1C3DA

X-ray crystal structure of c3d: a c3 fragment and ligand for complement receptor 2
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
294
structure length
294
Chain Sequence
MLDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C3D
publication title X-ray crystal structure of C3d: a C3 fragment and ligand for complement receptor 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complement
total genus 117
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 1998-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1c3dA00
1GSZA 3Q7AB 2GOXA 3G6JB 3HXDB 2H6GB 3K7XA 1N4QB 1TNBB 5FO8B 3PZ3B 5JPMB 1LTXB 4BOJA 1H35A 4YDEB 3OXUA 4GTMB 2H6FB 1DCEB 5FOBB 1LD8B 1H3BA 1KZPB 4FXGB 5AGDA 1H3CA 1D8EB 1W6KA 3PZ2B 2A73B 1O79A 2I07B 3C72B 1JCRB 3HXEB 2BBCA 2PMVA 1FPPB 3E37B 1GXOA 4EHMB 1KZOB 3Q78B 2ZIRB 4V1SA 4ZRQA 1SA4B 4GTRB 4GTVB 3EU5B 1JCSB 4D4CA 2V8KA 1JCQB 3RJ3A 1LD7B 4MU9A 4ZH1A 1W6JA 3KSQB 3SQCA 1NI1B 1O1TB 4GTOB 1TN7B 4KKIA 1TN6B 2BEDB 4MBGB 2WINB 2WY7A 1TNUB 3HXFB 5JPNB 2SQCA 1QQFA 4GTPB 4L9PB 4D4DA 1H39A 1UMPA 1O5MB 3EUVB 1SA5B 2NOJA 2WY8A 3SFXB 1D8DB 1MZCB 1GHQA 2BB6A 3DSSB 1H37A 2V8IA 1N9AB 2B39A 5FO7B 2PN5A 3DSVB 1S64B 3PZ1B 1H36A 2V8JA 3PZ4B 2F0YB 3D5SA 4KKJA 1R76A 1FT1B 1GXMA 3Q79B 4LNGB 4GTSB 3D5RA 1X81B 1TNYB 3KSLB 4GTQB 3E30B 4GTTB 4D94A 3HXCB 4ONTA 4D4BA 1O1SB 1C3DA 2H6HB 1H3AA 1S63B 1N95B 3HXBB 3E33B 2R2LB 1N4PB 1N94B 2H6IB 1GXNA 1O1RB 1O6HA 3Q73B 4YDOB 3Q75B 2V3PA 3DPYB 3DSUB 3DSTB 1QBQB 1TNOB 3KLSA 2XWBB 1NL4B 1O6QA 4LNBB 1QSJA 1FT2B 2IEJB 2G02A 4FXKB 2G0DA 3DRAB 3E34B 3SFYB 2V3NA 2XWJB 1HZFA 3DSWB 4LNVA 1SQCA 1TN8B 2ZISB 2WIIB 1N4SB 4ZRPA 3DSXB 2BB5A 2XQWA 4M76A 1O6RA 4V1RA 3CU7A 3E32B 1TNZB 3Q7FB 4D4AA 1N4RB 4BOKA 5FO9B 3OEDA 4C1SA 3KQ4A
chains in the Genus database with same CATH superfamily
1GSZA 2D8LA 1HXGA 3G6JB 3HXDB 2H6GB 2NVPA 3K7XA 3M7CA 4DODA 1TNBB 5JPMB 1UT9A 1LTXB 1H35A 1HXAA 4GTMB 4JJJA 1LD8B 3WKIA 5FOBB 4FXGB 4OK2A 2EACA 1HM3A 1N23A 3W7UA 1D8EB 3WKFA 1W6KA 1GA2A 2I07B 3C72B 2BRWA 3WIRA 1CB8A 4ZH5A 1V5DA 2PMVA 4WVBA 3A0OA 3E6UA 1KZOB 5ILIA 1SA4B 1RQ5A 3PYAA 4WU0A 1N7OA 4GTRB 2XFGA 3S4BA 4TF4A 3H3KA 1LXMA 2JJBA 4ZH1A 3KSQB 1N21A 4OZWA 1O1TB 1KKTA 1FBOA 3ON6A 3QT3A 4GTOB 4MBGB 3QXFA 2SQCA 4GTPB 4L9PB 3M7LA 1LF6A 3EUVB 2NOJA 1D8DB 3RSYA 1DOGA 3P2CA 1H37A 5FO7B 3M78A 1S64B 2CQTA 2V8JA 3PZ4B 2ZZRA 1GXMA 3M77A 3E7JA 3Q79B 4GTSB 5EASA 4OZVA 3KSLB 3E30B 1H14A 4GTTB 5JMFA 1IS9A 4ONTA 5DHIA 1HMUA 1UG9A 4J5TA 5EAUA 1HM2A 1L1YA 1O1RB 1O6HA 3Q73B 3W7XA 1TNOB 2BRPA 1X1HA 4LNBB 2IEJB 3N0FA 2CQSA 1V5CA 5EATA 1FCEA 4LNVA 1X9DA 2A8ZA 2QNOA 4ZRPA 5IK9A 4AYQA 1IA7A 1XW2A 2BB5A 2XQWA 5IL3A 3CU7A 2WCOA 4RNQA 3M72A 1KS8A 1V7WA 3S4CA 1N4RB 3OEDA 5M7IA 1WU4A 2GZ6A 3Q7AB 2AFAA 2YIKA 3W5MA 1N4QB 1H54A 1AYXA 3M73A 5FO8B 4YDEB 2JF4A 3NFVA 1V7XA 3EU8A 3QFYA 1DCEB 1W3YA 1DL2A 1H3BA 2Z07A 5AGDA 3W7SA 1H3CA 2F6DA 2FV1A 1ULVA 3M71A 2AHGA 1FPPB 4OK4A 3E37B 1GXOA 1KSDA 3E73A 5DGQA 1XWTA 1OJNA 3M02A 1FO2A 2FBAA 4GTVB 5GZKA 1JCSB 3N0GA 1J0NA 1CEMA 1JCQB 4MU9A 1FMIA 4KKIA 1OJPA 1TN6B 3VW5A 4LIXA 4D4DA 1H39A 4FNVA 5ILKA 3QWTA 1LF9A 1SA5B 2Q1FA 3H7LA 3M74A 5ILDA 3H2WA 4DI5A 4YCRA 1MZCB 1GHQA 4DOEA 4AYOA 2DRRA 5GY3A 3WIQA 4Z4LA 2V8IA 1N9AB 1WU5A 3QT9A 3VXDA 1H36A 2F0YB 1R76A 2BRVX 2ONGA 4Z4JA 1HXCA 1H12A 1OJOA 5CA3A 1TNYB 4QT9A 3RX7A 3WC3A 1N1BA 4D4BA 3W5NA 3NNBA 1H3AA 1GLMA 5ILZA 3HXBB 1N4PB 1N94B 3PMMA 2V3PA 3DSUB 1KWFA 2WYNA 3DSTB 5MEHA 1QBQB 1V7VA 1KSCA 3RENA 3KLSA 1RW9A 4L0GA 1NC5A 3S9VA 1FT2B 3SFYB 3P5PA 1NXCA 1HZFA 2JG0A 1KREA 3D3IA 2ZISB 1X1JA 1N20A 4M76A 2RI8A 4V1RA 3E32B 4CE7A 3ANIA 1N7PA 3EZ8A 4L6XA 4ZG8A 4TXTA 2X03A 2DRQA 5C05A 3SDQA 2FUZA 2FV0A 1F9GA 3PZ3B 4BOJA 2H6FB 1LOHA 5M7YA 5IL8A 1N7QA 3SDTA 1KZPB 3M76A 3WUXA 3W7WA 2GH4A 3AFLA 2A73B 3PZ2B 4E1YA 5E2JA 1JCRB 4NEIA 1X1IA 3S4AA 4EHMB 1F9OA 2AHFA 4F13A 4V1SA 1HCUA 3M00A 4GAXA 4ZRQA 3RX5A 3TF4A 3ACTA 1RWGA 4D4CA 3S4DA 3RJ3A 1W6JA 3SQCA 1NI1B 3SAEA 1TN7B 5CZLA 2BEDB 2E22A 2WINB 3ANKA 1RWAA 3G4FA 1O5MB 3GZKA 5ILYA 5IK0A 2BB6A 3DSSB 2ZBLA 4WVAA 2VN7A 1K72A 3K11A 1F9DA 2B39A 2PN5A 3DSVB 1I8QA 2E24A 4KKJA 5IK6A 3QPFA 1N24A 4EL8A 3W7TA 3D5RA 1X81B 4GTQB 3SDUA 1L2AA 3M01A 2H6HB 4AYPA 1S63B 1N95B 1OJMA 3E33B 2R2LB 5DGRA 2H6IB 1GXNA 4YDOB 3Q75B 3DPYB 1QAZA 5ILJA 5IKAA 1N7RA 3QRYA 3RRSA 1GAHA 1F1SA 2XWBB 1NL4B 1O6QA 3M7BA 4FXKB 2ONHA 1FBWA 2G02A 3DRAB 1G9JA 4GL3A 2XWJB 1CLCA 1TN8B 2WIIB 1N4SB 3DSXB 2DRSA 3WIWA 1XWQA 1HN0A 4D4AA 2VN4A 5FO9B 3KQ4A 1RWHA 4F10A 4OJZA 2RI9A 4Q2BA 2GOXA 4KTPA 1TF4A 3WKHA 1AGMA 3OXUA 4KTRA 4CJ1A 3A3VA 3CIHA 1VD5A 3LZ9A 1O79A 3HXEB 2BBCA 3P5RA 2EABA 1C82A 2FUQA 1HV6A 3ACSA 1JS4A 2DROA 3EQAA 1N22A 2ZIRB 3Q78B 3ANJA 5CD2A 1RWCA 5IM1A 1GAIA 3EU5B 2V8KA 1LD7B 1G87A 3QDEA 2EAEA 1EGUA 3QXQA 1G9GA 1J0MA 5JPNB 2WY7A 1TNUB 1RWFA 3HXFB 2B4FA 1QQFA 4WVCA 5IKHA 3PYBA 1UMPA 2J5CA 2WY8A 1KFGA 3SFXB 1HX9A 4CJ0A 3M75A 1KRFA 1LXKA 4FUSA 3X17A 1IA6A 3PZ1B 3D5SA 3GT5A 1FT1B 2WDAA 3G4DA 1WZZA 4LNGB 3QG0A 5GW7A 4MMHA 3RX8A 2P0VA 4D94A 5KKBA 5ILHA 3HXCB 2FUTA 1O1SB 1C3DA 1HMWA 5DHKA 3WKGA 2EADA 3VSNA 3SDRA 1FAEA 1G6IA 3QSPA 1FP3A 3QFZA 3VSMA 5JMDA 3AFJA 1QSJA 1N7NA 3E34B 2G0DA 3M7EA 4AYRA 2V3NA 1H13A 3DSWB 3GLYA 2D5JA 1FO3A 1WU6A 2OKXA 1SQCA 1N1ZA 3SDVA 1O6RA 4MMIA 1TNZB 3E80A 3T33A 3Q7FB 4BOKA 2RGKA 4FJQA 4C1SA 4XUVA 4Q88A
chains in the Genus database with same CATH topology
1GSZA 2D8LA 3G6JB 3HXDB 2H6GB 2NVPA 3K7XA 3M7CA 4DODA 1TNBB 5JPMB 1UT9A 1LTXB 1H35A 4GTMB 4JJJA 1LD8B 3WKIA 5FOBB 4FXGB 2EACA 3W7UA 1D8EB 3WKFA 1W6KA 1GA2A 2I07B 3C72B 3WIRA 4ZH5A 1V5DA 2PMVA 4WVBA 3E6UA 1KZOB 1SA4B 1RQ5A 3PYAA 4WU0A 4GTRB 2XFGA 3S4BA 4TF4A 3H3KA 2JJBA 4ZH1A 3KSQB 1O1TB 1KKTA 1FBOA 3ON6A 3QT3A 4GTOB 4MBGB 3QXFA 2SQCA 4GTPB 4L9PB 3M7LA 1LF6A 3EUVB 2NOJA 1D8DB 3RSYA 1DOGA 3P2CA 1H37A 5FO7B 3M78A 1S64B 2CQTA 2V8JA 3PZ4B 2ZZRA 1GXMA 3M77A 3Q79B 4GTSB 3KSLB 3E30B 1H14A 4GTTB 1IS9A 4ONTA 1UG9A 4J5TA 1L1YA 1O1RB 1O6HA 3Q73B 3W7XA 1TNOB 4LNBB 2IEJB 2CQSA 1V5CA 1FCEA 4LNVA 1X9DA 2A8ZA 2QNOA 4ZRPA 4AYQA 1IA7A 1XW2A 2BB5A 2XQWA 3CU7A 3M72A 1KS8A 1V7WA 3S4CA 1N4RB 3OEDA 5M7IA 1WU4A 2GZ6A 3Q7AB 2AFAA 2YIKA 3W5MA 1N4QB 1H54A 1AYXA 3M73A 5FO8B 4YDEB 2JF4A 1V7XA 3EU8A 3QFYA 1DCEB 1DL2A 1H3BA 2Z07A 5AGDA 3W7SA 1H3CA 2F6DA 2FV1A 1ULVA 3M71A 2AHGA 1FPPB 3E37B 1GXOA 1KSDA 3E73A 5DGQA 1XWTA 1FO2A 2FBAA 4GTVB 5GZKA 1JCSB 1CEMA 1JCQB 4MU9A 1FMIA 4KKIA 1TN6B 3VW5A 4LIXA 4D4DA 1H39A 3QWTA 1LF9A 1SA5B 3H7LA 3M74A 3H2WA 4YCRA 1MZCB 1GHQA 4DOEA 4AYOA 2DRRA 5GY3A 3WIQA 4Z4LA 2V8IA 1N9AB 1WU5A 3QT9A 3VXDA 1H36A 2F0YB 1R76A 4Z4JA 1H12A 5CA3A 1TNYB 4QT9A 3RX7A 3WC3A 4D4BA 3W5NA 1H3AA 1GLMA 3HXBB 1N4PB 1N94B 3PMMA 2V3PA 3DSUB 1KWFA 2WYNA 3DSTB 5MEHA 1QBQB 1V7VA 1KSCA 3RENA 3KLSA 4L0GA 1NC5A 3S9VA 1FT2B 3SFYB 3P5PA 1NXCA 1HZFA 2JG0A 1KREA 3D3IA 2ZISB 4M76A 2RI8A 4V1RA 3E32B 4CE7A 3ANIA 4L6XA 3EZ8A 4ZG8A 4TXTA 2DRQA 3SDQA 2FUZA 2FV0A 3PZ3B 4BOJA 2H6FB 5M7YA 3SDTA 1KZPB 3M76A 3WUXA 3W7WA 2GH4A 3PZ2B 2A73B 5E2JA 1JCRB 3S4AA 4EHMB 1F9OA 2AHFA 4V1SA 1HCUA 4ZRQA 3TF4A 3RX5A 3ACTA 4D4CA 3S4DA 3RJ3A 1W6JA 3SQCA 1NI1B 3SAEA 1TN7B 5CZLA 2BEDB 2WINB 3ANKA 1O5MB 3GZKA 2BB6A 3DSSB 2ZBLA 4WVAA 2VN7A 1K72A 3K11A 1F9DA 2B39A 2PN5A 3DSVB 4KKJA 3QPFA 4EL8A 3W7TA 3D5RA 1X81B 4GTQB 3SDUA 1L2AA 2H6HB 4AYPA 1S63B 1N95B 3E33B 2R2LB 5DGRA 2H6IB 1GXNA 4YDOB 3Q75B 3DPYB 3RRSA 3QRYA 1GAHA 2XWBB 1NL4B 1O6QA 3M7BA 4FXKB 1FBWA 2G02A 3DRAB 4GL3A 1G9JA 2XWJB 1CLCA 1TN8B 2WIIB 1N4SB 3DSXB 2DRSA 3WIWA 1XWQA 4D4AA 2VN4A 5FO9B 3KQ4A 2RI9A 4Q2BA 2GOXA 4KTPA 1TF4A 3WKHA 1AGMA 3OXUA 4KTRA 4CJ1A 3A3VA 3CIHA 1VD5A 1O79A 3HXEB 2BBCA 3P5RA 2EABA 3ACSA 1JS4A 2DROA 3EQAA 2ZIRB 3Q78B 3ANJA 5CD2A 1GAIA 3EU5B 2V8KA 1LD7B 1G87A 3QDEA 2EAEA 3QXQA 1G9GA 5JPNB 2WY7A 1TNUB 3HXFB 2B4FA 1QQFA 4WVCA 3PYBA 1UMPA 2WY8A 1KFGA 3SFXB 4CJ0A 3M75A 1KRFA 4FUSA 3X17A 1IA6A 3PZ1B 3D5SA 3GT5A 1FT1B 1WZZA 4LNGB 3QG0A 5GW7A 3RX8A 2P0VA 4D94A 5KKBA 3HXCB 1O1SB 1C3DA 3WKGA 2EADA 3SDRA 1FAEA 1G6IA 3QSPA 1FP3A 3QFZA 3AFJA 1QSJA 3E34B 3M7EA 2G0DA 4AYRA 2V3NA 1H13A 3DSWB 3GLYA 2D5JA 1FO3A 1WU6A 2OKXA 1SQCA 3SDVA 1O6RA 1TNZB 3T33A 3Q7FB 4BOKA 2RGKA 4C1SA 4XUVA 4Q88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSZ A;  3Q7A B;  2GOX A;  3G6J B;  3HXD B;  2H6G B;  3K7X A;  1N4Q B;  1TNB B;  5FO8 B;  3PZ3 B;  5JPM B;  1LTX B;  4BOJ A;  1H35 A;  4YDE B;  3OXU A;  4GTM B;  2H6F B;  1DCE B;  5FOB B;  1LD8 B;  1H3B A;  1KZP B;  4FXG B;  5AGD A;  1H3C A;  1D8E B;  1W6K A;  3PZ2 B;  2A73 B;  1O79 A;  2I07 B;  3C72 B;  1JCR B;  3HXE B;  2BBC A;  2PMV A;  1FPP B;  3E37 B;  1GXO A;  4EHM B;  1KZO B;  3Q78 B;  2ZIR B;  4V1S A;  4ZRQ A;  1SA4 B;  4GTR B;  4GTV B;  3EU5 B;  1JCS B;  4D4C A;  2V8K A;  1JCQ B;  3RJ3 A;  1LD7 B;  4MU9 A;  4ZH1 A;  1W6J A;  3KSQ B;  3SQC A;  1NI1 B;  1O1T B;  4GTO B;  1TN7 B;  4KKI A;  1TN6 B;  2BED B;  4MBG B;  2WIN B;  2WY7 A;  1TNU B;  3HXF B;  5JPN B;  2SQC A;  1QQF A;  4GTP B;  4L9P B;  4D4D A;  1H39 A;  1UMP A;  1O5M B;  3EUV B;  1SA5 B;  2NOJ A;  2WY8 A;  3SFX B;  1D8D B;  1MZC B;  1GHQ A;  2BB6 A;  3DSS B;  1H37 A;  2V8I A;  1N9A B;  2B39 A;  5FO7 B;  2PN5 A;  3DSV B;  1S64 B;  3PZ1 B;  1H36 A;  2V8J A;  3PZ4 B;  2F0Y B;  3D5S A;  4KKJ A;  1R76 A;  1FT1 B;  1GXM A;  3Q79 B;  4LNG B;  4GTS B;  3D5R A;  1X81 B;  1TNY B;  3KSL B;  4GTQ B;  3E30 B;  4GTT B;  4D94 A;  3HXC B;  4ONT A;  4D4B A;  1O1S B;  1C3D A;  2H6H B;  1H3A A;  1S63 B;  1N95 B;  3HXB B;  3E33 B;  2R2L B;  1N4P B;  1N94 B;  2H6I B;  1GXN A;  1O1R B;  1O6H A;  3Q73 B;  4YDO B;  3Q75 B;  2V3P A;  3DPY B;  3DSU B;  3DST B;  1QBQ B;  1TNO B;  3KLS A;  2XWB B;  1NL4 B;  1O6Q A;  4LNB B;  1QSJ A;  1FT2 B;  2IEJ B;  2G02 A;  4FXK B;  2G0D A;  3DRA B;  3E34 B;  3SFY B;  2V3N A;  2XWJ B;  1HZF A;  3DSW B;  4LNV A;  1SQC A;  1TN8 B;  2ZIS B;  2WII B;  1N4S B;  4ZRP A;  3DSX B;  2BB5 A;  2XQW A;  4M76 A;  1O6R A;  4V1R A;  3CU7 A;  3E32 B;  1TNZ B;  3Q7F B;  4D4A A;  1N4R B;  4BOK A;  5FO9 B;  3OED A;  4C1S A;  3KQ4 A; 
#chains in the Genus database with same CATH topology
 1GSZ A;  2D8L A;  1HXG A;  3G6J B;  3HXD B;  2H6G B;  2NVP A;  3K7X A;  3M7C A;  4DOD A;  1TNB B;  5JPM B;  1UT9 A;  1LTX B;  1H35 A;  1HXA A;  4GTM B;  4JJJ A;  1LD8 B;  3WKI A;  5FOB B;  4FXG B;  4OK2 A;  2EAC A;  1HM3 A;  1N23 A;  3W7U A;  1D8E B;  3WKF A;  1W6K A;  1GA2 A;  2I07 B;  3C72 B;  2BRW A;  3WIR A;  1CB8 A;  4ZH5 A;  1V5D A;  2PMV A;  4WVB A;  3A0O A;  3E6U A;  1KZO B;  5ILI A;  1SA4 B;  1RQ5 A;  3PYA A;  4WU0 A;  1N7O A;  4GTR B;  2XFG A;  3S4B A;  4TF4 A;  3H3K A;  1LXM A;  2JJB A;  4ZH1 A;  3KSQ B;  1N21 A;  4OZW A;  1O1T B;  1KKT A;  1FBO A;  3ON6 A;  3QT3 A;  4GTO B;  4MBG B;  3QXF A;  2SQC A;  4GTP B;  4L9P B;  3M7L A;  1LF6 A;  3EUV B;  2NOJ A;  1D8D B;  3RSY A;  1DOG A;  3P2C A;  1H37 A;  5FO7 B;  3M78 A;  1S64 B;  2CQT A;  2V8J A;  3PZ4 B;  2ZZR A;  1GXM A;  3M77 A;  3E7J A;  3Q79 B;  4GTS B;  5EAS A;  4OZV A;  3KSL B;  3E30 B;  1H14 A;  4GTT B;  5JMF A;  1IS9 A;  4ONT A;  5DHI A;  1HMU A;  1UG9 A;  4J5T A;  5EAU A;  1HM2 A;  1L1Y A;  1O1R B;  1O6H A;  3Q73 B;  3W7X A;  1TNO B;  2BRP A;  1X1H A;  4LNB B;  2IEJ B;  3N0F A;  2CQS A;  1V5C A;  5EAT A;  1FCE A;  4LNV A;  1X9D A;  2A8Z A;  2QNO A;  4ZRP A;  5IK9 A;  4AYQ A;  1IA7 A;  1XW2 A;  2BB5 A;  2XQW A;  5IL3 A;  3CU7 A;  2WCO A;  4RNQ A;  3M72 A;  1KS8 A;  1V7W A;  3S4C A;  1N4R B;  3OED A;  5M7I A;  1WU4 A;  2GZ6 A;  3Q7A B;  2AFA A;  2YIK A;  3W5M A;  1N4Q B;  1H54 A;  1AYX A;  3M73 A;  5FO8 B;  4YDE B;  2JF4 A;  3NFV A;  1V7X A;  3EU8 A;  3QFY A;  1DCE B;  1W3Y A;  1DL2 A;  1H3B A;  2Z07 A;  5AGD A;  3W7S A;  1H3C A;  2F6D A;  2FV1 A;  1ULV A;  3M71 A;  2AHG A;  1FPP B;  4OK4 A;  3E37 B;  1GXO A;  1KSD A;  3E73 A;  5DGQ A;  1XWT A;  1OJN A;  3M02 A;  1FO2 A;  2FBA A;  4GTV B;  5GZK A;  1JCS B;  3N0G A;  1J0N A;  1CEM A;  1JCQ B;  4MU9 A;  1FMI A;  4KKI A;  1OJP A;  1TN6 B;  3VW5 A;  4LIX A;  4D4D A;  1H39 A;  4FNV A;  5ILK A;  3QWT A;  1LF9 A;  1SA5 B;  2Q1F A;  3H7L A;  3M74 A;  5ILD A;  3H2W A;  4DI5 A;  4YCR A;  1MZC B;  1GHQ A;  4DOE A;  4AYO A;  2DRR A;  5GY3 A;  3WIQ A;  4Z4L A;  2V8I A;  1N9A B;  1WU5 A;  3QT9 A;  3VXD A;  1H36 A;  2F0Y B;  1R76 A;  2BRV X;  2ONG A;  4Z4J A;  1HXC A;  1H12 A;  1OJO A;  5CA3 A;  1TNY B;  4QT9 A;  3RX7 A;  3WC3 A;  1N1B A;  4D4B A;  3W5N A;  3NNB A;  1H3A A;  1GLM A;  5ILZ A;  3HXB B;  1N4P B;  1N94 B;  3PMM A;  2V3P A;  3DSU B;  1KWF A;  2WYN A;  3DST B;  5MEH A;  1QBQ B;  1V7V A;  1KSC A;  3REN A;  3KLS A;  1RW9 A;  4L0G A;  1NC5 A;  3S9V A;  1FT2 B;  3SFY B;  3P5P A;  1NXC A;  1HZF A;  2JG0 A;  1KRE A;  3D3I A;  2ZIS B;  1X1J A;  1N20 A;  4M76 A;  2RI8 A;  4V1R A;  3E32 B;  4CE7 A;  3ANI A;  1N7P A;  3EZ8 A;  4L6X A;  4ZG8 A;  4TXT A;  2X03 A;  2DRQ A;  5C05 A;  3SDQ A;  2FUZ A;  2FV0 A;  1F9G A;  3PZ3 B;  4BOJ A;  2H6F B;  1LOH A;  5M7Y A;  5IL8 A;  1N7Q A;  3SDT A;  1KZP B;  3M76 A;  3WUX A;  3W7W A;  2GH4 A;  3AFL A;  2A73 B;  3PZ2 B;  4E1Y A;  5E2J A;  1JCR B;  4NEI A;  1X1I A;  3S4A A;  4EHM B;  1F9O A;  2AHF A;  4F13 A;  4V1S A;  1HCU A;  3M00 A;  4GAX A;  4ZRQ A;  3RX5 A;  3TF4 A;  3ACT A;  1RWG A;  4D4C A;  3S4D A;  3RJ3 A;  1W6J A;  3SQC A;  1NI1 B;  3SAE A;  1TN7 B;  5CZL A;  2BED B;  2E22 A;  2WIN B;  3ANK A;  1RWA A;  3G4F A;  1O5M B;  3GZK A;  5ILY A;  5IK0 A;  2BB6 A;  3DSS B;  2ZBL A;  4WVA A;  2VN7 A;  1K72 A;  3K11 A;  1F9D A;  2B39 A;  2PN5 A;  3DSV B;  1I8Q A;  2E24 A;  4KKJ A;  5IK6 A;  3QPF A;  1N24 A;  4EL8 A;  3W7T A;  3D5R A;  1X81 B;  4GTQ B;  3SDU A;  1L2A A;  3M01 A;  2H6H B;  4AYP A;  1S63 B;  1N95 B;  1OJM A;  3E33 B;  2R2L B;  5DGR A;  2H6I B;  1GXN A;  4YDO B;  3Q75 B;  3DPY B;  1QAZ A;  5ILJ A;  5IKA A;  1N7R A;  3QRY A;  3RRS A;  1GAH A;  1F1S A;  2XWB B;  1NL4 B;  1O6Q A;  3M7B A;  4FXK B;  2ONH A;  1FBW A;  2G02 A;  3DRA B;  1G9J A;  4GL3 A;  2XWJ B;  1CLC A;  1TN8 B;  2WII B;  1N4S B;  3DSX B;  2DRS A;  3WIW A;  1XWQ A;  1HN0 A;  4D4A A;  2VN4 A;  5FO9 B;  3KQ4 A;  1RWH A;  4F10 A;  4OJZ A;  2RI9 A;  4Q2B A;  2GOX A;  4KTP A;  1TF4 A;  3WKH A;  1AGM A;  3OXU A;  4KTR A;  4CJ1 A;  3A3V A;  3CIH A;  1VD5 A;  3LZ9 A;  1O79 A;  3HXE B;  2BBC A;  3P5R A;  2EAB A;  1C82 A;  2FUQ A;  1HV6 A;  3ACS A;  1JS4 A;  2DRO A;  3EQA A;  1N22 A;  2ZIR B;  3Q78 B;  3ANJ A;  5CD2 A;  1RWC A;  5IM1 A;  1GAI A;  3EU5 B;  2V8K A;  1LD7 B;  1G87 A;  3QDE A;  2EAE A;  1EGU A;  3QXQ A;  1G9G A;  1J0M A;  5JPN B;  2WY7 A;  1TNU B;  1RWF A;  3HXF B;  2B4F A;  1QQF A;  4WVC A;  5IKH A;  3PYB A;  1UMP A;  2J5C A;  2WY8 A;  1KFG A;  3SFX B;  1HX9 A;  4CJ0 A;  3M75 A;  1KRF A;  1LXK A;  4FUS A;  3X17 A;  1IA6 A;  3PZ1 B;  3D5S A;  3GT5 A;  1FT1 B;  2WDA A;  3G4D A;  1WZZ A;  4LNG B;  3QG0 A;  5GW7 A;  4MMH A;  3RX8 A;  2P0V A;  4D94 A;  5KKB A;  5ILH A;  3HXC B;  2FUT A;  1O1S B;  1C3D A;  1HMW A;  5DHK A;  3WKG A;  2EAD A;  3VSN A;  3SDR A;  1FAE A;  1G6I A;  3QSP A;  1FP3 A;  3QFZ A;  3VSM A;  5JMD A;  3AFJ A;  1QSJ A;  1N7N A;  3E34 B;  2G0D A;  3M7E A;  4AYR A;  2V3N A;  1H13 A;  3DSW B;  3GLY A;  2D5J A;  1FO3 A;  1WU6 A;  2OKX A;  1SQC A;  1N1Z A;  3SDV A;  1O6R A;  4MMI A;  1TNZ B;  3E80 A;  3T33 A;  3Q7F B;  4BOK A;  2RGK A;  4FJQ A;  4C1S A;  4XUV A;  4Q88 A; 
#chains in the Genus database with same CATH homology
 1GSZ A;  2D8L A;  3G6J B;  3HXD B;  2H6G B;  2NVP A;  3K7X A;  3M7C A;  4DOD A;  1TNB B;  5JPM B;  1UT9 A;  1LTX B;  1H35 A;  4GTM B;  4JJJ A;  1LD8 B;  3WKI A;  5FOB B;  4FXG B;  2EAC A;  3W7U A;  1D8E B;  3WKF A;  1W6K A;  1GA2 A;  2I07 B;  3C72 B;  3WIR A;  4ZH5 A;  1V5D A;  2PMV A;  4WVB A;  3E6U A;  1KZO B;  1SA4 B;  1RQ5 A;  3PYA A;  4WU0 A;  4GTR B;  2XFG A;  3S4B A;  4TF4 A;  3H3K A;  2JJB A;  4ZH1 A;  3KSQ B;  1O1T B;  1KKT A;  1FBO A;  3ON6 A;  3QT3 A;  4GTO B;  4MBG B;  3QXF A;  2SQC A;  4GTP B;  4L9P B;  3M7L A;  1LF6 A;  3EUV B;  2NOJ A;  1D8D B;  3RSY A;  1DOG A;  3P2C A;  1H37 A;  5FO7 B;  3M78 A;  1S64 B;  2CQT A;  2V8J A;  3PZ4 B;  2ZZR A;  1GXM A;  3M77 A;  3Q79 B;  4GTS B;  3KSL B;  3E30 B;  1H14 A;  4GTT B;  1IS9 A;  4ONT A;  1UG9 A;  4J5T A;  1L1Y A;  1O1R B;  1O6H A;  3Q73 B;  3W7X A;  1TNO B;  4LNB B;  2IEJ B;  2CQS A;  1V5C A;  1FCE A;  4LNV A;  1X9D A;  2A8Z A;  2QNO A;  4ZRP A;  4AYQ A;  1IA7 A;  1XW2 A;  2BB5 A;  2XQW A;  3CU7 A;  3M72 A;  1KS8 A;  1V7W A;  3S4C A;  1N4R B;  3OED A;  5M7I A;  1WU4 A;  2GZ6 A;  3Q7A B;  2AFA A;  2YIK A;  3W5M A;  1N4Q B;  1H54 A;  1AYX A;  3M73 A;  5FO8 B;  4YDE B;  2JF4 A;  1V7X A;  3EU8 A;  3QFY A;  1DCE B;  1DL2 A;  1H3B A;  2Z07 A;  5AGD A;  3W7S A;  1H3C A;  2F6D A;  2FV1 A;  1ULV A;  3M71 A;  2AHG A;  1FPP B;  3E37 B;  1GXO A;  1KSD A;  3E73 A;  5DGQ A;  1XWT A;  1FO2 A;  2FBA A;  4GTV B;  5GZK A;  1JCS B;  1CEM A;  1JCQ B;  4MU9 A;  1FMI A;  4KKI A;  1TN6 B;  3VW5 A;  4LIX A;  4D4D A;  1H39 A;  3QWT A;  1LF9 A;  1SA5 B;  3H7L A;  3M74 A;  3H2W A;  4YCR A;  1MZC B;  1GHQ A;  4DOE A;  4AYO A;  2DRR A;  5GY3 A;  3WIQ A;  4Z4L A;  2V8I A;  1N9A B;  1WU5 A;  3QT9 A;  3VXD A;  1H36 A;  2F0Y B;  1R76 A;  4Z4J A;  1H12 A;  5CA3 A;  1TNY B;  4QT9 A;  3RX7 A;  3WC3 A;  4D4B A;  3W5N A;  1H3A A;  1GLM A;  3HXB B;  1N4P B;  1N94 B;  3PMM A;  2V3P A;  3DSU B;  1KWF A;  2WYN A;  3DST B;  5MEH A;  1QBQ B;  1V7V A;  1KSC A;  3REN A;  3KLS A;  4L0G A;  1NC5 A;  3S9V A;  1FT2 B;  3SFY B;  3P5P A;  1NXC A;  1HZF A;  2JG0 A;  1KRE A;  3D3I A;  2ZIS B;  4M76 A;  2RI8 A;  4V1R A;  3E32 B;  4CE7 A;  3ANI A;  4L6X A;  3EZ8 A;  4ZG8 A;  4TXT A;  2DRQ A;  3SDQ A;  2FUZ A;  2FV0 A;  3PZ3 B;  4BOJ A;  2H6F B;  5M7Y A;  3SDT A;  1KZP B;  3M76 A;  3WUX A;  3W7W A;  2GH4 A;  3PZ2 B;  2A73 B;  5E2J A;  1JCR B;  3S4A A;  4EHM B;  1F9O A;  2AHF A;  4V1S A;  1HCU A;  4ZRQ A;  3TF4 A;  3RX5 A;  3ACT A;  4D4C A;  3S4D A;  3RJ3 A;  1W6J A;  3SQC A;  1NI1 B;  3SAE A;  1TN7 B;  5CZL A;  2BED B;  2WIN B;  3ANK A;  1O5M B;  3GZK A;  2BB6 A;  3DSS B;  2ZBL A;  4WVA A;  2VN7 A;  1K72 A;  3K11 A;  1F9D A;  2B39 A;  2PN5 A;  3DSV B;  4KKJ A;  3QPF A;  4EL8 A;  3W7T A;  3D5R A;  1X81 B;  4GTQ B;  3SDU A;  1L2A A;  2H6H B;  4AYP A;  1S63 B;  1N95 B;  3E33 B;  2R2L B;  5DGR A;  2H6I B;  1GXN A;  4YDO B;  3Q75 B;  3DPY B;  3RRS A;  3QRY A;  1GAH A;  2XWB B;  1NL4 B;  1O6Q A;  3M7B A;  4FXK B;  1FBW A;  2G02 A;  3DRA B;  4GL3 A;  1G9J A;  2XWJ B;  1CLC A;  1TN8 B;  2WII B;  1N4S B;  3DSX B;  2DRS A;  3WIW A;  1XWQ A;  4D4A A;  2VN4 A;  5FO9 B;  3KQ4 A;  2RI9 A;  4Q2B A;  2GOX A;  4KTP A;  1TF4 A;  3WKH A;  1AGM A;  3OXU A;  4KTR A;  4CJ1 A;  3A3V A;  3CIH A;  1VD5 A;  1O79 A;  3HXE B;  2BBC A;  3P5R A;  2EAB A;  3ACS A;  1JS4 A;  2DRO A;  3EQA A;  2ZIR B;  3Q78 B;  3ANJ A;  5CD2 A;  1GAI A;  3EU5 B;  2V8K A;  1LD7 B;  1G87 A;  3QDE A;  2EAE A;  3QXQ A;  1G9G A;  5JPN B;  2WY7 A;  1TNU B;  3HXF B;  2B4F A;  1QQF A;  4WVC A;  3PYB A;  1UMP A;  2WY8 A;  1KFG A;  3SFX B;  4CJ0 A;  3M75 A;  1KRF A;  4FUS A;  3X17 A;  1IA6 A;  3PZ1 B;  3D5S A;  3GT5 A;  1FT1 B;  1WZZ A;  4LNG B;  3QG0 A;  5GW7 A;  3RX8 A;  2P0V A;  4D94 A;  5KKB A;  3HXC B;  1O1S B;  1C3D A;  3WKG A;  2EAD A;  3SDR A;  1FAE A;  1G6I A;  3QSP A;  1FP3 A;  3QFZ A;  3AFJ A;  1QSJ A;  3E34 B;  3M7E A;  2G0D A;  4AYR A;  2V3N A;  1H13 A;  3DSW B;  3GLY A;  2D5J A;  1FO3 A;  1WU6 A;  2OKX A;  1SQC A;  3SDV A;  1O6R A;  1TNZ B;  3T33 A;  3Q7F B;  4BOK A;  2RGK A;  4C1S A;  4XUV A;  4Q88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...