1C2IA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2iA02
1O2PA 2VINA 5JPMH 1RGQA 1BZXE 2BY8X 4FUIA 1BJUA 3DD2H 2C93B 5I46H 2FTLE 2ZFSA 3ATMA 1F5RA 3UY9A 1FPCH 5PTPA 2W7UA 4B1TA 2NU3E 1O31A 4Y8XA 2I6SA 1CA8B 4RSPA 2G81E 1QA0A 3GYMA 4YOJA 1SGDE 5FCRA 1BJVA 2GD4B 3QZQA 2AFQB 3S7HB 1OSSA 1FY8E 1ARCA 2VVUA 1V2ST 4OS1A 1LMWB 1XM1A 4I33A 3Q77A 1C5PA 3KQEA 4E06H 4X6NA 4YT6H 1W2KH 1MUEB 4FUJA 3UOPA 1E34B 1OWJA 1GJAB 3E16B 1SQTA 2WYGA 1C5YB 3H7TA 1WTGH 4NA7A 1HJAB 2ALVA 4Y10E 3M3TA 3U1JB 2F9NA 4MG3A 1Z6EA 1AWHB 1QRWA 1GBTA 1GBHA 1FMGA 2BDAA 1DY9A 1SGYE 3C27B 2ZQ1A 1ELBA 1LO6A 1XUKA 1SPJA 1O37A 2WUBA 4CBNA 1V2JT 1E38B 1O32A 1EAUA 1O5EH 1YLCA 4MDSA 1SB1H 1TQ0B 2QY0B 2OQ5A 4NIVA 2A7JA 1N8OC 1SR5C 3SN8A 1RIWB 8LPRA 2ZCLP 4Q80A 4TY6A 1JRSA 2ZFRH 3SJ8A 1P10A 1O34A 5FPTA 3ZVDA 1AB9C 1LTOA 1TX8A 1SOZA 2XC0A 5GDSH 2FS8A 4WXVA 5L30H 4HGCA 5C67A 2W3IA 2ZQ2A 4O3TA 1P2KA 1AUJA 1CHGA 1MTWA 1QNJA 3KQDA 1PQAA 4Y6DA 2PSYA 1GBKA 3A7WA 4LZ4B 1H9HE 1UCYK 3TGKE 1O33A 2OC0A 1K1LA 1SGFG 1C1VH 3S0NA 1G3EA 1H8IH 1TWXB 4XBBA 5DK1A 1GMCG 1EKBB 2PW8H 1K1MA 3A87A 3Q00A 1DX5M 4XE4A 5FPSA 1KXAA 3BTME 1SLXB 1KDQA 1GCTB 3MNBA 5JB9S 1SHYA 2OC1A 2BHGA 5C3NA 4BAQB 1UHBA 4GSOA 2OLGA 1OWEA 2BXTH 4WMEA 2ZU1A 1CA0C 1HXEH 4K1SA 2FPZA 2C4FH 3QWCH 1WUNH 3KF2A 3B23B 4ZHAA 3UQVA 1PJPA 2GV6A 4I31A 1L2EA 2EA3A 1GJ5H 2V3HH 2LPRA 4LK4A 5DP8A 1LPGB 1BTWA 2A31A 1FAKH 3LH1A 1QJ7B 1GI3A 2R9PA 1NTPA 1MKXK 1O5AB 5GCHG 3VEQB 4D9QA 3LGYA 4FU8A 4RKJB 2WV4A 4BTIB 4X8UH 2FOBA 1GBBA 2ZO3H 1QBNA 1IHSH 2C90B 1H8DH 2LNCA 1DFPA 3D49H 1Z1JA 4JZIA 2GDEH 1C1UH 3MNSA 5F6MA 3KGPA 5JBAS 3VPKA 4WMDA 4K8BA 2FOFA 4ISHH 3ZZ8A 4GHTA 1YKTA 2PTNA 2VGCB 1P3CA 3AVZA 1OXGA 2EI7A 1O2KA 3F9HA 1PPGE 1V2NT 3T27A 1A3EH 1P09A 4ZH8A 1DOJA 2ZFQH 3T26A 1YC0A 1F2SE 2BX4A 2J94A 1YP9A 3SU4A 1GHVH 1EJMA 3D65E 1TPPA 2F3CE 5EXLA 2A4OA 3I77A 5L2ZH 1ZR0A 1HAVB 2BY7X 1TGTA 5C20A 1PPFE 5EPNA 4BAHB 1Q31A 3GY4A 2ANMH 2GX4A 3GCTF 2VWNA 4NGAH 3A7ZA 3RMNH 4A7IB 1NPMA 3UNQA 3ELAH 3KCGH 1AY6H 4ABGA 1DT2A 1NFYA 3UWJH 4F49A 2FTMA 1K1JA 5LGOA 2ZHFH 1M9UA 1AHTH 1AKSA 1GBLA 1L1NA 1C5OH 2ZTYA 3KEEA 2VVVA 3CS0A 3M5LA 2ZDLA 1Y5UT 3SJOA 3ZVCA 2ESTE 1QB1A 4GCHG 5FX5A 1O0DH 2P3UB 3R0FA 1AZ8A 1G36A 3A86A 3RC6A 5E2OA 3TITA 5BRRE 1IAUA 1FN6A 1GPZA 4MPUA 3SU6A 3HATH 1C4U2 1Y3WA 1UTPA 5A0AE 2ALPA 1F92A 2Q1JA 3TJOA 2P8OC 2JH5D 3B9FH 3P95A 5TCCA 1BT7A 2BLQA 4MPXA 2OINA 2P3FH 1TA6A 1V2LT 4MTBA 5L6NH 1QBVH 1NS3A 2B7DH 3TH2H 3TVJB 6LPRA 1EZXC 4I7YH 1TMBH 2VWLA 1O2MA 2A0QB 1GWAA 2VIOA 1GHXH 2BDIA 1TNIA 2ZFPH 1P9SA 1VJAU 4ABFA 3TK5A 1BHXB 2DE9A 3E8LA 1JRTA 1BTYA 2BYAX 3RC4A 4KP0A 5GWZA 4WF8A 3JZ1B 2HWLB 4A1TA 6GCHF 1GL1A 2PKAA 3PB1E 2XXLA 2ZWLH 2G8TA 4JZFH 1DWEH 5A8YA 1GG6B 2ZPRA 4H6SB 3FVFB 4UFGH 1OOKB 4IC6A 2CN0H 3BTDE 1ZGIA 3EQ0H 2QXIA 5FCKA 4YTAA 2G4TA 5LPFA 2TGPZ 2K1QA 1ACBE 2R2WU 4ZKOU 1FDPA 2KAIB 1NRSH 2AEIH 2CF9H 4BAOB 1KIGH 4U2WA 3SHAH 1L4ZA 3M7TA 5DP3A 3SJKA 3ZVFA 3GY6A 3MYWA 1D9IA 2O8UA 3MU8A 1UTOA 1T4VH 3TK6A 5TJXA 3RXDA 2Z7FE 2SFAA 2BVSH 4KKDA 3BF6H 3MU0A 2A45B 2G52A 3V0XA 2ZCKP 1QBOA 3RXFA 2GTBA 1WQSA 1KTTB 1MBQA 3TNSA 1SQOA 2ZA5A 1P9UA 1FZZA 3GCHC 1N6YA 1EPTA 2O9QA 1DY8A 1NN6A 1IQEA 1WSSH 4WWYA 1DDJA 2PGBB 1KXEA 5DGJA 1AVWA 1HIAB 1LVBA 2CGAA 1L1JA 1YF4A 3G01A 1HBTH 1UCYE 3IG6B 2H1UA 1J16A 3SUDA 4HTCH 4UD9H 5A0CA 2FODA 1C2MA 1GVKB 1QTFA 4X0WU 1D3PB 2JH6D 1UK3A 1XKAC 2AH4X 1UVOA 1PYTC 3ZZAA 4AFUA 1TA2A 3ATKA 1OPHB 1MTNC 4JK5A 1BDAA 1V2MT 2VU8E 2QGRA 4Y11E 1LKAA 1DLKB 1MQ6A 1O5FH 4NZQA 1CT4E 2ZTXA 5EXMA 1UTMA 3SO3A 1DANH 1YPJH 5AHGH 2AMDA 3SNAA 1QB6A 3W95A 4THNH 1HXFH 4INHA 2FYQA 4H42U 1DPOA 4O9VA 3QZRA 1ZRBA 1LHFH 3TIUA 5T3HA 3M36A 1GJ4H 1VCPA 1TYNA 4WXIA 1UTNA 1P06A 1GHZA 5AFYH 4X1PU 4TY7A 2WPHS 1FNIA 1F0TA 1TRMA 1EUFA 5GPIB 7GCHG 1YPMH 2D2DA 1O30A 1L0ZA 1EOLA 1O3IA 2AGGX 2AMPA 4ABIA 1V2RT 1ZSLA 1YPHC 2Y5HA 1DWDH 2ULLA 2UWPA 2BD8A 1C5MD 2HNTF 2ZFFH 4DIIH 1F0RA 4XFQA 4NSYA 1W8BH 1NC6A 4ISNA 2SNVA 4AG2A 2FX6A 1EB1H 5ESTE 1NROH 3PYHA 4X6MA 3NWUA 4I8GA 1QJ1B 3SJ9A 1O2JA 3T29A 2V35A 2P94A 1ESTA 4MPVA 2FYRA 1LVYA 5I25A 1C2KA 1C5ZB 1XX9A 4Y7BA 4FXGH 2WV5A 3SU2A 2TRMA 2Y5FA 1D4PB 3O8DA 4UE7H 1DSUA 1K28D 2GT7A 4XOJA 1LQDB 3PMJA 3SW2B 1CHOF 1TGCA 1WAYB 3PMAB 1MD8A 1QB9A 2ODYB 3QGJA 3QTOH 1ETRH 2W3KA 3UOUA 1ETSH 2NWNA 1EZQA 4GUXA 1HRTH 1QIXB 3UR6A 1MH0A 2GMTC 2AGIX 1CE5A 4E05H 2CHAC 1GBMA 3QDZB 1SLWB 1BBRK 2FM2A 4KGAA 4FVDA 3P70B 3VB5A 1HAOH 1MZDA 3W94A 2F9UA 2Z3CA 2GZ7A 1W14U 2GCTC 2EEKA 1P0SH 1O3LA 1AFQC 1HAIH 4JYUH 1BB0B 1XUFA 2BB4A 1O2QA 1TRNA 2XBWA 3ZZ9A 1ABJH 5CHAB 4Y71A 4CR9A 1J17T 3EE0B 2ODQA 3DT0H 4AN7A 4AYVB 2BD2A 2PSXA 3VXEH 1CBWB 1TB6H 2A4RA 1P3EA 1J15A 3A8BA 3FP6E 4UFEH 3UQOA 1WCZA 3E0PB 1B5GH 1BTHH 1DVAH 1G3CA 2FX4A 1F7ZA 1GJ7B 4BOHA 1SFIA 4D7FA 2ODPA 3LGWA 2ASUB 1A0JA 1TMUH 1UTJA 2QIQA 1GBEA 1TQ7B 3V12A 1GI8B 1O2WA 3ESTA 1OYTH 4JZ1A 3F9GA 4ASHA 1ZOMA 2F9BH 5DPAA 2H9TH 3FFGA 1MD7A 2STAE 2XTTB 2F83A 4CRCA 3SV6A 1GI2A 1GJBB 3L33A 3K9XB 1T8MA 1CT0E 1YPGH 3LH3A 1WQVH 1EP6A 1K21H 3GICB 5K0HA 2QN5T 2XNIA 1ZTLA 5JYIA 4AB8A 5E0JA 1OP2A 2F9VA 1U6QA 5FHTA 3UIRA 1QURH 3H7OA 1O3EA 1O3JA 2FI3E 4Q7ZA 1C2HA 1Y8TA 2OBOA 1AU8A 1ZHMA 1KXDA 1QFKH 4ABEA 2JETC 4TWWA 1D6WA 4ABAA 1MU6B 3ODFA 1YBWA 1C2EA 1P02A 4ISLA 1K1OA 2CV3A 2FOCA 1SGQE 1EZUC 1SLVB 4IN1A 4CHAB 4DG4A 1FAXA 1E0FD 2VH6A 3VGCB 2HGTH 2M5TA 4UEHH 2BY5X 4AFSA 2QA9E 9ESTA 1TOMH 3BEFB 3SU0A 1BOQA 2BLVA 3LPRA 1B0FA 2ZKSA 3IWMA 1W0YH 1A2CH 2R0KA 1LKBA 3LONA 1RS0A 1FLEE 2D26C 1ELGA 1NT1A 2PUXB 3QGNB 1GMCF 1Z8RA 3A81A 5K7RA 2F9OA 4ZXXH 3P8GA 5F8ZA 2A1DB 3BG4B 2XWAA 2JKHA 3PTNA 5C5NA 1ZRKA 2OCVB 4YT7H 1BCUH 2ILNA 3EYDA 1O3CA 1C5VA 2ZHDA 1IQLA 1DE7H 5EU8A 3ATIA 3RXVA 3V3MA 2D1JA 3MHWU 1BRCE 1ZMNA 7ESTE 1ELFA 4KTUA 2SGEE 3DA9B 1GBCA 1HPGA 1G3DA 1C5QA 1TABE 3DUXH 1PQ8A 5GCHF 4B74A 1BTUA 5T6GA 2Z94A 1WTHD 2TGTA 3A80A 2ANYA 3RLYH 1P8VC 1HLTH 1C1OA 2ZPSA 1HAVA 4CRGA 5EODA 1DXPA 1HNEE 2GCHF 2YNBA 3GY7A 5H4IB 5IYTA 1O3PB 1MU8B 1THPB 1AO5A 3RXHA 4AYYB 5JDUB 4YLQH 1PPZA 2GGVB 1G9IE 3A7TA 1ANBA 2ZU4A 3BG8A 5GIBA 1GVLA 3SNEA 2VWMA 3SUFA 2J92A 1V2PT 3RMOH 1O3NA 1L4DA 1NRPH 3RDZA 2VIDA 3QX5H 1EQ9A 4XBCA 3A84A 1ESAA 1KXFA 3M37A 1KLTA 4E7NA 2A5AA 4NG9H 1QR3E 5HGGA 2BY6X 3AW1A 1SQAA 1GHAF 2GP9B 2VGCC 1SGRE 1QL7A 2HLCA 2ZFTA 4OS7A 4YZUA 2B9LA 1QGFA 1AE8H 3A89A 4TYDA 4QT8C 1C5XB 4ABJA 3DFLA 4IBLH 4X1SU 1NZQH 5EPYA 3TH3H 4OS4A 2WYJA 3TK9A 2FDAA 2O8TA 3NZIA 1C4Y2 1QQUA 1HUTH 1GDNA 4K3JA 2GT8A 3ZZ4A 1D3DB 3BTQE 2RA3A 3RXOA 1AZZA 1T32A 3LGTA 2OXSA 3PWBA 1Y3VA 4JYVH 1GMDG 1Y3UA 4BXSA 2AIQA 1XUIA 1V2KT 1EAXA 1V6DA 3RXRA 1VGCC 1FY5A 2ANWA 3PMHB 3GDVA 1KY9A 4MNVA 1ZPCA 2RDLA 1A1RA 5HM2A 1DITH 2PKSC 4GPGA 3OTJE 2CXVA 2JH0D 2O8MA 2WPLS 2SGFE 3MH4A 1YCPH 2H5CA 1P01A 3P6ZB 3TLOA 4TPYA 2A4QA 2ZDKA 2SNWA 1CT2E 3OYPA 3EDXB 4K5ZA 1BBRE 5TCAA 1NFWA 1Y59T 3ATWA 4CREA 1N8OB 4Q7YA 3LC3A 1BMAA 3LGIA 3MO6A 2QF0A 2BDYA 3UR9A 1BRUP 1ZSKA 3K65B 1T7CA 1VCWA 3OX7U 2XWBI 3A82A 1W0ZU 4GVUA 5CE1A 1AB9B 4IMZA 4CBOA 1EZSC 1VR1H 1JXPA 3AAVA 3U1IB 3MI4A 1B0EA 1T8NA 2F9PA 2KAIA 4FUBA 3RXIA 1AIXH 1UMAH 1AE5A 1IQKA 1ANCA 2ZI2H 2ZGXH 2AGEX 3SGAE 1O3BA 1ZGVA 1FIZA 1H4WA 1O5BB 1AVGH 4ABDA 5GXPA 1FI8A 4D76A 3CP7A 2C8YB 1GGDC 2C8XB 2A4GA 2OTVA 2IOTA 2BMGB 2GV7A 1P2OA 1A5IA 3M5NA 5C5OA 4Z0KA 1Z71A 3T28A 1C1RA 4INKA 1CA0B 2BQ6B 2XC5A 1C1NA 3VB7A 4RKOB 3UWIA 3F1SB 1D3TB 1UVUH 3HKJB 1KXBA 3MWIU 3OSYA 1TIOA 3BTKE 2GVFA 1P05A 1HIAA 1DICA 1UK4A 3STIA 3O8RA 6CHAC 1MZAA 4UFFH 2AYWA 1CO7E 3VXFH 3BV9B 4FU9A 1GG6C 3SJIA 2PGQB 2FOHA 3MH7A 1X7AC 4HI3A 5T6DA 1AFEH 1NRNH 3HPTB 4X8VH 1ELDE 1XVOA 1JIMA 1ZTJA 1YM0A 4OGYA 2FOGA 1UVPA 2BD4A 3SU5A 1MCVA 3E3TA 3U98H 1KLIH 5B6OA 2Y82A 4K2YA 4UDWH 3OY6U 4ZAEA 1AGJA 1BTXA 3RXGA 1SBWA 2ZHWH 1O2GH 3PTBA 1SSXA 2PLXA 5DP6A 3RU4T 4AFZA 4B73A 4B71A 3SV9A 1TGSZ 2BD3A 2ZNKH 2R0LA 9LPRA 1AMHA 2H6MA 2FZZA 5C2ZA 1S85A 1DLEA 4FUDA 1IHTH 1UCYH 2SGAA 3ZZCA 1IQGA 1G30B 1NU9A 3QTVH 3A8CA 5E0HA 4JK6A 2R2MB 2HPQH 1TBRH 3KQCA 1FN8A 1F0UA 1O35A 1UK2A 4Q7XA 3ZV9A 4MNYA 1PYTD 4IMQA 3ZZ6A 1Q2WA 2BD9A 2XCFA 3ENSB 1XVMA 1QA7A 5GJ4B 1V2WT 2Z9KA 1GJ6A 3MTYA 1GHBF 3PLBA 5E2PA 1CQQA 1VJ9U 1HAZB 2FO9A 3GCTG 1LPKB 1P11E 3MOCA 2BM2A 1W11U 4GHQA 5ETXA 4LZ1H 2J2UA 3KHVA 1JBUH 1QCPA 2C8ZB 7GCHF 4ZKSU 4MLFB 2H9HA 1JWTA 2A2XH 3GY8A 3GY2A 5ESBA 1BTPA 4WH6A 3A88A 4PROA 2Y80A 1GBAA 1O3MA 3QO6A 2P8OB 1EP5A 5F8XA 1WV7H 2WINI 4O03A 1O2VA 5LPEA 2FLBH 4BNRA 1SGIB 1ESBA 2EC9H 4XSKU 1S81A 3PO1C 3S9CA 4DVAU 1AWFH 1C5NH 2ZECA 2R3UA 1FIWA 1V2QT 3HK3B 1V2VT 2J34A 1K2I1 3GCNA 2F91A 5ABWA 1G2MA 1C5WB 4MNWA 3UREA 1GI9B 2CF8H 3JZ2B 1SHHB 2H9EH 1DWBH 2FEQH 2FS9A 3M7QA 3SUEA 3TJNA 2XC4A 3GY3A 4WVPE 4I32A 2O8LA 4ABBA 4JCNA 4FUCA 1S83A 2FOAA 4CRDA 2ANKH 4LXBH 4ZMAH 4VGCC 1A4WH 4Y8YA 3GOVB 1GI1A 4DGJA 2O8WA 1CSOE 3P8FA 5C1XA 1BUIA 6GCHG 2J95A 5FBEA 1GBFA 1TX7A 4B75A 1Q3XA 2ZDAH 3TPIZ 3TH4H 1H9IE 4ZXYH 1ELVA 4XDEA 1QL8A 1DXWA 3RXLA 2QXJA 1EPTC 1TE0A 2BVRH 3Q3KA 1BMNH 4RN6A 1BA8B 1PPBH 3ZZDA 5E0GA 2XBXA 1GCDA 4K8YA 3ZVAA 1YYY1 1TPOA 1CGHA 3MNCA 4K60A 1XKBC 2B5TB 3T2NA 1SGNE 4NIXA 3FANA 1GVZA 3SBKA 3VB4A 5EGMA 1YPKH 5IDKA 1T8OA 2FOEA 3GCHB 4ISIH 1QJ6B 4NWLA 3SI3H 3FP8E 1THRH 2BDHA 1H1BA 1BMLA 1ELAA 4O3UA 3NK8A 1Z8IB 1GJ9B 5AVDA 1S82A 2ZDMA 2ZIQH 2W7SA 1C1MA 1VCQA 4AGJA 4R0IA 4BTTB 5EW1H 4IGDA 1K1NA 2BZ6H 3SNCA 1MTNB 1INCA 1UTKA 2ZGCA 1SGCA 2TPIZ 1TGBA 3V7TA 4Y0ZE 4BTUB 3I29A 1IQMA 1NFUA 3LU9B 4I8HA 3SGQE 4NIWA 3CS7A 4DURA 3DHKH 4KTCA 3EA9A 1BTZA 2OC8A 2AERH 1ZMLA 2TGDA 3ZVBA 1MQ5A 1LCYA 1ZLRA 2BOHB 1O2OA 2RCEA 3F9EA 1DUAA 2DUCA 1S0QA 2A32A 4Y76A 4Y7AA 4TPIZ 2GDDA 1G32B 1GI4A 3A7VA 1E35B 1Y3XA 2BX3A 2NU0E 3U9AH 3BIVH 3R3GB 4D9RA 3TGIE 2AMQA 1O5CB 1VZQH 3MU4A 2ZC9H 2A2QH 2AIPA 4IC5A 5FXLA 3SZNA 1YPLH 1AI8H 2PUQH 1O3FA 4FU7A 3Q3YA 5J4QA 5J4SA 4R8TB 1NU7B 2Y5GA 4K1TA 1T4UH 2VIPA 1XMNB 2B8OH 1C5SA 1N1LA 5EXNA 1ZJKA 2Z9IA 3M7UA 4BAKB 1XUJA 3BG4C 1IOEA 2PHBA 3RXQA 2Q6FA 1UO6A 4KELA 2OC7A 2Z9GA 7KMEH 1A61H 2QC2A 3M61U 4OS2A 2PTCE 1SLUB 1TONA 1C1QA 2OQUA 8ESTE 1C9TA 1GDUA 2BD5A 4A5TS 1P2JA 3GDSA 1T8LA 4AB9A 1HAYB 5A09A 1THSH 1GMHG 5LH8A 1QL9A 1HJAC 1RD3B 1AVXA 1TX6A 1RTFB 1OP0A 3ZZ7A 3VFEA 2UWLA 4X2XA 2Z9JA 3BTEE 1ETTH 2BQ7B 3M35A 3GY5A 2HNTE 3HK6B 2GMTB 1C2FA 1RTKA 5A2MH 1O36A 2AS9A 1GI0A 1OKXA 2CHAB 1EXFA 1P12E 2PFEA 2BLOA 1CGIE 3RXAA 3MMGA 1QRZA 4UFDH 1F5KU 1O2IA 2FI5E 1HDTH 1PQ5A 3P17H 5SGAE 1O3GA 2GCTB 3E0NB 1TNKA 2G00A 1O2YA 4H6TA 1AFQB 1RIWC 2ZDVH 3ITIA 1G2LA 1LHEH 1GJ8B 1GHYH 1KLJH 3BEUA 1PPCE 4X2VA 3VB3A 1SOTA 5EOKA 1MTUA 1VITH 3MNXA 3L6PA 3MO3A 3SI4H 2FWWA 2IN2A 2ZCHP 1YCPM 1A5GH 4OS6A 5LPRA 5F03A 1O39A 2QAAA 2BDCA 2VIQA 1Y5AT 3LDXH 4MQAA 3SQHE 1SMFE 5FAHA 1O3DA 1P2QA 4ISOA 3NXPA 4FVBA 4X6OA 4FUFA 1O3OA 3URDA 4X1RU 1SG8B 3RXMA 2V6NA 1P04A 3LIWA 3T62A 5BPEA 4MVNA 4NSVA 4SGAE 2ZU3A 4OS5A 1O5GH 3U8OH 3ZZBA 4CH2B 1GCTC 3BIUH 1GMDF 1ZPBA 3LKWA 1SGPE 1O2HA 4WJG2 8GCHG 4AORA 4I8JA 3TJUA 5EQSA 1A46H 1FY3A 2DE8A 1YLDA 4I8LA 1C2JA 1Z1IA 3ZV8A 1IQNA 5DP9A 5FPYA 2FP7B 4NFEA 2NU4E 2PR3A 3ODDA 3QK1A 2ZGHA 1VITG 4JZEH 4IW4E 1PFXC 1DUEA 1TNJA 1V2OT 4GLYA 1TALA 3M3VA 3SOSA 1FY1A 4ZKRU 1GL0E 1E37B 2FMJA 4DOQA 3KNXA 2BTCE 5EW2H 1C1TA 2J9NA 2JETB 1BBRH 3RU4D 1B7XB 1C5TA 3DFJA 1FY4A 2P3TB 3TGJE 1GI6A 2G4UA 1W7GH 1MTSA 1PPEE 4K69A 1NESE 1S6HA 1SGTA 2A7HA 4U32A 1TBZH 4A1XA 3KQBA 1P57B 1O38A 2P95A 4WMFA 4CH8B 2SGDE 1HV7A 3AAUA 1LHCH 2TIOA 2XBYA 3BEIB 1BRBE 4MPWA 4DY7B 2P59A 3TNTA 5G4BA 2VNTA 1GBJA 1LVOA 2VIVA 3GCOA 4Z6AH 4NZLA 3F68H 3RC5A 1FPHH 3ZZ5A 2ZDNA 5HXFA 3UNRA 4AZ2B 1EASA 3RXEA 4ZUHA 4GCHF 1A7SA 3QLPH 1JIRA 2EI6A 2W5EA 2G5VA 1MKWH 1LDTT 3RXPA 1EAWA 5FBIA 1Z6JH 2WPKS 4F4OC 1MAYA 1ANDA 1O2RA 4B76A 2Z3EA 5A8XA 1PQ7A 2W26A 1IQJA 3ZYEA 1UTQA 5DP4A 5AF9H 1KTSB 1GHWH 1Z8GA 3EAJA 1OWKA 3B8JA 3E1XB 2BDBA 1C5LH 4ZHMU 3PM3A 4YLUA 3NUMA 2OBQA 1F5LA 4ZKNU 4BXWA 1TGNA 3HKIB 4GAWA 1SL3A 3GDUA 2GCHG 1FQ3A 1OWDA 1W7XH 1RXPA 4DIHH 3F6UH 1OP8A 1SI5H 4HZHA 1WYKA 2ZGJA 3V13A 3VB6A 1XXDA 5EG4A 3BTHE 5E8EH 4FUGA 3BTWE 1ABIH 3WY8A 1ZTKA 2G5NA 1HB0B 2NU2E 4Q2KA 4HFPB 4D8NA 1QRXA 3ZVEA 1C2DA 2B0FA 1NO9H 1A0LA 1S84A 7LPRA 4MNXA 1HAGE 1ZZZA 1QHRB 4WY3A 2SGPE 1EAIA 1GHAG 3K6ZA 3E6PH 2IPHA 1UVSH 1YPHE 2FI4E 3RM0H 5C1YA 1GI7B 4YO9A 1WOFA 1HAXB 3D23A 3SGBE 2XRCA 5HYOA 5CMXH 1SFQB 4U01A 5JB8S 2HNTC 1ZJDA 2BOKA 4H4FA 2A5IA 2V3OH 1KSNA 2VIWA 2ZHQH 3O8BA 3H5CB 1OX1A 2OP9A 3Q3XA 1FUJA 1TPSA 1BIOA 1VGCB 1AD8H 3K6YA 2PKSB 1D3QB 1ZPZA 1LPZB 2NU1E 3QUMP 1EB2A 1N6XA 1EATA 2WPJS 1OWIA 1WU1A 3CENA 3ZYDA 4BANB 5C1UA 3UTUH 1G37A 2QXGA 3S9AA 1DWCH 2G55A 2THFB 3UPEA 4B2AA 4ZROA 1AN1E 1LHGH 1WBGB 5EQRA 1IQHA 1F0SA 2CJIA 4FUHA 1O5DH 4INLA 5A8ZA 4D7GA 3TU7H 2ZGBH 2VH0A 3T5FH 3UFAA 2PV9B 1HJ8A 1BITA 1KDQB 2ZTZA 1FONA 2FLRH 3QN7A 1TNGA 1UHBB 1Y5BT 3BTTE 1G3BA 4X2YA 1DSTA 4Y8ZA 1J8AA 4JMYA 4JZDH 1ZMJA 4A92A 1EJNA 3MO9A 2BXUH 2CMYA 1BMMH 3RXKA 4Y79A 1TRYA 4OGXA 2ZU2A 3RMLH 1W13U 1GGDB 4BAMB 1SGEE 1C2GA 1FJSA 4I8KA 3RLWH 4B2CA 4NCYA 4J1YA 1LQEA 4IS5A 3OU0A 2HOBA 1C1WH 3EA7A 2UWOA 1PPHE 1CU1A 3SV7A 1ANEA 1RRKA 1GJDB 6CHAB 1T31A 2FESH 3O8CA 1MKXH 2C8WB 3RXCA 4NWKA 2Y81A 4X8SH 2QCYA 2RA0A 1TPAE 1K9OE 2Y6TA 1GI5A 2IJOB 1SGFA 3SORA 3HGNA 3STJA 1O2UA 2STBE 1O2SA 1O2ZA 1A3BH 4YM9A 1CGJE 1P03A 5EQQA 1AQ7A 1D6RA 3SU3A 5JBTA 5L2YH 1RJXB 2BLWA 4JYTA 3IITA 1YGCH 3GYLB 3E91A 2EI8A 1IQFA 2Q6GA 3U8RH 3FAOA 2Y7ZA 2UUJB 1KYNA 1HAPH 1LVMA 2FXRA 2BY9X 1AKSB 1KXCA 1GDQA 1UJ1A 4Y0YE 2VWOA 2GZ9A 4X8TH 5HMAA 3NCLA 5AFZH 1TLDA 1YPEH 3PLPA 1TAWA 3GISB 3AASA 2FOMB 1Y3YA 1HGTH 1J14A 1QQ4A 1C9PA 1UTLM 1W10U 3LJOA 3MH5A 3RXBA 1TMTH 4NA8A 2XYAA 3BTFE 4A1VA 3OY5U 1ZYOA 2BD7A 2ZG0H 1C2IA 1S5SA 2BDGA 3P8OA 5HM9A 2QXHA 1OS8A 1OWHA 2GZ8A 3PLKA 4CRBA 4CR5A 4KTSA 1NM6A 1ORFA 2RG3A 1ARBA 2J38A 4AX9H 1S6FA 3RP2A 1HCGA 3I78A 1GHBG 1GJCB 1FV9A 4J2YB 3EGKH 2VJ1A 3K2UA 1HFDA 5JBBS 3SV8A 4CRAA 3MFJA 4IN2A 4M7GA 1O2NA 4UONA 1O3HA 5CHAC 3RXUA 1BHXF 1NRQH 3L3TA 4TWYA 3ATLA 4DW2U 2BQWB 2Z3DA 1MMJN 3BN9A 3LGVA 5DO4H 4DJZB 1CBWC 4FUEA 3SUGA 3PO1B 1GBDA 3S7KB 4DT7B 3SV2H 2BZAA 2PKAB 3SQEE 2P93A 4SGBE 1C4V2 1K22H 1LHDH 2R3YA 4NIYA 2HVXA 4X6PA 3A7XA 4AFQA 2ZPQA 1ZSJA 3KL6A 3Q76A 1TNHA 2YNAA 3MH6A 2GKVE 3U69H 1XXFA 1S0RA 2ZU5A 4AG1A 1E36B 3NPSA 1ELCA 3SHCH 1GMHF 2D8WA 3RXSA 1A5HA 3S9BA 4X2WA 8KME2 3RM2H 1ID5H 2Z6BD 1K1PA 3N7OA 3RMMH 2ZHEH 1TBQH 1V2TT 1O2TA 2QV1A 1O3KA 3KN2A 2ZEBA 3MU1A 2H5DA 4VGCB 2XW9A 2Q6DA 1NFXA 4X1QU 1K1IA 3LJJA 3LT3A 4X1NU 1MAXA 2I6QA 2QF3A 1NRRH 1TNLA 1O2LA 2Z9LA 4ZHLU 3FZZA 2A5KA 1O3AA 2FIRH 2VVCA 1P2NA 1BQYA 2OUAA 3SNBA 3SNDA 2C3SA 1J9CH 1UVTH 1L1GA 3NKKA 3P8NA 3BSQA 3M3SA 3PROA 1EPTB 2WPMS 4DCDA 1Z8JB 2UUFB 3PMBB 3M5OA 3UNSA 2XCNA 2H2ZA 3PWCA 2ZP0H 5T6FA 1XUGA 2VB0A 4NA9H 4CHAC 1ZHRA 5JBCS 3VGCC 3RXTA 3S69A 3U8TH 1A0HB 1XUHA 3RXJA 3T25A 2WPIS 2BVXH 5DG6A 2TBSA 4NFFA 1SVPA 2ZZUH 3F9FA 1GBIA 2SGQE 3SU1A 1W12U 5DP5A 3PV4A 3RU4E 2A7CA 4YOGA 1C5RA 3KIDU 4ABHA 4LOYH 1ELTA 1MCTA 1DM4B 3A83A 2OD3B 4O97A 3A8DA 1W3CA 1MTVA 3EA8A 4AOQA 2UUYA 1C1PA 1P2MA 3E90B 1C2LA 1ELEE 1EOJA 3ZZ3A 1C1SA 3MU5A 4XBDA 4E7RG 8GCHF 2UUKB 3C1KA 1P2IA 4CRFA 4ESTE 5FX6A 3LC5A 5DKMA 1RTLA 5A0BA 1MBMA 2YOLA 1C5UA 1OYQA 3FZDA 1VITF 3LGUA 2Y7XA 3ZVGA 5F8TA 6ESTA 1JMOH 1IQIA 4YOIA 1SC8U 2P16A 3UUZA 1MKWK 2G51A 3BTGE 1HJ9A 3P92A 1CVWH 2WUCA 3M5MA 3AW0A 1NY22 2XBVA 1TFXA 1RFNA 2V0BA 2QYIA 4WH8A 1EJAA 4YESB 1Z7KA 2HALA 1CHOG 3A8AA 1JOUB 1YCPK 3URCA 2ZF0H 3LOXA 2TGAA 1TOCB 3HGPA 1QY6A 3A7YA 1AUTC 1V3XA 1ZHPA 2J4IA 5DJ7A 4U30A 4AGKA 3FP7E 1DS2E 2HRVA 2HPPH 4K1EA 1EX3A 1V2UT 1FXYA 4A6LA 3TJVA 5DP7A 1HYLA 2PWXA 1H9LB 1BRAA 1HAHH 3D62A 3RUOA 1O2XA 3A85A 4B2BA
chains in the Genus database with same CATH superfamily
1O2PA 2VINA 5JPMH 1RGQA 1BZXE 2BY8X 4FUIA 1BJUA 3DD2H 2C93B 2IPQX 5I46H 2FTLE 2JIZD 2ZFSA 3ATMA 1F5RA 3UY9A 3F2GA 1FPCH 5PTPA 2W7UA 4B1TA 2NU3E 1O31A 4Y8XA 2I6SA 2J97A 1CA8B 4RSPA 2G81E 1QA0A 3GYMA 4YOJA 1SGDE 5FCRA 1BJVA 2GD4B 3QZQA 2AFQB 3S7HB 1OSSA 1FY8E 1ARCA 2VVUA 1V2ST 4OS1A 1LMWB 1XM1A 4I33A 3Q77A 1C5PA 3KQEA 4E06H 4X6NA 4YT6H 1W2KH 1MUEB 4FUJA 3UOPA 1E34B 1OWJA 1GJAB 3E16B 1SQTA 2WYGA 1C5YB 4F55A 3H7TA 1WTGH 4NA7A 1HJAB 2ALVA 4Y10E 3M3TA 3U1JB 2F9NA 4MG3A 1Z6EA 1AWHB 1QRWA 1GBTA 1GBHA 1FMGA 2BDAA 1DY9A 1SGYE 3C27B 2ZQ1A 1ELBA 1LO6A 1XUKA 1SPJA 1O37A 2WUBA 4CBNA 1V2JT 1E38B 1O32A 1EAUA 5C94A 1O5EH 1YLCA 1NBMD 4MDSA 1SB1H 1TQ0B 2QY0B 2OQ5A 4NIVA 2A7JA 1N8OC 1SR5C 3SN8A 1RIWB 8LPRA 2ZCLP 4Q80A 4TY6A 1JRSA 2ZFRH 3SJ8A 1P10A 1O34A 5FPTA 3ZVDA 1AB9C 1LTOA 1TX8A 5C17A 1SOZA 2XC0A 5GDSH 2FS8A 4WXVA 5L30H 4HGCA 5C67A 2W3IA 2ZQ2A 4O3TA 1P2KA 1AUJA 1CHGA 1MTWA 1QNJA 3KQDA 1PQAA 4Y6DA 2PSYA 1GBKA 3A7WA 4LZ4B 1H9HE 1UCYK 3TGKE 1O33A 2OC0A 1K1LA 1SGFG 1C1VH 3S0NA 1G3EA 1H8IH 1TWXB 4XBBA 5DK1A 1GMCG 1EKBB 2PW8H 1K1MA 3A87A 3Q00A 1DX5M 4XE4A 5FPSA 1KXAA 3BTME 1SLXB 1KDQA 1GCTB 3KQ5A 3MNBA 5JB9S 1SHYA 2OC1A 2BHGA 5C3NA 4BAQB 1UHBA 4GSOA 2OLGA 1OWEA 2BXTH 4WMEA 2ZU1A 1CA0C 1HXEH 4K1SA 2FPZA 2C4FH 3QWCH 1WUNH 3KF2A 3B23B 4ZHAA 3UQVA 1PJPA 2GV6A 4I31A 1L2EA 2EA3A 1GJ5H 2V3HH 2LPRA 4LK4A 5DP8A 1LPGB 1BTWA 2A31A 3F3BA 3VG8A 1FAKH 3LH1A 1QJ7B 1GI3A 2R9PA 1NTPA 1MKXK 1O5AB 5GCHG 3VEQB 4D9QA 3LGYA 4FU8A 4RKJB 2WV4A 4BTIB 4X8UH 2FOBA 1GBBA 2ZO3H 1QBNA 1IHSH 2C90B 1UW7A 1H8DH 2LNCA 1DFPA 3D49H 4B6EA 2QF4A 1Z1JA 4JZIA 2GDEH 2AHME 1C1UH 3MNSA 5F6MA 3PV2A 3F2HA 3KGPA 5JBAS 3VPKA 4WMDA 4K8BA 2FOFA 4ISHH 3ZZ8A 4GHTA 1YKTA 2PTNA 2VGCB 2W6ID 1P3CA 3AVZA 1OXGA 2EI7A 1O2KA 3F9HA 1PPGE 1V2NT 3T27A 1A3EH 1P09A 4ZH8A 1DOJA 2ZFQH 3T26A 1YC0A 1F2SE 2BX4A 2J94A 1YP9A 3SU4A 1GHVH 1EJMA 3D65E 1TPPA 2F3CE 5EXLA 2A4OA 3I77A 3N7DA 1ZR0A 1HAVB 5L2ZH 2BY7X 1TGTA 5C20A 1PPFE 5EPNA 4BAHB 1Q31A 3GY4A 2ANMH 2GX4A 3GCTF 2VWNA 4NGAH 3A7ZA 3RMNH 4A7IB 1NPMA 3UNQA 3ELAH 3KCGH 1AY6H 4ABGA 1DT2A 1NFYA 3UWJH 4F49A 2FTMA 1K1JA 5LGOA 2ZHFH 1M9UA 1AHTH 1AKSA 1GBLA 1L1NA 1C5OH 2ZTYA 3KEEA 2VVVA 3CS0A 3M5LA 2ZDLA 1Y5UT 3SJOA 3ZVCA 2ESTE 1QB1A 4GCHG 5FX5A 1O0DH 2P3UB 3R0FA 1AZ8A 1G36A 3A86A 3RC6A 5E2OA 3TITA 5EJZA 5BRRE 1IAUA 1FN6A 1GPZA 4MPUA 3SU6A 3HATH 1C4U2 1Y3WA 1UTPA 5A0AE 2ALPA 1F92A 2Q1JA 3TJOA 2P8OC 2JH5D 3B9FH 3P95A 5TCCA 1BT7A 3FOAA 2BLQA 4MPXA 2OINA 2P3FH 2XOKD 1E1QD 1YLNA 1TA6A 1V2LT 4MTBA 5L6NH 1QBVH 1NS3A 2B7DH 3TH2H 3TVJB 6LPRA 1EZXC 4I7YH 1TMBH 2VWLA 1O2MA 2A0QB 1GWAA 3CNRA 2HVYB 2VIOA 1GHXH 2BDIA 1TNIA 2ZFPH 1P9SA 1VJAU 4ABFA 3TK5A 1BHXB 2DE9A 3E8LA 1JRTA 1BTYA 2BYAX 3RC4A 4KP0A 5GWZA 4WF8A 3JZ1B 2HWLB 4A1TA 6GCHF 1GL1A 2PKAA 3PB1E 2XXLA 2ZWLH 2G8TA 4JZFH 1DWEH 5CDFE 5A8YA 1GG6B 2ZPRA 4H6SB 3FVFB 4UFGH 1OOKB 4IC6A 2CN0H 3BTDE 1ZGIA 2M2AA 3EQ0H 2QXIA 5FCKA 4YTAA 2G4TA 5LPFA 2TGPZ 2K1QA 1ACBE 2R2WU 4ZKOU 1FDPA 2KAIB 1NRSH 2AEIH 2CF9H 4BAOB 1KIGH 4U2WA 3SHAH 1L4ZA 3M7TA 5DP3A 3SJKA 3ZVFA 3GY6A 3MYWA 1D9IA 2O8UA 3MU8A 1UTOA 1T4VH 3TK6A 5TJXA 3RXDA 2Z7FE 2SFAA 2BVSH 4KKDA 3BF6H 3MU0A 2A45B 2G52A 3V0XA 2ZCKP 1QBOA 3RXFA 2K8IA 2GTBA 1WQSA 1KTTB 1MBQA 3TNSA 1SQOA 2ZA5A 1P9UA 4RT1A 1FZZA 3GCHC 5DN6D 1N6YA 1EPTA 2O9QA 1DY8A 1NN6A 1IQEA 1WSSH 4WWYA 1DDJA 2PGBB 1KXEA 5DGJA 1AVWA 1HIAB 1LVBA 2CGAA 1L1JA 2YMSB 4P02A 1YF4A 3G01A 1HBTH 1UCYE 3IG6B 2H1UA 2K0QA 1J16A 3SUDA 4HTCH 4UD9H 5A0CA 2FODA 1C2MA 1GVKB 1QTFA 4X0WU 1D3PB 2JH6D 1UK3A 1XKAC 2AH4X 1UVOA 1PYTC 3ZZAA 4AFUA 1TA2A 3ATKA 1OPHB 1MTNC 4JK5A 1BDAA 1V2MT 2VU8E 2QGRA 4Y11E 1LKAA 1DLKB 1MQ6A 1O5FH 3PRDA 4NZQA 1CT4E 2ZTXA 5EXMA 1UTMA 3SO3A 1DANH 1YPJH 5AHGH 2AMDA 3SNAA 1QB6A 3W95A 4THNH 1HXFH 4INHA 2FYQA 4H42U 1DPOA 4O9VA 3QZRA 1ZRBA 1LHFH 3TIUA 5T3HA 3M36A 1GJ4H 1VCPA 1TYNA 4WXIA 1UTNA 1P06A 1GHZA 5AFYH 4X1PU 4TY7A 2WPHS 1FNIA 1F0TA 1TRMA 1EUFA 5GPIB 7GCHG 1YPMH 2D2DA 1O30A 1L0ZA 1EOLA 1O3IA 2AGGX 2AMPA 4ABIA 1V2RT 1ZSLA 1YPHC 2Y5HA 1DWDH 2ULLA 2UWPA 2BD8A 1C5MD 2HNTF 2ZFFH 4DIIH 1F0RA 4XFQA 4NSYA 1W8BH 1NC6A 4ISNA 2SNVA 4AG2A 2FX6A 1EB1H 5ESTE 1NROH 3PYHA 4X6MA 3NWUA 4I8GA 1MABB 1QJ1B 3SJ9A 1O2JA 3T29A 2V35A 2P94A 1ESTA 4MPVA 2FYRA 1LVYA 5I25A 1C2KA 1C5ZB 1XX9A 4Y7BA 4FXGH 2KCAA 2WV5A 3SU2A 2TRMA 2Y5FA 1D4PB 3O8DA 4UE7H 1DSUA 1K28D 2GT7A 2GJGA 4XOJA 1LQDB 3PMJA 3SW2B 1CHOF 1TGCA 1WAYB 3PMAB 5HIYA 1MD8A 1QB9A 2ODYB 3QGJA 3QTOH 1ETRH 2W3KA 3UOUA 1ETSH 2NWNA 1EZQA 4GUXA 1HRTH 1QIXB 3UR6A 1MH0A 2KCYA 1BMFD 2GMTC 2AGIX 1CE5A 4E05H 2CHAC 1GBMA 3QDZB 1SLWB 1BBRK 2FM2A 4KGAA 4FVDA 3P70B 3VB5A 1HAOH 1MZDA 3W94A 2F9UA 2Z3CA 2GZ7A 1W14U 2GCTC 2EEKA 1P0SH 1O3LA 1AFQC 1HAIH 4JYUH 1BB0B 1XUFA 2BB4A 1O2QA 1TRNA 2XBWA 3ZZ9A 1ABJH 5CHAB 4Y71A 4CR9A 1J17T 3EE0B 2ODQA 3DT0H 1H8HD 4AN7A 4AYVB 2BD2A 2PSXA 3VXEH 1CBWB 1TB6H 2A4RA 1P3EA 1J15A 3A8BA 1NBME 3FP6E 4UFEH 1WCZA 3UQOA 3E0PB 1B5GH 1BTHH 1DVAH 1G3CA 2FX4A 1F7ZA 1GJ7B 2J5UA 1SFIA 4BOHA 3SZEA 4D7FA 2ODPA 3LGWA 2ASUB 1A0JA 1TMUH 1UTJA 2QIQA 3KYFA 1GBEA 1TQ7B 3V12A 1GI8B 1O2WA 3ESTA 3H09A 1OYTH 4JZ1A 3F9GA 4ASHA 1ZOMA 2F9BH 5DPAA 3GS9A 2H9TH 3FFGA 2QE7D 1MD7A 2STAE 2XTTB 2F83A 4CRCA 3SV6A 1GI2A 1GJBB 3L33A 3K9XB 1T8MA 1CT0E 1YPGH 3LH3A 1WQVH 1EP6A 1K21H 3GICB 5K0HA 3OEHD 2QN5T 2XNIA 1ZTLA 5JYIA 4AB8A 5E0JA 1OP2A 2F9VA 1U6QA 5FHTA 3UIRA 1QURH 3H7OA 1O3EA 1O3JA 2FI3E 4Q7ZA 4TT3D 1C2HA 1Y8TA 2OBOA 1AU8A 1ZHMA 1KXDA 1QFKH 3OFND 2JETC 4TWWA 1D6WA 4ABAA 4ABEA 1MU6B 3ODFA 1YBWA 1C2EA 1P02A 4ISLA 1K1OA 2CV3A 2FOCA 1SGQE 1EZUC 1SLVB 4IN1A 4CHAB 4DG4A 1FAXA 1E0FD 2VH6A 3VGCB 2HGTH 2M5TA 4UEHH 2BY5X 4AFSA 2QA9E 9ESTA 1TOMH 3BEFB 3SU0A 1BOQA 2BLVA 3LPRA 1B0FA 3WWFA 2ZKSA 3IWMA 1W0YH 1A2CH 2R0KA 1LKBA 3LONA 1RS0A 1FLEE 2D26C 1ELGA 1NT1A 2PUXB 3QGNB 1GMCF 1Z8RA 3A81A 5K7RA 2F9OA 4ZXXH 3P8GA 5F8ZA 5HKKD 2A1DB 3BG4B 2XWAA 2JKHA 3PTNA 5C5NA 1ZRKA 2OCVB 4YT7H 1BCUH 2ILNA 3EYDA 1O3CA 1C5VA 2ZHDA 1IQLA 1DE7H 5EU8A 3ATIA 3RXVA 3V3MA 2D1JA 3MHWU 1BRCE 1ZMNA 7ESTE 1ELFA 4KTUA 2SGEE 3DA9B 1GBCA 1HPGA 1G3DA 1C5QA 1TABE 3DUXH 1PQ8A 4FOUC 5GCHF 4B74A 1BTUA 5T6GA 2Z94A 1WTHD 2TGTA 3A80A 2ANYA 3RLYH 1P8VC 1HLTH 2LP6A 1C1OA 2ZPSA 1HAVA 4CRGA 5EODA 1DXPA 1HNEE 2GCHF 2YNBA 3GY7A 5H4IB 5IYTA 1O3PB 1MU8B 1THPB 1AO5A 3W1EA 3RXHA 4AYYB 5JDUB 4YLQH 1PPZA 2GGVB 1G9IE 3A7TA 1ANBA 2ZU4A 3BG8A 5GIBA 1GVLA 3SNEA 2VWMA 3SUFA 2J92A 1V2PT 3RMOH 1E79D 1O3NA 1L4DA 1NRPH 3RDZA 2VIDA 3QX5H 1EQ9A 4XBCA 3A84A 1ESAA 2KCPA 1KXFA 3M37A 1KLTA 4E7NA 2A5AA 4NG9H 1QR3E 2RFKC 5HGGA 2BY6X 3AW1A 1SQAA 1GHAF 2GP9B 2VGCC 1SGRE 1QL7A 2HLCA 2ZFTA 4OS7A 4YZUA 2B9LA 1QGFA 1AE8H 3A89A 4TYDA 4QT8C 1C5XB 4ABJA 3DFLA 4IBLH 4X1SU 1NZQH 5EPYA 4P00A 3TH3H 4OS4A 2WYJA 3TK9A 2FDAA 2O8TA 3NZIA 1C4Y2 1QQUA 1HUTH 1GDNA 4RI0A 4K3JA 2GT8A 3ZZ4A 2EY4C 1D3DB 3BTQE 2RA3A 3RXOA 1AZZA 1T32A 3LGTA 2OXSA 3PWBA 1Y3VA 4JYVH 1GMDG 1Y3UA 4BXSA 2AIQA 1XUIA 1V2KT 1EAXA 1V6DA 3RXRA 1VGCC 1FY5A 2ANWA 3PMHB 3GDVA 1KY9A 3F0OA 4MNVA 1ZPCA 2RDLA 1A1RA 5HM2A 1DITH 2PKSC 4GPGA 3OTJE 2CXVA 2JH0D 2O8MA 2WPLS 2SGFE 3MH4A 1YCPH 2H5CA 1P01A 3UB0A 3OE7D 3P6ZB 3TLOA 4TPYA 2A4QA 2ZDKA 2SNWA 1CT2E 3OYPA 1YY3A 3EDXB 4K5ZA 1BBRE 5TCAA 1NFWA 1Y59T 3ATWA 4CREA 1N8OB 4Q7YA 3LC3A 1BMAA 2KR7A 3LGIA 3MO6A 2QF0A 2BDYA 3UR9A 1BRUP 1ZSKA 3K65B 1T7CA 4ZCNA 1VCWA 3OX7U 2XWBI 3A82A 1W0ZU 4GVUA 5CE1A 1AB9B 4IMZA 4CBOA 1EZSC 1VR1H 1OHHD 1JXPA 4ACBA 3AAVA 3U1IB 3MI4A 1B0EA 2F9PA 2KAIA 1T8NA 1YWUA 4FUBA 1AIXH 1UMAH 3RXIA 1AE5A 1IQKA 5GNDA 1ANCA 2ZI2H 2ZGXH 2AGEX 3SGAE 1O3BA 1ZGVA 1FIZA 1H4WA 1O5BB 1W0KD 1AVGH 4ABDA 5GXPA 1FI8A 4D76A 3CP7A 2C8YB 1GGDC 2C8XB 2A4GA 2OTVA 2IOTA 2BMGB 2GV7A 1P2OA 1A5IA 3M5NA 2XNDD 5C5OA 4Z0KA 1Z71A 3T28A 1C1RA 4INKA 1CA0B 2BQ6B 2XC5A 1C1NA 3VB7A 4RKOB 3UWIA 3F1SB 1D3TB 1UVUH 3HKJB 1KXBA 3MWIU 3OSYA 1TIOA 3BTKE 2GVFA 1P05A 1HIAA 1DICA 1UK4A 3STIA 3O8RA 6CHAC 1MZAA 4UFFH 2AYWA 1CO7E 3VXFH 3BV9B 4FU9A 1GG6C 3SJIA 2PGQB 2FOHA 3MH7A 1X7AC 4HI3A 5T6DA 2F4LA 1AFEH 1NRNH 3HPTB 4X8VH 1ELDE 1XVOA 1JIMA 1ZTJA 1YM0A 3PRBA 2FOGA 1UVPA 2BD4A 4OGYA 4AC9A 3SU5A 1MCVA 3E3TA 3U98H 1KLIH 5B6OA 2Y82A 4K2YA 4UDWH 3OY6U 4ZAEA 1AGJA 1BTXA 3RXGA 3EE7A 1QZ8A 1SBWA 2ZHWH 1O2GH 3PTBA 1SSXA 2PLXA 5DP6A 3RU4T 4AFZA 4B73A 4B71A 3SV9A 1TGSZ 4OM9A 2BD3A 2ZNKH 2R0LA 9LPRA 1AMHA 3WWBA 2H6MA 2FZZA 5C2ZA 1S85A 1DLEA 4FUDA 1IHTH 1UCYH 2SGAA 3ZZCA 1IQGA 1G30B 4ACAA 1NU9A 3QTVH 3A8CA 5E0HA 4JK6A 2YMSC 2R2MB 2HPQH 1TBRH 3KQCA 1FN8A 1F0UA 1O35A 1UK2A 4Q7XA 3ZV9A 4MNYA 1PYTD 4IMQA 3ZZ6A 1Q2WA 2EQNA 2BD9A 2XCFA 3ENSB 1XVMA 1QA7A 5GJ4B 1V2WT 4F48B 2Z9KA 1GJ6A 3MTYA 1GHBF 3PLBA 3OAAD 5E2PA 1CQQA 4B6FA 1VJ9U 5C0TA 1HAZB 2FO9A 3GCTG 4HG6A 1LPKB 1P11E 3MOCA 2BM2A 2JDID 1W11U 4GHQA 5T1VA 5ETXA 4LZ1H 2J2UA 3KHVA 1JBUH 1QCPA 2C8ZB 7GCHF 4ZKSU 4MLFB 2H9HA 1JWTA 2A2XH 2WSSD 3GY8A 2QF5A 3GY2A 5ESBA 1BTPA 1FX0B 4WH6A 3A88A 4PROA 2Y80A 1GBAA 1O3MA 3QO6A 2P8OB 1EP5A 5F8XA 1WV7H 2WINI 4O03A 1O2VA 5LPEA 2FLBH 4BNRA 1SGIB 1ESBA 2EC9H 4XSKU 1S81A 3PO1C 3S9CA 4DVAU 1AWFH 1C5NH 2ZECA 2R3UA 1FIWA 1V2QT 3HK3B 1V2VT 2J34A 1K2I1 3GCNA 2F91A 5ABWA 1G2MA 1C5WB 4MNWA 3UREA 1GI9B 2CF8H 3JZ2B 1SHHB 2H9EH 1DWBH 2FEQH 2FS9A 3M7QA 3SUEA 3TJNA 2XC4A 3GY3A 4WVPE 4I32A 2O8LA 4ABBA 4JCNA 4FUCA 1S83A 2FOAA 4CRDA 2ANKH 4LXBH 4ZMAH 4VGCC 1A4WH 4Y8YA 3GOVB 1GI1A 4DGJA 2O8WA 3WW7A 3PV5A 1CSOE 3P8FA 5C1XA 1BUIA 6GCHG 2J95A 5FBEA 1GBFA 1TX7A 4B75A 1Q3XA 2ZDAH 3TPIZ 3TH4H 1H9IE 4ZXYH 1ELVA 4XDEA 1QL8A 1DXWA 3RXLA 2QXJA 1EPTC 1TE0A 2BVRH 3Q3KA 2V3MA 1BMNH 4RN6A 1BA8B 1PPBH 3ZZDA 5E0GA 2XBXA 1GCDA 2V7QD 4K8YA 3ZVAA 1YYY1 1TPOA 1CGHA 3MNCA 4K60A 1XKBC 2B5TB 3T2NA 2WHXA 1SGNE 4NIXA 3FANA 1GVZA 3SBKA 3U28C 3VB4A 5EGMA 1YPKH 5IDKA 1T8OA 2FOEA 3GCHB 4ISIH 1QJ6B 4NWLA 3SI3H 3FP8E 1THRH 2BDHA 1H1BA 1BMLA 1ELAA 4O3UA 3NK8A 1Z8IB 1GJ9B 5AVDA 1S82A 2ZDMA 2ZIQH 2W7SA 1C1MA 1VCQA 4AGJA 4R0IA 5EJ1A 4BTTB 5EW1H 4IGDA 1K1NA 2BZ6H 3SNCA 1MTNB 3MQKC 1INCA 1UTKA 3N7EA 2ZGCA 1SGCA 2TPIZ 1TGBA 3V7TA 4Y0ZE 4BTUB 3I29A 1IQMA 1NFUA 3LU9B 4I8HA 3SGQE 4NIWA 3CS7A 4DURA 3DHKH 4KTCA 3EA9A 1BTZA 2OC8A 2AERH 1ZMLA 2TGDA 3ZVBA 1MQ5A 1LCYA 1ZLRA 2BOHB 1O2OA 2RCEA 3F9EA 1DUAA 2DUCA 1S0QA 2A32A 4Y76A 4Y7AA 4TPIZ 2J98B 2GDDA 1G32B 3UAIC 1GI4A 3A7VA 1E35B 1Y3XA 3FKSD 2BX3A 2NU0E 3U9AH 3BIVH 3R3GB 4D9RA 3TGIE 2AMQA 1O5CB 1VZQH 3MU4A 2ZC9H 2A2QH 2AIPA 3DSPA 4IC5A 5FXLA 3SZNA 1YPLH 1AI8H 2PUQH 1O3FA 4FU7A 3Q3YA 5J4QA 5J4SA 2WV9A 4R8TB 1NU7B 2Y5GA 4K1TA 1T4UH 2VIPA 1XMNB 2L6OA 2B8OH 1C5SA 1N1LA 5EXNA 1ZJKA 2Z9IA 3M7UA 4BAKB 1XUJA 3BG4C 1IOEA 2PHBA 3RXQA 2Q6FA 1UO6A 4KELA 2OC7A 2Z9GA 7KMEH 1A61H 2QC2A 3F2FA 3M61U 4OS2A 2PTCE 1SLUB 1TONA 1C1QA 2OQUA 8ESTE 1C9TA 1GDUA 2BD5A 4A5TS 1P2JA 3DSOA 3GDSA 1T8LA 4AB9A 1HAYB 5A09A 1THSH 1GMHG 5LH8A 1QL9A 1HJAC 1RD3B 1AVXA 2WPDD 1TX6A 1RTFB 1OP0A 3ZZ7A 3VFEA 2UWLA 4X2XA 2Z9JA 3BTEE 1ETTH 2BQ7B 3M35A 3GY5A 2HNTE 3HK6B 2GMTB 1C2FA 1RTKA 5A2MH 1O36A 2AS9A 5F53A 1GI0A 1OKXA 2CHAB 1EXFA 1P12E 2PFEA 2BLOA 1CGIE 3RXAA 3MMGA 1QRZA 4UFDH 1F5KU 1O2IA 2FI5E 1HDTH 1PQ5A 3P17H 5SGAE 1O3GA 2GCTB 3E0NB 1TNKA 2G00A 1O2YA 4H6TA 1AFQB 4YXWD 1RIWC 2ZDVH 3ITIA 1G2LA 1LHEH 1GJ8B 1GHYH 1KLJH 3BEUA 1PPCE 4X2VA 3VB3A 1SOTA 5EOKA 1MTUA 1VKYA 1VITH 3MNXA 3L6PA 3MO3A 3SI4H 2FWWA 2IN2A 2ZCHP 3OEED 1YCPM 1A5GH 4OS6A 5LPRA 5F03A 1O39A 2QAAA 2BDCA 2VIQA 1Y5AT 3LDXH 4MQAA 3SQHE 1SMFE 5FAHA 1O3DA 1P2QA 4ISOA 3NXPA 4FVBA 4X6OA 4FUFA 1O3OA 3URDA 4X1RU 1SG8B 3RXMA 2V6NA 1P04A 3LIWA 3T62A 5BPEA 4MVNA 4NSVA 4SGAE 2ZU3A 4OS5A 1O5GH 3U8OH 3ZZBA 4CH2B 4DT4A 1GCTC 3BIUH 1GMDF 1ZPBA 3LKWA 3ZIAD 1SGPE 1O2HA 4WJG2 8GCHG 4AORA 4I8JA 3TJUA 5EQSA 1A46H 1FY3A 2DE8A 1YLDA 4I8LA 1C2JA 1Z1IA 3ZV8A 1IQNA 5DP9A 5FPYA 2FP7B 4NFEA 2NU4E 2PR3A 3ODDA 3QK1A 2ZGHA 1VITG 1WXRA 4JZEH 4IW4E 1PFXC 1DUEA 1TNJA 4M9FA 1V2OT 4GLYA 5FL7D 1TALA 3M3VA 3SOSA 1FY1A 4ZKRU 1GL0E 1E37B 2FMJA 4DOQA 3KNXA 2BTCE 5EW2H 2JJ2D 1C1TA 2J9NA 2JETB 1BBRH 3RU4D 1SKYE 1B7XB 1C5TA 3DFJA 1FY4A 2P3TB 3TGJE 1GI6A 2G4UA 1W7GH 1MTSA 1PPEE 4K69A 1NESE 1S6HA 1SGTA 2A7HA 4U32A 1TBZH 4A1XA 3KQBA 1P57B 1O38A 2P95A 4WMFA 4CH8B 2SGDE 1HV7A 3AAUA 1LHCH 2TIOA 2XBYA 3BEIB 1BRBE 4MPWA 4DY7B 2P59A 3TNTA 5G4BA 2VNTA 1GBJA 1LVOA 2VIVA 2OK5A 3GCOA 4Z6AH 4NZLA 3F68H 3RC5A 1FPHH 3ZZ5A 2JJ1D 2ZDNA 5HXFA 3UNRA 4AZ2B 1EASA 3RXEA 4ZUHA 4GCHF 1A7SA 3QLPH 1JIRA 2EI6A 2W5EA 2G5VA 1MKWH 1LDTT 3SYJA 3RXPA 1EAWA 5FBIA 1Z6JH 2WPKS 4F4OC 1MAYA 2IJD1 1ANDA 1O2RA 4B76A 2Z3EA 5A8XA 1PQ7A 2W26A 1IQJA 1WDIA 3ZYEA 1UTQA 5DP4A 5AF9H 1KTSB 1GHWH 1Z8GA 3EAJA 1OWKA 3B8JA 3E1XB 2BDBA 1C5LH 4ZHMU 3PM3A 4YLUA 3NUMA 2OBQA 1F5LA 4ZKNU 4BXWA 1TGNA 3HKIB 4GAWA 1SL3A 3GDUA 2GCHG 1E1RD 1FQ3A 1OWDA 1W7XH 1RXPA 4DIHH 3F6UH 5KGOA 1OP8A 1SI5H 4XRNA 4HZHA 1WYKA 2ZGJA 3V13A 3VB6A 1XXDA 5EG4A 3BTHE 5E8EH 4FUGA 3BTWE 1ABIH 3WY8A 1ZTKA 2G5NA 1HB0B 3NRLA 2NU2E 4Q2KA 4HFPB 4RT0A 4D8NA 1QRXA 3ZVEA 1C2DA 2B0FA 1NO9H 1A0LA 1S84A 7LPRA 5B6LA 4MNXA 1HAGE 1ZZZA 1QHRB 4WY3A 2SGPE 1EAIA 1GHAG 2YMSD 3K6ZA 3E6PH 2IPHA 1UVSH 1YPHE 2FI4E 3RM0H 2RDEA 5C1YA 1GI7B 4YO9A 1WOFA 1HAXB 3D23A 3SGBE 2XRCA 5HYOA 5CMXH 1SFQB 4U01A 5JB8S 2HNTC 1ZJDA 2BOKA 4H4FA 2A5IA 2V3OH 1KSNA 2VIWA 2ZHQH 3O8BA 3H5CB 4Z1MD 1OX1A 2OP9A 3Q3XA 5HIZA 5IK2D 1FUJA 1TPSA 1BIOA 2KCOA 1VGCB 1AD8H 3K6YA 2PKSB 1D3QB 2W6JD 1ZPZA 1LPZB 2NU1E 3QUMP 1EB2A 1N6XA 1EATA 2WPJS 1OWIA 1WU1A 3CENA 3ZYDA 4BANB 5C1UA 3UTUH 1G37A 2QXGA 3S9AA 1DWCH 2G55A 2THFB 3UPEA 2VBCA 4B2AA 4ZROA 1AN1E 1LHGH 1WBGB 5EQRA 1IQHA 1F0SA 1EFRD 2CJIA 4FUHA 1O5DH 4INLA 5A8ZA 4D7GA 3TU7H 2ZGBH 2VH0A 3T5FH 3UFAA 3KYGA 2PV9B 1HJ8A 1BITA 1KDQB 2ZTZA 1FONA 2FLRH 3QN7A 1TNGA 1UHBB 1Y5BT 3BTTE 1COWD 1G3BA 4X2YA 1DSTA 4Y8ZA 1J8AA 4JMYA 4JZDH 1ZMJA 4A92A 5CHBA 1EJNA 3MO9A 2BXUH 2CMYA 1BMMH 3RXKA 4Y79A 1TRYA 4FETA 4OGXA 2ZU2A 3RMLH 2L74A 1W13U 2KZ4A 1GGDB 4BAMB 1SGEE 1C2GA 1FJSA 4I8KA 3RLWH 4B2CA 4NCYA 4J1YA 5C0UA 1LQEA 4IS5A 3OU0A 2HOBA 1C1WH 3EA7A 2UWOA 1PPHE 1CU1A 3SV7A 1ANEA 2LELA 1RRKA 1GJDB 6CHAB 1T31A 3DSGA 2FESH 3O8CA 1MKXH 2C8WB 3RXCA 4NWKA 2Y81A 4X8SH 2QCYA 2RA0A 1TPAE 1K9OE 2Y6TA 1GI5A 2IJOB 1SGFA 3SORA 3HGNA 3STJA 1O2UA 2STBE 1O2SA 1O2ZA 1A3BH 4YM9A 1CGJE 1P03A 1W0JD 3AK5A 5EQQA 1AQ7A 1D6RA 3SU3A 3FO8D 5JBTA 5L2YH 1RJXB 4TSFD 2BLWA 1SQRA 2KM0A 4JYTA 3IITA 1YGCH 3GYLB 3E91A 2EI8A 3N99A 1IQFA 2Q6GA 3U8RH 3FAOA 2Y7ZA 2UUJB 1KYNA 1HAPH 5DSFA 1LVMA 2FXRA 2BY9X 1AKSB 1KXCA 1GDQA 2J98A 1UJ1A 4Y0YE 2VWOA 2GZ9A 4X8TH 5HMAA 5KEDA 3NCLA 5AFZH 1TLDA 1YPEH 3PLPA 1TAWA 3GISB 3AASA 2FOMB 1Y3YA 3OTPA 1HGTH 1J14A 1QQ4A 1C9PA 1UTLM 1W10U 3LJOA 3MH5A 4Q4LA 3RXBA 1TMTH 1KMHB 4NA8A 2XYAA 3BTFE 4A1VA 2KFWA 3OY5U 1ZYOA 2BD7A 2ZG0H 1C2IA 1S5SA 2BDGA 3P8OA 5HM9A 2QXHA 1OS8A 1OWHA 2GZ8A 3PLKA 4CRBA 4CR5A 4KTSA 1NM6A 2KX4A 1ORFA 2HLDD 2RG3A 1ARBA 2J38A 4AX9H 1S6FA 3RP2A 1HCGA 3I78A 5EIYA 1GHBG 1GJCB 1S6LA 1FV9A 4J2YB 3EGKH 2VJ1A 3K2UA 1HFDA 5JBBS 3SV8A 4CRAA 3MFJA 4IN2A 2PP6A 4M7GA 1O2NA 4UONA 1O3HA 5CHAC 3RXUA 1BHXF 1NRQH 3L3TA 4TWYA 3ATLA 4DW2U 2BQWB 2Z3DA 1MMJN 3BN9A 3LGVA 5DO4H 4DJZB 1CBWC 4FUEA 3SUGA 2F43B 1GBDA 3PO1B 5EJLA 3S7KB 4DT7B 3SV2H 2BZAA 2PKAB 3SQEE 2P93A 4SGBE 1C4V2 1K22H 1LHDH 2R3YA 4NIYA 2HVXA 4X6PA 3A7XA 2CK3D 4AFQA 2ZPQA 4Q63A 1ZSJA 3KL6A 3Q76A 1TNHA 2YNAA 3MH6A 2GKVE 3U69H 1XXFA 1S0RA 2ZU5A 4AG1A 1E36B 3NPSA 1ELCA 3SHCH 1GMHF 2D8WA 3RXSA 1A5HA 3S9BA 4X2WA 8KME2 3RM2H 1ID5H 4XD7D 2Z6BD 1K1PA 3N7OA 3RMMH 3F0PA 2ZHEH 1TBQH 1V2TT 1O2TA 2QV1A 1O3KA 3KN2A 2ZEBA 3MU1A 2H5DA 4VGCB 2XW9A 2Q6DA 1NFXA 4X1QU 1K1IA 3LJJA 3LT3A 4X1NU 1MAXA 2I6QA 2QF3A 1NRRH 1TNLA 1O2LA 2Z9LA 4ZHLU 3FZZA 2A5KA 1O3AA 2FIRH 2VVCA 1P2NA 1BQYA 2OUAA 3SNBA 3SNDA 2C3SA 1J9CH 1UVTH 1L1GA 3NKKA 3P8NA 3BSQA 3DCLA 3M3SA 3PROA 1EPTB 2WPMS 4DCDA 1Z8JB 2UUFB 3PMBB 3M5OA 3UNSA 2XCNA 2H2ZA 3PWCA 2ZP0H 5T6FA 1XUGA 2VB0A 4NA9H 4CHAC 1ZHRA 5JBCS 3VGCC 3RXTA 4I86A 3S69A 3U8TH 1A0HB 1XUHA 3RXJA 3T25A 2WPIS 2BVXH 5DG6A 2TBSA 4NFFA 1SVPA 2ZZUH 3F9FA 1GBIA 3FN8A 2SGQE 3SU1A 1W12U 5DP5A 3PV4A 3RU4E 2A7CA 4YOGA 4ASUD 1C5RA 3KIDU 4ABHA 4LOYH 1ELTA 1MCTA 1DM4B 3A83A 2OD3B 2WZQA 4O97A 5KECA 3A8DA 1W3CA 1MTVA 3EA8A 4AOQA 2UUYA 1C1PA 1P2MA 3E90B 1C2LA 1ELEE 1EOJA 3ZZ3A 1C1SA 3MU5A 4XBDA 4E7RG 8GCHF 2UUKB 3C1KA 1P2IA 4CRFA 4ESTE 5FX6A 3LC5A 5DKMA 1RTLA 5A0BA 1MBMA 2YOLA 1C5UA 1OYQA 3FZDA 1VITF 3LGUA 2Y7XA 3ZVGA 5F8TA 6ESTA 1JMOH 1IQIA 4YOIA 1SC8U 2P16A 3UUZA 1MKWK 2G51A 3BTGE 1HJ9A 3P92A 1CVWH 2WUCA 3M5MA 3AW0A 1NY22 2XBVA 1TFXA 1RFNA 2V0BA 2QYIA 4WH8A 1EJAA 4YESB 1H8ED 1Z7KA 2HALA 1CHOG 3A8AA 1JOUB 1YCPK 3URCA 2ZF0H 3LOXA 2TGAA 1TOCB 3HGPA 1QY6A 3A7YA 1K0HA 1AUTC 1V3XA 1ZHPA 2J4IA 5DJ7A 4U30A 4AGKA 3FP7E 1DS2E 2HRVA 2HPPH 4K1EA 1EX3A 1V2UT 1FXYA 4A6LA 3TJVA 5DP7A 1HYLA 2PWXA 1H9LB 1BRAA 1HAHH 3D62A 3RUOA 1O2XA 3A85A 4B2BA
chains in the Genus database with same CATH topology
1O2PA 2VINA 5JPMH 1RGQA 1BZXE 2BY8X 4FUIA 1BJUA 3DD2H 2C93B 5I46H 2FTLE 2ZFSA 3ATMA 1F5RA 3UY9A 1FPCH 5PTPA 2W7UA 4B1TA 2NU3E 1O31A 4Y8XA 2I6SA 1CA8B 4RSPA 2G81E 1QA0A 3GYMA 4YOJA 1SGDE 5FCRA 1BJVA 2GD4B 3QZQA 2AFQB 3S7HB 1OSSA 1FY8E 1ARCA 2VVUA 1V2ST 4OS1A 1LMWB 1XM1A 4I33A 3Q77A 1C5PA 3KQEA 4E06H 4X6NA 4YT6H 1W2KH 1MUEB 4FUJA 3UOPA 1E34B 1OWJA 1GJAB 3E16B 1SQTA 2WYGA 1C5YB 3H7TA 1WTGH 4NA7A 1HJAB 2ALVA 4Y10E 3M3TA 3U1JB 2F9NA 4MG3A 1Z6EA 1AWHB 1QRWA 1GBTA 1GBHA 1FMGA 2BDAA 1DY9A 1SGYE 3C27B 2ZQ1A 1ELBA 1LO6A 1XUKA 1SPJA 1O37A 2WUBA 4CBNA 1V2JT 1E38B 1O32A 1EAUA 1O5EH 1YLCA 4MDSA 1SB1H 1TQ0B 2QY0B 2OQ5A 4NIVA 2A7JA 1N8OC 1SR5C 3SN8A 1RIWB 8LPRA 2ZCLP 4Q80A 4TY6A 1JRSA 2ZFRH 3SJ8A 1P10A 1O34A 5FPTA 3ZVDA 1AB9C 1LTOA 1TX8A 1SOZA 2XC0A 5GDSH 2FS8A 4WXVA 5L30H 4HGCA 5C67A 2W3IA 2ZQ2A 4O3TA 1P2KA 1AUJA 1CHGA 1MTWA 1QNJA 3KQDA 1PQAA 4Y6DA 2PSYA 1GBKA 3A7WA 4LZ4B 1H9HE 1UCYK 3TGKE 1O33A 2OC0A 1K1LA 1SGFG 1C1VH 3S0NA 1G3EA 1H8IH 1TWXB 4XBBA 5DK1A 1GMCG 1EKBB 2PW8H 1K1MA 3A87A 3Q00A 1DX5M 4XE4A 5FPSA 1KXAA 3BTME 1SLXB 1KDQA 1GCTB 3MNBA 5JB9S 1SHYA 2OC1A 2BHGA 5C3NA 4BAQB 1UHBA 4GSOA 2OLGA 1OWEA 2BXTH 4WMEA 2ZU1A 1CA0C 1HXEH 4K1SA 2FPZA 2C4FH 3QWCH 1WUNH 3KF2A 3B23B 4ZHAA 3UQVA 1PJPA 2GV6A 4I31A 1L2EA 2EA3A 1GJ5H 2V3HH 2LPRA 4LK4A 5DP8A 1LPGB 1BTWA 2A31A 1FAKH 3LH1A 1QJ7B 1GI3A 2R9PA 1NTPA 1MKXK 1O5AB 5GCHG 3VEQB 4D9QA 3LGYA 4FU8A 4RKJB 2WV4A 4BTIB 4X8UH 2FOBA 1GBBA 2ZO3H 1QBNA 1IHSH 2C90B 1H8DH 2LNCA 1DFPA 3D49H 1Z1JA 4JZIA 2GDEH 1C1UH 3MNSA 5F6MA 3KGPA 5JBAS 3VPKA 4WMDA 4K8BA 2FOFA 4ISHH 3ZZ8A 4GHTA 1YKTA 2PTNA 2VGCB 1P3CA 3AVZA 1OXGA 2EI7A 1O2KA 3F9HA 1PPGE 1V2NT 3T27A 1A3EH 1P09A 4ZH8A 1DOJA 2ZFQH 3T26A 1YC0A 1F2SE 2BX4A 2J94A 1YP9A 3SU4A 1GHVH 1EJMA 3D65E 1TPPA 2F3CE 5EXLA 2A4OA 3I77A 5L2ZH 1ZR0A 1HAVB 2BY7X 1TGTA 5C20A 1PPFE 5EPNA 4BAHB 1Q31A 3GY4A 2ANMH 2GX4A 3GCTF 2VWNA 4NGAH 3A7ZA 3RMNH 4A7IB 1NPMA 3UNQA 3ELAH 3KCGH 1AY6H 4ABGA 1DT2A 1NFYA 3UWJH 4F49A 2FTMA 1K1JA 5LGOA 2ZHFH 1M9UA 1AHTH 1AKSA 1GBLA 1L1NA 1C5OH 2ZTYA 3KEEA 2VVVA 3CS0A 3M5LA 2ZDLA 1Y5UT 3SJOA 3ZVCA 2ESTE 1QB1A 4GCHG 5FX5A 1O0DH 2P3UB 3R0FA 1AZ8A 1G36A 3A86A 3RC6A 5E2OA 3TITA 5BRRE 1IAUA 1FN6A 1GPZA 4MPUA 3SU6A 3HATH 1C4U2 1Y3WA 1UTPA 5A0AE 2ALPA 1F92A 2Q1JA 3TJOA 2P8OC 2JH5D 3B9FH 3P95A 5TCCA 1BT7A 2BLQA 4MPXA 2OINA 2P3FH 1TA6A 1V2LT 4MTBA 5L6NH 1QBVH 1NS3A 2B7DH 3TH2H 3TVJB 6LPRA 1EZXC 4I7YH 1TMBH 2VWLA 1O2MA 2A0QB 1GWAA 2VIOA 1GHXH 2BDIA 1TNIA 2ZFPH 1P9SA 1VJAU 4ABFA 3TK5A 1BHXB 2DE9A 3E8LA 1JRTA 1BTYA 2BYAX 3RC4A 4KP0A 5GWZA 4WF8A 3JZ1B 2HWLB 4A1TA 6GCHF 1GL1A 2PKAA 3PB1E 2XXLA 2ZWLH 2G8TA 4JZFH 1DWEH 5A8YA 1GG6B 2ZPRA 4H6SB 3FVFB 4UFGH 1OOKB 4IC6A 2CN0H 3BTDE 1ZGIA 3EQ0H 2QXIA 5FCKA 4YTAA 2G4TA 5LPFA 2TGPZ 2K1QA 1ACBE 2R2WU 4ZKOU 1FDPA 2KAIB 1NRSH 2AEIH 2CF9H 4BAOB 1KIGH 4U2WA 3SHAH 1L4ZA 3M7TA 5DP3A 3SJKA 3ZVFA 3GY6A 3MYWA 1D9IA 2O8UA 3MU8A 1UTOA 1T4VH 3TK6A 5TJXA 3RXDA 2Z7FE 2SFAA 2BVSH 4KKDA 3BF6H 3MU0A 2A45B 2G52A 3V0XA 2ZCKP 1QBOA 3RXFA 2GTBA 1WQSA 1KTTB 1MBQA 3TNSA 1SQOA 2ZA5A 1P9UA 1FZZA 3GCHC 1N6YA 1EPTA 2O9QA 1DY8A 1NN6A 1IQEA 1WSSH 4WWYA 1DDJA 2PGBB 1KXEA 5DGJA 1AVWA 1HIAB 1LVBA 2CGAA 1L1JA 1YF4A 3G01A 1HBTH 1UCYE 3IG6B 2H1UA 1J16A 3SUDA 4HTCH 4UD9H 5A0CA 2FODA 1C2MA 1GVKB 1QTFA 4X0WU 1D3PB 2JH6D 1UK3A 1XKAC 2AH4X 1UVOA 1PYTC 3ZZAA 4AFUA 1TA2A 3ATKA 1OPHB 1MTNC 4JK5A 1BDAA 1V2MT 2VU8E 2QGRA 4Y11E 1LKAA 1DLKB 1MQ6A 1O5FH 4NZQA 1CT4E 2ZTXA 5EXMA 1UTMA 3SO3A 1DANH 1YPJH 5AHGH 2AMDA 3SNAA 1QB6A 3W95A 4THNH 1HXFH 4INHA 2FYQA 4H42U 1DPOA 4O9VA 3QZRA 1ZRBA 1LHFH 3TIUA 5T3HA 3M36A 1GJ4H 1VCPA 1TYNA 4WXIA 1UTNA 1P06A 1GHZA 5AFYH 4X1PU 4TY7A 2WPHS 1FNIA 1F0TA 1TRMA 1EUFA 5GPIB 7GCHG 1YPMH 2D2DA 1O30A 1L0ZA 1EOLA 1O3IA 2AGGX 2AMPA 4ABIA 1V2RT 1ZSLA 1YPHC 2Y5HA 1DWDH 2ULLA 2UWPA 2BD8A 1C5MD 2HNTF 2ZFFH 4DIIH 1F0RA 4XFQA 4NSYA 1W8BH 1NC6A 4ISNA 2SNVA 4AG2A 2FX6A 1EB1H 5ESTE 1NROH 3PYHA 4X6MA 3NWUA 4I8GA 1QJ1B 3SJ9A 1O2JA 3T29A 2V35A 2P94A 1ESTA 4MPVA 2FYRA 1LVYA 5I25A 1C2KA 1C5ZB 1XX9A 4Y7BA 4FXGH 2WV5A 3SU2A 2TRMA 2Y5FA 1D4PB 3O8DA 4UE7H 1DSUA 1K28D 2GT7A 4XOJA 1LQDB 3PMJA 3SW2B 1CHOF 1TGCA 1WAYB 3PMAB 1MD8A 1QB9A 2ODYB 3QGJA 3QTOH 1ETRH 2W3KA 3UOUA 1ETSH 2NWNA 1EZQA 4GUXA 1HRTH 1QIXB 3UR6A 1MH0A 2GMTC 2AGIX 1CE5A 4E05H 2CHAC 1GBMA 3QDZB 1SLWB 1BBRK 2FM2A 4KGAA 4FVDA 3P70B 3VB5A 1HAOH 1MZDA 3W94A 2F9UA 2Z3CA 2GZ7A 1W14U 2GCTC 2EEKA 1P0SH 1O3LA 1AFQC 1HAIH 4JYUH 1BB0B 1XUFA 2BB4A 1O2QA 1TRNA 2XBWA 3ZZ9A 1ABJH 5CHAB 4Y71A 4CR9A 1J17T 3EE0B 2ODQA 3DT0H 4AN7A 4AYVB 2BD2A 2PSXA 3VXEH 1CBWB 1TB6H 2A4RA 1P3EA 1J15A 3A8BA 3FP6E 4UFEH 3UQOA 1WCZA 3E0PB 1B5GH 1BTHH 1DVAH 1G3CA 2FX4A 1F7ZA 1GJ7B 4BOHA 1SFIA 4D7FA 2ODPA 3LGWA 2ASUB 1A0JA 1TMUH 1UTJA 2QIQA 1GBEA 1TQ7B 3V12A 1GI8B 1O2WA 3ESTA 1OYTH 4JZ1A 3F9GA 4ASHA 1ZOMA 2F9BH 5DPAA 2H9TH 3FFGA 1MD7A 2STAE 2XTTB 2F83A 4CRCA 3SV6A 1GI2A 1GJBB 3L33A 3K9XB 1T8MA 1CT0E 1YPGH 3LH3A 1WQVH 1EP6A 1K21H 3GICB 5K0HA 2QN5T 2XNIA 1ZTLA 5JYIA 4AB8A 5E0JA 1OP2A 2F9VA 1U6QA 5FHTA 3UIRA 1QURH 3H7OA 1O3EA 1O3JA 2FI3E 4Q7ZA 1C2HA 1Y8TA 2OBOA 1AU8A 1ZHMA 1KXDA 1QFKH 4ABEA 2JETC 4TWWA 1D6WA 4ABAA 1MU6B 3ODFA 1YBWA 1C2EA 1P02A 4ISLA 1K1OA 2CV3A 2FOCA 1SGQE 1EZUC 1SLVB 4IN1A 4CHAB 4DG4A 1FAXA 1E0FD 2VH6A 3VGCB 2HGTH 2M5TA 4UEHH 2BY5X 4AFSA 2QA9E 9ESTA 1TOMH 3BEFB 3SU0A 1BOQA 2BLVA 3LPRA 1B0FA 2ZKSA 3IWMA 1W0YH 1A2CH 2R0KA 1LKBA 3LONA 1RS0A 1FLEE 2D26C 1ELGA 1NT1A 2PUXB 3QGNB 1GMCF 1Z8RA 3A81A 5K7RA 2F9OA 4ZXXH 3P8GA 5F8ZA 2A1DB 3BG4B 2XWAA 2JKHA 3PTNA 5C5NA 1ZRKA 2OCVB 4YT7H 1BCUH 2ILNA 3EYDA 1O3CA 1C5VA 2ZHDA 1IQLA 1DE7H 5EU8A 3ATIA 3RXVA 3V3MA 2D1JA 3MHWU 1BRCE 1ZMNA 7ESTE 1ELFA 4KTUA 2SGEE 3DA9B 1GBCA 1HPGA 1G3DA 1C5QA 1TABE 3DUXH 1PQ8A 5GCHF 4B74A 1BTUA 5T6GA 2Z94A 1WTHD 2TGTA 3A80A 2ANYA 3RLYH 1P8VC 1HLTH 1C1OA 2ZPSA 1HAVA 4CRGA 5EODA 1DXPA 1HNEE 2GCHF 2YNBA 3GY7A 5H4IB 5IYTA 1O3PB 1MU8B 1THPB 1AO5A 3RXHA 4AYYB 5JDUB 4YLQH 1PPZA 2GGVB 1G9IE 3A7TA 1ANBA 2ZU4A 3BG8A 5GIBA 1GVLA 3SNEA 2VWMA 3SUFA 2J92A 1V2PT 3RMOH 1O3NA 1L4DA 1NRPH 3RDZA 2VIDA 3QX5H 1EQ9A 4XBCA 3A84A 1ESAA 1KXFA 3M37A 1KLTA 4E7NA 2A5AA 4NG9H 1QR3E 5HGGA 2BY6X 3AW1A 1SQAA 1GHAF 2GP9B 2VGCC 1SGRE 1QL7A 2HLCA 2ZFTA 4OS7A 4YZUA 2B9LA 1QGFA 1AE8H 3A89A 4TYDA 4QT8C 1C5XB 4ABJA 3DFLA 4IBLH 4X1SU 1NZQH 5EPYA 3TH3H 4OS4A 2WYJA 3TK9A 2FDAA 2O8TA 3NZIA 1C4Y2 1QQUA 1HUTH 1GDNA 4K3JA 2GT8A 3ZZ4A 1D3DB 3BTQE 2RA3A 3RXOA 1AZZA 1T32A 3LGTA 2OXSA 3PWBA 1Y3VA 4JYVH 1GMDG 1Y3UA 4BXSA 2AIQA 1XUIA 1V2KT 1EAXA 1V6DA 3RXRA 1VGCC 1FY5A 2ANWA 3PMHB 3GDVA 1KY9A 4MNVA 1ZPCA 2RDLA 1A1RA 5HM2A 1DITH 2PKSC 4GPGA 3OTJE 2CXVA 2JH0D 2O8MA 2WPLS 2SGFE 3MH4A 1YCPH 2H5CA 1P01A 3P6ZB 3TLOA 4TPYA 2A4QA 2ZDKA 2SNWA 1CT2E 3OYPA 3EDXB 4K5ZA 1BBRE 5TCAA 1NFWA 1Y59T 3ATWA 4CREA 1N8OB 4Q7YA 3LC3A 1BMAA 3LGIA 3MO6A 2QF0A 2BDYA 3UR9A 1BRUP 1ZSKA 3K65B 1T7CA 1VCWA 3OX7U 2XWBI 3A82A 1W0ZU 4GVUA 5CE1A 1AB9B 4IMZA 4CBOA 1EZSC 1VR1H 1JXPA 3AAVA 3U1IB 3MI4A 1B0EA 1T8NA 2F9PA 2KAIA 4FUBA 3RXIA 1AIXH 1UMAH 1AE5A 1IQKA 1ANCA 2ZI2H 2ZGXH 2AGEX 3SGAE 1O3BA 1ZGVA 1FIZA 1H4WA 1O5BB 1AVGH 4ABDA 5GXPA 1FI8A 4D76A 3CP7A 2C8YB 1GGDC 2C8XB 2A4GA 2OTVA 2IOTA 2BMGB 2GV7A 1P2OA 1A5IA 3M5NA 5C5OA 4Z0KA 1Z71A 3T28A 1C1RA 4INKA 1CA0B 2BQ6B 2XC5A 1C1NA 3VB7A 4RKOB 3UWIA 3F1SB 1D3TB 1UVUH 3HKJB 1KXBA 3MWIU 3OSYA 1TIOA 3BTKE 2GVFA 1P05A 1HIAA 1DICA 1UK4A 3STIA 3O8RA 6CHAC 1MZAA 4UFFH 2AYWA 1CO7E 3VXFH 3BV9B 4FU9A 1GG6C 3SJIA 2PGQB 2FOHA 3MH7A 1X7AC 4HI3A 5T6DA 1AFEH 1NRNH 3HPTB 4X8VH 1ELDE 1XVOA 1JIMA 1ZTJA 1YM0A 4OGYA 2FOGA 1UVPA 2BD4A 3SU5A 1MCVA 3E3TA 3U98H 1KLIH 5B6OA 2Y82A 4K2YA 4UDWH 3OY6U 4ZAEA 1AGJA 1BTXA 3RXGA 1SBWA 2ZHWH 1O2GH 3PTBA 1SSXA 2PLXA 5DP6A 3RU4T 4AFZA 4B73A 4B71A 3SV9A 1TGSZ 2BD3A 2ZNKH 2R0LA 9LPRA 1AMHA 2H6MA 2FZZA 5C2ZA 1S85A 1DLEA 4FUDA 1IHTH 1UCYH 2SGAA 3ZZCA 1IQGA 1G30B 1NU9A 3QTVH 3A8CA 5E0HA 4JK6A 2R2MB 2HPQH 1TBRH 3KQCA 1FN8A 1F0UA 1O35A 1UK2A 4Q7XA 3ZV9A