3T28A 1LPGB 2GGVB 4XSKU 2BDGA 1W2KH 1AY6H 1H9HE 1K0HA 5EXMA 4WF8A 1BB0B 4RT1A 2GMTC 2QAAA 5C1UA 5HXFA 1N8OC 1Z8RA 1TNLA 3TLOA 1FXYA 5A0CA 2C8YB 3I29A 1HPGA 5CHAB 4NG9H 1KYNA 5FBIA 1KY9A 1YC0A 1QBVH 1GCDA 3BTKE 1GGDB 1TE0A 4IC5A 3Q00A 3HK6B 2OBOA 1K22H 3QUMP 1L4ZA 4DJZB 1GI7B 1EB1H 5DP6A 1DY9A 4WMFA 3ATMA 1V2WT 3OY6U 2FS9A 2O8LA 4O3UA 5J4QA 4BTIB 2WYGA 3NWUA 3VFEA 3UNRA 1P3CA 5LPRA 1O2SA 2BVRH 2W5EA 1J15A 2P93A 2OTVA 1O2HA 1EP6A 1UO6A 1KXBA 1CBWB 2A2XH 1DXPA 1GBLA 4GLYA 3V3MA 3U28C 1W0KD 3BEUA 1UHBB 3GDSA 2ZGJA 1UTPA 1P10A 1SGYE 1V2VT 2K1QA 4Q7XA 1T8NA 2GJGA 4XBCA 1S6LA 2KCAA 2J92A 4AGKA 1P2OA 1L1GA 2PWXA 4K60A 2RA3A 4A6LA 1MZAA 4JYTA 7ESTE 3S7KB 4IBLH 3E91A 1QR3E 3MH7A 3SV7A 1WTHD 3M3VA 1HAZB 3KYGA 4B74A 2AMQA 1V2PT 1K1PA 2BXUH 4OS1A 4BAQB 3I78A 4UEHH 5TJXA 2BDYA 5EPNA 1XKBC 1AI8H 4AFSA 1W8BH 1CGIE 1C1NA 3RC5A 3ZVEA 2SNWA 2EEKA 2CF9H 3K2UA 5DJ7A 2QE7D 3U69H 1FLEE 4WVPE 4FETA 1ZHMA 1GHAF 1PPHE 3CS0A 1FN6A 1SLUB 1GVZA 2VVVA 1YWUA 1SQTA 2JDID 3ZVCA 1UVPA 1GBFA 2BLVA 3O8CA 4Y7BA 1O3GA 4JMYA 1P2MA 2GCTC 1D9IA 1BRBE 1O5CB 1SBWA 2GKVE 3BTEE 2R3UA 4RKOB 3ZZAA 1K28D 2H5DA 1F2SE 1YP9A 2JH5D 1NT1A 1C5RA 3BTQE 3PO1C 1KTSB 3K9XB 3RXLA 1ID5H 2P95A 4KGAA 1ZGVA 2WPDD 4XD7D 2Z9JA 4WXVA 2BHGA 1Q31A 2F3CE 4M7GA 1O2PA 1E35B 8LPRA 1G3DA 1O3MA 2BY9X 2C8WB 5IDKA 3UB0A 3SU0A 3RXTA 3A82A 2P8OB 4NWKA 4OS6A 2JJ2D 4AX9H 1TGBA 1DANH 2Q6DA 3QGJA 1MTWA 1N6YA 1FAKH 3GOVB 5C3NA 1IOEA 1ESAA 2A5IA 4X8SH 3PLKA 2IJD1 1Z71A 3ZVFA 5FHTA 1P9UA 2EQNA 1SL3A 1O5BB 1PYTC 1S5SA 4UFEH 2PP6A 2KZ4A 1EPTC 1DICA 1EUFA 1O3BA 2GV7A 4FXGH 3LH1A 4IC6A 1GJ6A 2UWPA 2ALPA 5C1XA 4YM9A 1FZZA 2ZDKA 2G5NA 1MTNC 3A7VA 4X8TH 3QTOH 3NK8A 2OC7A 5BPEA 1P9SA 1OWDA 1RIWC 2VWMA 1OXGA 3EE0B 8KME2 1MCVA 1FQ3A 2SGDE 1S84A 1MTUA 4K69A 5EJ1A 4AFQA 1C5YB 1RD3B 2FDAA 1C5VA 1C1VH 1O2XA 2UWOA 2PGBB 1S0QA 1G32B 4O03A 1XXFA 3UWJH 3P95A 2ANYA 1ESTA 3UIRA 3SGAE 4HI3A 1ZTJA 1UCYE 1FPHH 2BDHA 4D9QA 2BD4A 4JK6A 2ZU4A 3ZVDA 4R8TB 4YOIA 3NUMA 5FL7D 9ESTA 5LGOA 1MUEB 1VGCC 1QJ1B 1MKWH 1N1LA 2CMYA 2XWBI 2A5KA 1UTKA 2C8ZB 3M5OA 1P2JA 3BTDE 1QFKH 5GIBA 1ELTA 3MMGA 1O33A 3A8CA 1BRUP 2ZFFH 4ZKRU 3SORA 1OPHB 2J5UA 2OBQA 1NRRH 1W13U 1J17T 1TNKA 1G37A 2G8TA 2VNTA 3ATWA 1P09A 2Y7XA 4H6TA 3SUGA 1TBQH 2W7UA 3M3TA 2TGTA 2J9NA 2F4LA 2G51A 1GBBA 4X8VH 3MNCA 5EU8A 1KLJH 3M3SA 1EKBB 1ANEA 2KR7A 1J8AA 2R0LA 4GPGA 1HIAB 1UVOA 1QB6A 4I32A 2EI8A 1KXDA 3BG8A 1AQ7A 4Y0ZE 3GCHB 2YNAA 3GY8A 1FV9A 1GJ4H 2FTMA 2HWLB 2QN5T 1JXPA 4CBOA 4WH8A 1O3NA 1C2EA 1MTSA 1ZOMA 1Z8GA 2F9BH 4MG3A 1QTFA 1AKSA 1JBUH 1UHBA 3TH3H 4WY3A 1SR5C 4JZFH 2F43B 4FU9A 2GVFA 3GYLB 1EAIA 5DN6D 2XBYA 2ZCHP 1BTWA 2ZHWH 2XBVA 5DP7A 5F03A 7GCHG 2BDCA 2AGIX 3MYWA 2AIQA 3HKJB 5A09A 3MU1A 1TGCA 3Q76A 2H1UA 4I86A 1S6HA 2VGCB 1BTYA 1C4U2 1HXFH 1O2LA 1QRWA 4INKA 4A5TS 2FS8A 2A4QA 3ODDA 4X6MA 1EP5A 1L0ZA 2Z9LA 3ELAH 3LIWA 5FPSA 1GI6A 2WPLS 4DY7B 4WXIA 2H6MA 3D23A 2J4IA 2PKSC 3ZVGA 1RRKA 3I77A 3SNAA 1BTUA 1GJ7B 3ATIA 2F83A 1YPEH 3E8LA 1K1LA 4RT0A 2J95A 1DWEH 1C2DA 1SMFE 1QURH 3PMJA 2HALA 1Y8TA 3MO6A 1VITG 1A5HA 2GZ8A 1DSUA 2XOKD 2PUQH 3BN9A 3KQDA 4XDEA 1LO6A 5HGGA 4JK5A 1YF4A 5T1VA 2QF3A 1KTTB 2GV6A 3LONA 3A7TA 2PKAA 4UFFH 4GHQA 2HNTC 1VITF 4D7GA 5FCKA 4IMQA 1WTGH 5H4IB 2SGQE 2F9VA 3M5LA 2VWLA 1NRNH 2J98B 4I31A 4E05H 1WXRA 1UVUH 1VR1H 5JBTA 3FZZA 1SFIA 2PSYA 3A85A 4DIIH 5FCRA 5A8ZA 1QB1A 2FOGA 2FODA 4FVBA 4A7IB 1DT2A 1LHCH 1F5RA 1LVYA 2V0BA 3SV6A 2L6OA 4ABFA 1KXAA 5JBCS 1PQ5A 1K1OA 1O2NA 2OQUA 3OTPA 1AVWA 3K6ZA 1G2MA 1Q3XA 3HGPA 1O2RA 1DLEA 3Q3YA 2ZECA 3MH5A 4A1TA 1HYLA 4X1PU 2VWOA 2SFAA 2PTNA 1THSH 2B0FA 4ABBA 1DWCH 2HVYB 2ZGHA 1H8ED 1KMHB 4OS2A 1NZQH 1MKWK 1OS8A 1AZ8A 4LOYH 3RLWH 1BMAA 1E34B 4GAWA 3SJ9A 1OWKA 1GI1A 4JZ1A 4AORA 3SV9A 1V3XA 1EAXA 2W6ID 1SC8U 2TGDA 4I7YH 4ZCNA 5DP9A 1GBMA 1HAHH 4KKDA 1GCTC 1Z1IA 1DWDH 2G5VA 4X1RU 5KECA 2O9QA 3SGBE 2VIPA 2G52A 2WV9A 1C1UH 3RUOA 4PROA 4A1XA 2FZZA 4X1SU 3QO6A 1KDQB 3PMHB 4MTBA 3F3BA 5HM9A 5C5OA 1B7XB 4O3TA 3AW0A 2W7SA 2FOFA 2ODPA 2ZFRH 2B7DH 3A84A 2A45B 1GBEA 1ELEE 4ISHH 2AMDA 4Q63A 2AERH 2FOMB 3PRBA 1UK3A 3AASA 3RC4A 1CA0C 1FAXA 3OX7U 3P17H 1Y3YA 1O2MA 1O2KA 1W10U 2FI3E 2RG3A 4ZXXH 4Q2KA 1CA8B 6GCHF 1IAUA 2HVXA 2V35A 2BLWA 3GICB 5GPIB 3TGJE 1P8VC 4X2XA 2ODQA 4TPYA 2EY4C 3WWBA 3KQBA 2FOEA 3PMBB 5CHBA 2ZG0H 5T6FA 1EFRD 2JKHA 4BAMB 2ZPRA 4B71A 3DFLA 1LVBA 3E6PH 3VB6A 4OGXA 1BTPA 2VIOA 3K6YA 2ZQ2A 2RDEA 3GY4A 3M37A 3SNEA 2J34A 3AAUA 4DW2U 1MKXK 3E0PB 4ZHMU 1EOJA 1D6RA 2C90B 1QL7A 5EODA 1T32A 3SO3A 4BXWA 1Y5AT 1PQ7A 3KEEA 1ZMJA 1SLWB 1UK2A 2Q6FA 1CHOG 1W7GH 1NFYA 4NCYA 1NO9H 2JH6D 4D8NA 4DG4A 3OE7D 5EJLA 1TA6A 1AIXH 1C5UA 4DGJA 3LGYA 1O3AA 2FOAA 1H4WA 2XYAA 4OM9A 2TIOA 1L2EA 3AAVA 2G81E 4X8UH 2OLGA 1XUFA 2KCOA 2P94A 3DSGA 2Y7ZA 3VB5A 2ZKSA 1YM0A 2QC2A 4P02A 3STIA 2HGTH 1O30A 4K5ZA 4LXBH 4E7NA 5JYIA 1KDQA 3SV8A 3F2FA 3EE7A 1BBRK 5GJ4B 1YPHC 3WW7A 1Y5BT 3A89A 5PTPA 1C2IA 4Y79A 2KAIA 1ARCA 1GMDF 1SHHB 2KFWA 2STBE 3L3TA 1SQOA 3TH2H 3ZZCA 4ISOA 1O2QA 1MMJN 1Q2WA 2BX4A 3BV9B 1F7ZA 2A1DB 1TWXB 3SJKA 4ABIA 2V3MA 1XVOA 2CF8H 1Z7KA 4NIXA 3UR6A 5E8EH 4NIWA 1QJ6B 5C17A 4MLFB 1BUIA 5L6NH 3ZYEA 3ZZBA 2O8MA 4YOJA 1GHVH 2PLXA 2XW9A 3SQHE 1O35A 2ZU1A 4HGCA 1INCA 1PJPA 2ZFQH 1LHGH 4Y11E 2VIVA 1BHXB 1HAOH 1EQ9A 6GCHG 1VCQA 3TJNA 1HDTH 2I6QA 4NA8A 1OWHA 1SLXB 8GCHG 1O32A 1XUJA 1UCYK 1W11U 1XUIA 2ODYB 1BMFD 1O2OA 1ZSLA 2CXVA 3NKKA 1XXDA 1TALA 5ABWA 2VINA 3F9GA 2PHBA 1XVMA 5E2PA 5C20A 1OSSA 3SQEE 1FY8E 1NESE 5AFYH 2I6SA 1QL9A 2XRCA 2WYJA 2HRVA 2AHME 3BEFB 1C1MA 1FY1A 4HFPB 3KIDU 3ZZDA 1W0YH 1SGTA 2GMTB 2W3IA 1SQAA 4TYDA 2KCPA 2W6JD 3SUDA 3MNSA 3SJOA 1P2KA 1O2VA 1SVPA 1T31A 3GYMA 5T6DA 4I8GA 4LK4A 1P2NA 4ZROA 4MPWA 2ULLA 1BHXF 3V0XA 1C2JA 2PSXA 3SBKA 1BRCE 2A4RA 1BITA 3TPIZ 2HPPH 1SHYA 1TB6H 1YLNA 2C93B 1P02A 2Z94A 3WWFA 4ABJA 3BIVH 3NRLA 3MHWU 3SU4A 2BD8A 1Z1JA 4BXSA 1AFQB 1C5NH 1TMUH 4QT8C 3KL6A 2Z3CA 1P57B 2ZFTA 1HAYB 3GY7A 1HFDA 4NSYA 1YLDA 1C9PA 4ISLA 2ZU3A 2QCYA 1GG6B 2BMGB 1TX6A 1BBRE 2KM0A 1PPCE 1A3EH 4X6NA 4OGYA 4ACAA 2PV9B 1TBRH 1EASA 3BTGE 2Y5FA 3MI4A 1TRNA 1GJCB 5EXNA 2STAE 1SQRA 1TOCB 2JETB 2C3SA 2UWLA 1TMBH 1TYNA 3D62A 1E79D 1RTKA 4KTCA 1QQ4A 4ZHAA 3LDXH 3UOUA 2J98A 1LCYA 5F53A 1VCPA 3QN7A 3IITA 3V13A 2G00A 2BTCE 2ZDMA 1O2GH 1TA2A 3PMAB 2PGQB 4ZH8A 4K3JA 1WQVH 1AO5A 1AB9C 1H8HD 1NFUA 3W94A 5ESBA 2V3OH 4ASUD 4CH8B 4XOJA 2R0KA 1ZHRA 3TNTA 1O5EH 1Z6EA 1BJVA 5EIYA 5C94A 2J94A 3U9AH 3EAJA 4AYVB 2ZHDA 1QBOA 3SHAH 1QL8A 5FAHA 2HNTF 3A7ZA 4OS4A 3A80A 1OX1A 2BD7A 1TNGA 3VGCC 4F49A 2ZCKP 2C8XB 4YT7H 1SLVB 3N99A 4ABHA 1WCZA 1AU8A 1F5LA 2A5AA 2BQ7B 2R2WU 2YMSC 5KEDA 5A8YA 3B8JA 2GCTB 4Z1MD 1ZHPA 3RU4D 3E0NB 3LJJA 2M5TA 1ZSKA 2XWAA 2EC9H 1ANCA 1BBRH 3SU5A 4XBDA 3GCTG 2Z6BD 3SU1A 4Y0YE 2QA9E 3GCTF 5L2ZH 2RDLA 3F0OA 3OEED 3KF2A 4INHA 7GCHF 1KXFA 5JBBS 1ETRH 2BOHB 2O8TA 5AFZH 2DUCA 4JYVH 4F48B 2P59A 2HNTE 1V2TT 1N8OB 4HG6A 1C1SA 2P3FH 5CHAC 4NIYA 3LOXA 1EXFA 4E06H 1C2LA 4H6SB 1ZLRA 2PTCE 1IQHA 2RCEA 5SGAE 1MQ6A 2AYWA 4ISNA 2NU1E 1EPTB 3P8OA 1AN1E 1VCWA 5C5NA 1CVWH 2BDBA 2ZFSA 4AFUA 2BD3A 1P2QA 3UPEA 1WOFA 1XUGA 3ENSB 3U1JB 1RS0A 1XUKA 1GBKA 1CBWC 1A0HB 1QQUA 2WPKS 2SGAA 5A0AE 2SGEE 2CHAC 1O3EA 5DP3A 1O2WA 2WPIS 4Y76A 3DA9B 1D3PB 1P05A 1GVKB 3QTVH 4ESTE 2BY5X 1AHTH 4D9RA 2K0QA 4DVAU 2ESTE 5DGJA 1GBCA 2QIQA 4KELA 4B73A 1C1RA 1OKXA 5EQQA 2O8WA 1C5PA 1VKYA 2BQ6B 1AUTC 2VU8E 3GCNA 4CRFA 3SI3H 1VGCB 1ORFA 4ZKOU 4RN6A 1P03A 2OC0A 2B9LA 3PYHA 3DT0H 1H9IE 1W0JD 2FI4E 3RXJA 5C0TA 1HGTH 3TJOA 1ZJDA 3KQCA 1QRZA 5L30H 1P3EA 1A0LA 1CT2E 4YESB 1SI5H 1ELGA 5E2OA 4NA7A 1UW7A 1L1NA 1TONA 1BMMH 1YPMH 3SNDA 4XE4A 3F2HA 1V2JT 4U2WA 3KGPA 3ZZ6A 4IN1A 4MQAA 2GCHG 1DX5M 2VVCA 3JZ2B 5T3HA 3P6ZB 2A7CA 2ZHQH 1BJUA 1P0SH 5FBEA 1YCPK 1HAPH 1HUTH 1ELBA 3RMOH 1BTZA 4BANB 4DURA 1IQNA 2OK5A 3OY5U 1B5GH 4A92A 4FUGA 3PV5A 4TWYA 2Z9IA 4FU7A 1XX9A 4BAKB 4X1NU 1YPKH 1T4UH 1BDAA 2EI7A 2ZCLP 1V6DA 5F8ZA 5HYOA 1MD7A 2HLCA 1LKAA 1TRMA 1HAIH 1DWBH 2ZP0H 3RXHA 7KMEH 1SG8B 4TPIZ 1E1QD 1O37A 3FO8D 5CDFE 1IQGA 3RP2A 3RXPA 2TBSA 3LGWA 3F68H 3AVZA 3M7QA 2AGEX 3CS7A 4LZ1H 1ACBE 3HATH 5DG6A 1JRTA 1DVAH 2BQWB 1WV7H 1SOTA 4MNYA 3MOCA 4I8KA 3RU4T 2J2UA 1S82A 1F0TA 4D76A 2RA0A 4YTAA 5EW2H 1C5OH 4AFZA 2SNVA 2UUJB 4DOQA 3ZZ7A 1IQIA 3MNXA 1OWJA 1C2KA 3BG4C 1F0UA 1UVTH 1OYTH 1LDTT 1C2GA 1TLDA 3KCGH 3U8OH 1UCYH 1GI0A 2FM2A 1GBTA 2FX4A 1O38A 3QWCH 1ZRKA 3U8RH 3NZIA 3S9BA 4BAHB 1G9IE 1SGFA 2QGRA 1BA8B 2F9NA 3MU0A 1EX3A 4CRDA 3GS9A 4AB8A 1CE5A 3G01A 3MTYA 1GI2A 3TK9A 1AFQC 2IOTA 1SGIB 1O2JA 5JB9S 1YPLH 1JIMA 1ZMNA 3A83A 1J14A 1EATA 3TNSA 4NSVA 3P70B 2ANWA 4THNH 2IPQX 1G36A 1O2TA 4U30A 2ZDLA 1YYY1 4K1EA 2Y5GA 4Y8XA 1PYTD 2B8OH 5FX5A 1NS3A 3GY5A 1DY8A 1JIRA 2G4TA 4MNVA 3VPKA 4K8BA 1CHOF 1HJAC 1O3FA 1YKTA 2CN0H 4JZIA 4CRAA 3TH4H 2H2ZA 1NPMA 5L2YH 2GCHF 2R2MB 1V2OT 3TVJB 2ZGXH 4GUXA 1C5TA 3VXEH 4A1VA 3F1SB 3E90B 1SGCA 2F9UA 4B75A 3O8DA 4ZKSU 1CT0E 1BTXA 1TPPA 1EB2A 3RXKA 1UMAH 2BM2A 1J9CH 2XNIA 3RM0H 3GDVA 1Y3XA 4B76A 1QHRB 1PPFE 1MU8B 1TGNA 2QXGA 4ACBA 1E36B 2AIPA 1IQFA 4AOQA 3N7EA 8ESTE 4ZKNU 1LQDB 3E3TA 2P8OC 4X0WU 1DE7H 1C5QA 1O39A 1C1WH 1CHGA 1A0JA 3KYFA 5IK2D 4IMZA 1MZDA 4ABEA 4BTTB 4Y6DA 1PPZA 4GCHG 1FJSA 1GMHF 3OTJE 1C1PA 1FIWA 1MBMA 2QYIA 2H9EH 1S81A 1GHZA 1AUJA 3DSPA 5HIZA 5JDUB 1NBME 5IYTA 1E0FD 3QZRA 4FOUC 1W3CA 2D1JA 1EZSC 2WSSD 1MKXH 2QF5A 5EW1H 1MTNB 4CRCA 4U01A 3TK6A 4JCNA 4CHAC 3T5FH 1K1JA 1LMWB 2OUAA 1GI9B 2C4FH 2SGFE 1O3OA 2IN2A 1DM4B 2BY7X 1O3KA 5GCHG 3D49H 4Z0KA 5B6LA 1O2ZA 3RM2H 2ZC9H 1V2MT 3ZZ3A 3SU6A 1JOUB 1KXEA 2W26A 3HK3B 1ETTH 4NGAH 3T62A 1T8OA 2R9PA 3SNCA 3U8TH 1TIOA 1QZ8A 3O8BA 3DSOA 3E1XB 4X2WA 1JWTA 3GY2A 1DXWA 1HJ8A 1W12U 1W14U 3OAAD 3FP7E 4BTUB 1C5XB 2YMSD 3MH6A 1HAGE 2ZTXA 1WQSA 3RXAA 2QF4A 3TGIE 2PR3A 1C5SA 1MBQA 4TY7A 1WYKA 1MD8A 5HM2A 1JMOH 1TGSZ 1J16A 4M9FA 1SGEE 3BSQA 1A61H 3RXVA 1DLKB 1GBIA 1KSNA 3ESTA 1ELVA 2VH0A 3KN2A 3SU3A 4ZAEA 1X7AC 3RXCA 2BLQA 3KQEA 1NRPH 1HB0B 3FVFB 1F5KU 2GT8A 1A7SA 1GBHA 4Y8ZA 2OCVB 1V2LT 2BD2A 4FUJA 1ETSH 3AK5A 1BIOA 3EGKH 1K1IA 3GCHC 2FOHA 1GBDA 2NU0E 1GHBF 2K8IA 3CENA 5A2MH 1QRXA 1WBGB 4YLQH 1WUNH 2Y82A 1A2CH 1TPOA 1U6QA 2ZGCA 4X6PA 2YOLA 4FUHA 1HV7A 1KLIH 1PQAA 3MFJA 4KTUA 4NZLA 4CRBA 2ILNA 3A8DA 1C2HA 3UTUH 5JB8S 2IJOB 1HXEH 2XCNA 3FP6E
chains in the Genus database with same CATH topology
4MNXA 4BOHA 1XMNB 1ZTLA 2ASUB 2H5CA 3NPSA 1ELCA 4AN7A 2QXIA 4Q7YA 1C2MA 2VH6A 3UWIA 3RXRA 3C27B 1TAWA 3ZYDA 1NFXA 5BRRE 1EZUC 3M5MA 2A4OA 1O0DH 4J2YB 4UFDH 1IQLA 2XC4A 1GMCG 2A4GA 5DP4A 1Z6JH 1T8MA 1WAYB 2Z3DA 4HZHA 1O2YA 1NFWA 1GGDC 4R0IA 4HTCH 4I8JA 1PPEE 4FUIA 3RMNH 3L6PA 5ETXA 4WWYA 2ZO3H 3VXFH 1ANBA 4I8HA 2QF0A 3PWCA 2BVSH 1TX7A 3GISB 3QX5H 5G4BA 2P16A 4Y8YA 4ABDA 1CT4E 2ZTZA 3TIUA 2EI6A 2G55A 2OINA 2NU3E 3P8FA 4CR9A 2ZF0H 3UR9A 1F0RA 5TCAA 3GCOA 3EA7A 3VB4A 1NN6A 1GHXH 1NTPA 2QXJA 1H9LB 4I8LA 4MPUA 1GVLA 3M7TA 4X1QU 1S0RA 4AG2A 2NU4E 3URCA 2ZI2H 2THFB 4FU8A 4TWWA 2WPMS 5AF9H 1SGRE 4CRGA 3OSYA 1B0EA 1IQJA 2GDDA 1YPJH 1LPZB 1TNHA 1AGJA 3UNSA 1G3CA 1LKBA 2FI5E 3PLPA 3STJA 3JZ1B 3UNQA 2ZNKH 1BT7A 3S9AA 4IGDA 3S69A 2ANKH 2BVXH 1C5ZB 5FPTA 5B6OA 1GBJA 5DPAA 4JZDH 2DE9A 4ZHLU 7LPRA 1YCPH 3RXBA 3EDXB 2ZEBA 1VZQH 2ZGBH 1AWHB 1GMCF 1ZRBA 1SB1H 3L33A 2PW8H 3A86A 3BTME 3LGUA 3UY9A 1P12E 1NROH 2OXSA 1AVGH 3FP8E 1O3PB 3Q77A 1RGQA 3RC6A 4YT6H 1G3BA 2PKAB 5GDSH 4NA9H 3MO9A 1LVMA 1YPGH 2Y5HA 2GTBA 2ZHFH 3RXDA 2FXRA 3IWMA 1RXPA 5F6MA 1GMDG 3MO3A 1C5MD 2FPZA 1K21H 2G4UA 1HJAB 1O3IA 5GXPA 4VGCB 1ANDA 4WJG2 3RXUA 4DCDA 5TCCA 3BEIB 1OP8A 1ESBA 3ATLA 2WINI 3TITA 1ZTKA 1L4DA 3FZDA 2ZZUH 5JBAS 4J1YA 4CH2B 1T4VH 1RTLA 3IG6B 2J38A 1FI8A 2FP7B 2ZHEH 1QNJA 2PFEA 2BD5A 3R0FA 2GZ9A 4OS7A 2UUFB 3H7TA 1O2IA 1ZPBA 1HAVA 1FONA 1K9OE 3MU5A 1RFNA 4UONA 3S0NA 2VGCC 1O36A 2WPHS 1O5GH 4Y10E 1S83A 1QIXB 5A8XA 2A7JA 4D7FA 4YOGA 1ZYOA 1LPKB 1O3LA 3U98H 1M9UA 2WV5A 1CSOE 1O5FH 2D2DA 1OP2A 3UUZA 2A31A 2OP9A 3E16B 1DPOA 1OOKB 2ZWLH 2BDIA 2H9TH 3UQVA 2ZDNA 4NZQA 2FLRH 2Z7FE 1UTOA 4WH6A 3W95A 4CHAB 3RXOA 3DUXH 3M36A 5DP8A 4JYUH 2ZA5A 4DIHH 1FN8A 1QA0A 1BRAA 1TX8A 4BNRA 2TRMA 4ZXYH 5J4SA 2ZQ1A 2V6NA 2WUCA 5E0JA 4ASHA 6CHAB 1TGTA 3PM3A 1Y3VA 1BMNH 1P04A 3F9HA 1WSSH 3EYDA 1UTMA 3TU7H 1CU1A 3ZVBA 1D6WA 2TGAA 6LPRA 1Y3WA 2VIWA 2BXTH 2ZU5A 1FY5A 1MU6B 2VJ1A 3NCLA 3BTHE 4Z6AH 1GMHG 3LC3A 4KP0A 1ZSJA 2QY0B 4K1TA 2SGPE 4SGBE 4O97A 3RXIA 4X2VA 1AE5A 3QDZB 1GPZA 1S85A 2GT7A 1TMTH 4K8YA 1BOQA 4E7RG 2CJIA 4FVDA 3LU9B 1F0SA 2XBWA 1C2FA 3UQOA 1TRYA 1SGDE 3KHVA 4YO9A 4Y71A 4AYYB 1ELAA 1EPTA 2OQ5A 4NFEA 2OD3B 2GP9B 3Q3XA 2F9OA 1XUHA 1NRSH 4CREA 1Y5UT 4AGJA 1O3DA 1GHBG 2IPHA 1GL0E 3RXEA 2BZAA 1VITH 1C5LH 3SGQE 1TPSA 3N7OA 4MPVA 3RXMA 2TGPZ 1GI3A 5CMXH 3T25A 1YGCH 4IS5A 2BY6X 1RJXB 1GCTB 1XKAC 1EJMA 3LC5A 1FIZA 2D8WA 3M7UA 2WUBA 3V7TA 3LPRA 1ZJKA 4ZMAH 3M35A 1DS2E 1ABJH 1G2LA 1HAXB 1NRQH 1IHSH 5GWZA 1MH0A 2ZTYA 3DD2H 1LHEH 4Q80A 1FUJA 3BTWE 4AZ2B 2A7HA 1C9TA 3PTBA 3P8GA 1DUAA 1O31A 1ELFA 1GJAB 1RIWB 1V2ST 3A8AA 2AMPA 2WPJS 3SV2H 1BCUH 5LPFA 5DKMA 1CGHA 5FX6A 1SSXA 1PPBH 2GX4A 1Y59T 1PQ8A 2ZIQH 1YCPM 3FFGA 4XBBA 1OYQA 2YNBA 3EA8A 1OWIA 5DO4H 4FUEA 1KIGH 1K1NA 1QA7A 1TNJA 1Y3UA 1JRSA 4AG1A 3BTFE 1UTQA 2Y6TA 5GCHF 1GBAA 1ZMLA 3T27A 2XXLA 1AE8H 1H8IH 3GY6A 3DHKH 1AD8H 3Q3KA 1GI5A 1BTHH 1GDNA 3LT3A 3SUFA 4FUBA 3GDUA 3T2NA 1QJ7B 1IHTH 2P3UB 1BZXE 3MWIU 4YLUA 1AKSB 2VWNA 3TJVA 3RXQA 4UDWH 1FY4A 1SOZA 4IN2A 3U1IB 3LKWA 2Q6GA 1C4V2 1GL1A 2BD9A 1FPCH 3MU4A 3CP7A 4BAOB 3PROA 2AEIH 1HCGA 2VVUA 2BZ6H 4GSOA 2JH0D 2BX3A 3DFJA 2ZFPH 2Z9GA 3C1KA 4MNWA 3A81A 2FTLE 1NU7B 5HMAA 3R3GB 1E38B 1ZGIA 1MAYA 2Z3EA 3B9FH 3MU8A 4Q7ZA 4B2BA 1ZPCA 2TPIZ 1GHYH 5C67A 3S7HB 2XBXA 1K1MA 2ZDAH 1SFQB 1A4WH 3QGNB 1GWAA 1G30B 1TQ0B 2D26C 3ZV8A 2H9HA 1V2NT 1OP0A 2ZU2A 1ARBA 4B2AA 4ZUHA 1FY3A 3VGCB 3UOPA 1VJ9U 2VIDA 2XC0A 1MQ5A 4H42U 3TK5A 1BQYA 4ISIH 1GHAG 5AHGH 3LGTA 3A7YA 5DK1A 3TGKE 3SU2A 2PUXB 1C1OA 1O5AB 2B5TB 2VB0A 1CO7E 4CBNA 1GJDB 1GJ9B 1GI4A 5E0GA 4X2YA 2PKSB 1LQEA 1TFXA 1GDUA 4X6OA 3ZZ8A 1HRTH 2OC1A 4TY6A 2QV1A 3T29A 8GCHF 2FOBA 4F4OC 4VGCC 1H8DH 1S6FA 5ESTE 2CV3A 3BF6H 3F9EA 3ODFA 3SHCH 1O3JA 2DE8A 2HPQH 1GJ5H 1AVXA 4WMDA 3PLBA 3LJOA 4H4FA 2BYAX 1O2UA 5EOKA 5K0HA 1TQ7B 4FUCA 1LHFH 2KAIB 1QB9A 5AVDA 3QZQA 1LTOA 4MVNA 1SGPE 1CGJE 1GDQA 3UREA 5JPMH 3ZVAA 5T6GA 3RXGA 3H5CB 3RDZA 1EZQA 4KTSA 1O3HA 4I33A 3LGIA 3A88A 5C2ZA 1UTLM 1D4PB 1SPJA 1ZR0A 1HBTH 3ZZ9A 3S9CA 1QBNA 1VJAU 2A2QH 2ALVA 1NY22 1QCPA 1UVSH 3A87A 2BY8X 3HKIB 2BOKA 3HGNA 4UD9H 1AFEH 2CHAB 5I25A 2ZPSA 5K7RA 4B1TA 4NIVA 4DT7B 1P06A 4NWLA 4CR5A 1DUEA 1YPHE 1EJNA 1QGFA 4RSPA 1G3EA 1XM1A 5I46H 5CE1A 3BG4B 2Z9KA 1KLTA 3PWBA 1C4Y2 3BTTE 3FAOA 4XFQA 3F9FA 1UK4A 3VB7A 1CQQA 3PV4A 5A0BA 1ZPZA 3K65B 4UFGH 6CHAC 3ZZ4A 3ITIA 1BMLA 3RLYH 3SW2B 4FUFA 1TBZH 3SJ8A 2A0QB 2FO9A 1ABIH 1A46H 1SGFG 1T7CA 2GD4B 1P01A 2AGGX 1GI8B 1THRH 3M61U 5FPYA 1YBWA 1D3DB 2JETC 4O9VA 1TPAE 2FMJA 6ESTA 1A5GH 2ZDVH 1O3CA 4U32A 1O5DH 3PO1B 4ABAA 1HAVB 3ZZ5A 9LPRA 3SI4H 1O34A 1C1TA 1L1JA 1EAWA 1A1RA 3P8NA 3B23B 3P92A 1WU1A 5FXLA 1LVOA 2QXHA 3RXFA 3LH3A 3OU0A 3SZNA 4K2YA 3PTNA 3URDA 3RU4E 4AB9A 3D65E 1FNIA 1CA0B 2A32A 1SGQE 5EQRA 2EA3A 1EOLA 2LNCA 3A8BA 3F6UH 4JZEH 2BDAA 5EG4A 3FANA 5E0HA 1A3BH 4SGAE 1SGNE 4B2CA 4IW4E 2FOCA 3WY8A 2VIQA 3M5NA 1P11E 1D3TB 3QK1A 3V12A 1AMHA 2Y81A 4GCHF 2AH4X 2AS9A 1MTVA 1C5WB 4K1SA 2BLOA 2XTTB 1DOJA 1YLCA 2FIRH 4FUDA 1UTJA 1UJ1A 1THPB 1V2RT 1HIAA 2CGAA 2BB4A 2NU2E 1ZZZA 1EAUA 4INLA 1DITH 2NWNA 1DSTA 5EQSA 1GJ8B 1DFPA 1D3QB 3QLPH 1TOMH 1TABE 4NFFA 1AZZA 1T8LA 3MNBA 1H1BA 1NM6A 2OC8A 1HLTH 4MDSA 1NC6A 5F8TA 2XCFA 1RTFB 3EQ0H 1UTNA 3TJUA 1GJBB 1C1QA 1K2I1 4OS5A 3SJIA 3KNXA 4GVUA 3SN8A 3SUEA 3SOSA 1EJAA 4LZ4B 3ZV9A 2P3TB 1KXCA 2FEQH 3RMMH 3VEQB 1AWFH 3MH4A 3EA9A 1GG6C 2ANMH 1HNEE 5LH8A 5EXLA 1E37B 2HOBA 2UUYA 1B0FA 2FWWA 3RMLH 3ATKA 3HPTB 5F8XA 3T26A 1NU9A 4WMEA 3H7OA 2F91A 4UE7H 3AW1A 2Y80A 2FYQA 1P2IA 1A5IA 1LHDH 1TNIA 2R3YA 1V2UT 1Z8JB 5LPEA 1N6XA 1V2KT 2O8UA 1MCTA 1AB9B 3GY3A 1PFXC 3SNBA 3RXSA 2WV4A 2V3HH 3VB3A 1IQKA 3PB1E 2W3KA 1QY6A 5DP5A 1F92A 3NXPA 4ABGA 4RKJB 2ZPQA 2GDEH 1OWEA 2UUKB 1ELDE 1IQEA 1DDJA 1FDPA 2FYRA 1V2QT 2AFQB 1IQMA 2XC5A 5C1YA 1W0ZU 2Q1JA 2LPRA 4GHTA 1MAXA 3LGVA 2GZ7A 1Z8IB 1HJ9A 1EZXC 3A7XA 4YZUA 4Y7AA 2F9PA 4MPXA 5EGMA 5EPYA 3O8RA 3UFAA 3BIUH 1GHWH 1PPGE 2FX6A 1FMGA 1W7XH 3OYPA 3A7WA 2FLBH 2FESH 3T28A 1LPGB 2GGVB 4XSKU 2BDGA 1W2KH 1AY6H 1H9HE 5EXMA 4WF8A 1BB0B 2GMTC 2QAAA 5C1UA 5HXFA 1N8OC 1Z8RA 1TNLA 3TLOA 1FXYA 5A0CA 2C8YB 3I29A 1HPGA 5CHAB 4NG9H 1KYNA 5FBIA 1KY9A 1YC0A 1QBVH 1GCDA 3BTKE 1GGDB 1TE0A 4IC5A 3Q00A 3HK6B 2OBOA 1K22H 3QUMP 1L4ZA 4DJZB 1GI7B 1EB1H 5DP6A 1DY9A 4WMFA 3ATMA 1V2WT 3OY6U 2FS9A 2O8LA 4O3UA 5J4QA 4BTIB 2WYGA 3NWUA 3VFEA 3UNRA 1P3CA 5LPRA 1O2SA 2BVRH 2W5EA 1J15A 2P93A 2OTVA 1O2HA 1EP6A 1UO6A 1KXBA 1CBWB 2A2XH 1DXPA 1GBLA 4GLYA 3V3MA 3BEUA 1UHBB 3GDSA 2ZGJA 1UTPA 1P10A 1SGYE 1V2VT 2K1QA 4Q7XA 1T8NA 4XBCA 2J92A 4AGKA 1P2OA 1L1GA 2PWXA 4K60A 2RA3A 4A6LA 1MZAA 4JYTA 7ESTE 3S7KB 4IBLH 3E91A 1QR3E 3MH7A 3SV7A 1WTHD 3M3VA 1HAZB 4B74A 2AMQA 1V2PT 1K1PA 2BXUH 4OS1A 4BAQB 3I78A 4UEHH 5TJXA 2BDYA 5EPNA 1XKBC 1AI8H 4AFSA 1W8BH 1CGIE 1C1NA 3RC5A 3ZVEA 2SNWA 2EEKA 2CF9H 3K2UA 5DJ7A 3U69H 1FLEE 4WVPE 1ZHMA 1GHAF 1PPHE 3CS0A 1FN6A 1SLUB 1GVZA 2VVVA 1SQTA 3ZVCA 1UVPA 1GBFA 2BLVA 3O8CA 4Y7BA 1O3GA 4JMYA 1P2MA 2GCTC 1D9IA 1BRBE 1O5CB 1SBWA 2GKVE 3BTEE 2R3UA 4RKOB 3ZZAA 1K28D 2H5DA 1F2SE 1YP9A 2JH5D 1NT1A 1C5RA 3BTQE 3PO1C 1KTSB 3K9XB 3RXLA 1ID5H 2P95A 4KGAA 1ZGVA 2Z9JA 4WXVA 2BHGA 1Q31A 2F3CE 4M7GA 1O2PA 1E35B 8LPRA 1G3DA 1O3MA 2BY9X 2C8WB 5IDKA 3SU0A 3RXTA 3A82A 2P8OB 4NWKA 4OS6A 4AX9H 1TGBA 1DANH 2Q6DA 3QGJA 1MTWA 1N6YA 1FAKH 3GOVB 5C3NA 1IOEA 1ESAA 2A5IA 4X8SH 3PLKA 1Z71A 3ZVFA 5FHTA 1P9UA 1SL3A 1O5BB 1PYTC 1S5SA 4UFEH 1EPTC 1DICA 1EUFA 1O3BA 2GV7A 4FXGH 3LH1A 4IC6A 1GJ6A 2UWPA 2ALPA 5C1XA 4YM9A 1FZZA 2ZDKA 2G5NA 1MTNC 3A7VA 4X8TH 3QTOH 3NK8A 2OC7A 5BPEA 1P9SA 1OWDA 1RIWC 2VWMA 1OXGA 3EE0B 8KME2 1MCVA 1FQ3A 2SGDE 1S84A 1MTUA 4K69A 4AFQA 1C5YB 1RD3B 2FDAA 1C5VA 1C1VH 1O2XA 2UWOA 2PGBB 1S0QA 1G32B 4O03A 1XXFA 3UWJH 3P95A 2ANYA 1ESTA 3UIRA 3SGAE 4HI3A 1ZTJA 1UCYE 1FPHH 2BDHA 4D9QA 2BD4A 4JK6A 2ZU4A 3ZVDA 4R8TB 4YOIA 3NUMA 9ESTA 5LGOA 1MUEB 1VGCC 1QJ1B 1MKWH 1N1LA 2XWBI 2CMYA 2A5KA