1C2MA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2mA02
4AFZA 1P2NA 3EDXB 1Y5AT 1CQQA 4XDEA 4WF8A 3MHWU 1FY4A 2C8YB 2ZFQH 1KLJH 1MTUA 1C5ZB 2KAIA 2UWPA 4Y7BA 5LPEA 1ELFA 1HPGA 4A7IB 1CT4E 1V2KT 1ZRKA 2R9PA 2A45B 4MVNA 2G00A 1HAOH 1C9PA 2EI7A 3AVZA 4O3TA 1MQ6A 1UTKA 1AQ7A 2XCFA 4Z6AH 3Q00A 4MPXA 1EAUA 3LGWA 1TNLA 3TJUA 5DJ7A 1Z6JH 1TALA 1IQGA 5JBBS 4B2CA 4F4OC 1O3NA 2BVXH 2R3YA 2R0LA 3E6PH 4U01A 1VITF 1ELCA 2D2DA 2PKSC 3TJOA 1RIWB 1V2JT 1MCVA 3SGBE 1SR5C 3VPKA 4YESB 4WXVA 2ZFFH 2ZHQH 1LPGB 1U6QA 5LPFA 1H4WA 5TCAA 9LPRA 1HGTH 3A7XA 4BTIB 2Y81A 4B74A 1LHEH 3SU3A 1T4UH 1YKTA 2H2ZA 1QQ4A 1QGFA 4DW2U 2EI8A 1H9HE 2ZIQH 2VH6A 3QK1A 5JB9S 2ZFRH 1A1RA 1HAVB 4AYVB 1GHYH 3GYLB 1DVAH 1GMDG 3UR6A 1NROH 4LZ4B 2FOEA 1SFIA 3RLWH 4LXBH 1JIMA 3V0XA 1L1JA 4LZ1H 1Y3UA 2AERH 1IQIA 4A1TA 5EPYA 2HPQH 4D7GA 1O3JA 1O37A 3EA8A 3IWMA 2ZU2A 4AN7A 3AASA 4B1TA 1G3EA 4MPVA 5FPTA 3SUGA 3VXFH 2O8MA 1ZJKA 1C4U2 4NFFA 2VIQA 3GOVB 1O38A 4K1SA 3KL6A 2F83A 2RDLA 4Z0KA 2Z9IA 1ELBA 1GBFA 5FCRA 1FAXA 2IN2A 1FQ3A 3U98H 3LOXA 3MNSA 8GCHF 3PLPA 5J4SA 5DP6A 2W3IA 4AZ2B 7ESTE 2XW9A 1YCPK 3RXOA 1OYQA 2V3OH 5T6GA 2FOMB 5F8XA 3DFJA 3M3TA 3URDA 3KNXA 4ZHMU 5FXLA 1HAIH 5AFZH 2O8LA 3RXLA 1SLUB 4FUFA 1O2KA 1AFQC 1GJAB 1O3OA 3PB1E 5EXMA 2J94A 4KTCA 1O36A 3D49H 1DICA 5F8ZA 2VGCB 2ZFTA 2W5EA 4ABBA 2HPPH 3UNRA 1YGCH 1NFUA 2Q6DA 1P2MA 1LTOA 4BAMB 4WY3A 3L6PA 2ZDNA 3KQDA 2ZDAH 4D76A 1RJXB 2Y7ZA 1HXEH 4GLYA 2GP9B 1ZSJA 4ABEA 4K1EA 1GI2A 5ESBA 3MU8A 1WTHD 3WY8A 3UR9A 4X8TH 1NFWA 1O0DH 1EPTB 1QRZA 2Z9LA 4FUHA 1MBMA 3QGNB 2VB0A 4WMEA 2Q6FA 2NU3E 1O2TA 1NO9H 4ABJA 5HGGA 1CO7E 1UTMA 1O2UA 3A8CA 3P6ZB 1TA2A 3TVJB 1AN1E 3NKKA 4AG1A 1P0SH 4NZLA 1XX9A 2PWXA 1CBWB 1AIXH 1HBTH 1C2GA 4OGYA 3LJOA 2GT8A 4ABAA 4NSYA 4XBCA 2ZCLP 1L4DA 1VJAU 3A85A 2PUXB 5FX6A 1NM6A 3E0NB 1NC6A 3E0PB 1ARCA 3RMOH 1TRYA 2OINA 1C4V2 2ZHDA 4RSPA 1TABE 5GDSH 1E38B 1Y3VA 2PGBB 1TPPA 1P09A 4KP0A 1K21H 4AGKA 3UPEA 4GPGA 2CXVA 1BTXA 3LIWA 1ZTJA 4AYYB 4IC6A 2BXTH 4X6NA 3A8DA 4OS2A 4D9QA 1V2LT 1AE5A 3SI4H 2ZQ1A 1BOQA 1GVKB 4FUBA 3NK8A 3A8AA 4LOYH 1O32A 2Q6GA 8LPRA 2ZU3A 1C5SA 1HV7A 1O39A 1HAVA 2G4UA 2QXGA 4O3UA 4SGAE 5ESTE 3H7OA 1TRMA 3EGKH 1LKBA 2J4IA 4ABFA 1BRAA 2WPKS 3DHKH 3F9GA 3KEEA 1W7XH 1GGDC 3TGIE 1A61H 6LPRA 2Y6TA 1HAGE 1W13U 3F68H 4ABHA 1V2UT 4ABDA 1P9UA 1WAYB 1QHRB 1TRNA 1UTLM 4X2XA 1H9IE 3GCNA 4UEHH 4YOGA 1A0LA 2P59A 3UNSA 4ZHLU 1N8OB 1UTJA 1CSOE 1TBRH 2ZPRA 4AG2A 2FX6A 1BB0B 1TWXB 3EA9A 3RXKA 5HM2A 1KXCA 2VWLA 2BLVA 1K1JA 5PTPA 4PROA 1GI8B 2H5DA 3SV2H 4ABIA 1TX8A 4ZHAA 1TNHA 1YC0A 1GI7B 3RXSA 4GVUA 2FYRA 1KDQB 2ZHWH 2Z3EA 1PPCE 3QTOH 1GBKA 2VIDA 4J2YB 4H6SB 3HPTB 1GPZA 3SU4A 3MU0A 2C4FH 3ZZ3A 3RDZA 1HIAB 1KLTA 1S84A 3TH3H 2BQ7B 3SORA 3K65B 4X1SU 3V12A 1NPMA 2GV7A 5C20A 2ZCKP 2ZDLA 4JZDH 1ANBA 3SHCH 3A84A 1LDTT 1C5UA 1AKSA 5T6FA 5DP4A 3M5LA 3ZVBA 4X6PA 2C8ZB 2FS9A 4DJZB 1GHVH 2BVRH 1ANCA 1P57B 2HNTF 1SOTA 1GHBG 1G3CA 2J95A 3SQHE 2XC5A 5ETXA 4KGAA 2TIOA 2ZQ2A 1CGJE 3A7VA 4CRGA 5EW1H 3MNCA 1JXPA 4ISIH 1C5TA 3LGYA 2ZCHP 2QA9E 5E2PA 2GKVE 3T28A 3KIDU 1JOUB 1O5GH 2AMQA 3EA7A 1C1WH 2J38A 3SUEA 4GCHF 1OOKB 1YPGH 3M5NA 1XXDA 1FI8A 1SGFG 1O5CB 2QAAA 2ZEBA 1QB9A 2P16A 1HB0B 5EODA 1E34B 3LGIA 3QO6A 3MNBA 1FY3A 1K1NA 1QL9A 1ZR0A 2QGRA 1HJ9A 1O3IA 3U8OH 4RKJB 4MQAA 1Z7KA 1S81A 3RXUA 4WMFA 3RUOA 1T8LA 3Q77A 5EW2H 3BEUA 1C2HA 4JK5A 3RXFA 1ZHMA 1G37A 3M7TA 5C3NA 2J34A 2WYJA 4IC5A 1DT2A 2NU4E 7LPRA 1ABJH 4A6LA 1HJAB 1WOFA 4UD9H 1LPKB 4JCNA 4LK4A 2Z3DA 2ZFSA 1JRSA 3MOCA 3RXRA 4K8YA 2ZWLH 1MD7A 2H9EH 4IGDA 1G3DA 3LH3A 1V2RT 1AFQB 4MDSA 3TITA 4TYDA 4Y0YE 3SGQE 2AMDA 2RCEA 1V6DA 3RXQA 4A5TS 1OWEA 2HGTH 1Z8RA 3RM2H 1UHBB 1OXGA 1GVZA 4H4FA 3TK9A 2DE9A 1O31A 1GL0E 1RTFB 4YT7H 5A0BA 5JBCS 1MTNB 1BHXB 2FYQA 1QJ7B 4YOIA 4Y8ZA 2AGIX 3ODDA 6CHAB 3RXHA 3TU7H 1ANDA 1IQKA 1GBLA 2GMTC 2WINI 2ANYA 2I6SA 3VB7A 3E1XB 4MLFB 4I7YH 4CRAA 3B8JA 2ODQA 2Y5FA 3R3GB 4BTUB 3D62A 2FXRA 1O33A 3MU5A 5T3HA 3SBKA 4ZH8A 4AB9A 3KQBA 4BTTB 1J9CH 2R2MB 1LVBA 1O2RA 1YCPM 1INCA 1LMWB 2ZF0H 2H9HA 1GBHA 1TNJA 1XMNB 2ZI2H 1NT1A 1ABIH 1PYTD 2BMGB 2XC0A 3A89A 1L4ZA 2FDAA 3ZZ9A 2JETB 1DUAA 5TJXA 1EKBB 2FLRH 3HGPA 4Y6DA 1PFXC 1KSNA 3PWCA 2PKAA 2UWLA 1C2DA 2ZU1A 1PPGE 2BB4A 1AY6H 2AIPA 1FIWA 1AO5A 2IPHA 2A5KA 2BYAX 3SUFA 1QL7A 1XM1A 3IITA 2HWLB 3MNXA 1XUFA 1LHGH 1TBZH 3NWUA 3P95A 2VVUA 1BTWA 3FANA 1DITH 3DFLA 3LGUA 1BTHH 2PFEA 3E3TA 2M5TA 3PTBA 3UWJH 1ELDE 1C2IA 1LHFH 2XYAA 2CF9H 1P9SA 2GCHF 2XRCA 1SG8B 5C67A 4JZEH 3M7QA 2H6MA 3TNTA 5E0JA 3ZV9A 3EAJA 2VIWA 3H7TA 1EOJA 2G5VA 2PKAB 2BX3A 1LKAA 3RXGA 3PMAB 3LGTA 2BX4A 1BTPA 4CRCA 1QBNA 2ALPA 3BTDE 3ZZ5A 1WV7H 4DURA 3S9CA 4AX9H 4BXWA 3DT0H 5JPMH 1SGTA 1AWHB 3UIRA 3VB5A 3A88A 1BZXE 1BIOA 1E0FD 1D3QB 1UK3A 4YOJA 1D6WA 2VJ1A 1N8OC 1AFEH 4K3JA 4DIHH 2BDCA 2Z9KA 4XBBA 1K1PA 1ACBE 4X6OA 4NG9H 4ISNA 1O5BB 3QGJA 3ZZDA 2VVCA 1K2I1 1XVOA 1S0QA 3E8LA 5GIBA 4X2VA 1IQJA 4YTAA 2FO9A 2G8TA 4ZXXH 1AUTC 4YLUA 1N6YA 3LC5A 1GJ9B 1UVPA 2G81E 1OWKA 1AKSB 3T27A 2SNWA 2BDAA 3PROA 1FPCH 1JBUH 2YOLA 1MZDA 3STJA 3S9AA 3U8RH 4H42U 1GHZA 2BXUH 2NWNA 1AI8H 4I8HA 3OU0A 4BAQB 2D26C 3AW0A 3K6YA 4AOQA 1IQHA 1O3LA 1O2GH 3U69H 2ZA5A 4Y8XA 4OS1A 1DSTA 1GJ4H 5A09A 2A4GA 1A2CH 1NN6A 1O2YA 4WXIA 5AHGH 2VWOA 1SGQE 3PMBB 1BBRK 1S6FA 3GCTG 3P70B 3NXPA 1PQ8A 1HJ8A 4MPWA 2BDBA 1BJUA 1H9LB 1IHSH 2ILNA 2XNIA 3QX5H 1NU9A 2FOFA 1Z1JA 2OBQA 1Z6EA 3A83A 3RC5A 2W7UA 5L30H 1YF4A 1FPHH 4GUXA 3PMJA 4ABGA 1TX7A 2WUBA 3M3VA 1BQYA 1YCPH 1RRKA 1TBQH 5K0HA 1C1TA 1FMGA 1C5QA 1VR1H 4Y10E 1A3BH 1C9TA 1C2EA 3UREA 3T5FH 2R3UA 2F9BH 1QB1A 1F0UA 1M9UA 1A7SA 1YM0A 4FU8A 4TWYA 5JBTA 1YYY1 2OCVB 1P2OA 3G01A 1KDQA 3A7YA 1C1UH 1IQLA 1SC8U 1ZYOA 2P3FH 1SGRE 5TCCA 1AVGH 1HRTH 1O30A 3ODFA 3UQOA 2PKSB 2ANMH 3RU4E 3T62A 1XVMA 3PYHA 2OUAA 1O2VA 4Q7ZA 3E91A 1G2MA 3O8RA 4WH6A 3RXTA 3SJOA 3SZNA 1O5AB 3ENSB 3RMLH 1P06A 1EUFA 1QRXA 5AF9H 1XUKA 1DY9A 3AW1A 1T8MA 3LPRA 3MFJA 1T7CA 3F9FA 2Y7XA 1KTTB 1HJAC 5DP3A 1F5LA 4TY6A 1UVTH 3I29A 1NRSH 3UWIA 4NWKA 1BRUP 5B6OA 2ZTXA 1BTYA 5EGMA 3ATWA 1FY8E 3BTME 1GJDB 1MZAA 2ZGCA 1LVYA 1ZMJA 1AB9B 2TGTA 2A4RA 2WUCA 4MTBA 2AH4X 1KXFA 3P17H 1QJ1B 1C2JA 2AYWA 1RXPA 2SGDE 1OPHB 2TBSA 1GCTC 2UUFB 3ZZBA 1UJ1A 3RXEA 6CHAC 3BG4B 1C1RA 2VU8E 4NIXA 3A86A 3SV8A 2XBVA 2OC1A 5GCHG 1AZZA 2A31A 4GHTA 6GCHF 2XCNA 2J9NA 4FVDA 2FOAA 3SHAH 1T8OA 1YPEH 3SNEA 4MG3A 3SUDA 3TH2H 1WQVH 4GCHG 2G55A 2AFQB 2FI3E 1S6HA 2GTBA 2ZDVH 4WH8A 3L3TA 1O3GA 4ZKNU 2CV3A 4FUIA 1KYNA 3RLYH 1ZGIA 1V2VT 1O2HA 2ODYB 1F2SE 3GICB 4UFDH 1ELVA 1YPMH 3VXEH 1VITG 2JETC 4X8SH 1FZZA 1NFYA 3B9FH 3MMGA 3TK5A 1O2OA 1ZHRA 1SQOA 1KXDA 3PTNA 3DA9B 3SU1A 2BLOA 1VJ9U 1QFKH 3TJVA 5F8TA 2PV9B 1PYTC 3KQCA 4UONA 3SQEE 1IQFA 1XUJA 3SN8A 4GSOA 3GCHC 2GCTB 1J16A 3LDXH 1SSXA 2C93B 1SPJA 2B8OH 2FS8A 2CHAB 1EPTC 2ZGXH 5GWZA 3UOPA 4X2WA 1L2EA 3BTGE 3E90B 3GISB 2SGEE 4MNXA 1OP2A 3SW2B 1TGNA 4FU7A 2RA3A 4FUDA 2GGVB 2BOHB 2AEIH 1TPOA 1NS3A 3CENA 1XKBC 2A7HA 2BHGA 4MNVA 1FUJA 1G9IE 3OX7U 1VCWA 4INKA 1N6XA 1GHXH 2P93A 1Y3XA 3GY2A 4MNWA 1D3TB 3Q3YA 1QA0A 1V2QT 2JH0D 4RKOB 3HKIB 5L2YH 2ZTZA 3UNQA 2AGGX 1O2JA 2TGAA 2TPIZ 2BD2A 4ISLA 4Q7XA 1E37B 3T25A 3C1KA 2BM2A 4MPUA 1LHDH 1MMJN 1IQNA 1QJ6B 4MNYA 1EB2A 2SFAA 2Z9GA 2CJIA 1Z71A 1O3BA 1FN8A 1HAZB 3BV9B 1O2NA 1WSSH 2HRVA 2OC7A 2P3UB 3GCHB 1P2JA 3RP2A 2PR3A 3RMMH 5CE1A 2QYIA 2C8WB 1O2IA 1PQAA 1GJ5H 1O2PA 4D9RA 1GBBA 1ZPCA 2GT7A 4YT6H 2AGEX 1Y3YA 4O97A 1J15A 3PM3A 1ETRH 1AU8A 1DSUA 2Y80A 1D3PB 3UQVA 3K6ZA 3ZZ6A 1C1VH 3JZ2B 4K5ZA 4XFQA 5FBIA 3PV4A 2Y5HA 2TGDA 3BN9A 3KF2A 2ZECA 4FUCA 1VCPA 3P92A 1TGSZ 2AMPA 2ZKSA 2F91A 1O2XA 1EOLA 3AAVA 8ESTE 4ISOA 3MYWA 1ZRBA 3GY6A 3M3SA 4GHQA 1C1QA 4E05H 2AIQA 2XBWA 2OQ5A 3GY3A 1Z8GA 1C5PA 3ZYEA 1SGEE 4JZIA 1XUGA 5K7RA 4FXGH 1DXPA 5EQQA 5CHAB 4DY7B 2Z9JA 1BTZA 1MAYA 3HK6B 2SGQE 5JB8S 1THSH 2FZZA 3F6UH 2BZ6H 2BD8A 3JZ1B 4I8KA 5JYIA 5EOKA 1C2FA 1O5FH 3MH6A 4F49A 4Y7AA 4XE4A 2CF8H 4OS6A 1T32A 1V2NT 1BMNH 1J17T 5E2OA 3V13A 1BMLA 1OP8A 4I8JA 2A32A 3SU6A 1TFXA 1AHTH 2FODA 1H1BA 1GI6A 3FAOA 2XBYA 1PPHE 4UDWH 3TJNA 1CT2E 2BD7A 3W95A 1P10A 2CGAA 1O2LA 3OSYA 1TE0A 2SGAA 2ESTE 1B0FA 2OBOA 1Z8IB 5A8YA 2GZ7A 2BD5A 4AFQA 1LCYA 1QNJA 3QUMP 1GVLA 3A7WA 1GG6B 1P11E 2FESH 5DGJA 1ELTA 4HFPB 1F0SA 1A5IA 1C5XB 1UVSH 3GCOA 1A5GH 2H1UA 1EZQA 1O3MA 3URCA 1VGCC 2SGFE 1NRNH 2VIVA 4HI3A 4Y76A 2Y5GA 3Q3KA 3S9BA 2XWBI 2F9VA 1NZQH 1SHHB 2V35A 4R0IA 3EQ0H 1WUNH 4CHAB 3GCTF 1HYLA 3PO1C 8KME2 1A46H 5DPAA 1NRRH 4X8UH 3RU4T 4NCYA 4KELA 3P8FA 4U2WA 4HZHA 3RXMA 1DXWA 2XBXA 4HTCH 1FXYA 5EQSA 3S7HB 1GDNA 1Q2WA 1FAKH 2THFB 1W3CA 3BTEE 3KCGH 1ZMNA 1O3DA 4KKDA 2BD3A 4KTSA 4B71A 2FLBH 3K2UA 4ZXYH 1P12E 1YPJH 1E35B 4OS4A 3SNDA 2OP9A 3A82A 4WVPE 1PQ7A 2IOTA 2V6NA 3ESTA 1YPHC 2ZDKA 1C5VA 2QCYA 3MO9A 2BD4A 1DWCH 2FWWA 4I31A 1DUEA 1MKXK 1DLKB 3BSQA 1SL3A 3ZYDA 3STIA 3VB6A 1GJCB 3MI4A 4DOQA 1O3FA 1GGDB 1GDUA 2AS9A 1ZMLA 2NU2E 1OWHA 1GHAF 2ZTYA 4IBLH 2CN0H 1O5DH 5L2ZH 2PTCE 4Q2KA 1CHGA 4DCDA 3GDUA 1MTWA 2P95A 1HAXB 3KHVA 1EAWA 3QZQA 4AFSA 1MAXA 3KQEA 1C5WB 3TIUA 1VITH 2GX4A 2TGPZ 1O2SA 4DVAU 2QV1A 1UVUH 3ZV8A 3SJ9A 2BY9X 3RM0H 2EC9H 2ZP0H 1SLVB 1EZUC 3O8BA 2F9PA 1P03A 2HOBA 1EQ9A 2GCTC 3U1JB 4YZUA 2ZO3H 3Q3XA 1OWIA 1YPLH 2QN5T 2B5TB 5G4BA 3EYDA 3BTQE 4CBOA 2PGQB 1A4WH 2KAIB 3TK6A 2Z3CA 2F9UA 3ZVAA 1CT0E 4Y0ZE 2F9NA 4JYUH 1T8NA 1TAWA 2EI6A 3DD2H 5EPNA 2LPRA 1GMHG 2UUJB 2EA3A 4E7NA 1QQUA 2BDGA 2WV4A 1CE5A 1YLCA 1D4PB 1YBWA 1W0YH 1RFNA 1AMHA 3CS0A 1ELAA 2XTTB 1O2ZA 5C5NA 4Y79A 1BBRH 2VVVA 4HGCA 5EXLA 1P2QA 1BMMH 3GDVA 1SHYA 1GI0A 2A2XH 4D8NA 2VWNA 4FU9A 2ZHFH 1V2WT 2STBE 2JH5D 3RXPA 2BLWA 3M35A 1GBTA 3VGCC 1LQEA 2W26A 3TLOA 5A0AE 1T4VH 1OS8A 3SNAA 1AGJA 3FZDA 4FUEA 3A8BA 1AZ8A 5FPYA 2XXLA 1TNGA 1KXBA 1WBGB 2WV5A 5HM9A 1SLXB 1HAYB 2O8UA 2OQUA 1LVMA 3B23B 4R8TB 1DANH 3F9EA 1UO6A 1E36B 4CH2B 1HDTH 2FI5E 1S82A 5J4QA 1QBOA 3GY7A 4XSKU 3TGJE 3SV9A 2IJOB 5I46H 2A0QB 1A5HA 4A1XA 1TNKA 1TMUH 1YP9A 1TOCB 2GVFA 1K1MA 1WYKA 4AFUA 1LHCH 3M5MA 1O3EA 1NESE 2OC8A 1PJPA 1HXFH 1L1GA 3T29A 1NY22 1QRWA 5E8EH 2ZG0H 2LNCA 2P8OB 1MCTA 2QXHA 1UTNA 1TNIA 4I8LA 4YO9A 2FX4A 3MTYA 1DDJA 2Z6BD 2C3SA 3RC6A 5DP9A 1A0HB 4SGBE 1S83A 1EJAA 1DFPA 1PQ5A 1CGHA 3P8OA 1AE8H 1KLIH 4JK6A 1UVOA 4JYVH 3O8CA 2VGCC 5BPEA 5EXNA 1W0ZU 4I32A 3ATMA 3SJ8A 4THNH 1AB9C 1W8BH 1RTLA 2B9LA 4TY7A 1CHOF 1EZSC 3Q76A 1C5RA 1UCYK 3ZZCA 1EPTA 1Y8TA 2STAE 1HUTH 1DWDH 2B0FA 4BAKB 3K9XB 1BRBE 2G51A 2GMTB 1FN6A 3HGNA 3ZZAA 1LVOA 2H5CA 2O8WA 5F6MA 5GXPA 4Q80A 3T2NA 1OX1A 3NPSA 1BBRE 2ANKH 4U32A 4D7FA 4ZUHA 4YLQH 1BRCE 4B73A 2FMJA 1ANEA 2O8TA 2DUCA 5AFYH 1EATA 1TX6A 1GG6C 1SQTA 1QA7A 3FP8E 1CA0C 1DOJA 4GAWA 1FLEE 4CH8B 2P8OC 4INHA 4INLA 1CBWC 4DIIH 1F5RA 3KN2A 1QR3E 1C5NH 4Q7YA 4A1VA 1G3BA 1RD3B 4NA7A 2BY6X 1EJNA 2A4QA 4K60A 3QLPH 2I6QA 1P04A 1ID5H 1WCZA 1MD8A 2VNTA 1ESBA 4A92A 5IYTA 5C1YA 1HFDA 2OD3B 4CHAC 1UHBA 1S0RA 1HAPH 1QL8A 1P05A 3SU5A 2R0KA 1MKWH 4UFEH 1RTKA 1MTNC 2G5NA 1UK4A 4RN6A 2P94A 2OLGA 1IQEA 1TYNA 5GPIB 3RXVA 3GYMA 1XUIA 1AD8H 1O2MA 3ZVDA 4X1QU 2BD9A 1MBQA 1OYTH 2JKHA 3IG6B 3S0NA 3ATLA 2A7CA 1C1PA 2YNAA 6GCHG 1GMCG 3BF6H 4ZKRU 2OXSA 1XXFA 1EJMA 4B76A 3RXDA 1A0JA 1Q3XA 1VZQH 2J2UA 3I78A 3LKWA 2HNTE 3P8NA 2VINA 2QC2A 1FV9A 1CA0B 2P3TB 5E0GA 3SU0A 2G4TA 3A7ZA 1W7GH 4VGCB 3ATIA 3RMNH 4JYTA 1SGNE 3SJIA 4DT7B 4CR9A 2OTVA 1HIAA 1SGIB 2ZPSA 3A80A 1ORFA 4ZROA 1VCQA 1IAUA 1Z1IA 3BEFB 4O9VA 4OGXA 4X1PU 1TGBA 1V2MT 1NTPA 1EASA 3ZZ8A 2BDHA 5GJ4B 9ESTA 1H8DH 2QIQA 1AVWA 4X1RU 1FY1A 2ALVA 3SGAE 2D1JA 2D8WA 1P3EA 2ZDMA 3BG4C 5H4IB 3HK3B 4IMZA 5A8ZA 1UMAH 3UFAA 3SNCA 1T31A 3GDSA 1Q31A 4JZ1A 2PSYA 1LO6A 3BG8A 1GWAA 3D65E 2UWOA 3ZVCA 1DY8A 4B2AA 7KMEH 1GI5A 3BIVH 1MQ5A 7GCHG 2QF3A 1B7XB 2F3CE 2RA0A 1P3CA 3ZZ4A 2B7DH 3GY8A 1S85A 2PSXA 4UFFH 1QIXB 3U9AH 1GL1A 2FOGA 2J92A 5DO4H 2V3HH 3M36A 3UOUA 1BJVA 1P8VC 1X7AC 2A4OA 2BQ6B 2QY0B 4KTUA 4X0WU 2ZPQA 5LPRA 1CU1A 3TPIZ 3BTKE 1Y5BT 5DG6A 1GI9B 2GD4B 2A1DB 4FUJA 4E7RG 1HCGA 4WJG2 4X1NU 5FCKA 1C5OH 3U8TH 5C1XA 2BTCE 2ZU5A 1SFQB 5ABWA 1MH0A 2UUKB 3QDZB 3TGKE 2HVXA 1GCDA 1W14U 8GCHG 1SGYE 3SU2A 4BAHB 3C27B 7GCHF 1Y59T 3T26A 2ODPA 1OWJA 2BQWB 2ZNKH 3MO3A 3RXBA 1GHWH 1TONA 2ULLA 4NWLA 4AB8A 1CHOG 4ZKSU 1C1NA 2BY5X 4UFGH 1FIZA 3UY9A 1BUIA 2BY7X 2YNBA 1SGCA 3RC4A 4XOJA 2ZU4A 1SGDE 1SOZA 3F1SB 4ESTE 1K9OE 1MU8B 4CREA 5EQRA 1EP5A 1O2WA 5DP8A 3R0FA 3UUZA 1RIWC 1NFXA 1TPSA 3BTFE 1THPB 3HATH 4X8VH 1GBDA 2WPJS 1ZLRA 1GBMA 4I33A 1DS2E 1O3CA 1ZTKA 3DUXH 1V2TT 1XKAC 3A87A 1JIRA 1TQ7B 1K1OA 1MTSA 4K69A 3GY4A 2GDEH 3PWBA 1CA8B 1C1MA 1K1IA 3OY5U 3N7OA 5JDUB 3KGPA 1ELGA 1KTSB 1EZXC 3I77A 5HXFA 1MKWK 2HALA 1VGCB 1TGCA 3AAUA 1QY6A 2SNVA 3LU9B 1LPZB 2WPMS 2VIOA 2BDYA 3M5OA 2BLQA 3ELAH 3LONA 1C4Y2 1GBAA 3P8GA 5A0CA 1JWTA 3FFGA 1NRPH 3SI3H 4AGJA 1GI4A 1PPFE 2WPLS 3A81A 1AUJA 3RXAA 1O3KA 1Y3WA 1ETTH 1O34A 5C5OA 1ELEE 1IHTH 4M7GA 3BIUH 1F7ZA 3SNBA 2Q1JA 1IQMA 1QTFA 1O2QA 1MUEB 1ZPZA 2K1QA 2ZC9H 3TNSA 1GMCF 1TA6A 1WTGH 4ZAEA 3SV7A 2ZGHA 4UE7H 1ZOMA 1A3EH 3E16B 2BOKA 1B5GH 1PPBH 1Z8JB 5A8XA 1KXEA 1F92A 3OY6U 3M61U 2WYGA 2OC0A 3VB3A 5LGOA 1MTVA 3L33A 1V2OT 1UK2A 5CHAC 1ZGVA 1O3HA 1FJSA 1EXFA 4B75A 1D9IA 1F0RA 2CMYA 4TPYA 4WWYA 3ITIA 4BANB 1GI1A 2FEQH 1P02A 1D6RA 2TRMA 4IS5A 3O8DA 1GBCA 1GBEA 1QURH 1O3AA 4TWWA 4BXSA 3BEIB 3FP6E 1F5KU 1TQ0B 5HMAA 1OKXA 1C1SA 1TIOA 1BA8B 3LGVA 2C8XB 2C90B 2A2QH 3LH1A 3M37A 1TPAE 1FDPA 3VGCB 1NRQH 1HNEE 1PPZA 1S5SA 1P2KA 1THRH 3FVFB 1GHBF 1C2LA 1J14A 1GJ8B 1G32B 1N1LA 3RU4D 3SO3A 5FBEA 3BTTE 3V3MA 1BCUH 4ZMAH 3OTJE 4CRBA 2BZAA 3HKJB 5FX5A 1AWFH 1DX5M 1EP6A 5LH8A 1FNIA 4NZQA 1EB1H 4H6TA 3UTUH 1CGIE 1TMTH 4K1TA 2ASUB 5HYOA 4VGCC 1UTPA 4JMYA 1W2KH 3GY5A 1ZTLA 1BITA 1GDQA 3D23A 1C5YB 4ASHA 3PLKA 4ISHH 1UCYE 1KY9A 3CP7A 1YPKH 3PO1B 1CVWH 2GCHG 4QT8C 2UUYA 4CR5A 1OWDA 1JMOH 3LC3A 2GZ8A 1B0EA 2ZGJA 3VB4A 2XWAA 1MU6B 3FZZA 1SLWB 5A2MH 2V0BA 5DP5A 1GJ6A 5FPSA 4J1YA 2WPIS 4IW4E 3SOSA 3QN7A 1GJ7B 2CHAC 1QBVH 1F0TA 3V7TA 2ZFPH 1PPEE 2R2WU 5GCHF 3BTHE 1FY5A 1DE7H 1ARBA 2HLCA 4E06H 1P2IA 2HNTC 1V2PT 5AVDA 1C2KA 2DE8A 1UCYH 3RXIA 2EEKA 3NUMA 5C1UA 2FM2A 4BNRA 2W3KA 4B2BA 5IDKA 1C2MA 1KIGH 1ZSKA 4CRFA 1UTQA 4OS7A 1GJBB 2A5AA 1C5MD 1BT7A 3SV6A 3TH4H 5C2ZA 1TMBH 3LJJA 4DGJA 5DP7A 3NCLA 1EX3A 4Y71A 4YM9A 5CMXH 4NGAH 3BTWE 3LT3A 4O03A 2GDDA 4Y8YA 1SQAA 1RS0A 5JBAS 3PMHB 2QXJA 1QB6A 1K28D 4IN2A 3OYPA 4OS5A 3A7TA 5L6NH 1SVPA 5DK1A 4DG4A 1DWBH 1L1NA 1ZSLA 5DKMA 1WQSA 1ZHPA 3MH4A 4U30A 2RG3A 2Y82A 1GMHF 2FOHA 2FOCA 1GMDF 1V3XA 2PLXA 1SBWA 1AVXA 2PTNA 1H8IH 2VIPA 3H5CB 3VFEA 2FTMA 3MWIU 1HLTH 4NIVA 1GI3A 2FOBA 2WPHS 1YPHE 1SGPE 3S69A 4FVBA 5FHTA 3FP7E 2Z94A 1BHXF 1YLDA 4Y11E 4IN1A 1K1LA 4X6MA 3VEQB 2GZ9A 3QWCH 1BTUA 3RXCA 3EE0B 1C5LH 5T6DA 4NIWA 1D3DB 4TPIZ 1OP0A 2NU1E 3ZZ7A 5EG4A 3M7UA 2ZHEH 3MH7A 1J8AA 1TLDA 1Y5UT 1LQDB 1SMFE 2PUQH 4NFEA 1TGTA 1SGFA 4K2YA 1DPOA 2FI4E 1W11U 5EU8A 1ZJDA 1GBJA 2BVSH 2G52A 2FPZA 2FIRH 4ZKOU 5E0HA 1ZPBA 2FTLE 1KXAA 2ZZUH 3S7KB 4CRDA 2GV6A 1DLEA 1MKXH 3SJKA 1O5EH 1GHAG 2ZGBH 3MH5A 1ETSH 4NSVA 2F9OA 1BDAA 1C1OA 3F9HA 3MO6A 1GBIA 1NU7B 2PHBA 1W12U 3ZVGA 1IOEA 1TB6H 5I25A 1SI5H 1UTOA 1OSSA 2PW8H 3PLBA 2Z7FE 1V2ST 1HAHH 4NIYA 1XUHA 3RXJA 2BDIA 1EAXA 4NA8A 4WMDA 2O9QA 3ZVFA 5F03A 3QTVH 2W7SA 1FONA 1DM4B 1ESTA 4IMQA 1WU1A 2H9TH 4K8BA 1GCTB 1QCPA 4XBDA 4X2YA 2ANWA 3MU1A 1O35A 3ZVEA 2VH0A 3ATKA 3CS7A 2NU0E 1O3PB 1G30B 2VWMA 4AORA 1G36A 3MU4A 1RGQA 1G2LA 1W10U 2QXIA 3W94A 1TOMH 2A5IA 2FP7B 1EAIA 4BOHA 4I8GA 4NA9H 2XC4A 5SGAE 3NZIA 1JRTA 1SB1H 1K22H 1BMAA 2JH6D 1L0ZA 4JZFH 6ESTA 1ZZZA 1DWEH 2BY8X 4CBNA 4FUGA 5FAHA 1P01A 3QZRA 1ESAA 5BRRE 2QF0A 2SGPE 4BAOB 2A7JA 3U1IB
chains in the Genus database with same CATH superfamily
4AFZA 1P2NA 3EDXB 2IJD1 1Y5AT 1CQQA 4XDEA 4WF8A 3MHWU 1FY4A 2C8YB 2ZFQH 1KLJH 1MTUA 1C5ZB 2KAIA 2UWPA 4Y7BA 5LPEA 1ELFA 1HPGA 4A7IB 1CT4E 1V2KT 1ZRKA 2R9PA 2A45B 4MVNA 2G00A 1HAOH 1C9PA 2EI7A 3AVZA 4O3TA 1MQ6A 1UTKA 1AQ7A 2XCFA 4Z6AH 3Q00A 4MPXA 1EAUA 2AHME 3LGWA 1TNLA 3TJUA 5DJ7A 1Z6JH 1TALA 1IQGA 5JBBS 4B2CA 4F4OC 1O3NA 2BVXH 2R3YA 2R0LA 3E6PH 4U01A 1VITF 1ELCA 3W1EA 2D2DA 2PKSC 3TJOA 1RIWB 1V2JT 1MCVA 3SGBE 3F2FA 2KX4A 1SR5C 3VPKA 4YESB 4WXVA 2ZFFH 2ZHQH 1LPGB 1U6QA 5LPFA 4ZCNA 1H4WA 5TCAA 9LPRA 1HGTH 3A7XA 4BTIB 2Y81A 4B74A 1LHEH 3SU3A 1T4UH 1YKTA 2H2ZA 1QQ4A 1QGFA 4DW2U 2EI8A 1H9HE 2ZIQH 2VH6A 3QK1A 5JB9S 1UW7A 2ZFRH 1A1RA 1HAVB 4AYVB 1GHYH 3GYLB 1DVAH 1GMDG 3UR6A 1NROH 4LZ4B 2FOEA 1SFIA 3RLWH 4LXBH 1JIMA 3V0XA 1L1JA 4LZ1H 1Y3UA 2AERH 1IQIA 4A1TA 5EPYA 2HPQH 4D7GA 1O3JA 1O37A 3EA8A 3IWMA 2ZU2A 4AN7A 3AASA 4B1TA 1G3EA 4MPVA 5FPTA 3SUGA 3VXFH 2O8MA 1ZJKA 1C4U2 4NFFA 3U28C 2VIQA 3GOVB 1O38A 1MABB 3KL6A 4K1SA 2F83A 2RDLA 4Z0KA 2Z9IA 1ELBA 1GBFA 5FL7D 5FCRA 1FAXA 2IN2A 3PV2A 1FQ3A 3U98H 3LOXA 3MNSA 8GCHF 3PLPA 5J4SA 5DP6A 2W3IA 4AZ2B 7ESTE 2XW9A 1YCPK 3RXOA 1OYQA 2V3OH 5T6GA 2FOMB 5F8XA 3DFJA 3M3TA 3URDA 3KNXA 4ZHMU 3OFND 5FXLA 1HAIH 5AFZH 2O8LA 3RXLA 1SLUB 4FUFA 1O2KA 1AFQC 1GJAB 1O3OA 3PB1E 5EXMA 2J94A 4KTCA 1O36A 3D49H 1DICA 5F8ZA 2VGCB 2ZFTA 2W5EA 4ABBA 2HPPH 3UNRA 1YGCH 1NFUA 2Q6DA 1P2MA 1LTOA 4BAMB 4WY3A 3L6PA 2ZDNA 3KQDA 2ZDAH 4D76A 1RJXB 2Y7ZA 1HXEH 4GLYA 2GP9B 1ZSJA 1KMHB 4ABEA 4K1EA 1GI2A 5ESBA 3MU8A 1WTHD 3WY8A 3UR9A 4X8TH 1NFWA 1O0DH 3N99A 1EPTB 1QRZA 2Z9LA 4FUHA 2K8IA 1MBMA 3QGNB 2VB0A 4WMEA 2Q6FA 2NU3E 1O2TA 1NO9H 4ABJA 5HGGA 1CO7E 1UTMA 1O2UA 3A8CA 3P6ZB 1TA2A 3TVJB 1AN1E 3NKKA 4AG1A 1P0SH 4NZLA 1XX9A 2PWXA 1CBWB 1AIXH 1HBTH 1C2GA 4OGYA 3LJOA 2GT8A 4ABAA 4NSYA 4XBCA 2ZCLP 1L4DA 1VJAU 2W6JD 3A85A 2PUXB 5FX6A 1NM6A 3E0NB 1NC6A 3E0PB 1ARCA 3RMOH 1TRYA 2OINA 1BMFD 1C4V2 2ZHDA 4RSPA 1TABE 5GDSH 1E38B 1Y3VA 2PGBB 1TPPA 1P09A 4KP0A 1K21H 4AGKA 1SQRA 3UPEA 4GPGA 2CXVA 1BTXA 3LIWA 1ZTJA 4AYYB 4IC6A 5DSFA 2BXTH 4X6NA 3A8DA 4OS2A 4D9QA 1V2LT 1AE5A 3SI4H 2ZQ1A 1BOQA 1GVKB 4FUBA 2CK3D 3NK8A 3A8AA 4LOYH 1O32A 2Q6GA 8LPRA 2ZU3A 1C5SA 1HV7A 1O39A 1HAVA 2G4UA 2QXGA 4O3UA 4SGAE 5ESTE 3H7OA 1TRMA 3EGKH 1LKBA 2J4IA 5EJ1A 1COWD 4ABFA 1BRAA 2WPKS 3DHKH 5C17A 3F9GA 3KEEA 1W7XH 1GGDC 3TGIE 1A61H 6LPRA 2Y6TA 1HAGE 1W13U 3F68H 4ABHA 5B6LA 4B6FA 1V2UT 4ABDA 1P9UA 1WAYB 1QHRB 1TRNA 1UTLM 4X2XA 1H9IE 3GCNA 4UEHH 4YOGA 1A0LA 2P59A 3UNSA 4ZHLU 1N8OB 1UTJA 1CSOE 1TBRH 2ZPRA 4AG2A 2FX6A 1BB0B 1TWXB 3EA9A 3RXKA 5HM2A 1KXCA 2VWLA 2BLVA 1K1JA 5PTPA 4PROA 1GI8B 2H5DA 3SV2H 4ABIA 1TX8A 1WDIA 4ZHAA 1TNHA 1YC0A 1GI7B 2J98A 4M9FA 3RXSA 4GVUA 2FYRA 1KDQB 2ZHWH 2Z3EA 1PPCE 3QTOH 1GBKA 2VIDA 5KGOA 4J2YB 4H6SB 3HPTB 1GPZA 3SU4A 3MU0A 2C4FH 3ZZ3A 3RDZA 1HIAB 1KLTA 2QF4A 1S84A 3TH3H 2BQ7B 3SORA 3K65B 4X1SU 3V12A 1NPMA 2GV7A 5C20A 2ZCKP 2ZDLA 4JZDH 1ANBA 3SHCH 3A84A 1LDTT 1C5UA 1AKSA 5F53A 5T6FA 5DP4A 3M5LA 3ZVBA 4X6PA 2C8ZB 2JJ2D 2FS9A 4DJZB 1GHVH 2BVRH 1ANCA 1P57B 2HNTF 1SOTA 1GHBG 5DN6D 1G3CA 2J95A 3SQHE 2XC5A 5ETXA 4KGAA 2TIOA 2ZQ2A 1CGJE 3A7VA 4CRGA 5EW1H 3MNCA 1JXPA 4ISIH 1C5TA 3LGYA 2ZCHP 2QA9E 5E2PA 2GKVE 3T28A 3KIDU 1JOUB 3F2GA 1O5GH 2AMQA 4F48B 3EA7A 1C1WH 2J38A 3SUEA 4GCHF 1OOKB 1YPGH 3M5NA 1XXDA 1FI8A 1SGFG 1O5CB 2QAAA 2ZEBA 1QB9A 2P16A 1HB0B 5EODA 1E34B 3LGIA 3QO6A 3MNBA 1FY3A 2K0QA 1K1NA 1QL9A 1ZR0A 2QGRA 1HJ9A 1O3IA 3U8OH 4RKJB 4MQAA 1Z7KA 1S81A 3RXUA 3SYJA 4WMFA 3RUOA 1T8LA 3Q77A 5EW2H 3BEUA 1C2HA 2L6OA 4JK5A 3RXFA 1ZHMA 1E1RD 1G37A 2QF5A 3M7TA 5C3NA 2J34A 2WYJA 4IC5A 1DT2A 2NU4E 7LPRA 1ABJH 4A6LA 1HJAB 1WOFA 4UD9H 1LPKB 4JCNA 4LK4A 2Z3DA 2ZFSA 1JRSA 3MOCA 3RXRA 4K8YA 2ZWLH 1MD7A 2H9EH 4IGDA 3F0PA 1G3DA 3LH3A 1V2RT 1AFQB 4MDSA 3TITA 4TYDA 4Y0YE 3SGQE 2AMDA 2RCEA 1V6DA 3RXQA 4A5TS 1OWEA 2HGTH 1Z8RA 2KCPA 3RM2H 1UHBB 4ASUD 1OXGA 1GVZA 4H4FA 4Q4LA 2DE9A 3TK9A 1O31A 1GL0E 1RTFB 4YT7H 5A0BA 5JBCS 1MTNB 3VG8A 1BHXB 2FYQA 1QJ7B 4YOIA 4Y8ZA 3WWBA 2AGIX 3ODDA 6CHAB 3RXHA 5C0TA 3TU7H 1ANDA 1IQKA 1GBLA 2GMTC 2F43B 2WINI 2ANYA 2I6SA 3VB7A 3E1XB 4MLFB 4I7YH 4CRAA 3B8JA 2ODQA 1W0KD 2Y5FA 3R3GB 1E1QD 4BTUB 3D62A 2FXRA 1O33A 3MU5A 5T3HA 3SBKA 2HVYB 4ZH8A 4AB9A 3KQBA 4BTTB 1J9CH 2R2MB 1LVBA 1O2RA 1YCPM 1INCA 1LMWB 2ZF0H 2H9HA 1GBHA 1TNJA 1XMNB 2ZI2H 2PP6A 1NT1A 1ABIH 1PYTD 2BMGB 2XC0A 3A89A 1L4ZA 2FDAA 3ZZ9A 2JETB 1DUAA 5TJXA 1EKBB 2FLRH 3HGPA 4Y6DA 1PFXC 1KSNA 3PWCA 2PKAA 2UWLA 1C2DA 2ZU1A 1PPGE 2BB4A 1AY6H 2AIPA 1FIWA 1AO5A 2IPHA 2A5KA 2BYAX 3SUFA 1QL7A 1XM1A 3IITA 2HWLB 3MNXA 1XUFA 1LHGH 1TBZH 3NWUA 3P95A 2VVUA 2LELA 1BTWA 3FANA 1DITH 3DFLA 3LGUA 1BTHH 2PFEA 3E3TA 2M5TA 3PTBA 3UWJH 1ELDE 1C2IA 1LHFH 2XYAA 2CF9H 1P9SA 2GCHF 2XRCA 1SG8B 5C67A 4JZEH 3M7QA 2H6MA 3TNTA 5E0JA 2F4LA 3ZV9A 3EAJA 2VIWA 2W6ID 3H7TA 1EOJA 2G5VA 2PKAB 2BX3A 1LKAA 3RXGA 3PMAB 3LGTA 2BX4A 1BTPA 4CRCA 1QBNA 2ALPA 3BTDE 3ZZ5A 1WV7H 4DURA 3S9CA 4AX9H 4BXWA 3DT0H 5JPMH 1SGTA 1AWHB 3FO8D 3UIRA 3VB5A 3A88A 1BZXE 1BIOA 1E0FD 1D3QB 1UK3A 4YOJA 1D6WA 2VJ1A 1N8OC 1AFEH 4K3JA 4DIHH 2BDCA 2Z9KA 4XBBA 1K1PA 1ACBE 4X6OA 4NG9H 4ISNA 1O5BB 3QGJA 2KR7A 3ZZDA 2VVCA 1K2I1 1XVOA 1S0QA 3E8LA 5GIBA 4X2VA 1IQJA 4YTAA 2FO9A 2G8TA 4ZXXH 1AUTC 4YLUA 1N6YA 3LC5A 1GJ9B 1UVPA 2G81E 1OWKA 1AKSB 3T27A 2SNWA 2XOKD 2BDAA 3PROA 1FPCH 1JBUH 2YOLA 1MZDA 3STJA 3S9AA 3U8RH 4H42U 1GHZA 2BXUH 2NWNA 1AI8H 4I8HA 3OU0A 4BAQB 2D26C 3AW0A 3K6YA 4AOQA 1IQHA 1O3LA 1O2GH 3U69H 2ZA5A 4Y8XA 4OS1A 1DSTA 1GJ4H 5A09A 2A4GA 1A2CH 1NN6A 3AK5A 1O2YA 4RT0A 4WXIA 5AHGH 2VWOA 1SGQE 3PMBB 1BBRK 1S6FA 3GCTG 3P70B 3NXPA 1PQ8A 3F3BA 1HJ8A 4MPWA 2BDBA 1BJUA 1H9LB 1IHSH 2ILNA 2XNIA 3QX5H 1NU9A 2FOFA 1Z1JA 2OBQA 1Z6EA 3A83A 3RC5A 2W7UA 5L30H 1YF4A 1FPHH 4GUXA 3PMJA 4ABGA 1TX7A 2WUBA 3M3VA 1BQYA 1YCPH 1RRKA 1TBQH 5K0HA 1C1TA 1FMGA 1C5QA 1VR1H 4Y10E 1A3BH 1C9TA 1C2EA 3UREA 1NBME 3T5FH 2R3UA 2F9BH 1QB1A 1F0UA 1M9UA 1A7SA 1YM0A 4FU8A 4TWYA 5JBTA 1YYY1 1YLNA 2OCVB 1P2OA 3G01A 1KDQA 3A7YA 1C1UH 1IQLA 3PV5A 1SC8U 1ZYOA 2WHXA 2P3FH 1SGRE 5TCCA 1AVGH 1HRTH 1O30A 3N7DA 3ODFA 3UQOA 2PKSB 4Q63A 2ANMH 3KYGA 3RU4E 3T62A 1XVMA 3PYHA 3KYFA 2WZQA 2OUAA 1O2VA 4Q7ZA 3E91A 1G2MA 3O8RA 4WH6A 3RXTA 3SJOA 3SZNA 1O5AB 3ENSB 3RMLH 1P06A 1EUFA 1QRXA 5AF9H 1XUKA 1DY9A 3AW1A 1T8MA 3LPRA 3MFJA 1T7CA 3F9FA 2Y7XA 1KTTB 1HJAC 5DP3A 1F5LA 4TY6A 1UVTH 3I29A 1NRSH 3UWIA 4NWKA 1BRUP 5B6OA 2ZTXA 1BTYA 5EGMA 3ATWA 1FY8E 3BTME 1GJDB 1MZAA 2ZGCA 1LVYA 1ZMJA 1AB9B 2TGTA 2A4RA 2WUCA 4MTBA 2AH4X 1KXFA 3P17H 1QJ1B 1C2JA 2AYWA 4OM9A 1RXPA 2SGDE 1OPHB 2TBSA 1GCTC 2UUFB 3ZZBA 1UJ1A 3RXEA 6CHAC 3BG4B 1C1RA 2VU8E 4NIXA 3N7EA 3A86A 3SV8A 2XBVA 4AC9A 2OC1A 5GCHG 1AZZA 2A31A 4GHTA 6GCHF 2LP6A 2XCNA 2J9NA 4FVDA 2FOAA 3SHAH 1T8OA 1YPEH 3SNEA 4MG3A 3SUDA 3TH2H 1WQVH 4GCHG 2G55A 2AFQB 2FI3E 1QZ8A 1S6HA 2GTBA 2ZDVH 4WH8A 3L3TA 1O3GA 4ZKNU 2CV3A 4FUIA 1KYNA 3RLYH 1ZGIA 1V2VT 1O2HA 2ODYB 1F2SE 3GICB 4UFDH 1ELVA 1YPMH 3VXEH 1VITG 2JETC 4X8SH 1FZZA 4FOUC 1NFYA 3B9FH 3MMGA 3TK5A 1O2OA 5KEDA 1ZHRA 1SQOA 1KXDA 3PTNA 3DA9B 3SU1A 2BLOA 1VJ9U 1QFKH 3TJVA 5F8TA 3OTPA 2PV9B 1PYTC 3KQCA 4UONA 3SQEE 1IQFA 1XUJA 3SN8A 4GSOA 3GCHC 2GCTB 4RI0A 1J16A 3LDXH 1SSXA 2C93B 1SPJA 2B8OH 2FS8A 2CHAB 1EPTC 2RDEA 2ZGXH 5GWZA 3UOPA 4X2WA 1L2EA 3BTGE 5HKKD 3E90B 3GISB 2SGEE 4MNXA 1OP2A 3SW2B 1TGNA 4FU7A 2RA3A 4FUDA 2GGVB 2BOHB 2AEIH 4DT4A 1TPOA 1NS3A 5C94A 3CENA 1XKBC 2A7HA 2BHGA 4MNVA 1FUJA 1G9IE 3OX7U 1VCWA 4INKA 1N6XA 3ZIAD 1GHXH 2P93A 1Y3XA 3GY2A 4MNWA 1D3TB 3Q3YA 1QA0A 1V2QT 2JH0D 4RKOB 3HKIB 5L2YH 2ZTZA 1H8HD 3UNQA 2AGGX 1O2JA 2TGAA 2TPIZ 2BD2A 4ISLA 2WV9A 1E37B 4Q7XA 3T25A 3C1KA 2BM2A 4MPUA 1LHDH 1MMJN 1IQNA 1QJ6B 4MNYA 1EB2A 2SFAA 2Z9GA 2CJIA 1Z71A 1O3BA 1FN8A 1HAZB 3BV9B 1O2NA 1WSSH 2HRVA 4XRNA 2P3UB 2OC7A 3GCHB 1P2JA 3RP2A 2PR3A 3RMMH 5CE1A 2QYIA 2C8WB 1O2IA 1PQAA 1GJ5H 1O2PA 4D9RA 1GBBA 1ZPCA 2GT7A 4YT6H 5HIZA 2AGEX 1Y3YA 4O97A 1J15A 3PM3A 1ETRH 1AU8A 5EIYA 1DSUA 2Y80A 1D3PB 3UQVA 3FOAA 3K6ZA 3ZZ6A 1C1VH 3JZ2B 4K5ZA 4XFQA 5FBIA 3PV4A 2Y5HA 2TGDA 3BN9A 3KF2A 2ZECA 2M2AA 4FUCA 1VCPA 3P92A 1TGSZ 2AMPA 2ZKSA 2F91A 1O2XA 1EOLA 3AAVA 4HG6A 8ESTE 4ISOA 3MYWA 1ZRBA 3GY6A 3M3SA 4GHQA 1C1QA 4E05H 2AIQA 2XBWA 2OQ5A 3GY3A 1Z8GA 1C5PA 3ZYEA 1SGEE 4JZIA 1XUGA 5K7RA 4FXGH 1DXPA 5EQQA 4YXWD 5CHAB 4DY7B 2Z9JA 1BTZA 1MAYA 3HK6B 2SGQE 5JB8S 1THSH 2FZZA 3F6UH 2BZ6H 2BD8A 3JZ1B 4I8KA 5JYIA 5EOKA 1C2FA 1O5FH 3MH6A 4F49A 4Y7AA 2V7QD 4XE4A 2CF8H 4OS6A 2WPDD 1T32A 1V2NT 1BMNH 1J17T 5E2OA 3V13A 1BMLA 1OP8A 4I8JA 2V3MA 2A32A 3SU6A 1TFXA 1AHTH 2FODA 1H1BA 1GI6A 3FAOA 2XBYA 1PPHE 4UDWH 3TJNA 1CT2E 2BD7A 3W95A 1K0HA 1P10A 2CGAA 1O2LA 3OSYA 1TE0A 2SGAA 2ESTE 1B0FA 2OBOA 1Z8IB 5A8YA 2GZ7A 2BD5A 4AFQA 1LCYA 1YWUA 1QNJA 3QUMP 1GVLA 3A7WA 1GG6B 1P11E 2FESH 2KCOA 5DGJA 1ELTA 4HFPB 1F0SA 1A5IA 1C5XB 1UVSH 3GCOA 1A5GH 2H1UA 1EZQA 1O3MA 3URCA 1VGCC 2SGFE 1NRNH 2VIVA 4HI3A 4Y76A 2Y5GA 3Q3KA 3S9BA 2XWBI 2F9VA 1NZQH 1SHHB 2V35A 4R0IA 3EQ0H 1WUNH 4CHAB 3GCTF 1HYLA 3PO1C 8KME2 1A46H 5DPAA 1NRRH 4X8UH 3RU4T 4NCYA 4KELA 3P8FA 4U2WA 4HZHA 3RXMA 1DXWA 2XBXA 4HTCH 1FXYA 5EQSA 3S7HB 1GDNA 1Q2WA 1FAKH 2THFB 1W3CA 3BTEE 3KCGH 1ZMNA 1O3DA 2KCAA 4KKDA 2BD3A 4KTSA 4B71A 2FLBH 3K2UA 4ZXYH 1P12E 1YPJH 1E35B 4OS4A 3SNDA 2OP9A 3A82A 4WVPE 1PQ7A 2IOTA 2V6NA 3ESTA 1YPHC 2ZDKA 1C5VA 2QCYA 3MO9A 2BD4A 1DWCH 2FWWA 4I31A 1DUEA 1MKXK 1DLKB 3BSQA 1SL3A 2KM0A 3ZYDA 3STIA 3VB6A 1GJCB 3MI4A 4DOQA 1O3FA 1GGDB 1GDUA 2AS9A 1ZMLA 2NU2E 1OWHA 4B6EA 1GHAF 2ZTYA 4IBLH 2CN0H 1O5DH 5L2ZH 2PTCE 4Q2KA 1CHGA 4DCDA 3GDUA 1MTWA 2P95A 1HAXB 3KHVA 1EAWA 3QZQA 4AFSA 1MAXA 3KQEA 1C5WB 3TIUA 1VITH 2GX4A 2TGPZ 1O2SA 4DVAU 2QV1A 1UVUH 3ZV8A 3SJ9A 2BY9X 3RM0H 2EC9H 2ZP0H 1SLVB 1EZUC 3DSPA 3O8BA 3OE7D 2F9PA 1P03A 1WXRA 2HOBA 1EQ9A 2GCTC 3U1JB 4YZUA 3DSOA 2ZO3H 3Q3XA 1OWIA 1YPLH 2QN5T 2B5TB 5G4BA 3EYDA 3BTQE 4CBOA 2PGQB 1A4WH 2KAIB 3TK6A 2Z3CA 2F9UA 4XD7D 3ZVAA 3NRLA 1CT0E 4Y0ZE 2F9NA 4JYUH 1T8NA 1TAWA 2JIZD 2EI6A 3DD2H 5EPNA 2LPRA 1GMHG 2UUJB 2EA3A 4E7NA 1QQUA 2BDGA 2WV4A 1CE5A 1YLCA 1D4PB 1YBWA 1W0YH 1RFNA 1AMHA 3CS0A 1ELAA 2XTTB 1O2ZA 5C5NA 4Y79A 1BBRH 2VVVA 4HGCA 5EXLA 1P2QA 1BMMH 3GDVA 1SHYA 1GI0A 2A2XH 4D8NA 2VWNA 4FU9A 2EQNA 2ZHFH 1V2WT 2OK5A 2STBE 2JH5D 3RXPA 2BLWA 3M35A 1GBTA 3VGCC 1LQEA 2W26A 3TLOA 5A0AE 1T4VH 1OS8A 1W0JD 3SNAA 1AGJA 3FZDA 4FUEA 3A8BA 1YY3A 1AZ8A 5FPYA 2XXLA 1TNGA 1KXBA 1WBGB 2WV5A 5HM9A 3OEHD 1SLXB 1HAYB 2O8UA 2OQUA 1LVMA 3B23B 4R8TB 1DANH 3F9EA 1UO6A 1E36B 4CH2B 1HDTH 2FI5E 1S82A 5J4QA 1QBOA 3GY7A 4XSKU 3TGJE 3SV9A 2IJOB 1EFRD 5I46H 2A0QB 1A5HA 2J97A 4A1XA 1TNKA 1TMUH 1YP9A 1TOCB 2GVFA 1K1MA 1WYKA 4AFUA 1LHCH 3M5MA 1O3EA 1NESE 2OC8A 1PJPA 1HXFH 1L1GA 3T29A 1NY22 1QRWA 2WSSD 5E8EH 2ZG0H 2L74A 2LNCA 2P8OB 1MCTA 2QXHA 1UTNA 1TNIA 4I8LA 4YO9A 2FX4A 3MTYA 1DDJA 2Z6BD 2C3SA 3RC6A 5DP9A 1A0HB 4SGBE 1E79D 1S83A 1EJAA 1DFPA 1PQ5A 1CGHA 3P8OA 1AE8H 1KLIH 2VBCA 4JK6A 1UVOA 4JYVH 3O8CA 2VGCC 3PRDA 5BPEA 5EXNA 1W0ZU 5EJZA 4I32A 3ATMA 3SJ8A 4THNH 1AB9C 1W8BH 1RTLA 2B9LA 4TY7A 1CHOF 4F55A 1EZSC 3Q76A 1C5RA 1UCYK 3ZZCA 1EPTA 1Y8TA 2STAE 1HUTH 1DWDH 2B0FA 4BAKB 3K9XB 3CNRA 1BRBE 2G51A 2GMTB 1FN6A 3HGNA 3ZZAA 3WW7A 1LVOA 2H5CA 2O8WA 5F6MA 5GXPA 4Q80A 3T2NA 1OX1A 3NPSA 1BBRE 2ANKH 4U32A 4D7FA 4ZUHA 4YLQH 1BRCE 4B73A 2FMJA 1ANEA 2O8TA 2DUCA 5AFYH 1EATA 1TX6A 1GG6C 1SQTA 1QA7A 3FP8E 1CA0C 1DOJA 4GAWA 1FLEE 4CH8B 2P8OC 4INHA 4INLA 1CBWC 4DIIH 1F5RA 3KN2A 1QR3E 1C5NH 4Q7YA 4A1VA 1G3BA 1RD3B 4NA7A 2BY6X 1EJNA 2A4QA 4K60A 3QLPH 2I6QA 1P04A 1ID5H 1WCZA 1MD8A 2VNTA 1ESBA 4A92A 5IYTA 5C1YA 1HFDA 2OD3B 4CHAC 2YMSB 1UHBA 1S0RA 1HAPH 1QL8A 1P05A 3SU5A 2R0KA 1MKWH 4UFEH 1RTKA 1MTNC 2RFKC 2G5NA 1UK4A 4RN6A 2P94A 2OLGA 1IQEA 1TYNA 5GPIB 3RXVA 3GYMA 1XUIA 1AD8H 1O2MA 3ZVDA 4X1QU 2BD9A 1MBQA 1OYTH 2JKHA 3IG6B 3S0NA 2KZ4A 3ATLA 2A7CA 1C1PA 2YNAA 6GCHG 1GMCG 3BF6H 4ZKRU 2OXSA 1XXFA 1EJMA 4B76A 3RXDA 2YMSD 1A0JA 1Q3XA 1VZQH 2J2UA 2EY4C 3EE7A 2HNTE 3I78A 3LKWA 2VINA 3P8NA 2QC2A 1FV9A 1CA0B 2P3TB 1S6LA 3KQ5A 5E0GA 3F2HA 3SU0A 2G4TA 3A7ZA 1W7GH 4VGCB 3ATIA 3RMNH 4JYTA 1SGNE 3SJIA 4DT7B 4CR9A 2OTVA 1HIAA 1SGIB 2ZPSA 3A80A 1ORFA 4ZROA 1VCQA 1IAUA 1Z1IA 2YMSC 3BEFB 4O9VA 4OGXA 4X1PU 1TGBA 1V2MT 1NTPA 1EASA 3ZZ8A 2BDHA 5GJ4B 9ESTA 1H8DH 2QIQA 1AVWA 4X1RU 1FY1A 2ALVA 3SGAE 2D1JA 2D8WA 1P3EA 2ZDMA 3BG4C 5H4IB 3HK3B 4IMZA 5A8ZA 1UMAH 3UFAA 3SNCA 3F0OA 1T31A 3GDSA 1Q31A 4JZ1A 2PSYA 1LO6A 3BG8A 1GWAA 3D65E 2UWOA 3ZVCA 1DY8A 4B2AA 7KMEH 4FETA 1GI5A 3BIVH 1MQ5A 7GCHG 2QF3A 1B7XB 2F3CE 2RA0A 2J5UA 1P3CA 5CHBA 2B7DH 3GY8A 3ZZ4A 1S85A 2PSXA 4UFFH 1QIXB 3U9AH 1GL1A 2FOGA 2J92A 5DO4H 2V3HH 3M36A 3UOUA 1BJVA 1P8VC 1X7AC 2A4OA 2BQ6B 2QY0B 4KTUA 4X0WU 2ZPQA 5LPRA 1CU1A 3TPIZ 3BTKE 1Y5BT 5DG6A 1GI9B 2GD4B 2A1DB 4FUJA 4E7RG 1HCGA 4WJG2 4X1NU 5FCKA 1C5OH 3U8TH 5C1XA 2BTCE 2ZU5A 3DCLA 1SFQB 5ABWA 1MH0A 2UUKB 3QDZB 3TGKE 2HVXA 1GCDA 1W14U 8GCHG 1SGYE 3SU2A 4BAHB 3C27B 7GCHF 1Y59T 3T26A 3PRBA 2ODPA 1H8ED 1OWJA 2BQWB 2ZNKH 3MO3A 3RXBA 1GHWH 1TONA 2ULLA 4NWLA 4AB8A 1CHOG 4ZKSU 1C1NA 2BY5X 4UFGH 1FIZA 3UY9A 1BUIA 2BY7X 2YNBA 1SGCA 3RC4A 1VKYA 4XOJA 2ZU4A 1SGDE 1SOZA 3F1SB 4ESTE 1K9OE 1MU8B 4CREA 5EQRA 1EP5A 1O2WA 5DP8A 3R0FA 3UUZA 1RIWC 1NFXA 1TPSA 3BTFE 1THPB 3HATH 4X8VH 1GBDA 2WPJS 1ZLRA 1GBMA 2IPQX 4I33A 1DS2E 1O3CA 1ZTKA 3DUXH 1V2TT 1XKAC 3A87A 1JIRA 1TQ7B 1K1OA 1MTSA 4K69A 3GY4A 2GDEH 3PWBA 1CA8B 1C1MA 1K1IA 3OY5U 3N7OA 5JDUB 3KGPA 1ELGA 1KTSB 1EZXC 3I77A 5HIYA 5HXFA 1MKWK 2HALA 1VGCB 1TGCA 3AAUA 1QY6A 2SNVA 3LU9B 1LPZB 2QE7D 2WPMS 2VIOA 2BDYA 3M5OA 2BLQA 3ELAH 1SKYE 3LONA 3DSGA 1C4Y2 1GBAA 3P8GA 1FX0B 5A0CA 1JWTA 3FFGA 1NRPH 3SI3H 4AGJA 1GI4A 1PPFE 2WPLS 3A81A 1AUJA 3RXAA 1O3KA 1Y3WA 1ETTH 1O34A 5C5OA 1ELEE 1IHTH 4M7GA 3BIUH 1F7ZA 3SNBA 2Q1JA 1IQMA 1QTFA 1O2QA 1MUEB 1ZPZA 2K1QA 2ZC9H 3TNSA 1GMCF 1TA6A 1WTGH 4ZAEA 3SV7A 2ZGHA 4UE7H 1ZOMA 1A3EH 3E16B 2BOKA 1B5GH 1PPBH 1Z8JB 5A8XA 1KXEA 5CDFE 1F92A 3OY6U 3M61U 2WYGA 2OC0A 3VB3A 5LGOA 1MTVA 3L33A 1V2OT 1UK2A 5KECA 4RT1A 5CHAC 1NBMD 1ZGVA 1O3HA 1FJSA 1EXFA 4B75A 1D9IA 1F0RA 2CMYA 2KCYA 4TPYA 3ITIA 4WWYA 4BANB 1GI1A 2FEQH 1P02A 1D6RA 2TRMA 4IS5A 3O8DA 1GBCA 1GBEA 1QURH 1O3AA 4TWWA 4BXSA 3BEIB 3FP6E 1F5KU 1TQ0B 3SZEA 5HMAA 1OKXA 1C1SA 3MQKC 1TIOA 1BA8B 3LGVA 2C8XB 2C90B 2A2QH 3LH1A 3M37A 1TPAE 1FDPA 3VGCB 1NRQH 1HNEE 1PPZA 4TT3D 4P00A 1S5SA 1P2KA 1THRH 3FVFB 3OAAD 1GHBF 1C2LA 1J14A 1GJ8B 1G32B 1N1LA 3RU4D 3SO3A 5FBEA 3BTTE 3V3MA 1BCUH 4ZMAH 3FN8A 3OTJE 4CRBA 2BZAA 3HKJB 2KFWA 5FX5A 1AWFH 1DX5M 1EP6A 5LH8A 1FNIA 4NZQA 1EB1H 4H6TA 3UTUH 1CGIE 1TMTH 4K1TA 2ASUB 5HYOA 4VGCC 1UTPA 4JMYA 1W2KH 3GY5A 3OEED 1ZTLA 1BITA 1GDQA 2GJGA 3GS9A 3D23A 1C5YB 4ASHA 3PLKA 4ISHH 1UCYE 1KY9A 3CP7A 1YPKH 3PO1B 1CVWH 2GCHG 4QT8C 2UUYA 4CR5A 1OWDA 1JMOH 3LC3A 2GZ8A 1B0EA 2ZGJA 3VB4A 2XWAA 1MU6B 3FZZA 1SLWB 5A2MH 2V0BA 5DP5A 3UAIC 1GJ6A 5FPSA 4J1YA 2WPIS 4IW4E 1OHHD 4ACAA 3SOSA 3QN7A 5GNDA 1GJ7B 2CHAC 1QBVH 1F0TA 3V7TA 2ZFPH 1PPEE 2R2WU 5GCHF 3BTHE 1FY5A 1DE7H 5EJLA 1ARBA 2HLCA 4E06H 1P2IA 2HNTC 1V2PT 5AVDA 1C2KA 2DE8A 1UCYH 3RXIA 2EEKA 3NUMA 5C1UA 5T1VA 2FM2A 4BNRA 2W3KA 4B2BA 5IDKA 1C2MA 1KIGH 1ZSKA 4CRFA 1UTQA 4OS7A 1GJBB 2A5AA 1C5MD 1BT7A 3SV6A 3TH4H 5C2ZA 1TMBH 3LJJA 4DGJA 5DP7A 3NCLA 1EX3A 4Y71A 4YM9A 5CMXH 4NGAH 3BTWE 3LT3A 4O03A 2GDDA 4Y8YA 1SQAA 1RS0A 4ACBA 5JBAS 3PMHB 2QXJA 1QB6A 2HLDD 1K28D 4IN2A 3OYPA 4OS5A 3A7TA 5L6NH 1SVPA 5DK1A 4DG4A 1DWBH 1L1NA 1ZSLA 5DKMA 1WQSA 1ZHPA 3MH4A 4U30A 2RG3A 2Y82A 1GMHF 2FOHA 2FOCA 1GMDF 1V3XA 2PLXA 1SBWA 2J98B 2PTNA 1AVXA 1H8IH 2VIPA 3H5CB 3VFEA 2FTMA 3MWIU 1HLTH 4NIVA 1GI3A 2FOBA 2WPHS 3UB0A 4TSFD 1YPHE 1SGPE 3S69A 4FVBA 5FHTA 3FP7E 2Z94A 1BHXF 1YLDA 4Y11E 4IN1A 1K1LA 4X6MA 3VEQB 2JDID 2GZ9A 3QWCH 1BTUA 3RXCA 3EE0B 1C5LH 5T6DA 4NIWA 1D3DB 4TPIZ 1OP0A 2NU1E 3ZZ7A 5EG4A 3M7UA 2ZHEH 3MH7A 2XNDD 1J8AA 1TLDA 1Y5UT 1LQDB 1SMFE 2PUQH 4NFEA 1TGTA 1SGFA 3FKSD 4K2YA 1DPOA 2FI4E 1W11U 5EU8A 1ZJDA 1GBJA 2BVSH 2G52A 2FPZA 2FIRH 4ZKOU 5E0HA 1ZPBA 2FTLE 1KXAA 2ZZUH 3S7KB 4CRDA 2GV6A 1DLEA 1MKXH 3SJKA 1O5EH 1GHAG 5C0UA 2ZGBH 3MH5A 1ETSH 4NSVA 2F9OA 1BDAA 1C1OA 3F9HA 3MO6A 1GBIA 1NU7B 2PHBA 1W12U 3ZVGA 1IOEA 1TB6H 5I25A 1SI5H 1UTOA 1OSSA 2PW8H 3WWFA 3PLBA 2Z7FE 1V2ST 1HAHH 4NIYA 1XUHA 3RXJA 2BDIA 1EAXA 4P02A 4NA8A 4WMDA 2O9QA 3ZVFA 5F03A 3QTVH 2W7SA 1FONA 1DM4B 1ESTA 4IMQA 1WU1A 5IK2D 2H9TH 4K8BA 1GCTB 1QCPA 4XBDA 4X2YA 2ANWA 3MU1A 1O35A 3ZVEA 2VH0A 3ATKA 3CS7A 2NU0E 1O3PB 1G30B 2VWMA 3H09A 4AORA 1G36A 3MU4A 1RGQA 1G2LA 1W10U 2QXIA 3W94A 1TOMH 2A5IA 2FP7B 4Z1MD 1EAIA 4BOHA 4I8GA 4NA9H 2XC4A 5SGAE 3NZIA 1JRTA 1SB1H 4I86A 1K22H 1BMAA 2JH6D 1L0ZA 4JZFH 6ESTA 1ZZZA 1DWEH 2BY8X 2JJ1D 4CBNA 4FUGA 5FAHA 1P01A 3QZRA 1ESAA 5BRRE 2QF0A 2SGPE 4BAOB 2A7JA 3U1IB
chains in the Genus database with same CATH topology
4AFZA 1P2NA 3EDXB 1Y5AT 1CQQA 4XDEA 4WF8A 3MHWU 1FY4A 2C8YB 2ZFQH 1KLJH 1MTUA 1C5ZB 2KAIA 2UWPA 4Y7BA 5LPEA 1ELFA 1HPGA 4A7IB 1CT4E 1V2KT 1ZRKA 2R9PA 2A45B 4MVNA 2G00A 1HAOH 1C9PA 2EI7A 3AVZA 4O3TA 1MQ6A 1UTKA 1AQ7A 2XCFA 4Z6AH 3Q00A 4MPXA 1EAUA 3LGWA 1TNLA 3TJUA 5DJ7A 1Z6JH 1TALA 1IQGA 5JBBS 4B2CA 4F4OC 1O3NA 2BVXH 2R3YA 2R0LA 3E6PH 4U01A 1VITF 1ELCA 2D2DA 2PKSC 3TJOA 1RIWB 1V2JT 1MCVA 3SGBE 1SR5C 3VPKA 4YESB 4WXVA 2ZFFH 2ZHQH 1LPGB 1U6QA 5LPFA 1H4WA 5TCAA 9LPRA 1HGTH 3A7XA 4BTIB 2Y81A 4B74A 1LHEH 3SU3A 1T4UH 1YKTA 2H2ZA 1QQ4A 1QGFA 4DW2U 2EI8A 1H9HE 2ZIQH 2VH6A 3QK1A 5JB9S 2ZFRH 1A1RA 1HAVB 4AYVB 1GHYH 3GYLB 1DVAH 1GMDG 3UR6A 1NROH 4LZ4B 2FOEA 1SFIA 3RLWH 4LXBH 1JIMA 3V0XA 1L1JA 4LZ1H 1Y3UA 2AERH 1IQIA 4A1TA 5EPYA 2HPQH 4D7GA 1O3JA 1O37A 3EA8A 3IWMA 2ZU2A 4AN7A 3AASA 4B1TA 1G3EA 4MPVA 5FPTA 3SUGA 3VXFH 2O8MA 1ZJKA 1C4U2 4NFFA 2VIQA 3GOVB 1O38A 4K1SA 3KL6A 2F83A 2RDLA 4Z0KA 2Z9IA 1ELBA 1GBFA 5FCRA 1FAXA 2IN2A 1FQ3A 3U98H 3LOXA 3MNSA 8GCHF 3PLPA 5J4SA 5DP6A 2W3IA 4AZ2B 7ESTE 2XW9A 1YCPK 3RXOA 1OYQA 2V3OH 5T6GA 2FOMB 5F8XA 3DFJA 3M3TA 3URDA 3KNXA 4ZHMU 5FXLA 1HAIH 5AFZH 2O8LA 3RXLA 1SLUB 4FUFA 1O2KA 1AFQC 1GJAB 1O3OA 3PB1E 5EXMA 2J94A 4KTCA 1O36A 3D49H 1DICA 5F8ZA 2VGCB 2ZFTA 2W5EA 4ABBA 2HPPH 3UNRA 1YGCH 1NFUA 2Q6DA 1P2MA 1LTOA 4BAMB 4WY3A 3L6PA 2ZDNA 3KQDA 2ZDAH 4D76A 1RJXB 2Y7ZA 1HXEH 4GLYA 2GP9B 1ZSJA 4ABEA 4K1EA 1GI2A 5ESBA 3MU8A 1WTHD 3WY8A 3UR9A 4X8TH 1NFWA 1O0DH 1EPTB 1QRZA 2Z9LA 4FUHA 1MBMA 3QGNB 2VB0A 4WMEA 2Q6FA 2NU3E 1O2TA 1NO9H 4ABJA 5HGGA 1CO7E 1UTMA 1O2UA 3A8CA 3P6ZB 1TA2A 3TVJB 1AN1E 3NKKA 4AG1A 1P0SH 4NZLA 1XX9A 2PWXA 1CBWB 1AIXH 1HBTH 1C2GA 4OGYA 3LJOA 2GT8A 4ABAA 4NSYA 4XBCA 2ZCLP 1L4DA 1VJAU 3A85A 2PUXB 5FX6A 1NM6A 3E0NB 1NC6A 3E0PB 1ARCA 3RMOH 1TRYA 2OINA 1C4V2 2ZHDA 4RSPA 1TABE 5GDSH 1E38B 1Y3VA 2PGBB 1TPPA 1P09A 4KP0A 1K21H 4AGKA 3UPEA 4GPGA 2CXVA 1BTXA 3LIWA 1ZTJA 4AYYB 4IC6A 2BXTH 4X6NA 3A8DA 4OS2A 4D9QA 1V2LT 1AE5A 3SI4H 2ZQ1A 1BOQA 1GVKB 4FUBA 3NK8A 3A8AA 4LOYH 1O32A 2Q6GA 8LPRA 2ZU3A 1C5SA 1HV7A 1O39A 1HAVA 2G4UA 2QXGA 4O3UA 4SGAE 5ESTE 3H7OA 1TRMA 3EGKH 1LKBA 2J4IA 4ABFA 1BRAA 2WPKS 3DHKH 3F9GA 3KEEA 1W7XH 1GGDC 3TGIE 1A61H 6LPRA 2Y6TA 1HAGE 1W13U 3F68H 4ABHA 1V2UT 4ABDA 1P9UA 1WAYB 1QHRB 1TRNA 1UTLM 4X2XA 1H9IE 3GCNA 4UEHH 4YOGA 1A0LA 2P59A 3UNSA 4ZHLU 1N8OB 1UTJA 1CSOE 1TBRH 2ZPRA 4AG2A 2FX6A 1BB0B 1TWXB 3EA9A 3RXKA 5HM2A 1KXCA 2VWLA 2BLVA 1K1JA 5PTPA 4PROA 1GI8B 2H5DA 3SV2H 4ABIA 1TX8A 4ZHAA 1TNHA 1YC0A 1GI7B 3RXSA 4GVUA 2FYRA 1KDQB 2ZHWH 2Z3EA 1PPCE 3QTOH 1GBKA 2VIDA 4J2YB 4H6SB 3HPTB 1GPZA 3SU4A 3MU0A 2C4FH 3ZZ3A 3RDZA 1HIAB 1KLTA 1S84A 3TH3H 2BQ7B 3SORA 3K65B 4X1SU 3V12A 1NPMA 2GV7A 5C20A 2ZCKP 2ZDLA 4JZDH 1ANBA 3SHCH 3A84A 1LDTT 1C5UA 1AKSA 5T6FA 5DP4A 3M5LA 3ZVBA 4X6PA 2C8ZB 2FS9A 4DJZB 1GHVH 2BVRH 1ANCA 1P57B 2HNTF 1SOTA 1GHBG 1G3CA 2J95A 3SQHE 2XC5A 5ETXA 4KGAA 2TIOA 2ZQ2A 1CGJE 3A7VA 4CRGA 5EW1H 3MNCA 1JXPA 4ISIH 1C5TA 3LGYA 2ZCHP 2QA9E 5E2PA 2GKVE 3T28A 3KIDU 1JOUB 1O5GH 2AMQA 3EA7A 1C1WH 2J38A 3SUEA 4GCHF 1OOKB 1YPGH 3M5NA 1XXDA 1FI8A 1SGFG 1O5CB 2QAAA 2ZEBA 1QB9A 2P16A 1HB0B 5EODA 1E34B 3LGIA 3QO6A 3MNBA 1FY3A 1K1NA 1QL9A 1ZR0A 2QGRA 1HJ9A 1O3IA 3U8OH 4RKJB 4MQAA 1Z7KA 1S81A 3RXUA 4WMFA 3RUOA 1T8LA 3Q77A 5EW2H 3BEUA 1C2HA 4JK5A 3RXFA 1ZHMA 1G37A 3M7TA 5C3NA 2J34A 2WYJA 4IC5A 1DT2A 2NU4E 7LPRA 1ABJH 4A6LA 1HJAB 1WOFA 4UD9H 1LPKB 4JCNA 4LK4A 2Z3DA 2ZFSA 1JRSA 3MOCA 3RXRA 4K8YA 2ZWLH 1MD7A 2H9EH 4IGDA 1G3DA 3LH3A 1V2RT 1AFQB 4MDSA 3TITA 4TYDA 4Y0YE 3SGQE 2AMDA 2RCEA 1V6DA 3RXQA 4A5TS 1OWEA 2HGTH 1Z8RA 3RM2H 1UHBB 1OXGA 1GVZA 4H4FA 3TK9A 2DE9A 1O31A 1GL0E 1RTFB 4YT7H 5A0BA 5JBCS 1MTNB 1BHXB 2FYQA 1QJ7B 4YOIA 4Y8ZA 2AGIX 3ODDA 6CHAB 3RXHA 3TU7H 1ANDA 1IQKA 1GBLA 2GMTC 2WINI 2ANYA 2I6SA 3VB7A 3E1XB 4MLFB 4I7YH 4CRAA 3B8JA 2ODQA 2Y5FA 3R3GB 4BTUB 3D62A 2FXRA 1O33A 3MU5A 5T3HA 3SBKA 4ZH8A 4AB9A 3KQBA 4BTTB 1J9CH 2R2MB 1LVBA 1O2RA 1YCPM 1INCA 1LMWB 2ZF0H 2H9HA 1GBHA 1TNJA 1XMNB 2ZI2H 1NT1A 1ABIH 1PYTD 2BMGB 2XC0A 3A89A 1L4ZA 2FDAA 3ZZ9A 2JETB 1DUAA 5TJXA 1EKBB 2FLRH 3HGPA 4Y6DA 1PFXC 1KSNA 3PWCA 2PKAA 2UWLA 1C2DA 2ZU1A 1PPGE 2BB4A 1AY6H 2AIPA 1FIWA 1AO5A 2IPHA 2A5KA 2BYAX 3SUFA 1QL7A 1XM1A 3IITA 2HWLB 3MNXA 1XUFA 1LHGH 1TBZH 3NWUA 3P95A 2VVUA 1BTWA 3FANA 1DITH 3DFLA 3LGUA 1BTHH 2PFEA 3E3TA 2M5TA 3PTBA 3UWJH 1ELDE 1C2IA 1LHFH 2XYAA 2CF9H 1P9SA 2GCHF 2XRCA 1SG8B 5C67A 4JZEH 3M7QA 2H6MA 3TNTA 5E0JA 3ZV9A 3EAJA 2VIWA 3H7TA 1EOJA 2G5VA 2PKAB 2BX3A 1LKAA 3RXGA 3PMAB 3LGTA 2BX4A 1BTPA 4CRCA 1QBNA 2ALPA 3BTDE 3ZZ5A 1WV7H 4DURA 3S9CA 4AX9H 4BXWA 3DT0H 5JPMH 1SGTA 1AWHB 3UIRA 3VB5A 3A88A 1BZXE 1BIOA 1E0FD 1D3QB 1UK3A 4YOJA 1D6WA 2VJ1A 1N8OC 1AFEH 4K3JA 4DIHH 2BDCA 2Z9KA 4XBBA 1K1PA 1ACBE 4X6OA 4NG9H 4ISNA 1O5BB 3QGJA 3ZZDA 2VVCA 1K2I1 1XVOA 1S0QA 3E8LA 5GIBA 4X2VA 1IQJA 4YTAA 2FO9A 2G8TA 4ZXXH 1AUTC 4YLUA 1N6YA 3LC5A 1GJ9B 1UVPA 2G81E 1OWKA 1AKSB 3T27A 2SNWA 2BDAA 3PROA 1FPCH 1JBUH 2YOLA 1MZDA 3STJA 3S9AA 3U8RH 4H42U 1GHZA 2BXUH 2NWNA 1AI8H 4I8HA 3OU0A 4BAQB 2D26C 3AW0A 3K6YA 4AOQA 1IQHA 1O3LA 1O2GH 3U69H 2ZA5A 4Y8XA 4OS1A 1DSTA 1GJ4H 5A09A 2A4GA 1A2CH 1NN6A 1O2YA 4WXIA 5AHGH 2VWOA 1SGQE 3PMBB 1BBRK 1S6FA 3GCTG 3P70B 3NXPA 1PQ8A 1HJ8A 4MPWA 2BDBA 1BJUA 1H9LB 1IHSH 2ILNA 2XNIA 3QX5H 1NU9A 2FOFA 1Z1JA 2OBQA 1Z6EA 3A83A 3RC5A 2W7UA 5L30H 1YF4A 1FPHH 4GUXA 3PMJA 4ABGA 1TX7A 2WUBA 3M3VA 1BQYA 1YCPH 1RRKA 1TBQH 5K0HA 1C1TA 1FMGA 1C5QA 1VR1H 4Y10E 1A3BH 1C9TA 1C2EA 3UREA 3T5FH 2R3UA 2F9BH 1QB1A 1F0UA 1M9UA 1A7SA 1YM0A 4FU8A 4TWYA 5JBTA 1YYY1 2OCVB 1P2OA 3G01A 1KDQA 3A7YA 1C1UH 1IQLA 1SC8U 1ZYOA 2P3FH 1SGRE 5TCCA 1AVGH 1HRTH 1O30A 3ODFA 3UQOA 2PKSB 2ANMH 3RU4E 3T62A 1XVMA 3PYHA 2OUAA 1O2VA 4Q7ZA 3E91A 1G2MA 3O8RA 4WH6A 3RXTA 3SJOA 3SZNA 1O5AB 3ENSB 3RMLH 1P06A 1EUFA 1QRXA 5AF9H 1XUKA 1DY9A 3AW1A 1T8MA 3LPRA 3MFJA 1T7CA 3F9FA 2Y7XA 1KTTB 1HJAC 5DP3A 1F5LA 4TY6A 1UVTH 3I29A 1NRSH 3UWIA 4NWKA 1BRUP 5B6OA 2ZTXA 1BTYA 5EGMA 3ATWA 1FY8E 3BTME 1GJDB 1MZAA 2ZGCA 1LVYA 1ZMJA 1AB9B 2TGTA 2A4RA 2WUCA 4MTBA 2AH4X 1KXFA 3P17H 1QJ1B 1C2JA 2AYWA 1RXPA 2SGDE 1OPHB 2TBSA 1GCTC 2UUFB 3ZZBA 1UJ1A 3RXEA 6CHAC 3BG4B 1C1RA 2VU8E 4NIXA 3A86A 3SV8A 2XBVA 2OC1A 5GCHG 1AZZA 2A31A 4GHTA 6GCHF 2XCNA 2J9NA 4FVDA 2FOAA 3SHAH 1T8OA 1YPEH 3SNEA 4MG3A 3SUDA 3TH2H 1WQVH 4GCHG 2G55A 2AFQB 2FI3E 1S6HA 2GTBA 2ZDVH 4WH8A 3L3TA 1O3GA 4ZKNU 2CV3A 4FUIA 1KYNA 3RLYH 1ZGIA 1V2VT 1O2HA 2ODYB 1F2SE 3GICB 4UFDH 1ELVA 1YPMH 3VXEH 1VITG 2JETC 4X8SH 1FZZA 1NFYA 3B9FH 3MMGA 3TK5A 1O2OA 1ZHRA 1SQOA 1KXDA 3PTNA 3DA9B 3SU1A 2BLOA 1VJ9U 1QFKH 3TJVA 5F8TA 2PV9B 1PYTC 3KQCA 4UONA 3SQEE 1IQFA 1XUJA 3SN8A 4GSOA 3GCHC 2GCTB 1J16A 3LDXH 1SSXA 2C93B 1SPJA 2B8OH 2FS8A 2CHAB 1EPTC 2ZGXH 5GWZA 3UOPA 4X2WA 1L2EA 3BTGE 3E90B 3GISB 2SGEE 4MNXA 1OP2A 3SW2B 1TGNA 4FU7A 2RA3A 4FUDA 2GGVB 2BOHB 2AEIH 1TPOA 1NS3A 3CENA 1XKBC 2A7HA 2BHGA 4MNVA 1FUJA 1G9IE 3OX7U 1VCWA 4INKA 1N6XA 1GHXH 2P93A 1Y3XA 3GY2A 4MNWA 1D3TB 3Q3YA 1QA0A 1V2QT 2JH0D 4RKOB 3HKIB 5L2YH 2ZTZA 3UNQA 2AGGX 1O2JA 2TGAA 2TPIZ 2BD2A 4ISLA 4Q7XA 1E37B 3T25A 3C1KA 2BM2A 4MPUA 1LHDH 1MMJN 1IQNA 1QJ6B 4MNYA 1EB2A 2SFAA 2Z9GA 2CJIA 1Z71A 1O3BA 1FN8A 1HAZB 3BV9B 1O2NA 1WSSH 2HRVA 2OC7A 2P3UB 3GCHB 1P2JA 3RP2A 2PR3A 3RMMH 5CE1A 2QYIA 2C8WB 1O2IA 1PQAA 1GJ5H 1O2PA 4D9RA 1GBBA 1ZPCA 2GT7A 4YT6H 2AGEX 1Y3YA 4O97A 1J15A 3PM3A 1ETRH 1AU8A 1DSUA 2Y80A 1D3PB 3UQVA 3K6ZA 3ZZ6A 1C1VH 3JZ2B 4K5ZA 4XFQA 5FBIA 3PV4A 2Y5HA 2TGDA 3BN9A 3KF2A 2ZECA 4FUCA 1VCPA 3P92A 1TGSZ 2AMPA 2ZKSA 2F91A 1O2XA 1EOLA 3AAVA 8ESTE 4ISOA 3MYWA 1ZRBA 3GY6A 3M3SA 4GHQA 1C1QA 4E05H 2AIQA 2XBWA 2OQ5A 3GY3A 1Z8GA 1C5PA 3ZYEA 1SGEE 4JZIA 1XUGA 5K7RA 4FXGH 1DXPA 5EQQA 5CHAB 4DY7B 2Z9JA 1BTZA 1MAYA 3HK6B 2SGQE 5JB8S 1THSH 2FZZA 3F6UH 2BZ6H 2BD8A 3JZ1B 4I8KA 5JYIA 5EOKA 1C2FA 1O5FH 3MH6A 4F49A 4Y7AA 4XE4A 2CF8H 4OS6A 1T32A 1V2NT 1BMNH 1J17T 5E2OA 3V13A 1BMLA 1OP8A 4I8JA 2A32A 3SU6A 1TFXA 1AHTH 2FODA 1H1BA