1C2MA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2mA02
4PROA 2ILNA 1TABE 4XBDA 1GDQA 1HAGE 1S5SA 2OUAA 1AIXH 2UWLA 1WSSH 2O8WA 1HAHH 2ZDKA 2ESTE 3ZVCA 1W2KH 4UD9H 1KXFA 5FX6A 3FAOA 5HM2A 1H8IH 1GJ6A 1V6DA 1ZSKA 1AO5A 1O5CB 4NA8A 3RXSA 2XCFA 1TMBH 1OSSA 1SR5C 1GJ8B 2PW8H 3LKWA 2W7SA 2XRCA 1BT7A 4BAQB 2FODA 1XX9A 2ZGHA 1TMUH 3ELAH 1LPGB 4E7RG 3NXPA 1EB2A 5E0JA 3H5CB 3P92A 3A7WA 1PPFE 1EB1H 3GISB 1WQVH 1IQEA 5C1XA 1O36A 1QGFA 3PWBA 5LPEA 2C8XB 1L1NA 3BIVH 4JYVH 3ZZBA 3GOVB 3M5LA 3ZVGA 1K22H 2C93B 5F6MA 1JXPA 1ETTH 3LC5A 4MQAA 2O8LA 1JRSA 1CBWC 2BDAA 3A89A 1SGDE 1DY9A 2SGPE 1KLTA 1YCPH 2STAE 4XSKU 1A0LA 4K5ZA 3A7TA 2BZAA 3BTFE 4MPVA 6GCHG 3A83A 3ESTA 2Y7XA 2STBE 1GMDF 2P16A 3K9XB 3QTOH 4Y7AA 1HJAC 4E7NA 2QN5T 1LHCH 3QZRA 1HAIH 1LDTT 3UY9A 2A4OA 3NWUA 1ANDA 2C8WB 2GVFA 1MQ6A 4Q80A 4KP0A 5EQRA 3GY8A 1BTXA 1P9SA 2QXJA 3B9FH 4H6SB 5FBEA 4TPIZ 3ZZ5A 1XUIA 5E0HA 1FIWA 3M7TA 1XKBC 3GCOA 3K6ZA 3SQHE 1C2IA 4WVPE 2OXSA 1VGCC 4CR5A 7KMEH 1MMJN 3BTQE 3E1XB 4AFZA 5JB9S 1HGTH 2QF0A 1TOCB 1AHTH 1TMTH 3RXRA 3ZZ6A 1P9UA 3P8NA 1GBFA 3C1KA 1MTNB 1FIZA 4ZKOU 4IW4E 1IQHA 4JCNA 1LO6A 3V0XA 2UUYA 2LNCA 4MPXA 3EDXB 3KQEA 4AYYB 3MU0A 3QGNB 1O3LA 2G5NA 1LHEH 1OP8A 2PGQB 4O3TA 3N7OA 4XOJA 5EXLA 4I8JA 1XXFA 1V2QT 1O2HA 1HIAA 2VIVA 1THSH 2ZQ1A 4MTBA 1H4WA 1C5WB 3A8DA 3RXHA 1HXEH 2G00A 1C5MD 4BXSA 1NRSH 1B0EA 3UIRA 4YOJA 3F9HA 3RUOA 1O3GA 5T6FA 2VVVA 3SI4H 1BTZA 1D6RA 3ZZ3A 2KAIB 3AVZA 3Q3YA 2ASUB 4AG1A 1W0YH 1GL0E 2SNWA 3E16B 4JZIA 2EC9H 3HGNA 1C5LH 1O2SA 1HCGA 1ELDE 2LPRA 1EAXA 1Z8GA 4O3UA 4NSVA 2C8YB 1ZHMA 1FLEE 1T7CA 2AH4X 3O8CA 3M5MA 2D1JA 1SVPA 4B76A 2ZDAH 2R2WU 1BTWA 2JETB 1UTJA 3PMJA 2A7JA 1Z7KA 4X1PU 2HWLB 2FP7B 4AFSA 1T4UH 4HI3A 1QRWA 4AFQA 2VIPA 2Z3CA 2AMDA 2WV4A 2Z3DA 1VR1H 3A7XA 1O2ZA 4Z6AH 3DFJA 5E8EH 4O97A 2VIWA 3U8TH 3FP6E 4FU7A 1FN8A 2ODPA 2EI8A 4A7IB 1O2VA 1IQNA 2Z6BD 3E6PH 5DP9A 4B75A 5FCRA 1PPEE 4NIWA 1BB0B 3STIA 1QHRB 3D23A 3LGTA 2Y7ZA 1TGNA 2GT8A 4MLFB 3U69H 3LONA 1AGJA 1AY6H 4CRDA 1GGDB 5I46H 2BY8X 3S7HB 2BD2A 1A5GH 1MQ5A 4YT6H 1ANEA 4B73A 3BN9A 4BNRA 1DICA 1P0SH 2GMTB 3SU6A 1C9PA 1NU9A 1C2GA 3RMNH 4NG9H 2K1QA 4BAKB 2OP9A 3P17H 3UR6A 1C5VA 1SGYE 1EP5A 3PLPA 3U9AH 2H1UA 1ZJDA 1AD8H 1L0ZA 1P09A 3MO6A 3MNSA 1YLCA 5K0HA 1C1TA 5F8TA 4ABDA 2AS9A 1SGEE 3D49H 1QTFA 3A7ZA 1RTLA 1J16A 3RMLH 5JYIA 2TPIZ 5C2ZA 2BOHB 3F1SB 3RXGA 4B2AA 1TPPA 3FZZA 4IN1A 2C4FH 2BOKA 1C2MA 3MU5A 4Q2KA 1QR3E 1IQIA 2A31A 2BY6X 2TGPZ 4WH6A 2AMPA 4LOYH 2F9VA 2ODYB 1FY4A 2B7DH 1J17T 1SQAA 3MWIU 1P06A 3O8DA 2FOEA 4IMQA 5ESBA 2R0LA 1K1LA 1NM6A 2JH5D 1ZZZA 1MTVA 1K28D 4OS4A 5T6DA 2ZIQH 1EOJA 3A7YA 1CQQA 4X8TH 3L3TA 3H7TA 1CGIE 2IN2A 1FQ3A 1O3MA 1O33A 4KKDA 1M9UA 1GJAB 1O3OA 1SMFE 1GJCB 3RP2A 3RLYH 3PV4A 1EOLA 5DP8A 2GZ7A 3GCHC 4INHA 1A2CH 3A8BA 3F9FA 3U1IB 4U2WA 3GCTF 1GI7B 2C3SA 1ORFA 1TGTA 1YF4A 1GBMA 1G3CA 1QIXB 1EZSC 4A1VA 1MTNC 5EQSA 2A7HA 3RXIA 2HNTE 5CHAB 1O34A 3SNEA 4I32A 1AFQB 1DITH 1TWXB 2FYQA 2XYAA 4A5TS 1O2PA 3RM0H 2ZHFH 1NTPA 4BTIB 3UPEA 1UMAH 2XBVA 1K2I1 2OD3B 1JIMA 1C4U2 2PLXA 2WV5A 5A09A 1O2LA 1O3IA 1P04A 4Y0YE 4K69A 1FAXA 1QA0A 3UUZA 3SN8A 2ZPSA 5CE1A 1SQOA 2GX4A 2CV3A 5F8XA 4KTUA 3M3SA 2QV1A 2D8WA 1B5GH 1QQUA 4DY7B 1HAXB 4AN7A 2XBWA 1WTHD 4OS5A 3TGKE 1W8BH 1C1NA 5EPNA 1W13U 1GI5A 2OC0A 2FOHA 2P95A 4ABHA 2AERH 4OS2A 3VB4A 3R3GB 1ZRBA 3GY3A 3RXMA 1T8OA 1G3EA 5DP6A 1VJ9U 2BDGA 1THRH 2BYAX 2KAIA 3BV9B 1Y3VA 5L6NH 3CENA 2BLWA 2JETC 2A45B 1BMAA 3KQBA 1BTHH 1LVMA 1ELCA 3P70B 4KTSA 3BTME 4X1RU 2TIOA 3A8CA 3RC4A 1ZOMA 1TNLA 2PFEA 1P8VC 4UFDH 4D9RA 3M7UA 2ALVA 1Y3YA 1GJ5H 3GDVA 4JZ1A 4CBOA 1ID5H 1SGFG 1TQ7B 1BUIA 4K8YA 2J92A 1PPZA 1O3FA 1V2VT 4FUJA 3T29A 2O8TA 1DXWA 3GY4A 4DOQA 3RXCA 3C27B 2B5TB 2NU3E 4MG3A 1GVZA 2AYWA 2OINA 2ODQA 2SGAA 3OYPA 3RXOA 3T62A 1F0SA 1G36A 2FEQH 3RMMH 1LMWB 2P94A 1EJMA 1GGDC 1CA8B 1GI6A 1GDNA 1O5GH 2D2DA 2J2UA 4UFGH 5ABWA 3Q77A 1AKSB 5DGJA 4MNWA 1UVSH 1VCQA 3K6YA 1BHXF 2QXIA 5C1YA 1BJVA 1O2IA 4WJG2 1HB0B 2Y6TA 4Y8XA 4JZFH 5EXNA 1RRKA 1GBIA 1BZXE 2FOBA 1EKBB 3AASA 3SORA 1DM4B 2BX3A 1C5QA 5ETXA 3RXBA 2A32A 1DANH 3RLWH 5JB8S 1PPHE 1ELTA 3EE0B 1DX5M 5LPFA 3BTKE 2ANWA 3RXTA 1RXPA 4CRCA 2V3HH 1BRAA 1NPMA 3RMOH 1ESTA 3FP8E 3IWMA 5AFZH 1TX6A 1H9IE 3EA7A 3M3VA 3EAJA 1WCZA 2IJOB 2PTNA 3PO1B 3GCTG 3S7KB 2QC2A 2ZTYA 1CHGA 1GBDA 1GBTA 2AGEX 4CH2B 2NU1E 4K60A 1MU6B 3U8RH 1O3DA 1C5YB 4O9VA 3RU4T 3LT3A 1O2WA 4ZAEA 3TK6A 2TBSA 1DLKB 1DDJA 1ESBA 3A86A 4QT8C 1WUNH 1FY3A 2BLQA 2FLBH 2RA0A 1GHYH 4UFFH 3EA8A 3BG8A 1SSXA 1P05A 1Z8RA 3ATIA 2QF3A 2JH0D 3PB1E 2WYJA 2ZGXH 2SNVA 4GSOA 1BOQA 2QXGA 1GCTB 1W12U 1U6QA 3SBKA 3TGJE 1OWEA 4NWKA 3Q76A 1C5OH 1E35B 2BD3A 3ATMA 1RIWC 2J4IA 4ESTE 3TPIZ 1XUGA 3T28A 3TNSA 3ITIA 1UVPA 1MUEB 1O3CA 2W7UA 2ANKH 3I78A 4F49A 3A8AA 1KLJH 3PTNA 3MH7A 3P8OA 1C2JA 4TWYA 1D3TB 2SGEE 3AW1A 2J94A 3IG6B 1SI5H 1XMNB 1N6XA 2BTCE 3M3TA 2ZO3H 5CHAC 2GTBA 4ISOA 1O2UA 1D3QB 1DUAA 1Z1JA 1S84A 1AFQC 1WYKA 6ESTA 2VU8E 1C2HA 1A5HA 3TJVA 4WH8A 1ZMLA 2ANYA 2FIRH 2XXLA 4ASHA 4AX9H 4NFFA 4J2YB 2WUCA 4AGKA 1TBZH 4IC6A 3OY6U 2PSYA 7GCHF 2BD5A 3MOCA 1AB9C 4X2WA 4FU9A 1ZSJA 2BMGB 1V2UT 2CMYA 3NKKA 1LKAA 3RXVA 1OKXA 2O8MA 1GHBG 3KQDA 2ZECA 3TVJB 1MKWH 1MTWA 3QO6A 1C2EA 1G3BA 1K1JA 3MO3A 3VB3A 2GT7A 4WXVA 4Y7BA 2R3UA 1TPOA 4GHQA 1SLXB 2A2QH 2EI7A 1L4ZA 1IQFA 1WTGH 1IQJA 4RSPA 5EODA 4BANB 1XUHA 1EAIA 1TPSA 3K2UA 1K9OE 2W3IA 2PKSB 3TNTA 3KHVA 1VITF 4WWYA 1Y3XA 1OP2A 4M7GA 1C5NH 1K1NA 3BTDE 3P6ZB 5HYOA 1KXAA 2TGAA 1FDPA 3A82A 3MH6A 4ISLA 1MTUA 3UQVA 5JBAS 3I77A 5HXFA 1V2PT 2AGIX 1DT2A 2GV6A 2PWXA 1OWJA 1SFIA 1BMNH 1DS2E 1O5DH 4I31A 2V3OH 2ZGCA 1OP0A 1GBBA 1GHAG 1MD7A 1Y8TA 1TX8A 1ZSLA 1A7SA 2J38A 4CHAC 2G52A 5T6GA 5C3NA 1GDUA 5J4SA 3SV9A 1EPTB 1YP9A 2P3TB 5B6OA 5F03A 1ANCA 4K1EA 2P3FH 2FM2A 4ABBA 5IDKA 2FOAA 1NRRH 4DURA 2BY5X 2GCHF 2M5TA 2W3KA 1MZAA 2BXTH 2ZFTA 2CF8H 4Y76A 4ABJA 3SHCH 4GPGA 5GWZA 1DWEH 4KTCA 1TRNA 4ABIA 4THNH 1O2NA 4AB9A 2HLCA 3A85A 5SGAE 4XBCA 4AGJA 1PQ8A 2SGFE 1KXDA 3NK8A 2UUKB 1G30B 2XC4A 4A92A 1FNIA 3TJNA 5TCCA 1T8NA 1LHDH 1O2OA 1AKSA 3PLBA 4YLUA 1QFKH 1TONA 4WF8A 3GY5A 1AFEH 3NUMA 4RN6A 1QJ1B 1LPKB 3E0NB 2QIQA 1NT1A 2BY9X 1HXFH 1A0HB 2BB4A 4YLQH 8LPRA 1V2KT 1MKWK 1D6WA 4H6TA 3MH5A 2NU0E 2HALA 4NCYA 2AMQA 1H9HE 1CSOE 1EP6A 5GDSH 1UCYH 4WMDA 1TE0A 5PTPA 1E38B 1F2SE 2YOLA 3OSYA 3K65B 1V2JT 4INLA 2HPQH 1EZQA 2Q6DA 2XWAA 2G51A 1O31A 1C5PA 1UTMA 3A88A 1HPGA 3T26A 3UOPA 5GXPA 4R0IA 7GCHG 1F0UA 1TA2A 1TRYA 1JIRA 1FZZA 2ZA5A 3MU8A 2ZI2H 1BJUA 1W7XH 3RU4D 3SU5A 2BY7X 2ZQ2A 1D4PB 4I8KA 1W0ZU 1DLEA 1GCTC 4NIYA 1V2OT 1O2MA 1EX3A 1YCPK 2FTLE 2ZHWH 3M61U 2FX6A 1JOUB 4FVDA 1K1MA 4CBNA 2G4TA 1UTKA 2Y81A 2BDIA 3BTTE 3LOXA 1YPJH 3R0FA 4ZHAA 3VB7A 1F7ZA 5A2MH 1GVKB 4BAHB 2SGQE 1CA0B 4D7GA 2VIQA 4X8VH 1O3EA 2RCEA 1XUFA 2DE8A 1ZJKA 1VITG 2ZFQH 3DFLA 3OX7U 4BTTB 1NN6A 6LPRA 4DIIH 1GJ7B 1KDQB 2GDDA 5A8YA 2AGGX 3S9CA 1FY1A 4BTUB 1CT4E 1G3DA 8GCHG 4MDSA 2ZU2A 4YM9A 2AEIH 1C2FA 4ISHH 4YOGA 1PYTC 2FWWA 5BPEA 1SGIB 3U1JB 1P57B 2EA3A 1WQSA 4OS6A 1SLUB 3BF6H 4Y8YA 5IYTA 1HAPH 4GUXA 3OTJE 3AAVA 1F5RA 3MO9A 3ZYEA 2WYGA 3ZZDA 2HNTC 2PHBA 3TIUA 2UWOA 2F9OA 3TH2H 2B8OH 4J1YA 3RXFA 2A7CA 1BMMH 2FDAA 5LGOA 2FPZA 2AFQB 1PYTD 3TLOA 1ELBA 1O30A 2QCYA 3T25A 1X7AC 1Q3XA 5E0GA 3M36A 2GCHG 4MVNA 3ZVEA 2TGDA 1SOZA 3QUMP 1BITA 2H9TH 2VIOA 1SGPE 1QL7A 2A1DB 2PKSC 3GDSA 1C5SA 4FUDA 2WINI 5JDUB 4Z0KA 5CMXH 2BLOA 4BAMB 2GGVB 1SGTA 1NRNH 1O3AA 4U30A 3SJIA 4TYDA 3F6UH 1D3DB 1ANBA 1SGNE 2OBQA 2AIQA 2OQUA 4B74A 1QB6A 2SFAA 1ELEE 1W7GH 1K1IA 3SU2A 4X8UH 3KGPA 1GI2A 4WMEA 2XBYA 5DP4A 5ESTE 2BQ6B 1C1QA 1MAYA 3CS0A 4NA7A 2F83A 4MPWA 2H6MA 2VVUA 3BSQA 5DP5A 3GY2A 8ESTE 1C1RA 1RJXB 3NPSA 3UQOA 3ZZCA 4SGBE 1D9IA 2B0FA 1KYNA 5E2PA 1ZPCA 2ZPRA 1GBKA 1P12E 4XE4A 5L30H 2HNTF 1HV7A 3H7OA 1QRZA 4K2YA 4B71A 1MU8B 1O5BB 5A0BA 1NRQH 3DD2H 1CGHA 2OCVB 4NGAH 1F5KU 4ABGA 3F9GA 3KF2A 4K8BA 1EPTA 2H5DA 2ZNKH 1C5UA 1FUJA 4NA9H 2GZ8A 2J34A 1C1VH 1N8OB 1L2EA 2ZU1A 3BEFB 1GVLA 2P8OB 1ABJH 1Z1IA 3Q3KA 1SQTA 3KIDU 4LXBH 3MU4A 5FX5A 3VFEA 3SU0A 1G2LA 1FI8A 3SO3A 4A1XA 3QTVH 1Y5UT 3URDA 3LDXH 5AFYH 3AW0A 1CGJE 2Z3EA 1ELFA 3F68H 1TNJA 7LPRA 1HRTH 3SHAH 4AG2A 2FI4E 1F92A 3ZZ8A 1A1RA 3SW2B 1E37B 4U01A 1Z71A 1XUKA 2Y5FA 3QZQA 4NIVA 1TBRH 3VPKA 1XM1A 4Q7XA 2Z9LA 4BAOB 2CJIA 2GKVE 1C2DA 1JMOH 1T8LA 2OQ5A 2HPPH 1HBTH 2UUJB 4OGYA 1EUFA 2P93A 1G9IE 3SJ8A 1YBWA 3TH3H 3KN2A 3EQ0H 3SUGA 1J14A 1SLVB 2A5AA 1TNGA 1P2OA 2ZU3A 2EI6A 5F8ZA 3BEIB 3U8OH 3RXLA 1TGBA 1ZTJA 3W95A 2ZCHP 1HJ8A 4NZQA 3PMBB 1Y3UA 4Y11E 3UWJH 2V35A 2BHGA 4HZHA 2ZCLP 1HYLA 2BQWB 2RA3A 5FPTA 4ZUHA 1O38A 2FESH 3FP7E 2PSXA 1GJDB 1HAVB 4B1TA 2QXHA 4E06H 2WPMS 1EZUC 5FBIA 1CBWB 3TJOA 1BBRH 3ODDA 1GHBF 1AN1E 5HMAA 3TH4H 3Q3XA 1DVAH 2C90B 2VGCB 2FOFA 2FI5E 1QA7A 1YPEH 4DW2U 1GL1A 4X8SH 1UTQA 2VWMA 1F5LA 1C2KA 4ZROA 1HJAB 3QK1A 3SGBE 3RXJA 4X2XA 2GMTC 2Y80A 1XXDA 2ZDVH 1N6YA 2QGRA 2FX4A 1KDQA 4GCHG 3ZVAA 1SPJA 3TGIE 3LGIA 1O2YA 2ZTZA 3HKIB 5DPAA 3MNCA 4ABEA 5J4QA 3MYWA 1NESE 2JH6D 1MKXH 1HJ9A 2A4RA 1SHHB 1O3PB 2NU4E 1DY8A 1XVMA 1J15A 1AQ7A 1BTUA 1TQ0B 2NWNA 4DG4A 2IPHA 4WMFA 3CS7A 4AORA 1EZXC 2CGAA 1QL8A 4JYTA 4OS1A 1TB6H 5EXMA 1MZDA 1AI8H 3SGAE 1B7XB 2UWPA 1RTKA 4INKA 3S9AA 1GHAF 1GI9B 1C5XB 1B0FA 1YPHE 1V2WT 5FHTA 1UJ1A 1Y59T 4NWLA 4FUIA 3PLKA 3RM2H 2BXUH 1C1PA 1AE5A 1GBJA 2XBXA 3E3TA 1O39A 1BRCE 3HK6B 1JWTA 3PYHA 2FOCA 1O32A 4YT7H 1CO7E 1FPCH 1FN6A 1Z6EA 2A0QB 4D8NA 5DP3A 2BVSH 2C8ZB 3M7QA 1T32A 1T31A 1N1LA 4CRGA 2EEKA 1BCUH 1A46H 2ZZUH 2FLRH 3SU3A 1P01A 1ETRH 4DJZB 1Y5BT 2ZGJA 4YESB 4YOIA 4A6LA 4U32A 4BXWA 2XC0A 2H2ZA 2ZHQH 1MH0A 1GBHA 2Z94A 1NZQH 1P03A 2XWBI 3BEUA 2NU2E 1GHWH 1P3CA 1O5FH 5JBCS 1FJSA 3RXAA 3WY8A 1ZR0A 2ZDNA 4FVBA 1QNJA 4R8TB 3ZZAA 1Y3WA 2WPIS 1V2MT 1DWBH 4CREA 3T27A 1V2LT 3KCGH 1FONA 3LJJA 3SNBA 3ZVFA 1O3JA 1C1UH 4ZKSU 1EXFA 1CT2E 1K1OA 1N8OC 5EGMA 1GI3A 4O03A 1UTNA 2ZP0H 2GZ9A 3P8FA 1LQDB 2V0BA 3P95A 1HNEE 2Q6GA 3VGCB 2ZU4A 2W26A 3RXQA 5AHGH 3ZZ9A 4HFPB 1KXEA 4KGAA 2YNBA 1F0RA 1PFXC 2WPKS 4UEHH 1BDAA 2FI3E 1MKXK 1S83A 2R3YA 1ARBA 1O2RA 4Y8ZA 1ZGVA 1SLWB 3E8LA 1PQ7A 1V3XA 1J9CH 2BD7A 1BRBE 1QY6A 3SGQE 5C67A 1TAWA 1W14U 1CHOF 4CRBA 1ZHPA 4X6NA 3GDUA 2CXVA 5FXLA 3OY5U 4IBLH 5LPRA 4FUCA 1NFYA 5JPMH 1AWHB 1GHVH 2ZTXA 1DFPA 3ZZ4A 5A8XA 2ZPQA 4ZXXH 3LPRA 1UHBB 2XW9A 5C5OA 3KL6A 1QRXA 1HAZB 1XUJA 2ZDLA 3PWCA 4OS7A 3I29A 1L1GA 1O0DH 2OC1A 2HGTH 2UUFB 5EPYA 1ZTKA 4CRFA 1C5ZB 4X1NU 2AIPA 5DKMA 3SNDA 2W5EA 1TNHA 2OC7A 1W10U 3SI3H 1JBUH 1ETSH 3HK3B 4YO9A 2GCTB 8GCHF 2ZF0H 3ZV9A 5FAHA 5EW2H 4X2YA 4Y0ZE 1V2TT 3LGYA 1MAXA 1S85A 1OPHB 1UK3A 7ESTE 3QLPH 2WPHS 2Z9KA 1ZGIA 5FPYA 1IQGA 1NRPH 4MPUA 1TYNA 2F9PA 4JK6A 2TRMA 3L6PA 3W94A 3GICB 1C9TA 3S0NA 1O2GH 1RS0A 3VB5A 3ATWA 5EW1H 4ZXYH 4IS5A 1V2ST 2Z9JA 1NU7B 5C5NA 1P02A 1BMLA 1YLDA 2GD4B 2THFB 2XNIA 1FXYA 2VGCC 5GJ4B 3UNRA 1A3BH 1TNKA 1S0QA 1TGCA 1EATA 4ABFA 2G5VA 1Q31A 2RDLA 2ZWLH 4I33A 1ELAA 5HGGA 1HAVA 1O3BA 1TALA 1ELVA 4FUGA 1C1OA 2QY0B 3ZZ7A 5G4BA 1VITH 2P59A 2G4UA 5TJXA 1SGRE 2Z7FE 3E91A 3JZ2B 1XVOA 2F91A 4D9QA 1KY9A 1O5EH 3LGWA 1SB1H 3D65E 3TU7H 1YCPM 2PUXB 1NY22 1A0JA 3TK5A 3TK9A 1LCYA 4RKJB 5L2ZH 1QQ4A 2BLVA 1WV7H 1GMCF 1DSTA 4XFQA 3L33A 2WUBA 2CN0H 1OOKB 3SV8A 3MU1A 4AZ2B 3GCHB 4X6OA 2DE9A 3PMHB 1UCYE 1GI1A 1UVTH 3LH3A 1C4Y2 4X2VA 3PO1C 4FUBA 1G32B 1DUEA 1H1BA 4IN2A 1FY5A 2PGBB 1KXBA 1GBAA 1GMHF 2IOTA 4Y79A 2XTTB 3M37A 2H5CA 1GJ4H 1P11E 1IAUA 2FMJA 5DK1A 1YGCH 4DGJA 1P2JA 1ESAA 2ZEBA 1UTOA 2GP9B 1GHZA 1MCVA 1S0RA 3A87A 3BTHE 1MCTA 2OTVA 3F9EA 1QB9A 1C1SA 2F9BH 2QYIA 4I8HA 5GCHF 1UVUH 1GBLA 5TCAA 2PKAB 1DXPA 2V6NA 1NC6A 1FPHH 2G81E 4LZ4B 1AVWA 4D76A 3V3MA 2Q6FA 4RKOB 1QL9A 1BHXB 2FZZA 2VVCA 4GVUA 1OWIA 2G8TA 3LU9B 2VH6A 5FPSA 2A5IA 1O2XA 2SGDE 1CHOG 6CHAB 1ABIH 1IQMA 1THPB 1TX7A 4K1SA 3TJUA 2FOMB 3AAUA 3ATLA 1FV9A 1UTPA 3ZVDA 1LHGH 1C5RA 1EAUA 2R9PA 2JKHA 4ABAA 1NROH 1ZMNA 1S6HA 3IITA 2BVRH 9LPRA 4H4FA 1AUJA 3SU4A 1EJAA 2FYRA 1TIOA 1QJ6B 3KNXA 1TNIA 3SZNA 1FAKH 1CU1A 1YM0A 1LQEA 1LVBA 1ZLRA 3B23B 3SUEA 5L2YH 3P8GA 2XC5A 1C4V2 1D3PB 4Q7YA 5GPIB 1VCWA 1KIGH 1KSNA 2VWLA 3TITA 3SV6A 2CHAB 1IHTH 1NFWA 3VGCC 1KXCA 4K1TA 2H9EH 1SGFA 1PJPA 2CF9H 4ZKNU 2PTCE 3LH1A 4YZUA 1Z8IB 3NCLA 4DCDA 1GI4A 4DIHH 4TY6A 1SGCA 4X1QU 1S82A 3BG4B 2HRVA 3GY7A 3M5NA 1EASA 1OWKA 2ZU5A 1OXGA 1GMDG 4UE7H 4X1SU 3QDZB 2F9NA 3FVFB 4Q7ZA 2H9HA 3SU1A 1ELGA 4YTAA 3RXEA 3QGJA 1YPLH 3CP7A 2TGTA 2VIDA 4MNYA 3QX5H 3SJ9A 4CR9A 1KTSB 3SUDA 2QAAA 3ZYDA 4Y10E 1UCYK 3RU4E 4FUHA 2ZHDA 2BDCA 3QWCH 3ENSB 1O2QA 2ALPA 3VXEH 4TY7A 1CT0E 4XBBA 9ESTA 2OLGA 1LPZB 1O3KA 1ZTLA 3A81A 1V2RT 3PROA 2GCTC 2ZFFH 1GMCG 4X6PA 2VINA 3BTGE 1NFUA 3GYMA 3LJOA 4X6MA 3ZVBA 1O5AB 1TBQH 1UHBA 3HKJB 4NIXA 1NFXA 1KLIH 3FZDA 1ZPBA 1IQLA 4IGDA 4TWWA 4MNVA 3RXPA 1ZMJA 3SNCA 1CVWH 3UNQA 2R2MB 1AVGH 2F9UA 1SOTA 3O8RA 4UDWH 3LC3A 2FO9A 3RC6A 3PMAB 2VNTA 2Z9IA 4GCHF 5DP7A 3ZV8A 4NZLA 1CE5A 1GHXH 1C2LA 1WAYB 1V2NT 2GDEH 1GMHG 4JYUH 1W3CA 4JK5A 1W11U 1F0TA 4D7FA 1EPTC 1UVOA 1MBMA 4VGCB 3V13A 3T2NA 3PM3A 1O3HA 2P3UB 5EG4A 3FFGA 3O8BA 1GG6B 5GCHG 2BD9A 1LKBA 4GLYA 2BM2A 1SGQE 1O2TA 4I8LA 3LGUA 5EQQA 1TLDA 1RTFB 1MTSA 3UFAA 1INCA 2VWOA 5BRRE 1P2KA 4I8GA 1S6FA 2PV9B 1AU8A 3GCNA 2Y82A 1RIWB 1O37A 2FS8A 1AVXA 1H9LB 1KTTB 4CRAA 1K1PA 4FU8A 5AF9H 4K3JA 2VWNA 2FXRA 1HAYB 2A4QA 1QB1A 4JMYA 2HVXA 5JBTA 2O9QA 3PTBA 3MNXA 4HTCH 3E90B 3RC5A 2B9LA 1VJAU 1YKTA 1LVYA 4KELA 1MD8A 5T3HA 3S69A 3NZIA 2PUQH 2R0KA 4FXGH 2J9NA 3STJA 1L1JA 4AFUA 3KQCA 1GWAA 4ZHLU 1TOMH 2BQ7B 5DJ7A 1FY8E 1OS8A 5DG6A 1K21H 1NO9H 1UTLM 1EQ9A 1OX1A 3VXFH 1DWCH 3DHKH 4IC5A 3VEQB 3BIUH 1QBNA 1H8DH 5C1UA 3S9BA 1E34B 1AB9B 3RXDA 1YPMH 3QN7A 4OGXA 2BD8A 4ZMAH 1QURH 2Q1JA 1HDTH 1S81A 1O2KA 1RD3B 1VCPA 2BDHA 1YPHC 1TFXA 1AWFH 1TPAE 3GYLB 2DUCA 1ACBE 3UWIA 1DPOA 3UOUA 5DO4H 3KEEA 6CHAC 1YC0A 1YYY1 1GPZA 2Y5HA 5LH8A 3T5FH 3B8JA 2FS9A 4UFEH 3BTWE 2PKAA 5I25A 2YNAA 3M35A 3SV7A 2VB0A 1J8AA 2QA9E 3A84A 2F3CE 1BBRE 1CA0C 1HFDA 1EJNA 3MI4A 5GIBA 3RDZA 1LTOA 1BIOA 3M5OA 1P2QA 1IHSH 1PQ5A 3DUXH 4H42U 1DWDH 3UTUH 4AOQA 1G2MA 3LGVA 2XCNA 3MFJA 1FMGA 1SG8B 3HPTB 2ZC9H 3EYDA 5EOKA 3OU0A 3GY6A 3ATKA 2BD4A 5JBBS 4GHTA 2ZKSA 1DOJA 1UK2A 2HOBA 4JZEH 5E2OA 4AYVB 1DE7H 1Q2WA 2CHAC 1BQYA 2ZGBH 2WPJS 3HATH 1MBQA 1BA8B 4TPYA 1QCPA 3A80A 1A5IA 1UK4A 2RG3A 5FCKA 4XDEA 4ZH8A 1P2IA 1AE8H 3Q00A 3A7VA 1BRUP 3SUFA 1UO6A 1G37A 1GBEA 1AMHA 2BDYA 1HUTH 2BZ6H 1SL3A 2VJ1A 1NS3A 1VZQH 2OC8A 2A5KA 4CHAB 1OYTH 3EGKH 3MMGA 4ISIH 1GI0A 1GI8B 3BG4C 1PPBH 1Y5AT 1OYQA 5AVDA 1RGQA 3URCA 1HLTH 4UONA 1AZ8A 1O2JA 1EAWA 4HGCA 5K7RA 1C5TA 2BDBA 1L4DA 1P10A 3UR9A 1VGCB 2FOGA 2I6QA 1T8MA 1HIAB 2GV7A 1RFNA 1ZHRA 2ZFSA 4X0WU 3LIWA 3SV2H 4LK4A 3MTYA 1AZZA 1TA6A 4NFEA 1SFQB 2G55A 4LZ1H 1ARCA 1OWDA 3DT0H 5HM9A 1A61H 5A0CA 1SBWA 2BVXH 3BTEE 2OBOA 2WPLS 3VB6A 4I7YH 1C1MA 8KME2 1Z8JB 6GCHF 1SHYA 4IMZA 3G01A 1WBGB 1A4WH 1BTPA 1OWHA 2D26C 2ANMH 1LVOA 1GJBB 5A8ZA 1T4VH 1SC8U 1QJ7B 3V12A 4ZHMU 1O3NA 1PPGE 1GBCA 2PR3A 2Y5GA 1TRMA 2J95A 1DSUA 1ZYOA 4Y71A 4AB8A 3U98H 2VH0A 1A3EH 1O35A 3SJKA 4WXIA 1P3EA 2ZG0H 4WY3A 2ZHEH 4FUFA 4VGCC 1BTYA 3EA9A 5A0AE 4DT7B 3FANA 2I6SA 1TGSZ 3MNBA 1GG6C 1GJ9B 4E05H 3UNSA 3D62A 2ULLA 1WU1A 3SOSA 4DVAU 1XKAC 4BOHA 1BBRK 2O8UA 1WOFA 4Y6DA 3V7TA 3DA9B 1PPCE 3UREA 4ZKRU 1HAOH 5H4IB 4ISNA 1Z6JH 3ODFA 1C1WH 3SJOA 3RXKA 3MH4A 3JZ1B 4B2BA 3SQEE 4FUEA 2P8OC 4GAWA 4MNXA 1P2NA 3HGPA 2BX4A 2ZFRH 1ZPZA 3E0PB 3MHWU 4SGAE 1IQKA 1QBVH 1GCDA 2A2XH 1AUTC 4JZDH 5C20A 3RXUA 4NSYA 1PQAA 4CH8B 1E0FD 1E36B 2FTMA 4B2CA 1IOEA 1JRTA 2Z9GA 1ZRKA 2ZCKP 4F4OC 1QBOA 5EU8A 1P2MA 1YPGH 2A4GA 3SNAA 4A1TA 1LHFH 2ZDMA 2ZFPH 1YPKH
chains in the Genus database with same CATH superfamily
4PROA 2ILNA 1TABE 4XBDA 1GDQA 1HAGE 1S5SA 2OUAA 1AIXH 3PV2A 2UWLA 1WSSH 2O8WA 1HAHH 2ZDKA 2ESTE 3OE7D 3ZVCA 1W2KH 4UD9H 1KXFA 5FX6A 3FAOA 5HM2A 1H8IH 1GJ6A 1V6DA 1ZSKA 1AO5A 1O5CB 4NA8A 3RXSA 2XCFA 3H09A 1TMBH 1OSSA 1SR5C 1GJ8B 2PW8H 3LKWA 2W7SA 3MQKC 2XRCA 1BT7A 4BAQB 2FODA 1XX9A 2ZGHA 1TMUH 3ELAH 1LPGB 4E7RG 3NXPA 1EB2A 5E0JA 3H5CB 3P92A 3A7WA 1PPFE 1EB1H 3GISB 1WQVH 1IQEA 5C1XA 1O36A 1QGFA 3PWBA 5LPEA 2C8XB 1L1NA 3BIVH 4I86A 4JYVH 3ZZBA 3GOVB 1S6LA 3KYFA 3M5LA 3ZVGA 1K22H 3DSGA 2C93B 5F6MA 1JXPA 1ETTH 3LC5A 4MQAA 2O8LA 1JRSA 1CBWC 2BDAA 3A89A 1SGDE 1DY9A 2SGPE 1KLTA 1YCPH 2STAE 2XOKD 1A0LA 4K5ZA 3A7TA 2BZAA 3BTFE 4MPVA 6GCHG 3A83A 3ESTA 2Y7XA 2STBE 1GMDF 2P16A 3K9XB 3QTOH 4Y7AA 1HJAC 2OK5A 4E7NA 2QN5T 1LHCH 3QZRA 1HAIH 1LDTT 3UY9A 2A4OA 3NWUA 1ANDA 2C8WB 2GVFA 1MQ6A 4Q80A 4KP0A 5EQRA 3GY8A 1BTXA 1P9SA 2QXJA 3B9FH 4H6SB 5FBEA 4TPIZ 3ZZ5A 1XUIA 5E0HA 1FIWA 3M7TA 1XKBC 3GCOA 3K6ZA 3SQHE 1C2IA 4WVPE 2OXSA 1VGCC 4CR5A 7KMEH 1MMJN 3BTQE 3E1XB 4AFZA 5JB9S 1HGTH 2J97A 2QF0A 1TOCB 2YMSB 1AHTH 1TMTH 3RXRA 3ZZ6A 1P9UA 3P8NA 1GBFA 3C1KA 1MTNB 1FIZA 4ZKOU 4IW4E 1IQHA 4JCNA 1LO6A 3V0XA 2UUYA 2LNCA 4MPXA 3EDXB 3KQEA 4AYYB 3MU0A 1YLNA 3QGNB 1O3LA 2G5NA 2KCAA 1LHEH 1OP8A 2PGQB 4O3TA 3N7OA 4XOJA 5EXLA 4I8JA 4P02A 1XXFA 1V2QT 2V7QD 1O2HA 1HIAA 2VIVA 1THSH 2ZQ1A 3OEED 4MTBA 1H4WA 1C5WB 3A8DA 3RXHA 1HXEH 2G00A 1C5MD 4BXSA 1NRSH 1B0EA 3UIRA 4YOJA 1SQRA 3F9HA 3RUOA 1O3GA 5T6FA 2VVVA 3SI4H 1BTZA 1D6RA 3ZZ3A 2KAIB 3AVZA 3Q3YA 2ASUB 4AG1A 1W0YH 1GL0E 2SNWA 3E16B 4JZIA 2EC9H 3HGNA 1C5LH 1O2SA 1HCGA 1ELDE 2LPRA 1EAXA 1Z8GA 2F43B 4O3UA 4NSVA 2C8YB 1ZHMA 1FLEE 1T7CA 2AH4X 3O8CA 3M5MA 2D1JA 1SVPA 4B76A 2ZDAH 2R2WU 1BTWA 2JETB 1UTJA 3PMJA 2A7JA 1Z7KA 4X1PU 2HWLB 2FP7B 4AFSA 5EJLA 1T4UH 4HI3A 1QRWA 4AFQA 2KCOA 2VIPA 2Z3CA 2AMDA 2WV4A 2Z3DA 1VR1H 3A7XA 1O2ZA 4FETA 4Z6AH 3DFJA 5E8EH 4O97A 2VIWA 3U8TH 3FP6E 4FU7A 1FN8A 2ODPA 2EI8A 4A7IB 1O2VA 1IQNA 2Z6BD 3E6PH 5DP9A 4B75A 5FCRA 1PPEE 4NIWA 1BB0B 3STIA 1QHRB 3D23A 3LGTA 2Y7ZA 1TGNA 1E1RD 2GT8A 4MLFB 3U69H 3LONA 1AGJA 1AY6H 4CRDA 1GGDB 5I46H 2BY8X 3EE7A 2BD2A 1A5GH 3S7HB 1MQ5A 4YT6H 1ANEA 4B73A 3BN9A 5HIZA 4BNRA 1DICA 1P0SH 2GMTB 3SU6A 1C9PA 1NU9A 1C2GA 3RMNH 4NG9H 2K1QA 4BAKB 2OP9A 3P17H 3UR6A 4TT3D 1C5VA 1SGYE 1EP5A 3PLPA 3U9AH 2H1UA 1ZJDA 3PRDA 1AD8H 1L0ZA 1P09A 3MO6A 3MNSA 1YLCA 5K0HA 1C1TA 5F8TA 4Q63A 4ABDA 2AS9A 1SGEE 3D49H 1QTFA 3A7ZA 1RTLA 2M2AA 1J16A 3RMLH 5JYIA 1BMFD 2TPIZ 5C2ZA 2BOHB 3F1SB 3RXGA 4B2AA 1TPPA 3FZZA 5KGOA 4IN1A 2C4FH 2BOKA 1C2MA 3MU5A 4Q2KA 1QR3E 1IQIA 2A31A 2BY6X 2TGPZ 4WH6A 2AMPA 4LOYH 2F9VA 2ODYB 1FY4A 2B7DH 1J17T 1SQAA 3MWIU 1P06A 3O8DA 2FOEA 4IMQA 5ESBA 2R0LA 1K1LA 1NM6A 2JH5D 1ZZZA 4Z1MD 1MTVA 1K28D 4OS4A 5T6DA 2ZIQH 1EOJA 3A7YA 1CQQA 4X8TH 3L3TA 3H7TA 1CGIE 2IN2A 2L6OA 1FQ3A 1O3MA 1O33A 1KMHB 4KKDA 1M9UA 1GJAB 1O3OA 1SMFE 1GJCB 3RP2A 3RLYH 2KCPA 3PV4A 1EOLA 5DP8A 2GZ7A 3GCHC 4INHA 1A2CH 3A8BA 3F9FA 3U1IB 2KR7A 3GCTF 4U2WA 1GI7B 2C3SA 1ORFA 1TGTA 1YF4A 1GBMA 1G3CA 1QIXB 1EZSC 5DN6D 4A1VA 1MTNC 5EQSA 2A7HA 3RXIA 2HNTE 5CHAB 5DSFA 1O34A 3SNEA 4I32A 1AFQB 1DITH 1TWXB 2FYQA 1YWUA 2W6ID 2XYAA 4A5TS 4XSKU 1O2PA 3RM0H 2ZHFH 1NTPA 4BTIB 3UPEA 1UMAH 2XBVA 1UW7A 2W6JD 5EJ1A 1K2I1 3CNRA 2OD3B 1JIMA 5T1VA 1C4U2 2PLXA 2WV5A 5A09A 1O2LA 1O3IA 1P04A 4Y0YE 4K69A 1FAXA 1QA0A 3UUZA 3SN8A 2ZPSA 5CE1A 1SQOA 2GX4A 2CV3A 4DT4A 5F8XA 4KTUA 3M3SA 2QV1A 2D8WA 1B5GH 1QQUA 4DY7B 1HAXB 2WHXA 4AN7A 2XBWA 1WTHD 4OS5A 3TGKE 1W8BH 1C1NA 5EPNA 3FOAA 2JJ2D 1W13U 1GI5A 2OC0A 2FOHA 2P95A 4ABHA 2AERH 4OS2A 3VB4A 3R3GB 1ZRBA 3GY3A 3RXMA 1T8OA 1G3EA 5DP6A 1VJ9U 2BDGA 1THRH 2BYAX 2KAIA 3BV9B 1Y3VA 5L6NH 3CENA 2BLWA 2JETC 2A45B 1BMAA 3KQBA 1BTHH 1LVMA 1ELCA 3P70B 4KTSA 3DCLA 3BTME 4X1RU 2TIOA 3A8CA 3RC4A 1ZOMA 1TNLA 2PFEA 1P8VC 4UFDH 4D9RA 3M7UA 2ALVA 1Y3YA 1GJ5H 3GDVA 4JZ1A 4CBOA 1ID5H 1MABB 1SGFG 1TQ7B 2WSSD 1BUIA 4K8YA 2J92A 1PPZA 1O3FA 1V2VT 4FUJA 3T29A 2O8TA 1DXWA 3GY4A 4DOQA 3RXCA 3C27B 2B5TB 2NU3E 4MG3A 1GVZA 2AYWA 2OINA 2ODQA 2SGAA 3OYPA 3RXOA 2VBCA 1F0SA 3T62A 1G36A 2FEQH 3RMMH 1LMWB 2P94A 1SKYE 1EJMA 1GGDC 1CA8B 1GI6A 1GDNA 1O5GH 2D2DA 2J2UA 4UFGH 5ABWA 3Q77A 1AKSB 5DGJA 4MNWA 1UVSH 1VCQA 3K6YA 1BHXF 2QXIA 5C1YA 1BJVA 1O2IA 4WJG2 1HB0B 2Y6TA 4Y8XA 4JZFH 5EXNA 1RRKA 1GBIA 1BZXE 2FOBA 1EKBB 3AASA 3SORA 1DM4B 2BX3A 1C5QA 5ETXA 3RXBA 2A32A 1DANH 3RLWH 5JB8S 1PPHE 1ELTA 3EE0B 1DX5M 5LPFA 3BTKE 2ANWA 3RXTA 1RXPA 4CRCA 2V3HH 1BRAA 1NPMA 3RMOH 1ESTA 3FP8E 3IWMA 5AFZH 1TX6A 1H9IE 3EA7A 3M3VA 3EAJA 1WCZA 2IJOB 2PTNA 3PO1B 3GCTG 3S7KB 2QC2A 2ZTYA 1CHGA 1GBDA 1GBTA 4HG6A 2AGEX 4CH2B 2NU1E 3WWFA 4K60A 1MU6B 3U8RH 1O3DA 1C5YB 4O9VA 3RU4T 3LT3A 1O2WA 4ZAEA 3TK6A 2TBSA 1DLKB 1DDJA 1ESBA 3A86A 4QT8C 1WUNH 1FY3A 2BLQA 2FLBH 2RA0A 1GHYH 4UFFH 3EA8A 3BG8A 1SSXA 1P05A 1Z8RA 3ATIA 2QF3A 2GJGA 2JH0D 3PB1E 2WYJA 2XNDD 2EQNA 2ZGXH 2SNVA 4GSOA 1BOQA 2QXGA 1GCTB 1W12U 1U6QA 3SBKA 3TGJE 1OWEA 4NWKA 3Q76A 1C5OH 1E35B 2BD3A 3DSOA 3ATMA 1RIWC 2J4IA 4ESTE 3TPIZ 1XUGA 3T28A 3TNSA 3ITIA 1UVPA 1MUEB 1O3CA 2W7UA 3F2FA 2ANKH 3I78A 4F49A 3A8AA 1KLJH 3PTNA 3MH7A 3P8OA 1C2JA 4TWYA 1D3TB 2SGEE 3AW1A 2J94A 3IG6B 1SI5H 1XMNB 1N6XA 2BTCE 3M3TA 2ZO3H 5CHAC 4TSFD 2GTBA 4ISOA 1O2UA 1D3QB 1DUAA 1Z1JA 1S84A 1AFQC 1WYKA 6ESTA 2VU8E 1C2HA 1A5HA 3TJVA 4WH8A 1ZMLA 2ANYA 2FIRH 2XXLA 4ASHA 4AX9H 4NFFA 4J2YB 2WUCA 4AGKA 1K0HA 1TBZH 4IC6A 3OY6U 2PSYA 7GCHF 2BD5A 3MOCA 1AB9C 4X2WA 4FU9A 1ZSJA 5CHBA 2BMGB 1V2UT 2CMYA 3NKKA 1LKAA 3RXVA 1OKXA 2O8MA 1GHBG 3KQDA 2ZECA 3TVJB 1MKWH 1MTWA 3QO6A 1C2EA 1G3BA 1K1JA 3MO3A 3VB3A 2GT7A 1W0KD 4WXVA 4Y7BA 2R3UA 1TPOA 4GHQA 1SLXB 2A2QH 2EI7A 1L4ZA 1IQFA 1WTGH 1IQJA 4RSPA 5EODA 4BANB 1XUHA 1EAIA 1TPSA 3K2UA 1FX0B 1K9OE 2W3IA 2PKSB 3TNTA 3KHVA 1VITF 4WWYA 1Y3XA 2KM0A 1OP2A 4M7GA 1C5NH 1K1NA 3BTDE 3P6ZB 5HYOA 1KXAA 2TGAA 1FDPA 3A82A 3MH6A 4ISLA 1MTUA 2IJD1 3UQVA 5EIYA 5JBAS 3I77A 5HXFA 1V2PT 2AGIX 1DT2A 2GV6A 2PWXA 1OWJA 1SFIA 1BMNH 1DS2E 2L74A 1O5DH 4I31A 2V3OH 2ZGCA 1OP0A 1GBBA 1GHAG 1MD7A 1Y8TA 1TX8A 1ZSLA 1A7SA 2J38A 4CHAC 4ACBA 2G52A 5T6GA 5C3NA 1GDUA 5J4SA 3SV9A 1EPTB 1YP9A 2P3TB 5B6OA 5F03A 1ANCA 4K1EA 2P3FH 2FM2A 4ABBA 5IDKA 2FOAA 1NRRH 4DURA 2BY5X 2GCHF 2M5TA 2W3KA 1MZAA 2BXTH 2ZFTA 2CF8H 4Y76A 4ABJA 3SHCH 4GPGA 1WXRA 5GWZA 1DWEH 3F2GA 4KTCA 1TRNA 4ABIA 4THNH 1O2NA 4AB9A 2HLCA 3A85A 5SGAE 4XBCA 4AGJA 1PQ8A 2SGFE 1KXDA 3NK8A 2UUKB 1G30B 2XC4A 4A92A 1FNIA 3TJNA 5TCCA 1T8NA 1LHDH 1O2OA 1AKSA 3PLBA 4YLUA 1QFKH 1TONA 4WF8A 3GY5A 1AFEH 3NUMA 4RN6A 1QJ1B 1LPKB 3E0NB 2QIQA 1NT1A 2BY9X 1HXFH 1A0HB 2BB4A 4YLQH 8LPRA 1V2KT 1MKWK 1D6WA 4H6TA 3MH5A 2NU0E 2HALA 4NCYA 2AMQA 1H9HE 1CSOE 1EP6A 5GDSH 1UCYH 4WMDA 1TE0A 5PTPA 1E38B 1F2SE 2YOLA 3OSYA 3K65B 1V2JT 4INLA 5KEDA 2HPQH 1EZQA 2Q6DA 2XWAA 2F4LA 2G51A 1O31A 1C5PA 1UTMA 3A88A 1HPGA 3T26A 3UOPA 5GXPA 4R0IA 7GCHG 1F0UA 1TA2A 1TRYA 1JIRA 1FZZA 2ZA5A 3MU8A 2ZI2H 1BJUA 1W7XH 3RU4D 3SU5A 2BY7X 2ZQ2A 1D4PB 4I8KA 1W0ZU 1DLEA 1GCTC 4NIYA 1V2OT 1O2MA 1EX3A 2HLDD 1YCPK 2FTLE 2ZHWH 3M61U 2FX6A 1JOUB 4FVDA 1K1MA 3N7DA 4CBNA 2G4TA 1UTKA 2Y81A 5KECA 2BDIA 3BTTE 3LOXA 1YPJH 3R0FA 4ZHAA 3VB7A 1F7ZA 5A2MH 1GVKB 4BAHB 2SGQE 1CA0B 4D7GA 2VIQA 4X8VH 1O3EA 2RCEA 1XUFA 2DE8A 1ZJKA 1VITG 2ZFQH 3DFLA 3OX7U 4BTTB 1NN6A 6LPRA 4DIIH 1GJ7B 1KDQB 2GDDA 5A8YA 2AGGX 4M9FA 3S9CA 1FY1A 4BTUB 1CT4E 1G3DA 3OAAD 8GCHG 4MDSA 2ZU2A 3WW7A 4YM9A 2AEIH 1C2FA 4ISHH 4YOGA 1PYTC 2FWWA 5BPEA 1SGIB 3U1JB 1P57B 2EA3A 1WQSA 4OS6A 3DSPA 1SLUB 3BF6H 4Y8YA 5IYTA 1HAPH 4GUXA 3OTJE 3AAVA 1F5RA 3MO9A 3ZYEA 2WYGA 3ZZDA 2HNTC 2PHBA 3TIUA 2UWOA 2F9OA 5C0TA 4Q4LA 3TH2H 2B8OH 4J1YA 3RXFA 2A7CA 1BMMH 2FDAA 5LGOA 2FPZA 2AFQB 1E1QD 1PYTD 3TLOA 1ELBA 1O30A 2QCYA 3T25A 1X7AC 1Q3XA 5E0GA 3M36A 2GCHG 4MVNA 3ZVEA 2TGDA 1SOZA 3QUMP 1BITA 2H9TH 2VIOA 1SGPE 1QL7A 2A1DB 2PKSC 3GDSA 1C5SA 4FUDA 2WINI 5JDUB 2JJ1D 4Z0KA 5CMXH 2BLOA 4BAMB 2GGVB 1SGTA 1NRNH 1O3AA 4U30A 3SJIA 4TYDA 3F6UH 1D3DB 1ANBA 1SGNE 2OBQA 2AIQA 2OQUA 4B74A 1QB6A 2SFAA 1ELEE 3PRBA 1W7GH 1K1IA 3SU2A 4X8UH 3KGPA 1GI2A 4F48B 4WMEA 2XBYA 5DP4A 1H8HD 5ESTE 2BQ6B 1C1QA 1MAYA 3CS0A 4NA7A 2F83A 4MPWA 2H6MA 2VVUA 3BSQA 5DP5A 3GY2A 8ESTE 1C1RA 1RJXB 3W1EA 3NPSA 3UQOA 2QF4A 3ZZCA 4SGBE 1D9IA 2B0FA 1KYNA 5E2PA 1ZPCA 2ZPRA 1GBKA 1P12E 4XE4A 5L30H 2HNTF 1HV7A 3H7OA 1QRZA 4K2YA 4B71A 1MU8B 1O5BB 5A0BA 1OHHD 1NRQH 2YMSC 3DD2H 1CGHA 2OCVB 4NGAH 1F5KU 4ABGA 3F9GA 3KF2A 4K8BA 1EPTA 2H5DA 2ZNKH 4XRNA 1C5UA 1FUJA 4NA9H 2GZ8A 2J34A 3F2HA 1C1VH 1N8OB 1L2EA 2ZU1A 3BEFB 1GVLA 2P8OB 1ABJH 1Z1IA 3Q3KA 1SQTA 3KIDU 4LXBH 3MU4A 5FX5A 3VFEA 3N7EA 1YY3A 4P00A 3SU0A 1G2LA 1FI8A 2YMSD 3SO3A 4A1XA 3QTVH 1Y5UT 3URDA 3LDXH 5AFYH 3AW0A 2WV9A 1CGJE 2Z3EA 1ELFA 3F68H 1TNJA 7LPRA 1HRTH 3SHAH 4AG2A 2FI4E 1F92A 3ZZ8A 1A1RA 3SW2B 1E37B 4U01A 1Z71A 1XUKA 2Y5FA 3QZQA 4NIVA 1TBRH 3VPKA 1XM1A 4Q7XA 2Z9LA 4BAOB 2CJIA 2GKVE 1C2DA 1JMOH 1T8LA 2OQ5A 2QE7D 2HPPH 1HBTH 2UUJB 4OGYA 1EUFA 2P93A 1G9IE 3SJ8A 1YBWA 3TH3H 3KN2A 3EQ0H 3SUGA 5C0UA 1J14A 1SLVB 2A5AA 1TNGA 1P2OA 2ZU3A 2EI6A 5F8ZA 3BEIB 3U8OH 3RXLA 3N99A 1TGBA 1ZTJA 3W95A 2ZCHP 1HJ8A 4NZQA 3PMBB 1Y3UA 4Y11E 3UWJH 2V35A 2BHGA 4HZHA 1E79D 2ZCLP 3FKSD 1HYLA 2BQWB 2RA3A 5FPTA 4ZUHA 4AC9A 1O38A 2FESH 3FP7E 2PSXA 1GJDB 1HAVB 4B1TA 2QXHA 2EY4C 4E06H 2WPMS 2CK3D 1EZUC 5FBIA 1CBWB 3TJOA 1BBRH 3ODDA 1GHBF 1AN1E 5HMAA 3TH4H 3Q3XA 1DVAH 2C90B 2VGCB 2FOFA 2FI5E 1QA7A 1YPEH 4DW2U 1GL1A 4X8SH 1UTQA 2VWMA 1F5LA 1C2KA 4ZROA 1HJAB 3QK1A 3SGBE 3RXJA 3NRLA 4X2XA 2GMTC 2Y80A 5HIYA 1XXDA 2ZDVH 1N6YA 2QGRA 2FX4A 1KDQA 4GCHG 3OEHD 3ZVAA 1SPJA 3TGIE 3LGIA 1O2YA 2ZTZA 3HKIB 5DPAA 3MNCA 4ABEA 5J4QA 3MYWA 1NESE 2JH6D 1MKXH 1HJ9A 2A4RA 1SHHB 1O3PB 2NU4E 1DY8A 1XVMA 1J15A 1AQ7A 1BTUA 1TQ0B 2NWNA 4DG4A 2IPHA 4WMFA 3CS7A 4AORA 1EZXC 2CGAA 1QL8A 4JYTA 4OS1A 1TB6H 5EXMA 1MZDA 1AI8H 3SGAE 1VKYA 1B7XB 2UWPA 1RTKA 4INKA 3S9AA 1GHAF 1GI9B 1C5XB 1B0FA 1YPHE 1V2WT 5FHTA 1UJ1A 1Y59T 4NWLA 4FUIA 3PLKA 3RM2H 2BXUH 1C1PA 1AE5A 1GBJA 2XBXA 3E3TA 1O39A 1BRCE 3HK6B 1JWTA 3FO8D 3PYHA 2FOCA 1O32A 4YT7H 1CO7E 1FPCH 1FN6A 1Z6EA 2A0QB 4D8NA 5DP3A 2BVSH 2C8ZB 3M7QA 1T32A 1T31A 1N1LA 4CRGA 2EEKA 1BCUH 1A46H 2ZZUH 2FLRH 3SU3A 1P01A 1ETRH 4DJZB 1Y5BT 2ZGJA 4YESB 4ZCNA 4YOIA 4A6LA 4U32A 4BXWA 2XC0A 2H2ZA 2ZHQH 1MH0A 1GBHA 2Z94A 1NZQH 1P03A 2XWBI 3BEUA 2NU2E 1GHWH 1P3CA 1O5FH 5JBCS 1FJSA 3RXAA 3WY8A 1ZR0A 2ZDNA 4FVBA 1QNJA 3F0PA 4R8TB 1Y3WA 2WPIS 3ZZAA 1V2MT 1DWBH 4CREA 3T27A 1V2LT 3KCGH 1FONA 3LJJA 3SNBA 3ZVFA 1O3JA 1C1UH 4ZKSU 1EXFA 1NBME 1CT2E 1K1OA 1N8OC 5EGMA 1GI3A 4O03A 1UTNA 2ZP0H 2GZ9A 3P8FA 1LQDB 2K0QA 2V0BA 3P95A 1HNEE 2Q6GA 1EFRD 2ZU4A 3VGCB 2W26A 3RXQA 5AHGH 3ZZ9A 4HFPB 1KXEA 4KGAA 2YNBA 1F0RA 1PFXC 2WPKS 4UEHH 1BDAA 2FI3E 1MKXK 1S83A 2R3YA 1ARBA 1O2RA 4Y8ZA 1ZGVA 1SLWB 3E8LA 1PQ7A 1V3XA 1J9CH 2BD7A 1BRBE 2K8IA 1QY6A 3SGQE 5C67A 1TAWA 1W14U 1CHOF 4CRBA 1ZHPA 4X6NA 3GDUA 2CXVA 5FXLA 3OY5U 4IBLH 5LPRA 4FUCA 3SZEA 1NFYA 5JPMH 1AWHB 1GHVH 2ZTXA 1DFPA 3ZZ4A 5A8XA 2ZPQA 4ZXXH 3LPRA 1UHBB 2XW9A 5C5OA 3KL6A 1QRXA 1HAZB 1XUJA 2ZDLA 3PWCA 4OS7A 3I29A 1L1GA 1O0DH 2OC1A 2HGTH 2UUFB 5EPYA 1ZTKA 4CRFA 1C5ZB 4X1NU 2AIPA 5DKMA 3SNDA 2W5EA 1TNHA 2OC7A 1W10U 3SI3H 1JBUH 1ETSH 3HK3B 4YO9A 2GCTB 8GCHF 2ZF0H 3ZV9A 5FAHA 5EW2H 4X2YA 4RT0A 3UB0A 4Y0ZE 1V2TT 3LGYA 1MAXA 1S85A 4FOUC 1OPHB 1UK3A 3UAIC 7ESTE 3QLPH 2WPHS 2Z9KA 1ZGIA 5FPYA 1IQGA 1NRPH 4MPUA 1TYNA 2F9PA 4JK6A 2TRMA 3L6PA 3W94A 3GICB 1C9TA 3S0NA 1O2GH 1RS0A 3VB5A 3ATWA 5EW1H 3SYJA 4ZXYH 4IS5A 1V2ST 2Z9JA 1NU7B 5C5NA 1P02A 1BMLA 1YLDA 2GD4B 2THFB 2XNIA 1FXYA 2VGCC 5GJ4B 3UNRA 1A3BH 2QF5A 4XD7D 1TNKA 1S0QA 1TGCA 2LP6A 1EATA 4ABFA 2G5VA 1Q31A 2RDLA 2ZWLH 4I33A 1ELAA 5HGGA 1HAVA 1O3BA 1TALA 1ELVA 4FUGA 1C1OA 2QY0B 3ZZ7A 5G4BA 1VITH 2P59A 2G4UA 5TJXA 1SGRE 2Z7FE 3E91A 3JZ2B 1XVOA 2F91A 4D9QA 1KY9A 1O5EH 3LGWA 1SB1H 3D65E 3TU7H 1YCPM 2PUXB 1NY22 1A0JA 3TK5A 3TK9A 1LCYA 4RKJB 5L2ZH 1QQ4A 2BLVA 1WV7H 1GMCF 1DSTA 3FN8A 4XFQA 3L33A 2WUBA 2CN0H 1OOKB 3SV8A 3MU1A 4AZ2B 3GCHB 4X6OA 2DE9A 3PMHB 1UCYE 1GI1A 1UVTH 3LH3A 1C4Y2 4X2VA 3PO1C 2WZQA 4FUBA 1G32B 1DUEA 1H1BA 4IN2A 1FY5A 2PGBB 1KXBA 1GBAA 1GMHF 2IOTA 4Y79A 2XTTB 3M37A 2H5CA 1GJ4H 4RT1A 1P11E 1IAUA 2FMJA 5DK1A 3F3BA 1YGCH 4DGJA 1P2JA 1ESAA 2ZEBA 1UTOA 2GP9B 1GHZA 1MCVA 1S0RA 3A87A 3BTHE 1MCTA 2OTVA 3F9EA 1QB9A 1C1SA 2F9BH 2QYIA 4I8HA 5GCHF 1UVUH 1GBLA 5TCAA 2PKAB 1DXPA 2V6NA 1NC6A 1FPHH 2G81E 4LZ4B 1AVWA 5FL7D 4D76A 3V3MA 2Q6FA 4RKOB 1QL9A 1BHXB 2FZZA 2VVCA 4GVUA 1OWIA 2G8TA 3LU9B 2VH6A 5FPSA 2A5IA 1O2XA 2SGDE 1CHOG 6CHAB 1ABIH 1IQMA 1THPB 1TX7A 4K1SA 3TJUA 2FOMB 3AAUA 2WPDD 1FV9A 1UTPA 3ATLA 3ZVDA 1LHGH 3F0OA 1C5RA 1EAUA 2R9PA 2JKHA 2J98B 4ABAA 1NROH 1ZMNA 1S6HA 3IITA 2BVRH 9LPRA 4H4FA 1AUJA 3SU4A 1EJAA 2FYRA 1TIOA 1QJ6B 3KNXA 1TNIA 3SZNA 1FAKH 1CU1A 1YM0A 1LQEA 1LVBA 1ZLRA 3B23B 3SUEA 5L2YH 2PP6A 3P8GA 2JIZD 2XC5A 1C4V2 1D3PB 4Q7YA 5GPIB 1VCWA 1KIGH 1KSNA 2VWLA 3TITA 3SV6A 2CHAB 1IHTH 1NFWA 3VGCC 1KXCA 4K1TA 2H9EH 1SGFA 1PJPA 2CF9H 4ZKNU 3U28C 2PTCE 3LH1A 4YZUA 1Z8IB 3NCLA 4DCDA 5C17A 1GI4A 4DIHH 4TY6A 1SGCA 4X1QU 1S82A 3BG4B 2HRVA 3GY7A 3M5NA 1EASA 1OWKA 2ZU5A 1OXGA 1GMDG 4UE7H 4X1SU 3QDZB 2F9NA 3FVFB 4Q7ZA 2H9HA 3SU1A 1ELGA 4YTAA 3RXEA 3QGJA 1YPLH 2RFKC 3CP7A 3ZIAD 5C94A 2TGTA 2VIDA 4MNYA 3QX5H 3SJ9A 4CR9A 1KTSB 3SUDA 2QAAA 3OTPA 3ZYDA 4Y10E 1UCYK 3RU4E 1H8ED 2KFWA 4FUHA 2ZHDA 2BDCA 3QWCH 3ENSB 1O2QA 2ALPA 2JDID 3VXEH 4TY7A 1CT0E 4XBBA 9ESTA 2OLGA 1LPZB 1O3KA 1ZTLA 3A81A 1V2RT 3PROA 2GCTC 2ZFFH 1GMCG 4X6PA 2VINA 3BTGE 1NFUA 3GYMA 3LJOA 4X6MA 3ZVBA 1O5AB 1TBQH 1UHBA 3HKJB 4NIXA 1NFXA 1KLIH 3FZDA 1ZPBA 1IQLA 4IGDA 4TWWA 4MNVA 3RXPA 1ZMJA 3SNCA 1CVWH 3UNQA 2R2MB 5B6LA 1AVGH 2F9UA 1SOTA 3O8RA 4UDWH 3LC3A 2FO9A 3RC6A 3PMAB 2VNTA 2Z9IA 4GCHF 5DP7A 3ZV8A 4NZLA 1CE5A 1GHXH 1C2LA 1WAYB 1V2NT 2GDEH 1GMHG 4JYUH 1W3CA 4JK5A 5IK2D 1W11U 1F0TA 4D7FA 1EPTC 1UVOA 1MBMA 4VGCB 3AK5A 3V13A 3T2NA 3PM3A 1O3HA 2P3UB 5EG4A 4ACAA 3FFGA 3O8BA 1GG6B 5GCHG 2BD9A 1LKBA 4GLYA 2BM2A 1SGQE 1O2TA 4B6EA 4I8LA 3LGUA 5EQQA 3GS9A 1TLDA 1RTFB 1MTSA 3UFAA 1INCA 2VWOA 5BRRE 1P2KA 4I8GA 1S6FA 2PV9B 1AU8A 3GCNA 2Y82A 1RIWB 1O37A 2FS8A 1AVXA 1H9LB 1KTTB 4CRAA 1K1PA 4FU8A 5AF9H 4K3JA 2VWNA 2FXRA 1HAYB 2A4QA 1QB1A 4JMYA 2HVXA 5JBTA 2O9QA 3PTBA 3MNXA 4HTCH 3E90B 3RC5A 2B9LA 1VJAU 1YKTA 1LVYA 4KELA 1MD8A 5T3HA 3S69A 3NZIA 2PUQH 2R0KA 4FXGH 2J9NA 3STJA 1L1JA 4AFUA 3KQCA 1GWAA 4ZHLU 1TOMH 2BQ7B 2KX4A 5DJ7A 1FY8E 1OS8A 5DG6A 1K21H 1NO9H 1UTLM 1EQ9A 1OX1A 3VG8A 3VXFH 1DWCH 2AHME 3DHKH 4IC5A 3VEQB 3BIUH 1QBNA 1H8DH 5C1UA 3S9BA 1E34B 1AB9B 3RXDA 1YPMH 3QN7A 4OGXA 2BD8A 4ZMAH 1QURH 2Q1JA 1HDTH 1S81A 1O2KA 1RD3B 1VCPA 2BDHA 1YPHC 1TFXA 1AWFH 1TPAE 3GYLB 2DUCA 2KZ4A 1ACBE 1COWD 3UWIA 1DPOA 3UOUA 5DO4H 3KEEA 3PV5A 5EJZA 6CHAC 1YC0A 1YYY1 1GPZA 2J5UA 2Y5HA 5LH8A 3T5FH 3B8JA 2FS9A 4UFEH 3BTWE 2PKAA 5I25A 2YNAA 3M35A 3SV7A 2VB0A 1J8AA 2QA9E 3A84A 2F3CE 1BBRE 1CA0C 1HFDA 1EJNA 3MI4A 5GIBA 3RDZA 1LTOA 1BIOA 3M5OA 1P2QA 1IHSH 1PQ5A 3DUXH 4H42U 1DWDH 3UTUH 4AOQA 1G2MA 3LGVA 2XCNA 3MFJA 1FMGA 1SG8B 3HPTB 2ZC9H 3EYDA 4YXWD 5EOKA 3OU0A 3GY6A 3ATKA 2BD4A 5JBBS 3KQ5A 4GHTA 2ZKSA 1DOJA 1UK2A 2HOBA 4JZEH 5E2OA 4AYVB 1DE7H 1Q2WA 2CHAC 1BQYA 2J98A 2ZGBH 2WPJS 3HATH 1MBQA 1BA8B 4TPYA 1QCPA 3A80A 1A5IA 1UK4A 2RG3A 5FCKA 4XDEA 4B6FA 4ZH8A 1P2IA 1AE8H 3Q00A 3A7VA 1BRUP 3SUFA 1UO6A 1G37A 1GBEA 1AMHA 2BDYA 1HUTH 2BZ6H 1SL3A 2VJ1A 1NS3A 1VZQH 2OC8A 2A5KA 4CHAB 4F55A 1OYTH 3EGKH 3MMGA 4ISIH 1GI0A 2RDEA 1GI8B 3BG4C 1PPBH 1Y5AT 1OYQA 5AVDA 1RGQA 3URCA 1HLTH 4UONA 1AZ8A 1O2JA 1EAWA 4HGCA 5K7RA 1C5TA 2BDBA 1L4DA 1P10A 3UR9A 1VGCB 2FOGA 2I6QA 1T8MA 1HIAB 1QZ8A 2GV7A 1RFNA 1ZHRA 2ZFSA 4X0WU 3LIWA 3SV2H 5HKKD 4LK4A 3MTYA 1AZZA 1TA6A 1NBMD 4NFEA 1SFQB 2G55A 4LZ1H 1ARCA 1OWDA 3DT0H 5HM9A 1A61H 5A0CA 1SBWA 2BVXH 3BTEE 2OBOA 2WPLS 3VB6A 4I7YH 1C1MA 1W0JD 3KYGA 1WDIA 8KME2 1Z8JB 6GCHF 1SHYA 4IMZA 3G01A 1WBGB 1A4WH 1BTPA 1OWHA 2D26C 2ANMH 1LVOA 1GJBB 5A8ZA 5F53A 1T4VH 1SC8U 2HVYB 1QJ7B 3V12A 4ZHMU 1O3NA 1PPGE 1GBCA 2PR3A 2Y5GA 1TRMA 2J95A 1DSUA 1ZYOA 4Y71A 5CDFE 4AB8A 4OM9A 3U98H 2VH0A 1A3EH 1O35A 5GNDA 3SJKA 4WXIA 1P3EA 2ZG0H 4WY3A 2ZHEH 4FUFA 4VGCC 1BTYA 3EA9A 5A0AE 4DT7B 3FANA 2I6SA 1TGSZ 3MNBA 1GG6C 1GJ9B 3WWBA 3UNSA 3D62A 4E05H 2ULLA 1WU1A 3SOSA 4DVAU 1XKAC 4BOHA 1BBRK 2O8UA 1WOFA 4RI0A 4Y6DA 3V7TA 3DA9B 2LELA 1PPCE 3UREA 4ZKRU 1HAOH 2IPQX 5H4IB 4ISNA 1Z6JH 3ODFA 1C1WH 3SJOA 3RXKA 3MH4A 3JZ1B 3OFND 4B2BA 3SQEE 4FUEA 2P8OC 4GAWA 2V3MA 4MNXA 1P2NA 3HGPA 2BX4A 2ZFRH 1ZPZA 3E0PB 3MHWU 4SGAE 1IQKA 1QBVH 1GCDA 2A2XH 1AUTC 4JZDH 4ASUD 5C20A 3RXUA 4NSYA 1PQAA 4CH8B 1E0FD 1E36B 2FTMA 4B2CA 1IOEA 2KCYA 1JRTA 2Z9GA 1ZRKA 2ZCKP 4F4OC 1QBOA 5EU8A 1P2MA 1YPGH 2A4GA 3SNAA 4A1TA 1LHFH 2ZDMA 2ZFPH 1YPKH
chains in the Genus database with same CATH topology
4PROA 2ILNA 1TABE 4XBDA 1GDQA 1HAGE 1S5SA 2OUAA 1AIXH 2UWLA 1WSSH 2O8WA 1HAHH 2ZDKA 2ESTE 3ZVCA 1W2KH 4UD9H 1KXFA 5FX6A 3FAOA 5HM2A 1H8IH 1GJ6A 1V6DA 1ZSKA 1AO5A 1O5CB 4NA8A 3RXSA 2XCFA 1TMBH 1OSSA 1SR5C 1GJ8B 2PW8H 3LKWA 2W7SA 2XRCA 1BT7A 4BAQB 2FODA 1XX9A 2ZGHA 1TMUH 3ELAH 1LPGB 4E7RG 3NXPA 1EB2A 5E0JA 3H5CB 3P92A 3A7WA 1PPFE 1EB1H 3GISB 1WQVH 1IQEA 5C1XA 1O36A 1QGFA 3PWBA 5LPEA 2C8XB 1L1NA 3BIVH 4JYVH 3ZZBA 3GOVB 3M5LA 3ZVGA 1K22H 2C93B 5F6MA 1JXPA 1ETTH 3LC5A 4MQAA 2O8LA 1JRSA 1CBWC 2BDAA 3A89A 1SGDE 1DY9A 2SGPE 1KLTA 1YCPH 2STAE 4XSKU 1A0LA 4K5ZA 3A7TA 2BZAA 3BTFE 4MPVA 6GCHG 3A83A 3ESTA 2Y7XA 2STBE 1GMDF 2P16A 3K9XB 3QTOH 4Y7AA 1HJAC 4E7NA 2QN5T 1LHCH 3QZRA 1HAIH 1LDTT 3UY9A 2A4OA 3NWUA 1ANDA 2C8WB 2GVFA 1MQ6A 4Q80A 4KP0A 5EQRA 3GY8A 1BTXA 1P9SA 2QXJA 3B9FH 4H6SB 5FBEA 4TPIZ 3ZZ5A 1XUIA 5E0HA 1FIWA 3M7TA 1XKBC 3GCOA 3K6ZA 3SQHE 1C2IA 4WVPE 2OXSA 1VGCC 4CR5A 7KMEH 1MMJN 3BTQE 3E1XB 4AFZA 5JB9S 1HGTH 2QF0A 1TOCB 1AHTH 1TMTH 3RXRA 3ZZ6A 1P9UA 3P8NA 1GBFA 3C1KA 1MTNB 1FIZA 4ZKOU 4IW4E 1IQHA 4JCNA 1LO6A 3V0XA 2UUYA 2LNCA 4MPXA 3EDXB 3KQEA 4AYYB 3MU0A 3QGNB 1O3LA 2G5NA 1LHEH 1OP8A 2PGQB 4O3TA 3N7OA 4XOJA 5EXLA 4I8JA 1XXFA 1V2QT 1O2HA 1HIAA 2VIVA 1THSH 2ZQ1A 4MTBA 1H4WA 1C5WB 3A8DA 3RXHA 1HXEH 2G00A 1C5MD 4BXSA 1NRSH 1B0EA 3UIRA 4YOJA 3F9HA 3RUOA 1O3GA 5T6FA 2VVVA 3SI4H 1BTZA 1D6RA 3ZZ3A 2KAIB 3AVZA 3Q3YA 2ASUB 4AG1A 1W0YH 1GL0E 2SNWA 3E16B 4JZIA 2EC9H 3HGNA 1C5LH 1O2SA 1HCGA 1ELDE 2LPRA 1EAXA 1Z8GA 4O3UA 4NSVA 2C8YB 1ZHMA 1FLEE 1T7CA 2AH4X 3O8CA 3M5MA 2D1JA 1SVPA 4B76A 2ZDAH 2R2WU 1BTWA 2JETB 1UTJA 3PMJA 2A7JA 1Z7KA 4X1PU 2HWLB 2FP7B 4AFSA 1T4UH 4HI3A 1QRWA 4AFQA 2VIPA 2Z3CA 2AMDA 2WV4A 2Z3DA 1VR1H 3A7XA 1O2ZA 4Z6AH 3DFJA 5E8EH 4O97A 2VIWA 3U8TH 3FP6E 4FU7A 1FN8A 2ODPA 2EI8A 4A7IB 1O2VA 1IQNA 2Z6BD 3E6PH 5DP9A 4B75A 5FCRA 1PPEE 4NIWA 1BB0B 3STIA 1QHRB 3D23A 3LGTA 2Y7ZA 1TGNA 2GT8A 4MLFB 3U69H 3LONA 1AGJA 1AY6H 4CRDA 1GGDB 5I46H 2BY8X 3S7HB 2BD2A 1A5GH 1MQ5A 4YT6H 1ANEA 4B73A 3BN9A 4BNRA 1DICA 1P0SH 2GMTB 3SU6A 1C9PA 1NU9A 1C2GA 3RMNH 4NG9H 2K1QA 4BAKB 2OP9A 3P17H 3UR6A 1C5VA 1SGYE 1EP5A 3PLPA 3U9AH 2H1UA 1ZJDA 1AD8H 1L0ZA 1P09A 3MO6A 3MNSA 1YLCA 5K0HA 1C1TA 5F8TA 4ABDA 2AS9A 1SGEE 3D49H 1QTFA 3A7ZA 1RTLA 1J16A 3RMLH 5JYIA 2TPIZ 5C2ZA 2BOHB 3F1SB 3RXGA 4B2AA 1TPPA 3FZZA 4IN1A 2C4FH 2BOKA 1C2MA 3MU5A 4Q2KA 1QR3E 1IQIA 2A31A 2BY6X 2TGPZ 4WH6A 2AMPA 4LOYH 2F9VA 2ODYB 1FY4A 2B7DH 1J17T 1SQAA 3MWIU 1P06A 3O8DA 2FOEA 4IMQA 5ESBA 2R0LA 1K1LA 1NM6A 2JH5D 1ZZZA 1MTVA 1K28D 4OS4A 5T6DA 2ZIQH 1EOJA 3A7YA 1CQQA 4X8TH 3L3TA 3H7TA 1CGIE 2IN2A 1FQ3A 1O3MA 1O33A 4KKDA 1M9UA 1GJAB 1O3OA 1SMFE 1GJCB 3RP2A 3RLYH 3PV4A 1EOLA 5DP8A 2GZ7A 3GCHC 4INHA 1A2CH 3A8BA 3F9FA 3U1IB 4U2WA 3GCTF 1GI7B 2C3SA 1ORFA 1TGTA 1YF4A 1GBMA 1G3CA 1QIXB 1EZSC 4A1VA 1MTNC 5EQSA 2A7HA 3RXIA 2HNTE 5CHAB 1O34A 3SNEA 4I32A 1AFQB 1DITH 1TWXB 2FYQA 2XYAA 4A5TS 1O2PA 3RM0H 2ZHFH 1NTPA 4BTIB 3UPEA 1UMAH 2XBVA 1K2I1 2OD3B 1JIMA 1C4U2 2PLXA 2WV5A 5A09A 1O2LA 1O3IA 1P04A 4Y0YE 4K69A 1FAXA 1QA0A 3UUZA 3SN8A 2ZPSA 5CE1A 1SQOA 2GX4A 2CV3A 5F8XA 4KTUA 3M3SA 2QV1A 2D8WA 1B5GH 1QQUA 4DY7B 1HAXB 4AN7A 2XBWA 1WTHD 4OS5A 3TGKE 1W8BH 1C1NA 5EPNA 1W13U 1GI5A 2OC0A 2FOHA 2P95A 4ABHA 2AERH 4OS2A 3VB4A 3R3GB 1ZRBA 3GY3A 3RXMA 1T8OA 1G3EA 5DP6A 1VJ9U 2BDGA 1THRH 2BYAX 2KAIA 3BV9B 1Y3VA 5L6NH 3CENA 2BLWA 2JETC 2A45B 1BMAA 3KQBA 1BTHH 1LVMA 1ELCA 3P70B 4KTSA 3BTME 4X1RU 2TIOA 3A8CA 3RC4A 1ZOMA 1TNLA 2PFEA 1P8VC 4UFDH 4D9RA 3M7UA 2ALVA 1Y3YA 1GJ5H 3GDVA 4JZ1A 4CBOA 1ID5H 1SGFG 1TQ7B 1BUIA 4K8YA 2J92A 1PPZA 1O3FA 1V2VT 4FUJA 3T29A 2O8TA 1DXWA 3GY4A 4DOQA 3RXCA 3C27B 2B5TB 2NU3E 4MG3A 1GVZA 2AYWA 2OINA 2ODQA 2SGAA 3OYPA 3RXOA 3T62A 1F0SA 1G36A 2FEQH 3RMMH 1LMWB 2P94A 1EJMA 1GGDC 1CA8B 1GI6A 1GDNA 1O5GH 2D2DA 2J2UA 4UFGH 5ABWA 3Q77A 1AKSB 5DGJA 4MNWA 1UVSH 1VCQA 3K6YA 1BHXF 2QXIA 5C1YA 1BJVA 1O2IA 4WJG2 1HB0B 2Y6TA 4Y8XA 4JZFH 5EXNA 1RRKA 1GBIA 1BZXE 2FOBA 1EKBB 3AASA 3SORA 1DM4B 2BX3A 1C5QA 5ETXA 3RXBA 2A32A 1DANH 3RLWH 5JB8S 1PPHE 1ELTA 3EE0B 1DX5M 5LPFA 3BTKE 2ANWA 3RXTA 1RXPA 4CRCA 2V3HH 1BRAA 1NPMA 3RMOH 1ESTA 3FP8E 3IWMA 5AFZH 1TX6A 1H9IE 3EA7A 3M3VA 3EAJA 1WCZA 2IJOB 2PTNA 3PO1B 3GCTG 3S7KB 2QC2A 2ZTYA 1CHGA 1GBDA 1GBTA 2AGEX 4CH2B 2NU1E 4K60A 1MU6B 3U8RH 1O3DA 1C5YB 4O9VA 3RU4T 3LT3A 1O2WA 4ZAEA 3TK6A 2TBSA 1DLKB 1DDJA 1ESBA 3A86A 4QT8C 1WUNH 1FY3A 2BLQA 2FLBH 2RA0A 1GHYH 4UFFH 3EA8A 3BG8A 1SSXA 1P05A 1Z8RA 3ATIA 2QF3A 2JH0D 3PB1E 2WYJA 2ZGXH 2SNVA 4GSOA 1BOQA 2QXGA 1GCTB 1W12U 1U6QA 3SBKA 3TGJE 1OWEA 4NWKA 3Q76A 1C5OH 1E35B 2BD3A 3ATMA 1RIWC 2J4IA 4ESTE 3TPIZ 1XUGA 3T28A 3TNSA 3ITIA 1UVPA 1MUEB 1O3CA 2W7UA 2ANKH 3I78A 4F49A 3A8AA 1KLJH 3PTNA 3MH7A 3P8OA 1C2JA 4TWYA 1D3TB 2SGEE 3AW1A 2J94A 3IG6B 1SI5H 1XMNB 1N6XA 2BTCE 3M3TA 2ZO3H 5CHAC 2GTBA 4ISOA 1O2UA 1D3QB 1DUAA 1Z1JA 1S84A 1AFQC 1WYKA 6ESTA 2VU8E 1C2HA 1A5HA 3TJVA 4WH8A 1ZMLA 2ANYA 2FIRH 2XXLA 4ASHA 4AX9H 4NFFA 4J2YB 2WUCA 4AGKA 1TBZH 4IC6A 3OY6U 2PSYA 7GCHF 2BD5A 3MOCA 1AB9C 4X2WA 4FU9A 1ZSJA 2BMGB 1V2UT 2CMYA 3NKKA 1LKAA 3RXVA 1OKXA 2O8MA 1GHBG 3KQDA 2ZECA 3TVJB 1MKWH 1MTWA 3QO6A 1C2EA 1G3BA 1K1JA 3MO3A 3VB3A 2GT7A 4WXVA 4Y7BA 2R3UA 1TPOA 4GHQA 1SLXB 2A2QH 2EI7A 1L4ZA 1IQFA 1WTGH 1IQJA 4RSPA 5EODA 4BANB 1XUHA 1EAIA 1TPSA 3K2UA 1K9OE 2W3IA 2PKSB 3TNTA 3KHVA 1VITF 4WWYA 1Y3XA 1OP2A 4M7GA 1C5NH 1K1NA 3BTDE 3P6ZB 5HYOA 1KXAA 2TGAA 1FDPA 3A82A 3MH6A 4ISLA 1MTUA 3UQVA 5JBAS 3I77A 5HXFA 1V2PT 2AGIX 1DT2A 2GV6A 2PWXA 1OWJA 1SFIA 1BMNH 1DS2E 1O5DH 4I31A 2V3OH 2ZGCA 1OP0A 1GBBA 1GHAG 1MD7A 1Y8TA 1TX8A 1ZSLA 1A7SA 2J38A 4CHAC 2G52A 5T6GA 5C3NA 1GDUA 5J4SA 3SV9A 1EPTB 1YP9A 2P3TB 5B6OA 5F03A 1ANCA 4K1EA 2P3FH 2FM2A 4ABBA 5IDKA 2FOAA 1NRRH 4DURA 2BY5X 2GCHF 2M5TA 2W3KA 1MZAA 2BXTH 2ZFTA 2CF8H 4Y76A 4ABJA 3SHCH 4GPGA 5GWZA 1DWEH 4KTCA 1TRNA 4ABIA 4THNH 1O2NA 4AB9A 2HLCA 3A85A 5SGAE 4XBCA 4AGJA 1PQ8A 2SGFE 1KXDA 3NK8A 2UUKB 1G30B 2XC4A 4A92A 1FNIA 3TJNA 5TCCA 1T8NA 1LHDH 1O2OA 1AKSA 3PLBA 4YLUA 1QFKH 1TONA 4WF8A 3GY5A 1AFEH 3NUMA 4RN6A 1QJ1B 1LPKB 3E0NB 2QIQA 1NT1A 2BY9X 1HXFH 1A0HB 2BB4A 4YLQH 8LPRA 1V2KT 1MKWK 1D6WA 4H6TA 3MH5A 2NU0E 2HALA 4NCYA 2AMQA 1H9HE 1CSOE 1EP6A 5GDSH 1UCYH 4WMDA 1TE0A 5PTPA 1E38B 1F2SE 2YOLA 3OSYA 3K65B 1V2JT 4INLA 2HPQH 1EZQA 2Q6DA 2XWAA 2G51A 1O31A 1C5PA 1UTMA 3A88A 1HPGA 3T26A 3UOPA 5GXPA 4R0IA 7GCHG 1F0UA 1TA2A 1TRYA 1JIRA 1FZZA 2ZA5A 3MU8A 2ZI2H 1BJUA 1W7XH 3RU4D 3SU5A 2BY7X 2ZQ2A 1D4PB 4I8KA 1W0ZU 1DLEA 1GCTC 4NIYA 1V2OT 1O2MA 1EX3A 1YCPK 2FTLE 2ZHWH 3M61U 2FX6A 1JOUB 4FVDA 1K1MA 4CBNA 2G4TA 1UTKA 2Y81A 2BDIA 3BTTE 3LOXA 1YPJH 3R0FA 4ZHAA 3VB7A 1F7ZA 5A2MH 1GVKB 4BAHB 2SGQE 1CA0B 4D7GA 2VIQA 4X8VH 1O3EA 2RCEA 1XUFA 2DE8A 1ZJKA 1VITG 2ZFQH 3DFLA 3OX7U 4BTTB 1NN6A 6LPRA 4DIIH 1GJ7B 1KDQB 2GDDA 5A8YA 2AGGX 3S9CA 1FY1A 4BTUB 1CT4E 1G3DA 8GCHG 4MDSA 2ZU2A 4YM9A 2AEIH 1C2FA 4ISHH 4YOGA 1PYTC 2FWWA 5BPEA 1SGIB 3U1JB 1P57B 2EA3A 1WQSA 4OS6A 1SLUB 3BF6H 4Y8YA 5IYTA 1HAPH 4GUXA 3OTJE 3AAVA 1F5RA 3MO9A 3ZYEA 2WYGA 3ZZDA 2HNTC 2PHBA 3TIUA 2UWOA 2F9OA 3TH2H 2B8OH 4J1YA 3RXFA 2A7CA 1BMMH 2FDAA 5LGOA 2FPZA 2AFQB 1PYTD 3TLOA 1ELBA 1O30A 2QCYA 3T25A 1X7AC 1Q3XA 5E0GA 3M36A 2GCHG 4MVNA 3ZVEA 2TGDA 1SOZA 3QUMP 1BITA 2H9TH 2VIOA 1SGPE 1QL7A 2A1DB 2PKSC 3GDSA 1C5SA 4FUDA 2WINI 5JDUB 4Z0KA 5CMXH 2BLOA 4BAMB 2GGVB 1SGTA 1NRNH 1O3AA 4U30A 3SJIA 4TYDA 3F6UH 1D3DB 1ANBA 1SGNE 2OBQA 2AIQA 2OQUA 4B74A 1QB6A 2SFAA 1ELEE 1W7GH 1K1IA 3SU2A 4X8UH 3KGPA 1GI2A 4WMEA 2XBYA 5DP4A 5ESTE 2BQ6B 1C1QA 1MAYA 3CS0A 4NA7A 2F83A 4MPWA 2H6MA 2VVUA 3BSQA 5DP5A 3GY2A 8ESTE 1C1RA 1RJXB 3NPSA 3UQOA 3ZZCA 4SGBE 1D9IA 2B0FA 1KYNA 5E2PA 1ZPCA 2ZPRA 1GBKA 1P12E 4XE4A 5L30H 2HNTF 1HV7A 3H7OA 1QRZA 4K2YA 4B71A 1MU8B 1O5BB 5A0BA 1NRQH 3DD2H 1CGHA 2OCVB 4NGAH 1F5KU 4ABGA 3F9GA 3KF2A 4K8BA 1EPTA 2H5DA 2ZNKH 1C5UA 1FUJA 4NA9H 2GZ8A 2J34A 1C1VH 1N8OB 1L2EA 2ZU1A 3BEFB 1GVLA 2P8OB 1ABJH 1Z1IA 3Q3KA 1SQTA 3KIDU 4LXBH