1C3EA

New insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylate in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into inhibitor design from the crystal structure and NMR studies of Escherichia coli GAR transformylase in complex with beta-GAR and 10-formyl-5,8,10-trideazafolic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
total genus 68
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1c3eA00
1NJSA 4Q12A 4PZUA 3AV3A 1MEJA 1S3IA 2FMTA 4ZYZA 3O1LA 4YFYA 1YRWA 3AUFA 4ZYTA 1RC1A 1RC0A 1MENA 4TTSA 4DS3A 4EW3A 1CDDA 4S1NA 1CDEA 1RBYA 3R8XA 4EW1A 4EW2A 5J9FA 4YFVA 3DA8A 3TQQA 4ZYXA 2BLNA 2BW0A 2GARA 2YWRA 4R8VA 3KCQA 4ZYVA 4ZZ1A 1FMTA 1RBZA 4ZZ2A 1GARA 4ZYWA 1C2TA 1ZLXA 4ZZ3A 3GARA 5CJJA 3DCJA 4ZYYA 1ZLYA 3P9XA 4TS4A 4IQFA 4QPDA 4QPCA 4ZYUA 1ZGHA 4NV1A 5J63A 1MEOA 1RBQA 3Q0IA 1JKXA 3W7BA 3N0VA 3NRBA 3OBIA 1C3EA 3LOUA 1RBMA 3TQRA 1GRCA 4TT8A 2CFIA 4ZZ0A
chains in the Genus database with same CATH superfamily
2OV1A 5ALMA 4D9FA 4B81A 3K9GA 3A32A 3EZ7A 1I3OA 1SC4A 2HRQA 3AX6A 3B2NA 3OPQA 4G0YA 4QDUA 2O0JA 2HLNA 5FNVB 5GV7A 5L45A 4ZAWA 1B2RA 3HN7A 1QHNA 4YEDA 1VLLA 3CW9A 1VBKA 4HNAB 3RHSA 3WSVA 3ZE6A 5JBIA 1HE8B 3IVAA 2VCEA 3AJ8A 5DH9A 3UPUA 2R6FA 5B58T 2P6MA 5E4TA 5TC4A 4A5SA 1RRMA 1DKMA 2YQ4A 1LC0A 2WTBA 3IPCA 4Q4JA 3IKLA 1NTRA 3TM4A 3KJGA 3V4SA 4JA0A 1A7AA 3PFFA 3EGDA 4M9CA 4PZEA 2XMPA 3G2MA 2P65A 5LNK6 1HMPA 3OE7D 1B6SA 3RC7A 5J43A 1ICIA 1HTWA 2CB9A 3E35A 4KW7A 5T6BA 4DTCA 1SQFA 2GPTA 3OQJA 1GCGA 4LE0A 3OMXA 3FSRA 3QF4B 2EHJA 1TZ2A 2XEXA 5LP6F 1V95A 1N92A 3N2LA 1W2WB 1BHSA 5EINA 4K46A 4X1IB 3NJRA 5CM9C 5DASA 3RWOA 4B46A 1R0YA 1UINA 1UXJA 1GN8A 2R6JA 3BFXA 3EW9A 3I37X 2FKAA 4NG5A 2PJZA 4DJEC 4JP2A 3LT0A 2XDAA 1B3RA 1KZYC 1WM1A 1QV9A 5FBKA 1BROA 5AHWA 5CHYA 3TNJA 3GARA 4GWGA 3ZOZA 1U4OA 5HRUA 4D9IA 3C87A 3D6FA 2XGJA 2RBGA 4LZPA 2HCFA 1QG2A 4CU5A 1X9IA 5T57A 2PAFA 4AF7A 4PC2A 1NOJA 2BMFA 3JTEA 3PR1A 4DIEA 1F7VA 1N6LA 1NRIA 1SBYA 3AVXA 4PNPA 4F8JA 4OHYA 3R20A 1WVMA 1GPJA 1GZ6A 4KI7A 4KIJA 1IEXA 2WKRA 1E9VA 2CL7X 3ID6C 2C99A 3LCMA 2AN5A 4KR2A 1R8YA 3OTWA 3O1JC 1DMRA 2CUNA 2EJVA 2VDOB 1E2JA 1YZTA 2HPZA 1QFSA 1XTSA 1HG1A 2B61A 3IPYA 3VYWA 2PQMA 3HDTA 2J1LA 3GNQA 4M1YA 2BAGA 4EPTA 2VP3A 2PD3A 2E85A 4YI3A 1R9NA 1WABA 4DDTA 1CJCA 1Q50A 4N41A 3QKWA 2OXEA 4QGHA 1EXNA 1IATA 2ZRAA 4G09A 3VYVA 4B6FA 1TYZA 3FMOB 5IJ0A 4KVAA 3PDWA 1SBNE 1R8QA 2IHZA 1E8MA 1E7YA 2OQIA 1H0HA 1X3SA 2R1ZA 3BJIC 4HUQA 1G41A 2DUWA 4WGFA 1E1RD 3Q2OA 4YNBA 3SBDA 2XUPA 3TLYA 1XHEA 4AKEA 2YV5A 1BW9A 1SOAA 1UH5A 2GHTA 3MWKA 1B2LA 1B41A 3DPIA 3NANA 4KYVA 4LI0A 2XJ9A 1DQPA 4ALLA 3GFGA 5KHOC 2C4MA 1S8FA 2BN4A 1Z5ZA 1N2CE 4MGKR 4ER7A 2FZLA 1YI1A 1N2IA 3G68A 4NEGA 1KK1A 3WDLA 1Q2UA 2I78A 3COPA 5ALXA 1E32A 1ACLA 2QEQA 4D43A 9ABPA 4NBNA 2C20A 1H2YA 3D4OA 2EEZA 3DM5A 1XCJA 3C6ZA 1FLVA 3DMTA 3NRBA 4AUMA 4DBZA 1PLJA 3MBKA 3NG1A 2BH2A 4URFA 1ZITA 3EWIA 3WKDA 3ZDCA 3TOZA 3A1UA 4XVRA 4GKKB 3VR0A 2R6DA 3MLEA 4MRSA 2FW7A 5ERGB 1ZIYA 2XVYA 4HL6A 3ZIDA 2Q5JA 5TQ0B 2YKGA 2NTYC 4CG0A 4AY3A 5EIBD 3C7KA 2KBFA 4ND1A 2GZDA 2PT9A 1AA9A 3TGLA 3KZXA 1TNDA 4F85A 2O3TA 5AJZA 3YASA 1J8DA 3HNRA 1C8BA 3NKFA 4BFZA 4RTPA 5HQJA 1IL0A 3QELA 3RB8A 1ZK3A 4EA7A 3CNNA 3QXSA 4ZCTA 2V5UA 1M1YA 2WJVA 1MP0A 1UBMS 2PSSA 3ZY5A 3R7LA 3CF4A 4X8LA 4BFXA 1SVNA 3FUWA 3KPYA 1NC1A 1GLGA 3R8CA 2GBLA 4IGAA 2B4QA 3KK0A 3S2YA 2REOA 2WJYA 1H66A 1MT0A 3IQWA 4NFYA 4AXBA 3G88A 4KLRA 1PZGA 4L4RA 3UZUA 3Q6IA 3ZHQA 4MV4A 1U3DA 2CL0X 1KJZA 4OOFA 3M70A 1DNPA 2O1XA 1CQWA 3SXUB 4RVGA 1K7SN 1BDBA 3JQ8B 2GR9A 3I9V6 3BREA 4C4ZA 3SSNA 1XFAA 2DM6A 2IYTA 3R1IA 1VOTA 2WI8A 3PFNA 6REQB 1RFGE 1ZGJA 2IEIA 2Z2IA 3OZWA 2AXEA 4OMFG 4DBVO 2R96A 5DYYA 1NXSA 3D7KA 4ASUA 5AICA 1KDYA 4PX9A 2PR7A 2B3DA 4QXAA 4B4WA 2EF0A 1VLZA 1M2HA 2XUFA 4DABA 2ECFA 3M9XA 4P5PA 3IVXA 2X0RA 5HSGA 2CV0A 1JDJA 5EJ5A 3MWEA 4ZQGA 2F48A 2C4KA 4GXNA 3UJPA 2DF8A 3UPDA 3T38A 4ZQHA 4MDFA 1CT9A 4RESA 4HNGA 1M2VB 2QU8A 5FWNA 1P9OA 1RLIA 3SX0A 2QOEA 2ZEJA 3GEHA 5T6MA 3U26A 5BN4B 2COUA 1ESMA 4RH3A 3O9ZA 4DJAA 3BJRA 4DV5B 1XD2B 3HSSA 1CUFA 3OCXA 3QEJA 1EX7A 4BS9A 5LPNA 4QWWA 1X0VA 4KHPB 4Q3KA 3RHTA 4S3MA 3P52A 4N82A 1YIDA 5KNDD 2ZIGA 1DC4A 1NLMA 3GEPA 3HXLA 4PLCA 4MA4A 3PL1A 4M53A 4HS9A 4NK4A 1NOKA 1YU6A 1YVEI 2ZPAA 3NYIA 4GS5A 3UGKA 3NHPA 1CZHA 3PP8A 4P3OA 4ABTA 3TOVA 5IULC 4OBXA 5K1ZA 2DYKA 2PMFA 2B0CA 2VKTA 4H1TA 4IOLA 5HJ7A 4B74A 1N7IA 2ZUSA 3SCZA 2J5BA 5EJEA 1SCUB 3BHNA 2Z1DA 3GO4A 3BFKA 5TF4A 3VUEA 3QUSA 3LHKA 2CEAA 3B3FA 3H3JA 4NJEB 3CLKA 1F2VA 1UAGA 3ESDA 2YWFA 3VR6H 4AJPA 2ZJ2A 1C7FA 1C7ZA 2FPXA 4J0CA 3W8RA 3GU3A 3LP6A 3T35A 3W8EA 4PXYA 4BECA 5HKAA 3Q7SA 1XZNA 3U1BA 1O2DA 4ENTA 2HI0A 4TLCA 2YN4A 5EP4A 3EISA 3TQRA 1GFWA 1W88A 5TGDA 1MC8A 2KWIA 4YN3A 1OLUB 5H4GA 3N76A 1DGQA 3ZE8A 3EF3A 4QA9A 4C2AA 2WTNA 5BSRA 5FL7D 2AJBA 5I9IA 2J5KA 5CD9A 4E30A 4QNMA 2FEWB 2JFUA 3H0KA 1OAKA 3GDOA 2R7KA 3CX4A 4L15A 3EA0A 1QOZA 1ZD2P 2C3YA 2YZNA 3COWA 1GG8A 4UDNA 3K70D 1U0NA 1LSUA 3E2PA 3LBAA 2P7HA 1XWFA 2NU6A 3PLNA 1PP4A 2IVZA 3DCJA 3O6VA 4LVUA 4ND3A 3ROTA 5IJ0B 1KNXA 4UJ5A 4L75A 5F23A 3ZWKA 1I2MA 1C3EA 1TKCA 1O57A 2C61A 2PX4A 3LOUA 4GOXA 4HZIA 4K7JA 4LYAA 2J48A 5ESWA 3NIBA 4B0PA 4FSXA 3L7CA 2DT5A 1EQ2A 5JECA 3GCWA 3G8YA 1NQWA 2VBCA 3JPYA 4LNHA 3E15A 3KAKA 4UPEA 4S1NA 4GMGA 4ZFNA 3BBLA 1MORA 4XR9A 2XVXA 3ZOKA 4EGAA 2G88A 4MV8A 4ZYXA 4GR9A 3SVLA 4GWKA 1SC9A 2GWRA 2JL1A 1FU4A 1U0TA 3JWHA 4MCAA 3ILXA 4BZPA 3VFDA 3ZG6A 2WDPA 4D9GA 1QG6A 5F3WB 2DWOA 4H3HB 5CURA 3HA3A 1FVHA 5F76A 3GB9A 3AF0A 2X3UA 5DF1A 1VL5A 1SELA 1SXJE 2WA1A 1W4LA 4RKWA 4FNAA 5ETJA 4DMUB 1SWWA 1JZTA 4HH4A 3UO8B 2VUTA 1JLRA 3RE1A 3H1PA 2YOGA 3KSBC 7GPBA 1N78A 2C31A 2ZUTA 4AN0A 1QC5A 4EQZA 1S2MA 3HUFA 3HJUA 5FLXA 4UBOA 1NLFA 4BWYA 4Q93A 4CLDA 2B34A 4Y6QA 4M46A 3MUEA 4ESEA 1QP0A 1ZC3A 3DEHA 1ADBA 2P11A 4MXDA 2YOHA 2R5FA 4KGXA 5FI1B 4F9TA 2E1PA 3FROA 3AR9A 1UOQA 5HFAA 3B5JA 1TU3A 1PZNA 2XODA 5U4XA 5EIBC 1C41A 3G02A 3WTBA 3DMTC 1A1SA 3EGDB 4M8IA 4WLFA 5DE3A 2XD9A 2CYAA 2ZAGA 1VHLA 2YASA 4R8MA 3RUCA 4CKWB 1K0FA 3MYRA 3MELA 4PCUA 5FJIA 5J1TB 3UYKA 3ZHRA 1IQUA 1W36C 2G5PA 2X7JA 1U80A 1T4MA 3DEFA 3O8LA 2I65A 2ERXA 2Z30A 2GBCA 3DO6A 2V65A 3ZWNA 1XXHA 3ZCSA 4HNAA 4GP7A 3FVWA 3E8SA 1BKYA 4CF7A 2ONZA 2V6FA 3WLSA 1J09A 1TZKA 3C8MA 3EIQA 5K3FA 3ZW9A 2XB6A 4RGYA 5B6JA 4OHKA 1A2BA 2XUZA 2QVXX 4YRMA 1KY3A 2O1WA 3O4IA 3NALA 5ICFA 5TQ2B 4DLLA 3IR6A 1E1RA 1SBQA 3O2QB 3PQFA 1P2VA 4I9UA 3DVAB 1WSAA 3BRCA 3WS7A 2AMFA 4F7WA 1P5ZB 2XITA 2DOKA 3M4JA 3I73A 1G59A 4DLYA 2P9JA 3U4GA 2AVDA 4DJDC 1WSWA 3QTLA 2B21A 2RKWA 5JS6A 2L69A 2KLBA 2O7SA 2DFDA 1QH8B 1JEOA 3VV3A 4BBJA 5HZMA 3O4JA 1DEOA 2YWEA 4CKYA 1X13A 3HE3A 3IAHA 3JD0A 3VYTB 4D8YA 4ZHQF 4Y6LA 1CJTC 1JDUA 1H85A 1E6KA 2PLRA 3A6LA 4MRAA 4ZT3A 3E4DA 1RS0A 2EBUA 4MKFA 4DILA 3AESA 5KX5F 1G64A 2XT0A 3K16A 3I61A 3F7MA 3AR7A 2PH3A 3LKBA 2NO1A 3ZW8A 1E5VA 1LW7A 2G5TA 2QB5A 1XZGA 1T4DA 1VSTA 2Q6KA 1A71A 4A92A 2BE7A 4G0QA 3SFTA 4U0JA 2WB4A 1AJEA 3ELDA 3IP8A 4IIJA 2NZ8A 2E4UA 2F67A 3F46A 4FTWA 1KWGA 2E5FA 3O91A 1ABEA 2RH8A 3I6YA 3NM5A 3LOPA 5M34A 4TX1A 4AJ4A 2ZE7A 4MYUA 4P84A 5HF6A 3K1YA 2CLDX 4DDMA 4LVCA 4DB4A 5PNTA 2X5KO 4Q4AB 1Z29A 1EESA 4JB8A 4XB1A 2J3EA 3QYPA 3WHLA 2JEZA 3CV3A 1RCFA 4TTVA 4G8BA 2PXCA 1CR2A 1Z0UA 4YQFA 4MVCA 5A9RA 5FBLB 2CL6X 5IT0A 1QORA 3EH1A 3LO5A 4HN2A 1X1QA 1KERA 4HNRA 4CR6A 1CU1A 4EZEA 1PNOA 4I4TA 1JHUA 2W43A 3HR8A 2POCA 5AVWA 4JWKA 3MCUA 1YFKA 3P7MA 5HF9A 4EHJA 1Z82A 1PQUA 4KR0A 3MJVA 3AB7A 5D3ZA 4ISCA 4BLVA 1H0KA 4OYRA 4Q7MB 2GT1A 4K6OA 4R7ZA 4AMUA 1GM5A 3IR7A 3AP1A 1L7EA 1YACA 2Z4SA 3QLUA 4LYJA 1SKYB 2CC2A 4GMXA 2AD5A 4JEHA 2JHGA 4YP0A 3V9AA 2C59A 4EENA 4U63A 3TQQA 4NQRA 5DGTA 3LVBA 3NQ41 4R2KA 2WNIA 1NU6A 3L8MA 4IMPA 5HIIA 3DHWC 3SJAA 1XZKA 2R0QC 4KTTE 1VKOA 4ARCA 1VJTA 3TLJA 3NMUF 1JQJC 2EP8A 1GTJ1 3DE7X 1GA6A 4LNAA 4P4GA 2VQ3A 1EEXB 1T8YA 2FUG1 4JOQA 4XDYA 5AT1A 4CKBB 3QOFA 4JBIA 4OEHA 5B3KA 1XELA 1XTPA 4PCVA 4HDQB 4BMOB 4AULA 1H2RS 4U5QA 2AH5A 2P4EA 4PINA 3M3DA 3QPDA 2C7VA 3KJQA 3DAHA 4ZGGA 1EDDA 4OP2A 4XD2A 4BNUA 4E12A 4TMWA 2E4XA 2P35A 4PLFA 3UHJA 1RBYA 5JALA 3JQEA 1KH2A 3PTLA 4MV3A 3E9YA 2CLKB 3L1KA 2HT6A 3WDSA 4TS9A 2OV8A 1T8WA 3QPWA 1X42A 1DQNA 4XQ0A 1GNQA 1QCDA 3RS7A 3Q5DA 3UG7A 1RWMA 4B43A 5A7FA 1H0SA 3GOHA 1SUFA 2J4DA 2OK8A 4MUIA 4BVEA 3LUGA 1VHJA 1HDXA 2M6LA 4EI8A 3F6PA 2EJTA 3LUFA 3HCFA 2WZQA 3WL4A 1SB8A 3WIDA 2ILTA 2PXHA 2PA0A 1QNLA 2O2SA 1PFVA 3OT5A 4HDOB 3H17A 4JMPA 3ZY2A 4AS3A 2HU5A 5IXSA 1TM2A 4GX0A 3FHJA 4YMSA 1NF9A 1YB5A 5WRFA 3S5JA 4C6SA 3WAJA 3EQ9A 1L1EA 1XA3A 1YAHA 3CMMA 3OCUA 3UJAA 1JVBA 4B3HA 1XZLA 1SOVA 1IRXA 1Y7TA 4IKEA 3AM3A 4LDZA 1ZUNA 4WHMA 2FW9A 2OZLA 1IXSB 2IP1A 1ILWA 2BW0A 3ZDFA 3GLIB 3RSCA 4HWTA 3L01A 4G5OA 1NIPA 4WW0A 4O02B 1ZVJA 3KPVA 1RVV1 2YHIA 1LBIA 5LU9A 4P0PB 1S3FA 4FZ5A 3ND8A 3ZH2A 1TPZA 2RIPA 3TF5A 4CYMA 3R6LA 2CF5A 3H18A 5KAMA 2VPIA 1CUGA 5DK4A 3RAPR 3ZK7A 3ZWWA 4F21A 1II8B 4H6XA 3H3FA 3EUWA 5H7XA 2XCIA 4MUMA 1KSHA 1OI4A 2WZBA 3JQPA 5JH7A 4NVRA 1M34E 1TM7E 3BSWA 2BGWA 3QK7A 4BVAA 2WQ6A 5C3UA 3ICOA 3C5WP 1ZJJA 2PX0A 4EA6A 3PWSA 4O3MA 1YASA 4WTOA 2PO5A 1KEKA 4DRXA 1XCMA 2QL7A 1E60A 1TO2E 1WUHS 2KQUA 3DC7A 2VK2A 3KB6A 3KWFA 4ZCPA 3IP6A 3C3MA 4BTLA 1OXBB 5BQ3A 2O2EA 3EASA 2HAEA 3G2IA 4JXKA 3AKEA 3R74A 1Q6YA 4B76A 1DV2A 4C3UA 4DV2B 1ENYA 3D5EA 1XCLA 2JIOA 5E1BA 4ZYYA 1O89A 3PUWA 3VO2A 4JQZA 1AS2A 3B6JA 4MARA 3B9BA 3PC6A 1G4UR 2H29A 3PX3A 1EP3B 3S40A 2OPHA 1XCGB 5CVJA 1Y3DE 1GNLA 1IONA 5D51S 4ENSA 5ARCA 5C7LO 3MWDB 4O2BB 2FF5A 2OE2A 4EGFA 5KU1A 4AKSA 1PU2A 4BL5A 1RWXA 3DLCA 4UZSA 5GONB 2C4UA 1R6AA 3MS4A 4FHZA 4YQYA 5DOZA 4AJJA 3CH4B 4F71A 1LC3A 2YY6A 1QIKA 5A03A 4O6VA 4NTZA 1VB5A 4Z9XA 1XZ8A 2GZSA 5IKEA 5JSUA 1SR8A 1SU6A 4AY2A 4JXZA 3ZW7A 5JS1A 3ETEA 4JI8B 4B7XA 3HY4A 1LW6E 5LQDA 2Z58A 1R0ZA 3F7NA 4BYGA 4ERNA 1A88A 2ZR9A 4LX0A 1NMSA 4V2UA 3D8TA 3I1JA 1M33A 3FW1A 5F3DA 4HJXA 2ZZMA 3LH5A 2FXIA 4KRGA 3A28A 2Z1NA 3JQ8A 2Q9CA 2QE7A 1OA1A 3ANMA 2ZI9A 1UJCA 3DNPA 3QFTA 4JJEA 1NN5A 4MH0R 5FTWA 5A4MS 2MJLA 1SVLA 2F8TA 2FUNB 1RI2A 1ODFA 4ZOCA 4BFTA 4F2DA 1MRNA 2PJDA 4N6OA 1RXVA 1P5FA 1EB9A 3VPDA 5AJHA 1I6MA 2W22A 5FORA 3P32A 3L6OO 2VZ8A 3LX8A 5EZYF 2QM7A 2W2XA 4K9SA 4V0LA 3SQDA 1ZC4A 4UQPA 4BNVA 3E9DA 4ZT6A 3CN7A 1XJ5A 1GGJA 2C8JA 2WLSA 2WC1A 4ZQEA 1BDJA 1EJ6A 4EH1A 4QFMA 4XGQA 1VDZA 5F9HA 2PJUA 1PS8A 2Q6VA 4N18A 4M55A 1CG6A 4LTNA 1VLJA 2LCFA 2XLCA 3WMGA 5FLYA 5CDYA 1CR4A 4HNSA 4Z4EA 1I6LA 3QVSA 1KJIA 2OCKA 4CMGA 1Y6QA 5FOXA 1ZJWA 3V1UA 4HBZA 4F3TA 1GNRA 4MINA 1UOPA 4EY3A 4X66B 1NKTA 1F8FA 3U39A 3QE3A 5CCDA 4A2QA 1EFVB 1SNYA 2GCIA 1ODJA 1WRBA 3AHJA 3EVZA 5BR7A 5FLKA 1LVUA 4OBWA 3T9CA 4DM7A 9LDTA 1YULA 3E27A 3IAS1 1WZNA 4PIVA 4J76A 5KHAA 4AMBA 4B6OA 4LQ4A 1AIPA 1POXA 3HN6A 1QIHA 1IJFA 5CEEA 3HGTA 1H3FA 3IUQA 4FCCA 2DHRA 3EJWA 4YRTA 1L3BA 3GVXA 1RZ3A 4IIBA 4D0LB 2PUCA 3RIXA 4FGKA 3OU2A 2IEGA 1BU8A 1EJ0A 4A3SA 2RIRA 3OOHA 5FI0B 3PHHA 4D5EA 4DNPA 5K09A 4EELA 1FSFA 3V34A 4F60A 3GGPA 3NWOA 1QHSA 4GRIA 3LQFA 3HJFA 1X9HA 3R3UA 3CF0A 3NGLA 4XXHA 1G8KA 2IX3A 2J85A 4PGFA 3QNWA 5EP2A 2DX7A 3T7RA 4IPTA 3OPNA 4P3XA 4AYTA 2HBQA 2EOAA 3DD1A 1NMZA 1KC3A 1UXHA 3ANYB 3NBFA 5HZGA 3AYXB 3MRVA 1YIOA 1G3MA 5ADUS 1C8KA 2OXFA 4NDAA 4ZYTA 4L5YA 1Q7BA 2BFNA 1ACMA 3UMFA 2Y0CA 4CDRA 1KMIY 2HLHA 3BRSA 2XTZA 1FSSA 1VA5A 3A05A 3A3YA 5EIXA 1CR0A 1ODCA 4R8SA 1U7OA 4C07A 4EPYA 4M54A 5CH5A 3ZCVA 2WJZB 1OB2A 1DU4A 5A3VA 3LCJA 2D2XA 2GXSA 1XLUA 1WEKA 3L3BA 1E5XA 2YJNA 5DFAA 4CM8A 2PKEA 1N5RA 3FCAA 1QR2A 4B45A 1JFSA 2NUPA 3RYIA 1OI3A 2A9OA 5D5PA 1PDOA 1PWHA 3UTCA 1C4KA 4MGHA 1YZNA 3KOMA 5D3MA 3DZKA 1IN5A 3PJFA 2PUTA 2WV9A 1CNEA 3HCCA 2Y1OA 1E7SA 5JR3A 1JKIA 1GZHB 2C04A 1XR3A 5BNFA 2VCYA 3TGWA 2IHYA 1D2HA 2CXOA 1BKSB 1KKUA 4IILA 4O4JF 3U7RA 1S0UA 2Q9BA 1V16B 2V7PA 4TTIA 3H87A 4NYJR 4QT0A 4D80A 4PHTA 1P1KA 3B9PA 1PR9A 4DG5A 3E9RA 4JH0A 3GG9A 3ZWDA 5DBIA 2P90A 1HYEA 5BV1A 5MFZA 2KI5A 3GVPA 3R09A 3PGLA 2FEPA 3VH4A 3ZD8A 4DDUA 4O8ZA 3S2FA 2EQBA 2G9UA 3M33A 1G8GA 3HFGA 1U2QA 2VXCA 3PNKA 5AKHA 2PE5A 2CFTA 5BWOA 1RQRA 2W7TA 4NJMB 4WIAA 5CW1A 4L6CA 3O1IC 1K92A 1GCOA 2JFNA 2ZJ8A 3OF2A 4TZTA 2BF7A 4A16A 5EJ6A 1U8ZA 4DQDA 3DOJA 1KZHA 4YMHA 2YC4C 3Q72A 2ZI3A 4R68A 3W8FA 4HQ0A 2DCMA 4J91A 4U0KA 2CKDA 4QOEA 1SCAA 1ZUHA 3GH1A 4BV3A 1KJ9A 1Z35A 3OE5A 3BQMB 3H05A 4WK0B 3OZDA 2O4UX 1NW7A 3IOMA 2WTEA 4BJ1A 2HK8A 3OP1A 4JAVC 1Y9DA 2FW6A 2VP4A 3D8NA 3ED5A 3EG9A 2XYVA 2P3LA 2ZU0C 1K8XB 2FX3A 3IMKA 3I6QA 1J8MF 2O2ZA 1M0WA 4IJQA 3U7IA 2WSLA 1E6UA 1Z13A 3LO8A 3LY5A 4JNKA 2Z5FA 3KSZO 4TKVB 2ZTHA 4BBPA 4AK9A 1WPGA 4ZPXA 1ZN2A 2CNWD 2UZ3A 4JUDX 4MYRA 4ZAZA 3PQ8A 3HCEA 5G1NA 3ZDQA 1DFGA 2XNHA 4RZUA 1QF7A 2N47A 3KE8A 4PC7A 4WESB 5EQJB 3IDSA 3WMRA 4EKEA 2H2WA 4YUYA 5GVSA 5KC8A 3AB3A 4CIYA 1WPXA 1A98A 2C9MA 1JV2B 4PRLA 2CHQA 1NBHA 1C80A 1FDWA 1TQ8A 3A37A 3L7AA 4Q82A 1FFEA 4CEIA 2VH1A 4NJMA 5F35A 4AO8A 1ZXBA 4PGHA 3T41A 1Q17A 1I3LA 4M0FA 1PG0A 4NMMA 1W0JD 5HG0A 4ZI7B 3WL5A 3LBIA 5LQSA 3RWBA 4L22A 4C06A 1CY0A 1LRJA 5CMLA 2V4MA 1SU7A 3SQNA 5JU6A 3EIFA 1PWXA 1NGSA 2XVMA 1AVTA 3HEBA 1GUDA 1GDDA 1IB0A 5K05A 2DHQA 2XAUA 4UTOA 4MYHA 1HG0A 4ZV7A 3NAQA 5FR2A 4MUAA 3RAJA 2ICAA 3OQIB 2EKBA 1XRMA 2GTIA 4LJRA 3OKAA 3B3AA 3D8SA 3DDHA 3SP1A 2CLCX 1BEEA 3OLWA 3AM5A 3I64A 3MMXA 5D3MB 2E37A 1LJUA 2R6R1 4MI3A 3I72A 1X9GA 3O8NA 3GELA 3OAAD 4R4JA 3C74A 1QFJA 3EN0A 5FB3A 3SMVA 2RK4A 1ODIA 4WZZA 2WWVD 1PYDA 2D1RA 3RSLA 5I8WA 1P39A 4JUBA 3HU5A 4JMLA 4MVJP 5H4HA 3HO1A 3S8YA 2J0UA 1KOLA 1USGA 1FDUA 4CQMD 1T10A 4JI4B 1KI7A 1EUQA 1RE1A 3AWIA 3V46A 3HB4X 3D5TA 3I62A 3C16C 2BUCA 1ZUD1 2WJIA 3DT6A 3OP4A 4OXRA 4CM7A 3ZC3A 3FTQA 5JNSA 1KK0A 3C7AA 5EEGA 2GN4A 4UHHA 3ROPA 4BO7A 4DV0B 5G0SA 1UC4B 1KP9A 3BEOA 4P2GA 4MQEA 1Q20A 4TXLA 1PFYA 2VNKA 5ILQA 1G38A 2RHGB 4B71A 5IDXA 3VI4B 3K71B 1P0PA 4P83A 2C77A 4IV5A 2FSUA 2I9PA 3ZWAA 1X7XB 3UJ3X 1I9GA 3C4QA 3LDUA 4EJSB 1GVHA 4LX8A 2G82A 1GYPA 2QUKA 5LN1A 4CEJB 1RM0A 2V58A 3UG6A 4S12A 4OG2A 1XEWX 4DDHA 3GRAA 2P8JA 3EE6A 3IHLA 3QY9A 1Z74A 3IV6A 3TOSA 2BEVA 4UAVA 4FE4A 2FK7A 2XE6A 3K1ZA 4Y1EA 4YT4A 4IJUA 2D0PB 4DT1A 1E9SA 4ER0A 1CC1S 5AJVB 2B2CA 3EUEA 2JW5A 5JC8A 4G1FA 2H4XA 2A78A 4A8JC 2UYHA 3STYA 3ZD6A 1B6RA 1WZEA 5AKXA 3U31A 2VF2A 4FUTA 1NI4B 4ZOEA 3RSSA 4D2IA 2B36A 1CUSA 1E2UA 2B6NA 2P6NA 4LJKA 4FMPA 4WE3A 4DCMA 4ZAVA 3R8FA 1JTEA 3AL3A 2O5RA 2IYNA 3B1ZA 3I34X 4MJLA 2PTGA 2B82A 4QREA 3MGKA 4URHA 1V3QE 2ZDQA 4RFSA 3WAGA 4RELA 1CQIA 2ZAOA 3IPRA 4RORA 1QPGA 2FZGA 2GILA 5FUVA 1CS4C 2XQIA 4E6EA 5TGZA 2G04A 1A4UA 4BX8A 4BU0A 2ONKA 1UADA 1ZOLA 2R7AA 2XE7A 2YVLA 4UAGA 4CL0A 1YV9A 2R1VA 4N0DA 1KFBB 3P27A 3QXGA 3HVIA 4ARZB 1OKKA 5LUBA 3IJEB 2XF8A 4EGSA 1ADFA 3Q85A 3G2QA 4IH4A 4IHKA 4A0HA 1F1BA 2WHRA 2V5VA 4W8HA 2C98A 2ZWOA 4GT1A 4AG5A 3QY0A 1FPMA 1MUUA 1N7GA 3N39C 3U9TA 1E3WA 1VYUA 1G42A 2ATEA 2I62A 3EBLA 4QRHA 3WNZA 1WXWA 2BR3A 3JATB 2VWHA 4EHNA 3CONA 3ME5A 1ARZA 4KSCA 1IULA 1XMPA 4KC0A 4RF5A 3N2ZB 3X1KA 4G1BA 4LRXA 1T3GA 4JUCA 3NVMB 4DLWA 1Q22A 4QULA 5PGMA 3K9WA 5LDDC 2IEDA 2FR1A 1JHXA 3B1YA 1B0UA 1E4OA 2EATA 2JCYA 3AC0A 4NMHA 3SX4A 3VOAA 5CFPA 5KVSA 1WPQA 3KDPA 2AN9A 2HL6A 5IJWA 3CA8A 1EGQA 1DAHA 3X3HA 1USWA 4Q9LA 4UHEA 4ZK6A 5HJEA 3VSEA 3EK2A 3R5HA 4C0KA 2PT5A 2FHSA 5FWXB 2C4HA 1D8AA 1T26A 4RM2A 1MEJA 2VF5X 3MS2A 2P9ZA 1JALA 1K8ZB 3Q0EA 5F7ZA 1TAHA 2VZEA 3I2KA 3ICEA 1M8FA 2P6OA 1RYDA 4EO9A 5I3CA 2BFBA 4NK5A 4XYMA 4Z0PA 1QCZA 2XTMA 1FNNA 4TQGA 2BZGA 2E21A 1ZOIA 4KV7A 3TQOA 3FDXA 3BL6A 3NVAA 4RQUA 2JVJA 3TI9A 2ZUDA 3NAZA 2DULA 1DWOA 1L5VA 2X4LA 3THXA 2Q46A 1ZIDA 2FOIA 4WZBA 4A9AA 2WAXA 4O08A 4TKMA 4E33A 4LY6A 5KREA 3C6KA 1QV6A 3ZJ4A 4W9RA 5LYJA 4D26A 3W3AA 1T15A 4JJGA 5BSKA 3ZEAA 1EHIA 4DIFA 3KR9A 1VFPA 4JR2A 4LJSA 4M9RA 4NCJA 1VQ1A 1PIWA 4L9SA 1DOAA 1XRSB 4NARA 3VGJA 2VKQA 2ZTLA 3I92A 2Q3HA 1P33A 5HDBB 1KAHA 1WUJS 3UV6A 3F47A 3HVJA 3G0DA 4RNCA 1DHTA 3D2AA 3ABQB 3WGOA 1GGHA 4JBWA 3RUPA 2MYTA 2J3HA 1P1FA 2QMQA 1CIJA 4ENRA 3E8XA 2Z4TA 5B58C 3BH0A 2VPWA 1ZW1A 2P30A 3BXEA 4FGLA 3CZPA 1II8A 4Y2XA 3OM8A 1VYTA 3G8DA 3LM8A 4BJ5A 2Q2OA 3BQ9A 4HPWA 5IVKA 5FFFA 1VSUA 1C29B 3K0AA 3ORRA 4NV1A 4E4RA 1W7AA 1OQAA 4EFNA 1RJDA 4P4SB 4COKA 1LDMA 3TFOA 1R18A 2O07A 5FUQA 1T9ZA 2GDJA 2G5GX 1JHZA 2SCUB 4O4LA 4PZYA 1QZZA 4XQGA 1N4AA 3RVDA 1TTHA 2EG5A 4Q1CA 4LXXA 4F1JA 2OYSA 3DPUA 1KR5A 3OC6A 4G5YA 4GNKA 4IO0A 5KYXA 1FNSA 1RW4A 1Z16A 3OFVA 1PS9A 4ER5A 2IYPA 2Z5LA 2B6HA 3C6BA 4YB8A 2BY4A 4ZRMA 3FAKA 2Q2QA 2Y2VA 3BYZA 1SPXA 2F8MA 3IAUA 3OT1A 1KFCB 5CNJA 1KVTA 3UMYA 2K2WA 4BRZA 3MB8A 4C4XA 1I3NA 4R3WA 2OQRA 1ZRNA 3OIUA 4CMHA 4A6XA 3A06A 4AX8A 4LBVA 1ZWKA 4WEQA 4N39A 2O8FB 2DQSA 4UHKA 2OHVA 4MMYB 3KL2A 1DP4A 2DHEA 1VL8A 1Y8CA 5A6VA 2J7KA 4J49A 3RW9A 3QKRA 4NU6A 3BTVA 4B3XA 3KUXA 4PR3A 2C3OA 4A27A 1N6KA 4OHVA 4QOSA 2A0UA 2WSBA 5DX0A 4EY6A 3HCDA 1OXSC 1UKZA 2IS4A 2GGSA 2D1QA 1O1YA 2H5JA 2ZROA 2DWUA 3EZXA 5EJFA 3N8IA 1HFKA 3QRWA 1TYDE 1RHMA 1WBDA 2ZSUA 5IYZA 4GGMX 3FA2A 3EW7A 4LNUA 3RV4A 2PL9A 3W1VA 1T5HX 3CNOA 3T7CA 2M2IA 4DANA 3RK1A 3GFQA 1IZ9A 3KOYA 3MWFA 2ZS8A 4X92A 3TKLA 2XCRB 5KVCA 3UAGA 3PX7A 4PV7A 5A05A 1FP1D 4RXUA 3FX2A 2VN8A 3HYLA 4DR5B 4DC1A 1D09A 3U80A 2WKWA 3LC0A 2G07A 3GLGE 2VDLB 2FWRA 3PC4A 1H6CA 1X7YA 2H1LA 5CBPA 1LQ2A 3ELUA 4MUYA 1J21A 1KS9A 2ANCA 5C8DA 2J9FB 1GYQA 2Q4OA 2RGXA 1W73A 5FPSA 2Z8XA 1O08A 2BGMA 2ZS7A 3C3XA 4KN5A 1GCUA 2LD4A 2OAP1 2ZBUA 2PMCA 3G5LA 4MQMA 2XXBA 4TM7A 1ULTA 3PHJA 4HVLA 3FSEA 1XIVA 4I4TB 4EUKA 4XSHA 1IHYA 2CNLA 3SYRA 4EB6A 1YU9A 2IK8A 4I1IA 5F9FA 2H2DA 2GK4A 2GN9A 3ZXSA 3HKCA 4BNHA 5IHXA 1LGYA 2GI4A 3LCVB 4JDPA 1R74A 1IBCA 5ES3A 3T3PB 2AW3A 1W1IA 4P3NA 4F6CA 4C6TB 3KCNA 4P9NA 3UJ8A 4YCNA 3TNFA 1T9GR 1UODA 1W0KD 3W0LB 4CMAA 4CN8A 1MFZA 2OGTA 4PYIA 3H6HA 4UMEA 3Q9UA 5B36A 3N2NA 4H4CA 2Q28A 4N03A 4NNOA 1VGQA 1MH9A 4RVFA 4TUYA 3BCSA 5CYOA 5KNBH 1HNWB 2PKYX 2Y0PA 1LK5A 2NOAA 5E1MA 2QVLA 4IIJB 1GUZA 1NW6A 4FYMA 2OECA 1VL2A 3DUFB 2JAOA 4B6RA 3HB9A 2FGJA 1U3VA 3FLBA 1N36B 3NTUA 5K8TA 4Y6GB 5J4KA 4Z9AA 5IF9A 5JS8A 2PGNA 3I01M 4KO1S 4U00A 2XECA 2C1ZA 1JIVA 4PIPA 3BSSA 4D0RA 4MX8A 1ZJ5A 4EHHA 1XTVA 4KUHA 4RTNA 3M8KA 3SM9A 4TV8F 3SBEA 1OW3B 1E61A 2YHBA 3UKDA 1QH8A 4JZYA 3VR6A 4RL4A 1IZ0A 4MMXB 3VPGA 3T1YB 1Y63A 4JT8A 4WXEA 5P21A 1EH5A 4Q5IA 2ZSBA 1RWNA 2AL7A 2H1CA 2X2EA 1J00A 3KUDA 3I58A 4M0EA 3A6JA 4ZIRA 3DVAA 4XKJA 2P79A 3EG5A 3TZQA 4D4MA 2AOXA 4I55B 1SZDA 1JG3A 3P9NA 5T5QA 1LF5A 5BUCA 1SA0A 3LPNA 3RYFA 4AG3A 2FSSA 3QENA 3SZUA 4GPEA 2L42A 2WY2D 4NS4A 3TLCA 2GEJA 2AR0A 4M1WA 4P5EA 3USZA 2JAHA 4LXHA 5J58A 5H82A 3TSOA 3TCKA 1KNQA 1QGDA 4UARA 3OEHD 3DQPA 3L5OA 1MGOA 3Q8MA 4DBLE 5E6UA 1Q83A 2Q8QA 2ZXFA 4OGGA 4TMVA 3BZWA 3TTTA 4EQ6A 4PFJA 3K9LA 5BV0A 4PCLA 3Q7QA 821PA 2V9CA 1ZR2A 4NZOA 1XTQA 1U02A 1U04A 2XB9A 3LC7O 3RD5A 5KNDA 3ZJVA 4FJ2A 1S2OA 3KEQA 5FYQA 1XWWA 2NXNA 3D8RA 2PEZA 1BHO1 1QG4A 1Z6XA 3GFTA 4II3A 4U2FA 4XGKA 5LBTA 4V1CB 2NZWA 3VZPA 4Z8XA 4LIPD 5DTRA 2ZPUA 4WVFA 3DLHA 3C2QA 1SVIA 3HB7A 1V41E 3Q7TA 2JRLA 3G89A 4Q6BA 5G4LA 3PFCA 2VH2A 4D9JA 1AB5A 1YC5A 1P2FA 3ENWA 4RWEA 5EUBA 1GG9A 2J87A 1TMOA 4OJMX 4WOBA 1PFGA 4XGNA 1Q1BA 1YS7A 5T64A 1NUQA 3ZE7A 4CN9A 1JHMA 1EDEA 2QTVB 3MWJA 4Q66C 3MEQA 3EPHA 1OXUA 1VMAA 3QXCA 2LPMA 4FGUA 4B4UA 5JXJA 3WR5A 3OTGA 1SBZA 1VYHA 3KV1A 4R1SA 5JRDS 4LYFA 1M0EA 3SSMA 4KP7A 3H7AA 1LI5A 2FNAA 3H9EO 3U7QA 3WADA 5A6SB 4QJBA 4Z5XA 5A0TA 4BFLA 1T5SA 2MSWA 4TSFD 2GRUA 3HU2A 1CVRA 5ARDA 5EMMA 2NTVA 4BWVA 2D5BA 2P2SA 3FR7A 3NBXX 3PUIA 4O4IF 3SXJA 3KKLA 2BHNA 2LGJA 2FFJA 1KYXA 1XZHA 3HEAA 4NCBA 2QLJA 3UHOA 1AGRA 4KE7A 4EY8A 3HXQA 5CLQA 4RLSA 5EMLA 1GT6A 1IOLA 5HBGA 2F9FA 4N40A 3UMRA 4JK3A 1ADCA 2ZSJA 4K6FA 1X80A 2Y1LA 5BW6B 3I8XA 4PLTA 3ZHBA 1FXUA 2X9LA 1L4BA 1YH3A 3I52A 4H18A 3T0IA 4B5KA 4KR3A 2J7PA 4FQ8A 2WYWA 2L19A 2YQZA 4BLRA 1SUPA 5FO1A 2PPVA 4N3GA 4XLTA 4AWXA 1DJNA 3CB2A 2ZATA 5SZIA 1TEZA 1Z3CA 4XRGA 1JYFA 3H5RA 4Q1VA 4EG4A 3TN7A 3D4IA 4Y2UA 4UD2A 1U4SA 4NMXB 1OZFA 3H5IA 4CMJA 3OCZA 2D5LA 3K0FB 2LVBA 1Z3IX 3R7SA 1ZOPA 3BRWA 4CKEA 5ICEA 4B3GA 1PT8A 1SUDA 3PDUA 1OYYA 3DBLB 4MR8B 1QO7A 5JDIA 1EFAA 1Z08A 4HAZA 4ZVMA 2VTBA 5KQGA 1RYMA 3WRVA 4V0ME 1T3SA 721PA 4NOJA 2O2IA 4X41A 3O92A 5AKZA 2GLUA 3TLMA 1VLQA 1EYZA 2CXHA 2XA9A 4YY3B 1F51E 3H4MA 3GZNB 3OVMA 5A2QA 2DXIA 3OICA 4AX4A 4FIZA 3TEJA 3FNQA 1TO1E 1I2CA 1ULAA 2FDCA 4RE5A 1NVWQ 4PLVA 5I9LA 1Z8FA 3PSAA 2HQOA 5GGXA 5CYGA 1OVGA 3V7NA 3WZMA 4ZGBA 5KTYA 2DMRA 2D0DA 1X15A 2QX9A 4UMVA 3E5RA 5ECYA 5KNLA 1ZRSA 2IYZA 3BJEA 1T6NA 3NC0C 1QQTA 4PSUA 2IZZA 4Z4FA 1G5FA 3RVOA 2HMWA 4RA6B 3LY7A 5BWBA 1U8FO 1XLTA 2JLBA 5SYAA 3EF0A 5F12A 2C0PA 4LV6A 4MO9A 4JLOA 2GKOA 1K6MA 4UEJA 3KQHA 5ELLA 3RADC 4E51A 3PDIB 2EG9A 4Z54A 4QPZA 5SY9A 3GCDA 4JLJA 1CV2A 1GPKA 2Z5GA 3PXUA 3OURA 2R751 1CJSA 3SQXA 5JWRA 4RJLA 5ANRB 4C7VA 3VYUB 2M98A 4YRFA 1WU8A 1N0UA 2QMUA 1KK3A 5LOVB 3O84A 5GOZA 2FR0A 1LTHR 1U8YA 4GI7A 5AOBA 3QX9A 4ZVUA 3RC3A 1EE9A 2IBTA 1N5IA 2EHDA 3U60B 1E0JA 1L7XA 2OT3B 2XUKA 3KVVA 4BN5A 4AY5A 4YRIA 5FWAA 2QZPA 3CB4A 2HXGA 1IZZA 1JEJA 1L7AA 2XYQA 3IS3A 3QW2A 4KG7A 4MTCA 4O4HF 1XZAA 1DWQA 1UBHS 2HDWA 3W8NA 1QE5A 5EXTA 1SOWA 4KNWA 5BWNA 4A15A 3UXHA 4HAYA 3TS1A 1J1UA 2R25B 3QVWA 1VG0B 4EG7A 3TNYA 4KXUA 2P6RA 5CAEA 1XAJA 5JDCC 3THYB 4V24A 3W9SA 421PA 2WIGA 4TV8A 3UOGA 4WUTA 4G5HA 5T8KA 2HJRA 2XCLA 4FWIB 3UJNA 1IJBA 3HO8A 5BT8A 2IOFA 2QP4A 4F72A 4FNMA 4OM8A 5A4FS 3KZNA 4EDFA 9ATCA 1EHYA 4PAWA 4MCJA 4FFRA 8OHMA 1HT1E 4NE2A 1SVUA 5AOAA 4D4LA 1V37A 3VKHA 1T35A 3SIRA 3JWJA 1U7XA 3I3SR 3PEEA 4X8HA 3WB2A 1JJAA 2PJRA 3SXUA 3W2GA 3TOXA 3H1FA 1C8VB 3IAXA 4I50B 2EX4A 4UZFA 4ZV4A 2ID8A 2CVPA 5J40A 4A8JB 2EKZA 2GCGA 1E3MA 4KO4S 5FNVF 3OKPA 4HO1X 4GUDA 5CFLA 4N5DA 3ENKA 2CHEA 3KJZA 4FFSA 4RZSA 1KH1A 2GYVA 2QY9A 3B38A 4TRNA 5DIZA 2G67A 4ECAA 3LC1O 3RREA 3PF9A 1YDEA 4BAZA 3QELB 3S6JA 2BGUA 1BE8A 4XDZA 2F9MA 4KQXA 4DR2B 4LI3X 1MQSA 1E3TA 3GPCA 3OQ1A 3TLBA 2O19A 2QY6A 4EARA 5BSGA 2GBFA 1USVA 2ACEA 4I55F 2EJCA 2IYUA 4KXLA 1XQ1A 4OO3A 4RENA 1N8NA 2HADA 2EV9A 5HM8A 4E2ZA 3VO1A 1K5GA 3WKCA 3JARA 4FX2A 3LY9A 4ZANA 2FWPA 1JS1X 3P0JA 4KFCA 1R50A 3JS5A 5AM1A 2QQ5A 3TRHA 4W5QA 1GZSA 4WI1A 4AS2A 2NUAA 1LPAB 5EN4A 2JKZA 4X44A 1YJBA 1ODTC 3FVTA 4G8CA 2PNFA 2P4QA 4CTKA 2X0FA 1EUDB 1W36D 2X8BA 1RKUA 4RWZA 4FX5A 3ZNOA 3GN1A 1UZUA 3WE7A 2RONA 1IQ0A 4I1SA 5LDHA 1E2GA 1Z22A 1W2HA 3Q7PA 5AESA 5K7SA 3LUKA 4MVJH 4NY1A 3O75A 3LXMA 1CY8A 3RS4A 3K31A 2BKEA 3P2MA 4MQFA 3VBCA 5B3LA 1M1NA 1MENA 2GAAA 2QTBA 2ZJAA 2XNJA 2AE1A 3G2NA 3KU1A 5K4AA 5EJ4A 3AUTA 3QSYA 1BW9B 3G79A 1XQ9A 4PONA 4QBFA 3CSSA 1GOTA 3UA4A 1CE8B 3HB5X 4HUQB 2IUTA 1D4FA 2TMYA 4JLUA 2EQAA 1UEJA 5ICSA 4B7CA 1WXQA 5JS2A 3OE4A 3PIRA 1BGXT 3L8YA 3KTOA 3UF0A 2Q1SA 4MWGA 5IAKA 3VC7A 1CK4A 1PW5A 3K5IA 4RJKA 3FCUB 5IHPA 4LJ8A 3UBTA 3I2GA 3DZGA 1C7QA 4L0QA 3QUCA 1HLGA 3TQTA 1PKXA 4GR5A 2IHJA 1M2FA 2IS2A 3M9WA 4B09A 1VI6A 5IXYA 4GX1A 4TL7A 2HA6A 1T8SA 2I4RA 3GLSA 4H7KA 2R2AA 3SIPA 4U7HA 4JLWA 1F06A 2VDRB 3UPTA 2PYIA 4D1YA 4F3NA 3WRYC 2CNBA 3CLUC 3WG9A 5DTIA 1ECJA 1Y8QA 4E88A 2LTAA 2JBHA 3ADBA 1YFJA 3CURA 2RARA 1RWBA 1TM3E 4UTNA 4F8YA 1MA0A 4ESOA 1SUEA 4M60A 4FFBB 4Q00A 2IBMA 3K0HA 2ZM5A 1TVCA 3EH2A 3RWMB 2QRQA 3CY6A 3KYCB 2QMHA 4Z53A 4K28A 1EFTA 3L7MA 4MQUA 4Y7CA 4B80A 4I8IA 1BDMA 2QVGA 1UMCB 3KFLA 5KDDA 5MN6A 4ARIA 3PRYA 4XJXA 3NWEA 2AJTA 5AW8A 4Z99A 2EEPA 2PH7A 3E5MA 3WWCA 1FTNA 3ZZ1A 1LNSA 2X9GA 3DZ8A 1KZ4A 1BGVA 3CEJA 4K6CA 2CVFA 3T5PA 1G8PA 3W79A 4YV7A 3WO1A 4PX2A 2AXNA 2MOKA 2V74B 5E7JA 4MEBA 1V8ZA 1TMKA 1IYZA 1AUOA 3LX4A 4RYDA 2OCLA 2WILA 3R40A 4U7FA 2XMGA 1AKTA 2ZAMA 3K6KA 1KOGA 1OLSB 3MAAC 5INTA 1N0VC 3NCHA 3PRJA 4V02A 3QQ5A 5KYGA 1K6XA 1EQAA 3IP3A 2KM1A 4UEOA 3RSFA 1E3QA 2VNSA 2GPAA 1B74A 3NDRA 1TOAA 4OXNA 5ENDA 3UGTA 1E9AA 2FRVA 1D6NA 1ZN9A 3E5HA 1E6LA 1IY8A 1V8DA 1G9TA 3H2YA 3UOWA 1LBSA 2FZCA 3ISJA 2OLJA 3DQZA 1TB4A 1RZUA 2EYUA 1JFLA 3TTSA 3VDXA 1T0IA 4QUHA 1D8TA 5FNVA 1B42A 1HUQA 1EWQA 4RHTA 5I6DA 3CU5A 1TTPB 1C9DB 1NMQA 3MSCA 4AT1A 1AMUA 2C92A 4F6RA 4BYMA 4HPJB 3VNQA 4XX1A 1Z8NA 1WNFA 3NRCA 1ADYA 3WXMA 4C1BA 2VYQA 2FG6C 1E0SA 1W29A 2Y93A 2AX4A 3I30X 3R6TA 4OBBA 3KJHA 3I83A 4OPMA 1O5TA 1PT6A 4D3FA 1EK5A 5F2NA 1VHTA 1FNBA 2XH8A 4Q4LA 1SC3A 4C20A 3AP2A 3GT3A 1WNTA 5EMNA 4E5MA 4P7BA 4OI4A 1K89A 3CX6A 3D6JA 6PFKA 3FVQA 3UGJA 5AQEA 1TUEA 1VXOA 5H3HA 1JLLA 2GN0A 4IRMA 1GWNA 3MMZA 1NXVA 3ER9A 1XF9A 4KQHA 4A0SA 3QOYA 3H5AA 4Z86A 5E8JA 4NCKA 3UIEA 1HEIA 4Y6OA 1BHQ1 1EGMB 1M3SA 3QU4A 3SX2A 4DSNA 1GDHA 3CVYA 2FP4A 4BAUA 1TZJA 3GEGA 4PU0A 4R1QA 1NNSA 2BEJA 4CR7A 4HV4A 4PO1A 4NXNB 4MRMB 5KYYB 4RK1A 4MITA 4W5JA 5CGQB 3KLBA 5C5DA 1KKMA 1YR9A 1S7GA 1HZZC 2IGBA 1G8JA 4K87A 2CYCA 1NJ1A 4PZUA 5A06A 2K87A 2MMCA 1HE4A 1I4EB 1ULHA 3L6UA 1EHCA 4G8DA 4ZAXA 5FR1A 5GWXA 1U94A 3F73A 4UTPA 2VDPB 3RK4A 2PD6A 1HNNA 2GZ3A 2X0NA 5IVPA 4CQNA 3GJZA 1QKIA 2PV7A 1JEYB 2L17A 1U9CA 2JKYA 3IQXA 4NYIR 4D0SA 3BL5A 4XFKA 3TUIC 1Z37A 2NU8B 4YCJA 4MHSA 2CNDA 3ROMA 2BBOA 3DZIA 2C5HA 4XSVA 2IH4A 2NM0A 2QJWA 4HWGA 1KJNA 2HKIA 3KZCA 4BUZA 5I9NA 2NW6A 4WXYB 4BE9A 1A04A 1UDXA 4QJ4A 4NPHA 5FUYA 2DKFA 4G9BA 4JUIA 4BFWA 1UXGA 3I76A 4CTNA 2IW3A 5IUKC 5BNZA 2GM4A 2YVUA 4ZU1X 1Q0RA 4D4IA 4AXXA 2D59A 1NQUA 2G25A 2LV8A 1V35A 2EVWX 2VJCA 4LZAA 4KSBA 4Q21A 1MFPA 5T3UA 3SU8A 3DBVO 2CMHA 2A58A 1TE2A 3JAWA 4ZCQA 3HJGA 5J4HA 4DIMA 2AZ4A 5F1PA 2G6TA 3NHZA 1XEWY 3EQ2A 3TWOA 5D00A 4BC0A 4EEKA 1MC4A 1I6KA 1P7ZA 2COKA 2CSUA 4IGEA 1N1MA 4LUCA 1H8HD 2YNMA 4Y9RA 3U4DA 2Z6AA 2QE6A 3FWKA 4JLMA 3VZRA 3HSKA 1KIMA 1NP7A 1R3DA 2VXOA 5AK5A 4UTVA 1E1CA 3LRPA 3DOIA 3OZEA 3ZS9A 2FPMA 2I6FA 4OXQA 3JQ9C 3FB1A 3SS9X 1C9MA 4D0NA 2P3SA 3EYWA 2RCYA 5LP6B 1KS2A 4O29A 2W90A 3ZWOA 4KZKA 3AERB 1RC1A 1DCMA 2ZUWA 4E11A 2VHUA 5CLIA 3PXEA 4QBKA 1D9XA 2C00A 1AGYA 1OJ7A 3GHHA 1T91A 1M2NA 1QK3A 2J6CA 3OG9A 3O8OB 1DLIA 3WIBA 5GZ3A 5EOVA 2ZANA 3DJYA 5ALFA 4ACAA 4C7OB 1UK6A 4OB8A 1OV6A 3GJQA 3RS3A 1KBOA 3DL7A 4IYJA 4JI2B 4PHFA 2HBYA 4FWBA 3TIVA 5KPJA 4PRYA 1KYIA 2IXBA 4LOLA 4RFLA 3S1SA 3H65A 4B6QA 1OY1A 4XIJA 5TMPA 5HP4A 3A1EA 3OLQA 4P0TA 1G66A 4IWYA 4F4DA 3ZXXA 3ABSB 1OFTA 1ZI6A 2JHFA 5C3MA 2BSQA 1REQA 5ESXA 3C1UA 2RAFA 1VKRA 1DAOA 1NQTA 1ORHA 2HUNA 2V7VA 2WD9A 3E53A 4KXMA 4LMAA 2X0EA 2JAUA 3RHFA 1F14A 5I7RA 2R1TA 1ZXLA 1EVKA 2QW0X 3JAKB 3R9XB 4YA6A 4ETMA 1Y1LA 3AFIA 1YZ3A 1YS1X 2PMBA 3G49A 1A76A 3PUZA 3CVWA 3USCS 3LA6A 3NNNA 1T2AA 3OEEA 1RQNA 3P19A 4OVKA 1CQJA 5IVIA 1C1DB 1U2GA 3W2HA 1UDAA 3I53A 4ARUA 4J1SA 1V5EA 3NB0A 2BMEA 2WMOB 1GGEA 1HXHA 2FQ1A 1JUDA 2GWHA 4L4ZA 4Z1OA 3P4XA 2Z2KA 5ALNA 1UEXC 5AVTA 3LTNC 4NJOA 1E77A 4L51A 5FPQA 3K1AB 4HFMA 3ZLTA 4CIWA 3NXKA 1JG2A 4OA5A 5KSZA 2VDWA 2RHOA 3C3KA 4YECA 1YK0A 1XZEA 3TSYA 4Z3DA 1C1XA 2VZLA 1T0BA 4N54A 4WKPA 3GFPA 5DBOA 3W9YA 4LCJA 4TUYF 5CJ2A 4F45A 5KWIA 4CMCA 2ZQ5A 3IBSA 4ICIA 3BK2A 4UEQA 4TL8A 4EAQA 1VJRA 2DE0X 1PL6A 3ZIAA 5ALPA 3JQDA 5C8YB 2E2WA 1T1GA 1R4MA 1VIDA 2AXQA 3TQSA 1X77A 3D0QA 1K08A 3ZHSA 2JJ1D 5C5CA 2XHZA 1V3VA 1BE0A 3KEFA 2FPLA 1AE1A 3GRRA 2Z9BA 5DP1A 1FTYA 1SG9A 1UXOA 2X5JO 4NU8X 4P33A 5DBFA 4MR9B 4H3VA 5ALIA 5FUBA 1OXTA 1Z4KA 3HRIA 3KEOA 4BNDB 4CI9A 1UKEA 4P22A 2OKCA 5C81A 4ACBA 1P4HA 2WM2A 4IIDA 4ZOQI 2OP1A 2BLLA 7REQA 2HMVA 2PRSA 3BE5A 4CT4B 4NOKA 3SM3A 3LQYA 4JIMA 3D64A 2H3EA 1YL7A 4TVBA 4R9NA 2VNHA 3REOA 5C8ZA 1JTVA 3WYBA 2BEKA 3SVTA 2BYTA 3D2CA 4JC5A 2ISSD 3H9QA 3VZDA 3DF9A 4MAFA 4AJKA 3EUAA 3BMNA 1XNQB 1TI7A 2I1VB 3GMSA 2VSXA 2FN8A 3KHKA 4G63A 2Y0DA 2JD0A 3TO5A 3F8TA 4WK2B 3ND9A 4H16A 2ZXUA 4N76A 5K4GA 2C5AA 1PQYA 1QLHA 3CZRA 1A7UA 5HJ2A 2XOXA 3QLVA 3JWIA 5M2QA 4MB2A 3EPKA 1O9GA 1X7ZA 1EDOA 1TKBA 4JN6B 3TDNA 2HNKA 5EG5A 5K03A 3SZGA 3H83A 3W8DA 1SZCA 4MVJI 2G4CA 4EK9A 1BCSA 1IN7A 4XVHA 5EZ5A 3RLIA 4QAQA 3EOZA 3SNKA 3WIOA 4Y0AA 2PLNA 5B1SA 1LK7A 1XTTA 3PNLA 4DA0A 1L4LA 3NPMA 3OIVA 1I7LA 3R77A 2DR2A 3IBCA 3KKPA 4ZVTA 4BMNA 1OC2A 4EG0A 1DXQA 3P8ZA 2WOJA 2Z43A 1Y3CE 2M9MA 2H4YA 3RDPA 3DEZA 3HM2A 3SE7A 3R4CA 1J5XA 3KR0A 4DC9A 2YXBA 1A8SA 1NQ5A 4PG6A 4V0MA 4H7DA 5JANA 4TTTS 4GVLA 4C3ZA 3KVYA 1JQEA 4KGVA 4YVFA 4LF6B 2XZLA 1V45E 2OZPA 4D45A 3UMBA 1WEHA 2PGOA 1E64A 2B0JA 1F4PA 2BFPA 3GYBA 4TWZA 3K9CA 2A5LA 1KTIA 4YLEA 4YJ2F 2H17A 4PGGA 3VR2A 1L5FA 1NFFA 2O50A 2XGGA 3C1TA 4WKBA 2BSXA 2LW7A 3OTHA 4C03A 4I1PA 1JIXA 4HFNA 1AS3A 2ACKA 3HR4A 4NPCA 4R31A 2N46A 2XUAA 4C7KA 5CW2A 1UMBB 2VRCA 1QIIA 5IZCC 1PEDA 1YFLA 5FL7A 1S2DA 4XUCA 1LTQA 3L7JA 6AT1A 4V0QA 3REFA 2WD7A 5JISA 4KO2S 1VIAA 3DHEA 5B7QA 2IZ0A 1N5LA 1GRRA 5BURA 3QUQA 4XOUA 1IEWA 3KYDA 1JTFA 5J59A 4BLPA 2ZI6A 3VVBA 4N7MA 3ZHZA 3FCOA 4HCJA 3F5FA 4PYNA 2G6BA 3VX3A 2HM7A 2VK8A 3VR4H 1EGHA 3C5CA 5BOSA 2IH2A 1YWGO 1RNLA 1TUIA 5E4FA 4GLOA 4Q37A 5LJLA 2AJDA 3RC2A 3AXTA 1PEAA 2AWNA 2FUG6 3VPCA 3ZHVA 3IEVA 2XCTB 3C5EA 2GK7A 3KD3A 1YA8A 2XMQA 3GV0A 1YMQA 2OO5A 1SM4A 1X14A 3HADA 4GMHA 3GJ3A 2NZ2A 3R3YA 3UAWA 1JQDA 3VSBA 4X1YA 4OUDB 3VTKA 1V4BA 1VFNA 3KJNA 2YY7A 4X71A 2CSXA 2QRVA 5FX2A 1OZAA 1K97A 1U0EA 3M6LA 1XQ6A 5EE1A 4H1VA 3EC7A 1WXXA 4JGGA 3WGGA 2BMJA 5KNBD 2OHFA 2YXNA 2O3QA 3LIIA 4IMJB 4YREA 5CFOA 5G3YA 1D3AA 5SY6A 1E1QA 5IT4A 1RAIA 3M5CA 2O4CA 3AY7A 1V1MB 1F5NA 3B9RA 4P54A 1BX1A 2XOKD 3MJSA 1GNTA 3D4NA 2B69A 4RDIA 3DV0A 1UBLS 3GJ5A 4J2HA 2WV7A 4R9SA 1LVHA 1G3UA 3HUTA 2OD2A 2B5WA 1J2YA 1MNAA 1V43A 3BMCB 4CG1A 3GLFE 2CNOA 4BVKA 9GPBA 2VDQB 2JLYA 4WSOA 2Z3ZA 2ZRKA 4UM8B 1SKBA 4ZOAA 1HWYA 3CKMA 1K4MA 2OHHA 1BXKA 3SDBA 1MABB 3FJOA 2RCNA 3I9FA 2GX6A 4HQNA 5IKPA 5I7VA 2HDOA 3PGXA 4OP1A 2VWPA 4IOJA 3M1AA 3L06A 1Q3HA 5SZJA 1IIRA 1C4WA 1PHRA 1Y37A 5HGJA 1O96B 5CA0B 5ITVA 4C0BA 4ZGWA 1Y1RA 1LPBB 5E3JA 2J9ZB 3WSWA 5CB4A 5HPYB 1H3EA 3OZAA 4WK4B 3K32A 2HLDA 3VKGA 5BUQA 1XKQA 5AR1A 1Z47A 2I3BA 2Y1XA 1QQ5A 1UPUA 3VVLA 5F1KA 3HJRA 3M34A 1T5IA 1ZH8A 2G40A 3OX4A 2WJ6A 4FEAA 5ITWA 4UOEA 2AFIA 5ALGA 3GDHA 1RZVA 3N70A 1ATIA 1QGUA 3PBKA 3K9BA 2W6MA 1ZI8A 5AKJA 5KWEA 4EYSA 1UWCA 2IYEA 2Z6UA 4JXXA 1BWPA 1FNMA 3KSUA 3AO0B 1D7AA 4R98A 3K9NA 4M8KA 3OE1A 3BWEA 5EKDA 3UAXA 4KR6A 5GJWC 5EHZA 3NGMA 3RIHA 5EKTA 4DMGA 3GBPA 4KBGA 5DGXA 2JB9A 2R8PA 3I9OA 5IT9A 2N1MA 1NVGA 2ZJZA 3SQOA 1ZMRA 3KYJB 1LB1B 3L0CA 3G59A 4QLAA 1W52X 2QG6A 3TCNA 4QG3A 1L7NA 3K9QO 1QQ7A 3KLMX 3SEZA 4RIEA 5AI0A 1IMJA 1SXIA 3VNAA 5LL6P 2ZT7A 1XYGA 3LF2A 3B70A 3BZBA 2PTHA 1FFXA 2IYQA 1A8PA 2AOTB 2XCUA 3LFTA 4JLSA 1I1OA 2JAQA 4N12A 4RK5A 1KMHA 3RTDA 4DBLC 3ORSA 4NAHA 5KVVA 2P69A 5A4KA 1QBKC 1R12A 3ORHA 3EVBA 2HJSA 2GZ1A 3CLRC 4RDXA 1NUTA 3ZR4B 2Y27A 1Z5OA 5FBVB 4JV5B 2BF4A 1ZH0A 3NBYC 4ZVVA 4RVDA 1S2IA 1M2KA 4CMKA 3ES9A 3F7OA 2I33A 1XZBA 3MF4A 3JYPA 3RO7A 1OH8A 2JATA 4FK8A 2FX5A 1C7RA 3LK7A 4IDOA 4FIDA 5E2AA 5TEVA 4AWBA 1JDBB 1UEIA 1UP4A 1FLDA 1OIVA 2QQ0A 2X13A 4R2LA 3VR5H 1D07A 4YS6A 3T9FA 2AR7A 2HT1A 1UZAA 3VNSA 4RTLA 4P3KA 3BX1A 1W8IA 3ILSA 4FE3A 1G8HA 3UGQA 5A2GA 4RTRA 1GTMA 3BXOA 1YR7A 2JFFA 4F7DA 5JBNA 3A58B 2G1AA 2HJ9A 4XWWA 2W98A 3HDJA 2PY6A 1QCCA 1WO8A 3PCRB 5TARA 3OHPA 3RC9A 3P9YA 4DSTA 1J2TA 1XXLA 2PX8A 1YF3A 4G0PA 3F6RA 2C9DA 2A0KA 3TNDA 3JWGA 1Z6TA 2VPTA 3COZA 3EXG1 2RDMA 3K73O 3Q9NA 3H84A 4KZPA 5DWQA 3T12A 4NU5A 4TLLB 1YB6A 4DLZA 5KJ1A 2QAGB 2XA1A 1IY2A 5AH0A 2DQYA 1DT3A 4PAOA 1RWQA 4GL2A 2R4UA 1SVWA 4RPJA 5JMTA 1VZ2A 2R6GA 4EYQA 5LIPA 1AUXA 3CEPB 5COBA 2PRYA 2DJIA 1ZN7A 2JANA 5CFRA 2FR8A 2R7NA 4PO9A 1ZA1A 5L7YA 2FAXA 5KOJB 1WBBA 3TLEA 1JH8A 4UKDA 3QVXA 2QVBA 4DMHA 4L02A 1N6PA 4P93A 4RPHA 1MQAA 1QFMA 4ZI7F 3PGA1 1MX9A 2OO7A 3GVCA 4OGKA 2Q6LA 2O3SA 1FUIA 4KOAA 1H9AA 1W5BA 2ZKIA 1YKFA 4XWGA 5DBEX 5T4HA 5JH7F 4FWTA 3THWA 2NMVA 3F4LA 1J7KA 1N9KA 3F1LA 3WLQA 5BY2A 4HLUA 2QTTA 3WKEA 1R7RA 4B3DA 4ZK2A 5AD1A 2GJ9A 2J30A 1S4QA 3B7GA 4BFSA 1XXHE 4QODA 4BEBA 5EIWA 1L7RA 5U4QA 2GJ4A 2V6BA 2J9YB 2GESA 1GGKA 1RAAA 2BZSA 3VKFA 3LFUA 4NAUA 1G7SA 4JQYA 4IHJA 1GTVA 1FYDA 1I4WA 2YFKA 3OZCA 1QSGA 1DC6A 3IB6A 3INGA 4I9FA 2CDCA 1V5GA 4OXYA 4PFSA 4Q47A 4RC9A 4EVIA 3ERCA 4ERXA 3DMYA 3DE4X 5L6MB 3ZLBA 2YV4A 1DRUA 5D6NA 1THMA 2E6UX 2H7VA 1V7CA 4R8LA 5IG2A 1G2QA 4CV2A 2OCBA 4WCFC 4GQIA 5FV7A 4QJ3A 5I51A 5KQMA 4D9KA 5DV9A 3WLEA 1JJIA 4XZ3A 5BSUA 5K0JA 4HXGA 5C51B 4E03A 4X65B 4JVMA 3TW8A 2E0IA 2QLLA 3LGXA 3L7DA 4JELA 4CQMA 1UM9A 1BWRA 1ZLYA 2ZULA 4YAUA 3DYVA 2UXCB 1TIBA 3KQOA 3FMIA 3EY9A 4AUEA 5JCZA 4OFBA 2FEXA 1T13A 4OB7A 6ABPA 4IIXA 3SN6A 3U0BA 1K0UA 4UXIA 1TKAA 2JIBA 1E8DA 2EX0A 2P9TA 2PGJA 3NEPX 4WLNA 3A9TA 4PG5A 5KJFA 2XX3A 4NENA 4A6EA 4Z0TA 2EFHB 3D3EA 4X1KB 4OAPA 4HKTA 1R00A 2B1GA 2VK4A 2PVCA 3Q40A 1T1JA 1Q1ZA 4RZXA 3T3HA 3IUYA 1AD2A 3TZ6A 3V8RA 5BN3A 3IURA 4RTQA 6LDHA 3HY3A 4DQ0A 5H0IA 2QAGC 5D85A 1Z2AA 2HTEA 3IDZA 3OFKA 2ZUVA 5DM2A 1KMNA 1LKZA 1NV8A 1JHPA 2H1HA 4MWBA 3IEUA 1OIWA 2ATCA 4Q9IA 1N8TA 4ZCMA 2MR5A 3D6TB 4JGBA 2NNWB 3W6PA 1YFZA 1PG5A 1MKYA 4CM4B 1WF6A 3RASA 5BMOA 3AIIA 1BSVA 2ODQA 1OFUA 1NVKA 4QWMA 2C3UA 2PX6A 4Q01A 2AYYA 1XHFA 5DT9A 3T0GA 2XQKA 3QHPA 1G6OA 4G1UC 1Y9JA 1XAHA 1QZTA 1SXJA 1AZSC 3S1AB 4RVCA 1D4AA 3IPLA 5H81A 1V8PA 3IQEA 3WGYA 2X7XA 3EZGA 1QVAA 1F4VA 2GPYA 1IAQA 2HMSA 3JYLA 3PFIA 1BA2A 2VXBA 5I4KA 1MD9A 5C52B 3WJAA 1ZHOA 3LDHA 1W4CA 3JASA 4QSMA 3TZKA 3L6DA 1LV8A 4EEZA 1W1UA 1ZIPA 3RFCA 3BD8A 4YMUA 1USIA 1NQXA 1RADA 3Q6MA 1P2SA 2IHKA 1Y8ZA 5T4BA 1UKVY 2AKYA 4IQFA 4H3SA 3KNZA 2NQ8A 4EDHA 4Z0HO 1DQRA 1FTWA 4ZEXA 3I8OA 3QU9A 4GSKA 1JHVA 2C2HA 2QN9A 1YC2A 3EPPA 2X1VA 3PHBE 3ZDRA 4BJ3A 3SHQA 3TVDA 4NYMR 1PT7A 1A96A 1MG0A 1ZAKA 1OKKD 2CDAA 3QYJA 1BX0A 4FSHA 4EFLA 2EZ4A 5FEUA 3L4KA 5LZ5A 3U1VA 4B6SA 4MULA 3BDIA 3IEXA 2GTHA 2YMPA 4Q16A 4B17A 3JW8A 2Y6VA 1YKSA 4NCNA 2QRUA 1EVLA 4YACA 1RQPA 2WK1A 5GV8A 4DR4B 2WU4A 2BEUA 2DPGA 2IPXA 3MCTA 3W5CA 1JRLA 1DZIA 1EWVA 4JYBA 2HMYB 3LBFA 5FBQB 3P9XA 1OT3A 4WADA 3M5DA 2BFEA 5F52A 1ZGHA 4HDMB 5B30A 3X2FA 2X86A 2JLUA 2ZRHA 3D9QX 3RU7A 5BMVF 2F4VB 3ZE9A 2QN1A 4PQEA 3NBAA 3NW9A 1K06A 1XK7A 1SHKA 3HDYA 3IVGA 1CZLA 3HCAA 4GE3A 4MZDA 2WHXA 4RQTA 3B60A 3W9UA 3WSTA 1L8LA 4CV1A 1GUFA 4LY9A 1FX0B 1RIIA 4ZZIA 1J5PA 3TTUA 3G5TA 3I9V1 3NEYA 4GD3Q 1CUBA 2OFWA 2JFOA 2Y1EA 4LE1A 1UT5A 4BKRA 4ETWA 1NM5C 3ZI0A 1BA3A 4M0UA 3ZLUA 2A8YA 2J41A 4NATA 1PZEA 3R41A 5EQDA 4K03A 4MP6A 5REQA 5A0FA 2E4YA 3EDRA 1M6YA 1SUCA 1PJSA 1VMEA 1PL7A 2AI2A 2OMKA 3MBIA 4JUAA 3VR1A 3RU2A 8AT1A 2Z2XA 1VHQA 1VE6A 4HB2A 4I5FA 2OFFA 1E98A 2ZU6A 4KODA 4MUXA 2WPDD 2J3IA 3BB4A 3BTSA 4QPCA 3ZKWB 1L8OA 4E22A 4LFCB 1AUPA 4MJ3A 3EPLA 2XCQA 4WY8A 3E22A 4YCAA 1S4MA 1EVEA 5AK3A 1RJEA 2IYLD 5KOHA 2PG3A 2YS7A 1POWA 3PR2B 4FFPA 3FMFA 3T5GA 1RXIA 4X64B 3OZ7A 3JYOA 4MLDA 2PMEA 1YRHA 2H1VA 3U9LA 2G9NA 3INNA 3F2VA 3PE6A 3L6EA 2A9PA 5AVQA 5ILOA 4ITRC 1G7CA 4QUGA 2IV3A 1VRVA 2W0MA 1JL3A 1LDEA 2L82A 3JVEA 2FWJA 1L5HB 3R0QA 1YRYE 4D7AA 2CXSA 1XZDA 4TVOA 3ZVNA 1A9XA 5L95A 1A9OA 2I5PO 2JFQA 3KFXA 1U3FA 1HQKA 4X85A 3MJFA 5A04A 1F60A 2VYVD 3DTVB 4N01A 1BS9A 4CKCA 4F9FA 1OH5A 3MCWA 3OBBA 5L4LA 3UH1A 3OD1A 4Y2RA 3EFBA 4KV9A 1D1TA 2C2BA 2D8AA 3OCVA 4H08A 5EQTA 3N0RA 1DAIA 2ENWA 1IZ7A 3MPUA 3EZYA 3MUFA 1XP8A 4XASA 3W2TA 1FMLA 1FX1A 2ZTUA 4M22A 3RYCB 2AJLI 2BELA 3DXZA 3HKDB 4R9RA 4CHTA 4TYQA 3Q8LA 1XCOA 3QIVA 5HQ3A 3DKPA 3SF8B 3AV0B 1OT5A 2XRYA 2G0TA 4MGIR 2H16A 4HDNA 5CYFA 4ESVA 3V8VA 4JBHA 2QT9A 1T3ZA 1R16A 3RKSA 5MN5A 4KAAA 3AUKA 3OOYA 3GUVA 4FW8A 4QEZA 3UJ6A 2AOWA 4S1OA 3C98A 3PDCA 3FNRA 3IEPA 4UFNA 3TDMA 4CKZA 2Z04A 3H9UA 2D1FA 4AECA 1PSZA 5KC9A 3DQQA 3KXKA 3QI2A 1TF5A 3JAMA 3A4LA 4G24A 5DHPA 4ZARA 1TYEB 1LX7A 4IUBS 4M9XA 1ZGBA 5DCUA 3BWBA 2D8MA 3PJRA 4C0JA 4BTEA 5A3JA 1WDMA 2Y9PB 1NF3A 4LXTA 1XQWA 2PGDA 1TYBE 4BNZA 2IRWA 5KZMB 3TXAA 2IIBA 3GGDA 5IAGA 4ECEA 2RMKA 2X3YA 3OZGA 4JU9A 5A4AA 4J0KA 1XUOA 5IPFA 4ZTUB 1L5NA 3SVZA 5ELMA 3IIMA 1GZ7A 1UPFA 3TGPA 2BKAA 3MWLA 5GQSA 5JTTA 4Z9FA 1G5TA 3JVIA 2HCTA 4LHXA 2ZBVA 3MJTA 1T2FA 3MW8A 3TTXA 1JBQA 4WZAB 2CE7A 2ZIXB 1BVHA 3UK6A 4EO7A 4ZVNA 4KWIA 1V3TA 2EWVA 2Q0QA 2V55B 1H5NA 2NXCA 1VKNA 4H59A 5IM5A 2Q7DA 3D4LA 3GAAA 4MI1A 4MRNA 5K2OA 1FDSA 1QHHA 4DTIA 4E7OA 1ZJ4A 5D2CA 3DL0A 3FWPA 1O7JA 3ZHTA 1ECLA 4Z7JA 3SLKA 4X6UA 3IULA 1QB8A 1QDUA 1VSBA 2WJ3A 3TUZC 1Z68A 3EXIB 1EFHA 4XIIA 1DUVG 3IE1A 4BQOA 5J4YA 1Z8DA 5H80A 2IPMA 1ZNWA 1J7JA 1OHHA 2ZDGA 4AW9A 3I2JA 1KDPA 2VG8A 1OAAA 3AKCA 3PPYA 5COQA 5EWJB 4J0HA 1P0IA 3QJYA 1U0SY 2Z57A 4J4TA 5EUMA 2HIAA 1FF9A 5FBHA 3B6MA 3T1VA 3WA6A 4O2AF 4LF8B 2GCPA 2I71A 3CLSD 3DE5X 1U1FA 4UATA 5B7NA 4BVBA 1Z4QA 1HV8A 4JVNA 1J8VA 3DF7A 2I4TA 2H85A 2PO7A 4YJGB 4AAYA 3K4PA 1C81A 3SLGA 2R7LA 1M2JA 1EPUA 5FT9A 4D3DA 1ID8A 4HWOA 2QYOA 4D99A 1GGVA 1YCGA 4GNRA 3REQA 3PKZA 3DFKA 5A5FA 1XYVA 4AJOA 4DA9A 2JFZA 2I6GA 3AI1A 5TQJA 3T8YA 4YH1A 2VQDA 1YR1A 5EGSA 1UF9A 2Q1UA 2W11A 1WMDA 2X2FA 4Y9SA 4KBYA 4AYXA 3M3PA 1CUIA 4NDZA 3S28A 2NVOA 4MJXA 1PR1A 3CT4A 1E2LA 4MW7A 4YRAA 1GA4A 4M21A 2P0YA 3CNLA 4AMZA 4KQ6A 5FTJA 2UYQA 2EU8A 1VCOA 3MGCA 3RCBA 1E1YA 2V7TA 4MUFA 4X93A 3II6X 4BIIA 2Q1TA 1NLYA 3DNMA 1KQNA 1GEEA 2NO5A 2AOUA 4D8WA 1PYOA 2CFSA 3O0DA 2REXB 4BWFB 2JLQA 5FPHA 5C37A 3PU6A 1ZM2A 1VPWA 2O8DB 1KI9A 4HVAA 2IOHA 3B20A 2A4MA 3I39X 3SKXA 3MXOA 2GAJA 1YONA 1L8QA 4QO7A 5CDTA 1MPXA 4HF7A 2QAJA 1UDBA 2P6UA 3A2LA 1RE0A 1PFWA 1HDOA 4O33A 3JYQA 4B73A 1MQ8B 1SXJD 4IKOA 2QM0A 1IVNA 1UMDA 1UCFA 1BWSA 2I6SA 4JBGA 2BCGY 1DCFA 4O4JB 4KYUA 3W1WA 2B78A 1EP9A 2FRDC 3CW8X 3HSYA 4KE9A 3R7WB 3RT9A 3UFXB 4BXOA 4KGDA 2AQ8A 2GRAA 2KHZA 3AVPA 4GXTA 4PWYA 5DLDA 4HQLA 2GAIA 5J5CA 1HH4A 2ZTMA 1GPYA 2F17A 2EFDB 2CVHA 2YJ6A 3W34A 1DKLA 4GC5A 1H9CA 2WJHA 3OQVA 4MWOA 1XZMA 1KOFA 3IP9A 3IE0A 2FETA 3TLZA 5AHOA 1EFPB 1FE8A 4R40A 2ZT8A 3N59A 4V0NA 3T4XA 2I67A 5CXUA 5GTDA 4P4TA 5DHQA 5TEWA 2GPWA 3KUCA 2WUEA 2AI3A 3C3YA 2Q3CA 2CFCA 2R00A 3BXGA 3C14C 4UNNA 4ZODA 4CIBA 3AF6A 4A8PA 4MR7B 1JJ7A 4OQQA 4QTTB 4XM0A 3UOAB 5JD6A 3ZQJA 1GQSA 1XF1A 3OPYB 1P74A 1Q11A 4KAFA 3H86A 2HMAA 3ELBA 2QDXA 3TR5A 4UHBA 4PLPA 3L0IB 4GM4A 4S1VA 3KS9A 5TJ9A 4E4TA 2FG5A 4PTYA 1FFGA 1L4KA 3KKNA 2NSJA 4XIFA 4KMOA 1Y5NA 3A6DA 3ZVMA 2IQ5A 4ZQCB 3UMMA 1XMQB 1M1ZA 1XJ0A 4FLFA 4UCQA 3MAGA 2GA8A 1PJAA 4QOJA 4TTJA 1Z0SA 4R1UA 3EDOA 4WGGA 1PJTA 3KZMA 3URMA 1GUBA 3DLIA 5HOQA 4KX3A 4YJHB 4M1KA 1RABA 4EG1A 5CA0F 3EZFA 3EIEA 2A0YA 5CTAA 1CP2A 4G07A 3QBTA 3FUUA 4P6VF 3FNFA 1ZFNA 2ZRQA 2ZTSA 5LSAA 3WGQA 2GN2A 2O06A 2HWUA 4YMTA 2ZBQA 2WHEA 1A9SA 1PJQA 2XSZD 3AEXA 2MINB 3DMPA 3S3TA 2BGNA 1OWPA 3OESA 5ULLA 2WFLA 2Q4EA 3T7EA 4A7PA 1FQOA 5JIBA 3ZCQA 2VP5A 1O6BA 5DSXA 5JFGA 1QZUA 2OOKA 3U19A 1VKZA 4BB0A 2Z6QA 1COZA 2H51A 2VHJA 4YYEA 1J25A 4E32A 4BQQA 2ATXA 5CTJA 4EUNA 4X6LA 3T4PA 1ANKA 4Q7QA 2O2CA 1QFXA 3RNLA 1RKBA 2I8CA 3RYHB 4IIJF 1K4KA 4KRYA 5J9FA 1A5ZA 4XPZA 4UTRA 2B9EA 2H5LA 4FD3A 1NN0A 5A4IS 1E9CA 1E0KA 1TADA 3DS8A 3IVRA 2V0CA 1Q15A 4Q05A 4XX0B 2JI9A 3W5JA 2OM2A 4PN3A 5HJ5A 2PUEA 4KPYA 1TW3A 4Y1FA 5LZ8A 3IJ5A 2O20A 3JZIA 3KKZA 4EKDA 4BTVA 3FPLA 3BFVA 4GUAA 3I04M 2QLNA 3L93A 3QE0A 4ZT4A 3U49A 3R9WA 4AJNA 3KOWA 2VYVA 1LSOA 1A5BB 2LIVA 1NONA 3RAFC 5JXGA 1SKMA 4ROTA 2B4AA 2OC9A 3IMGA 3JQGB 3MVEA 4K9DA 4EOGA 1RJ9A 1D7OA 5DN6D 4TXJA 2HYDA 1F2UA 2OXRA 3GFOA 3DBHA 3OZUA 3LPAA 4TYMA 1JIKA 2GZ2A 1FUYB 4QEDA 4R0NA 3SHVA 1BRMA 5KOIA 1FK8A 3LBYA 1DRKA 5MF6A 3F5SA 4LOIA 3TMKA 1TCAA 1IY9A 3A9UA 1NXPA 1TT7A 3F0TA 4GP6A 4HQRA 4KJZA 4WPGA 3U3DA 4EI9A 3R3XA 3ZDEA 2K7ZA 3CG4A 5EYPA 4A03A 2HYIC 3ZY3A 4PGAA 3TL2A 4HGRA 1JVNA 5I8PA 4BB5A 3G2LA 3I09A 1ISPA 3AUXA 1XDSA 1ENPA 4DQKA 2H00A 1RRVA 3ESBA 5JV5A 4O4LF 3I2IA 4KWEA 4MVXA 4P81A 1ZUIA 3L1VA 1A8IA 1ZNQO 3G2JA 1YE8A 4NH4A 3WIEA 1ZD1A 5FEMA 1DAGA 1M72A 4JBXA 1RYBA 2ODNA 1GRCA 3JPWA 3PC8C 4I08A 3HKBA 3RODA 4MS1A 4O2AB 2QL6A 1TQ6A 1NW5A 4UM9D 5KQPA 3ZJTA 1WKVA 3NHMA 1KZ1A 3FCEA 1AKQA 1ZWLA 4KOEC 4ARVA 3X1JA 4GZLA 3A8TA 1CY1A 3FUCA 3AZQA 3GUCA 5J2UB 3VDQA 3ND6A 1C3OA 1B23P 1H8EA 1UBOS 3RVBA 4RPKA 5ELXA 5CITA 1MOPA 1WJGA 2I8LA 2RKOA 3IBGA 2X9NA 1E8NA 2FX2A 2MYUA 2CD7A 3SYLA 3I5YA 3HL0A 1PWYE 3V5NA 3NHSA 1EQUA 4TKLA 4D02A 2WQ7A 1UPXA 4JJAA 3L0BA 1VE7A 2MTBA 1RBQA 2ZW9A 3H5WA 1KI6A 3OX3A 5FO0A 2V7XA 5BT9A 4B2PA 3GMIA 4C6RA 4OLBA 4JU8A 4LZOA 4BNYA 4MUHA 2GHIA 5TPWA 5FUMA 3UW3A 4BMYA 3CYFA 2MDTA 3NBQA 5KKAA 3B8EA 2QL9A 4C4TA 4EX6A 1HFJA 2YVQA 4TT3D 1TJ4A 2GD2A 3LUPA 1K9VF 1F12A 2OMEA 1GITA 2OHIA 2YWHA 3NAGA 4CNQA 4EEXA 3CEAA 2VAXA 4L76A 4CMIB 2HN9A 4DM3A 2O3UA 3PUKA 1JIUA 1G0OA 1P4JA 1SVOA 1ZUWA 4X6YA 2FV8A 5ECDA 2I6QA 3RROA 1GZ3A 2PUFA 4BP3A 3FRJA 3SDZA 1UDWA 4HNVA 1R6TA 3TVYA 4DV4B 4C6HA 1Z2CA 5CIWA 2DUUA 2OBNA 1Z15A 2VFAA 2QRGA 5KVQA 3RPEA 4GZMA 5FA6A 2R97A 5IN4A 1U9ZA 1HY3A 4EGJA 3K3PA 1WS6A 1Y6GA 1THTA 1G5PA 2E9SA 3I42A 1AXGA 2Q2VA 3BICA 4U1RA 5DO9A 1CWUA 1NXXA 3I0ZA 4GYWA 4JQCA 4Z8YA 4DFDA 4F9GA 1AQUA 2W8ZA 1E3JA 5C2JB 4EYGA 4TQAA 2C2MA 2EZTA 2YDYA 1OWNA 1U3GA 3H8VA 3OIWA 5B6PA 4GPIB 4YXWA 4LZJA 1GR0A 4XWTA 2V7BA 3GQBB 1N6RA 3SEQA 3WTCA 4CUKA 1QWSA 4MWCA 8ABPA 3TK1A 7AT1A 1SEPA 5ESDA 2QORA 1CP3A 1I2ZA 1XVUA 3K0KA 3WYEA 1GDTA 2EFJA 3EJ6A 1JE1A 5ALUA 4QIHA 4B2IA 2IFTA