1C3EA

New insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylate in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
b'MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
molecule tags Transferase
source organism Escherichia coli
publication title New insights into inhibitor design from the crystal structure and NMR studies of Escherichia coli GAR transformylase in complex with beta-GAR and 10-formyl-5,8,10-trideazafolic acid.
pubmed doi rcsb
total genus 68
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1c3eA00
1GARA 1YRWA 4ZYZA 1RBZA 1NJSA 1RBYA 4EW3A 1RC0A 4ZYTA 5CJJA 4R8VA 2GARA 4EW1A 2BLNA 3GARA 4QPCA 4QPDA 4ZZ0A 4YFVA 5J63A 3LOUA 1RC1A 2CFIA 2YWRA 3AV3A 3N0VA 3OBIA 3NRBA 4ZYXA 2BW0A 1FMTA 4Q12A 4TTSA 5J9FA 1ZLXA 4ZYVA 4ZYWA 1C2TA 1JKXA 3P9XA 4EW2A 3O1LA 1S3IA 4ZYUA 3W7BA 3DA8A 3KCQA 3Q0IA 1CDEA 4TS4A 3TQQA 4ZZ1A 3AUFA 1ZLYA 1MEOA 2FMTA 3TQRA 4S1NA 1MENA 4PZUA 1GRCA 4IQFA 4NV1A 4ZZ3A 1C3EA 3DCJA 1ZGHA 4ZYYA 1RBMA 1MEJA 1RBQA 4TT8A 4DS3A 1CDDA 4ZZ2A 3R8XA 4YFYA
chains in the Genus database with same CATH superfamily
4EKEA 3K1AB 4BQEA 4QYIB 1I4WA 3JYNA 2OORA 3DWEX 1UM9B 1US8B 3EWNA 3IVGA 2TMDA 3GO4A 4QC2A 1X7DA 1FBNA 2WWRA 4GOJA 4HN9A 2B92A 4K8OA 1QHYA 3RIXA 1U8EA 3M81A 3BRCA 4ID3A 4JA2A 4H3HB 4LJ6A 5EIBC 2Y9PB 4GU5A 5SZJA 1SB9A 4M9QA 3REQA 1IIBA 1HH4A 1ZOPA 3OAAA 3I92A 3SXPA 2CCGA 2JGIA 4NONA 1B3BA 1N6NA 1JB9A 2FUEA 1KOLA 5HKLA 1B23P 3KYDB 4P2GA 1NSYA 3GLUA 5EI5A 4A2CA 4RK0A 1M0TA 2GXUA 4BE9A 2DLDA 4HWRA 5HQJA 1KU6A 4UATA 2NAPA 1JLLB 4UULA 3R1IA 2WPNA 4ZC8A 3G5LA 1E1CA 4M6WA 1HG1A 2I03A 2W0MA 2ZVPX 1D0SA 1IN4A 3P0EA 4P4TA 3TB4A 5A03A 2WF5A 5DSTA 1GSIA 3OZTA 4GFDA 4I50B 3FNHA 5BV7A 1ZP6A 1Y4UA 4K1LA 4MUJA 2ZJ6A 5CB4B 2ZI9A 4AKSA 2TS1A 1GUAA 3WRYA 3JYOA 4OHMA 3H3FA 5A0TA 4ZEVA 2DBRA 3QLTA 4ZYVA 3GJ7A 5CW1A 3DR3A 3KJIA 4D9GA 3HVJA 4D81A 1Z2CA 1OUMA 1LRLA 3H9UA 2LUOA 3IIEA 4K6HA 2UZ4A 3W1VA 3GBVA 4CCYB 1QIIA 1P9NA 1ZJ6A 3LQRA 1Q16A 3UH0A 4A8HA 1EXVA 2P2CA 1OGJA 4KQHA 3UMCA 2F90A 1Q2UA 4FILA 3P2OA 3F6BX 3D3QA 5IFLA 1YOBA 3AGPA 4JX9A 3ANMA 2H85A 1T1JA 2HAEA 4HRAA 5AKHA 4AG3A 5KB3A 5G3ZA 5FLYA 5SZKB 2J3KA 2HLNA 1DTEA 1VBKA 3J81k 1IWOA 2YW2A 3R6GA 1XZCA 5I5EA 3PWSA 2ZUEA 3C3WA 2IYXA 2LBPA 3KPVA 1WQ3A 1TU3A 1FFYA 1KWGA 3WSTA 1XLTC 3LLCA 2EARA 2NAFA 1ZYUA 1TFUA 4QAQA 2HW8A 1DIAA 2QLMA 4Q4HA 3LMKA 5KIAA 3RHZA 1N0WA 1QZZA 4HPXB 3ZKAA 1PYDA 1QIHA 4MVWA 4CTOA 2I71A 2O7NA 3DMTA 3EE6A 4PPNA 5B30A 2FW0A 1GA1A 5GJWC 3ZZUA 2ZAMA 3DHEA 4HEJA 5KMGB 2HK7A 2EERA 4G4SP 3ZIDA 2VP3A 3VZQA 3ZGLA 1K6JA 3M3DA 4M8IA 2A78A 4K0RA 1E2HA 1CJCA 3BMCA 4UPVA 4V24A 2H29A 5ETJA 4BKOA 1WRBA 5MN5A 4S04A 2EZUA 4Y9SA 1JJFA 1U7TA 2BBWA 5IUKC 4JROA 3I1JA 3CKKA 1GM5A 3KEOA 2LRHA 3BDVA 1X1TA 1AUOA 4BMZA 2GAOA 1K8QA 4OHFA 4WOPA 1Q0ZA 5AUNB 2NZ2A 2IEBA 3LQQA 5HZMA 5REQB 1WF3A 1JHQA 3JASB 1YQXA 5E2IA 1GNLA 4HNHA 3RVMA 1SWVA 3KOXA 3V7YA 3BB4A 1D07A 3OE4A 4GPZA 2QUKA 4HTFB 4EIWA 2XB2A 8MHTA 1C7FA 4PYKA 4ZQCB 3R76A 1UC9A 2O8CA 1RPJA 3MWKA 3V8VA 2ZI3A 4KBYA 2HFKA 4R98A 3L8YA 3PRJA 1DLIA 2XX3A 3B6KA 1KERA 1N57A 2EX4A 3O8QB 4FFLA 3AH8A 3MRSA 3BF7A 3DHYA 2GD2A 4TZKA 2HF7A 2HO4A 2LTAA 1JP7A 3AONB 2H1CA 4TMTA 3RRFA 3RYTC 2QP3A 3ZG6A 3QVGA 1JGTA 1VL0A 2QRLA 5KKNB 4DKJA 3LZDA 1KI6A 4EB6B 1M2FA 2QLLA 3MT7A 3N8DA 4B32A 3PEWA 3FE2A 1SCUB 1J06A 1NMQA 3C6QA 3G2PA 3OZUA 1CVIA 4WEQA 1KEWA 2K2QB 5I7EA 1TW2A 1RHKA 1NV8A 2VO1A 1OXTA 3ZZNA 3RU2A 4FQ8A 3BYZA 1CS0A 1XLUA 2XGGA 1Z4KA 5K0TA 4KRXA 4B83A 4OLAA 1GV1A 2AKYA 5DWQA 3ET4A 2A33A 1GGKA 4TMXA 1WXXA 1DUVG 1KAGA 2GI4A 1YONA 2W6CX 3BZWA 4ZD6A 2IOFA 1A9TA 3I6YA 4YJFB 4P9NA 1TQHA 4KWIA 5CGZA 2X2PA 2XJ9A 3IVCA 2GYYA 4I3HA 5C1BA 1N8NA 1GOTA 2POQX 5EVJA 1AKWA 5AKZA 3KKKA 1R3UA 1CUEA 3CT4A 3E7XA 4EENA 3NOOA 4XLZA 4KXNA 4LISA 4BEVA 4HNGA 1OWOA 1MZVA 1NBHA 2QB5A 4TSKA 4DSAA 1PWEA 3E9DA 2VZLA 1P6QA 1U8TA 4ENPA 2JFZA 1K7CA 3JQBC 4JB8A 4ME6A 1E77A 1WDMA 4P35A 1JZSA 4NCHA 4D0NA 3RRJA 3S2GA 4E2FA 2AN9A 2Y0DA 5KNBA 2HF9A 1EDBA 1H2WA 3N70A 1KHHA 3M6IA 1QBKC 3ZE2B 3HU1A 5BQ3A 1T10A 1GZSA 5NULA 1P1CA 3WL3A 1FDWA 3F71A 4OK5A 3ZHUA 3R5XA 5M29A 3H1PA 2CSUA 4N6GA 1M2OA 2Z2JA 4EHHA 3ZD6A 4EW2A 2EBUA 3AVWA 3QKRA 3BJZA 4LF6B 3DM5A 1ZWLA 4DCUA 1CZLA 3DKKA 1IK6A 1DADA 2Z8ZA 4QFDA 2H0RA 3KU4A 5HEKA 4OJTA 3Q3VA 3WB9A 4HJRA 3GZTB 1SIUA 5EXTA 1SRRA 3IBSA 2O0MA 1PJZA 3AR9A 5A6SB 2FWBA 3E23A 3KDSE 3DW1X 3ROFA 1JHVA 2JEOA 3M4JA 4RAOA 5B1DA 1Z9BA 3ORHA 2MYPA 1M1YA 2OV8A 2XB8A 4QU8A 4RGYA 4YLGA 4UPDA 2OQVA 1XRPA 1Y42X 5BURA 4TMKA 3EVGA 2G9UA 2JFPA 2OE2A 4GGOA 3TO5A 3QELB 5K0EA 5AKEA 1YMVA 4KQJA 3TIXB 1W1IA 3PXEA 4LYDA 3ETHA 4UBOA 2ZYTX 4U9UA 5ADWA 4W63A 2RH5A 2VHJA 1U4SA 2P6RA 4UNPA 3M6VA 1RYFA 2QGFA 2WW8A 2IOYA 4PZPA 3M5WA 2C9BA 1SC9A 1KH2A 5EXEA 4WWHA 3EW9A 3TVTA 4Q1DA 4MR9A 3T9BA 2GCGA 3JQRA 2YINC 2A94A 1CUWA 4N7RA 2XE7A 1E9SA 4M1SA 2YV1A 1UJBA 1T4DA 3HLKA 3KKPA 4B3DA 2GAJA 2ZQYA 3AX6A 4XFKA 1PD0A 3D43A 2FZLA 5DLQC 3IMCA 4UXIA 5K5EA 3OM9A 4QDOA 5BYBA 4D9EA 2AXEA 4DSOA 4W5TA 1W0KD 4PGGA 3GLIA 3OP4A 4GYJA 5IHXA 5AI0A 1RWVA 1S6YA 4YBRA 5AW9A 2HGZA 1DO0A 2I67A 4IDNA 5F3DA 1CDEA 4JLMA 4H7HA 2IYYA 4B46A 3KBBA 1TZJA 4AY2A 2RBGA 3BE6A 4OI1A 1L7PA 3WYFA 3QEAZ 3VU9A 2QVBA 2H1VA 3AV0B 1YR6A 4N48A 3A7DA 3MPUA 4PVDA 3WP1B 4CQLA 1SCAA 2VR1A 1K88A 3X1JA 1TLTA 1NHGA 2EQ5A 4NBRA 5HF9A 3LBHA 5DKFA 2X8WA 5DHRA 4D4JA 2J5KA 4W5JA 1GZHB 4QOGA 2O3RA 3KDAA 3LBNA 5FOWA 1XF9A 4MPRA 4ENUA 2E85A 3JQGA 2F00A 1NI3A 4X94A 1OZGA 3RG8A 4EBBA 1NASA 1U7UA 4L0DA 5AIAA 3FCSB 3PRKE 3SPXA 2XSZD 4ZCLA 2DC1A 4AJOA 2EP7A 5BV0A 5JJKA 2DH5A 2PL3A 3D3WA 3ICPA 5LBTA 3EC1A 2YZGA 4R1NA 4ZKEA 1DQSA 1Y5NA 4RVDA 4GF5A 1HFKA 1E66A 2P5YA 4CLEA 4TS3A 1XRLA 4BLVA 2CK3A 3C5HA 1ODSA 3OSUA 3TE7A 2W6ID 3DFKA 1N5JA 3GLFE 3FHOA 4MPPA 1Q15A 1XTZA 3RWBA 5KU7A 3B52X 3H13A 1SVNA 4UBIA 4G5OA 3V55A 4K3VA 3ETGA 4DFDA 4C7OB 4PLHA 3P2IA 3RSOA 5C32A 4JC5A 5TY0A 3O73A 1K7FB 1US8A 4KQ9A 1J6UA 1SBZA 4TWZA 4CMJA 1TC1A 2B0CA 1ZC4A 3OEHD 2I91A 2EKPA 5DLYA 4FHZA 4EF6A 5JSUA 1GCAA 4K9DA 1DUSA 4D7AA 4A92A 1ZKDA 3OZVA 1T35A 1H0RA 3LSTA 1X7WA 1IAQA 4ZJZA 2CNLA 1N5RA 2Y1KA 3A4MA 5JXHA 3AEQA 3EDRA 1T6BY 4QXRA 6YASA 1SXJE 3HPRA 2D7JA 3P96A 5B58C 3BMOA 2O8BA 1M34B 1CEEA 1WSWA 2BTEA 3PC8C 1TKRA 4I4TF 4DQDA 4YEDA 3H1AA 3WHPA 1FLAA 2V3VA 3GOHA 2WJGA 1KQFA 3ENZA 4LRSB 3BRQA 1NG9A 3M7IA 2DAPA 1MU0A 5HMMA 4DVJA 3EUAA 4MVJD 1YR9A 3RT1A 2G1JA 2OCGA 1NWHA 2VK1A 3E3NA 3HN2A 4TM7A 4DA8A 5EWJA 4CKWA 1JIIA 3SZLA 1ML4A 4G4IA 4BNVA 1HYEA 2DHCA 4ND1A 4JVLA 3L41A 4WZ6A 3CA8A 1PZFA 4DT1B 4JKOA 4MI6A 4NATA 5CHYA 4C4PA 1OFIA 1XT6A 3SNHA 3U6BA 3C74A 3FUVA 4K2HA 3C0KA 4DLYA 1E1NA 1VE7A 2JHFA 2X9GA 1K9SA 1K6XA 1UKVY 2H9IA 4GI7A 4WN9B 5K8IA 5C1IA 4DAOA 1F3OA 3IHTA 2GM5A 4V39A 4OHRA 3ULKA 4CYMA 5JH7B 3UJBA 4Z9YA 3K5IA 3KPWA 2JGEA 4HDNB 2PL1A 4UARA 3ZU4A 3ZDQA 4L22A 2H1OA 3WK8A 3Q2KA 1R9NA 4DYHA 3TIGA 4KXYA 2ZCJA 1TJ5A 2WIJA 3GLHE 5F7JA 5CDUA 3TLMA 3B6JA 2FW9A 4PXYA 5F3RA 3T0FA 4RACA 4IAOA 4NG4A 4P4NA 3ORRA 4AYWA 2W42A 4WV3A 2YZNA 1KDTA 4I3FA 4MROA 5EIAA 1NLYA 4FU0A 2FA9A 3D6AA 1U81A 1CR1A 2FLWA 5H9WA 3GGOA 3BB3A 4BB0A 1DWOA 1J5EB 3DAOA 1JHUA 2NSDA 5I47A 4OQPA 2GHRA 4LKOA 4U7JA 4PR3A 1A5BB 1DEXA 5JYDA 3E9CA 5E1BA 2FFHA 2HU8A 1T0BA 2AXPA 3K9QO 5IU6A 5LJLA 2C7RA 1KYXA 3AERA 1SXHA 3WLMA 3LWZA 4BV2A 3IT0A 2IZ6A 2JI8A 3RTEA 5CEFA 4MYHA 1D0IA 4B9AA 1L7EA 3FYHA 2GD0A 4OQLA 4PO1A 1KKMA 3A2MA 5JROA 3TECE 4C2BA 4UHJA 3OCCA 1T5TA 2RHLA 1UPXA 3H2YA 2GWHA 2C4KA 3DB2A 3BQMB 1WXDA 1JVBA 2OWDA 2WD7B 1KJNA 1TC2A 3CINA 2R8EA 2VPQA 1LPMA 3CKMA 1PZEA 3B20A 1M7BA 3GLQA 1U2GA 2E48A 1V8DA 3D7RA 2GR9A 3HYTA 4RIEA 3ZX5A 4DJFC 5I9LA 2PTHA 1KQNA 2GAIA 5GQSA 4HTFA 4N5HX 3NHFA 2ZU6A 4LTDA 3WYGA 2IP1A 2CLCX 1J90A 3JALB 4RIFA 1VLLA 1H4SA 5I9TA 4AJNA 1A96A 1O4WA 3AHFA 4IW3B 4EKNB 1VI5A 5BMVF 4HLDA 2J3HA 2MDTA 1JIVA 2BSAA 2AW3A 1RXEA 1FVXA 2ZTUA 4BE4A 4ES6A 1R4MA 3C85A 4EHDA 1VECA 1FTSA 2OGSA 3TBKA 5KYUA 2DQYA 4QYXA 1A9OA 1HLGA 3FVRA 3KQOA 4LY3A 4YPVA 1JHPA 1I5EA 4K6OA 2BL4A 2D13A 3MYYA 4PCUA 1UEIA 5J47A 4YDRA 3NT2A 2BGWA 4BXOA 4BMYA 3PFWO 2OUIA 3ADOA 1P7YA 5GGYA 4LE2A 5B57C 3EVZA 3F5FA 3HCAA 1MAVA 2P79A 5KTTA 1R9JA 3C15C 3TLJA 4U1RA 5IAEA 4EJSB 4UDXX 3EDYA 2N1MA 2V97A 2WUFA 3S68A 1I7LA 2RH9B 3FI0A 3U3XA 1ORTA 5C3MA 2X40A 4LJ8A 1M0SA 1CQJA 3AOEA 3DDHA 4IZHA 2O14A 3EYWA 1X77A 1XDSA 2CMFA 2ZDHA 4LE0A 4ECEA 1XCJA 4TL7A 4MAMA 1VJCA 3D6VA 5DO9A 3H5WA 1B93A 2XHZA 2PN1A 3AR2A 4WZAA 5K8CA 3SSNA 2ZBRA 1J42A 2G4LA 5FBWB 1G9XA 2WYHA 4URYR 4ZI7B 1TU0A 2B21A 5LQSA 5C3UA 1XEFA 1MH1A 2YQ5A 2Y0PA 4WKGA 1ZFNA 4MDHA 3LL4A 3P0RA 4D4HA 4R8VA 4ARZA 3GT3A 5A9SA 4FUTA 4RTKA 2R0QC 2VT2A 4MQUA 3S1AA 1J20A 2IV2X 4OMUA 5KYXB 5LWQA 1YBAA 1ORIA 3OQIB 4OL0A 5IW8A 3ADCA 1DLJA 3BH7A 1YDEA 4BJ6A 5LB2A 1T5OA 1BZYA 3PJDA 2C0CA 4ZJPA 2EX1A 2HHJA 4TT3A 3JAWA 4XEUA 3HB0A 3GLIB 3VJMA 1GTZA 3EGEA 1GTL1 1YA4A 1ZGCA 1W4LA 1YZUA 1L5WA 3FMIA 4FYHA 2O2IA 3HJHA 1GTG1 4JVNA 3TRIA 3MF4A 4KO1S 5LCXA 1DE0A 4LJRA 1CD5A 4WBNB 2PXCA 3OURA 1VHTA 4XWYA 1RAHA 3RM3A 1NI5A 5E3HA 1EDDA 2BGIA 1QB7A 4H6PA 2MWMA 4R0VA 4GQAA 1LC3A 1PS9A 1O94C 3DUFB 1VA4A 2WAOA 4MGYR 4FNGA 4DXDA 4FFMA 4G1CA 4IHJA 2A5DA 4X6XA 5DCUA 3K9NA 1X38A 3C5EA 4A6EA 5C5IA 4L7QA 4BLUA 4OU4A 1WUJS 2TRSB 2QY6A 3W2GA 2J31A 4CPDA 1VFPA 5BWNA 3ZU3A 1W59A 3CEAA 3VR4D 2GPNA 4GWGA 2P6MA 3THWB 3GOQA 4XCQA 5EUQB 1H0SA 4DIKA 2AL7A 5C51B 2Q7XA 4RS3A 3ZNNA 1OB5A 1K6MA 3HKBA 1P3DA 2ZPUA 1GT6A 1I3OA 3QEMA 5MGBA 1DOAA 1FC0A 2ZI4A 1XTJA 4FD3A 2EJTA 4TXMA 3GCZA 1DAKA 2C29D 1P18A 4X85A 5F2OA 2Q2QA 1W73A 5K2OA 2HJHA 2OD7A 3ZK9A 4DR6B 3IELA 4CQMB 2QN8A 3IE2A 3BWMA 1T8UA 1RAFA 3OKPA 2W2TA 3DPSA 3EB9A 4MV1A 5I4BA 3EHDA 1WVIA 5LKAA 3QU2A 3TQCA 1D3AA 2E4VA 3F7TA 3GLTA 3DEZA 4UW9A 1N7GA 3BREA 3SS9X 2AEFA 1RXIA 1H9CA 5AI9A 1QGYA 1J97A 1OZAA 4LJLA 1G7CA 4Q3LA 1GUBA 3BVPA 4Z8XA 3FPLA 1U1DA 4DA0A 5A4JA 2LVBA 3F5QA 2EW2A 4GUAA 2L42A 4X1IA 4IEEA 5EXXA 2C7GA 1WCIA 2HSGA 4AMYA 1XL0A 3G5TA 4P81A 4XPIB 3WQRA 4A0FA 4MEAA 4BLTA 2F3SA 4HNUA 2P9ZA 1KDOA 1T36B 1CUBA 2ZRHA 1EFDN 3OI7A 5D3KA 3ZNPA 3OOEA 2G67A 5GIPE 3H3XA 1MZPA 2WFAA 5KC9A 4GOXA 3QTLA 1A5AB 1H42A 1BXKA 2BEJA 5EVCA 3QXJA 1KE1A 3UXMA 3MGGA 4AJEA 3L92A 4DAEA 1Y8ZA 3BXZA 2B8TA 1KOJA 1XRRA 3LPCA 4KE6A 1VJ0A 1E4YA 3I3OA 4ZQEA 4ZA2A 3SHVA 4DLLA 1L7OA 3DH0A 1NVGA 5HKOA 3VZRA 1W93A 2RIPA 4CUZA 1FF9A 1GRNA 2UZ1A 2A7QA 5EIEA 2LKCA 3AJDA 2PMDA 1WCXA 1G8SA 3UKJA 4C4RA 4I8XA 2FWRA 4QG3A 5L53A 2P6PA 4J0CA 5IVDA 1JJBA 5EIBD 1H2YA 4FWIB 1KQGA 3TW6A 5ELXA 1NZFA 3EH2A 1AGXA 3ASUA 2Y67A 5DTQA 3REFA 1K6EA 1O77A 1IWPB 5HYVA 3AU9A 5EXSA 2P8SA 5E6SB 5EZQA 3R7LA 3NONA 1EFKA 1UKEA 1AG9A 3KM0A 1K7EB 2D3TA 4UXHA 1UBLS 4TSRA 4UU1A 2NGRA 2I6FA 2OCYC 1WTAA 3MRTA 4B3JA 3K31A 2Q5JA 3V1UA 4AS3A 5BWLA 2YNMC 1OX6A 3OT4A 5CT5A 4JFRA 2WYWA 3OPQA 5L4NA 4GXNA 4L7VA 4UQOA 3O47A 3SAJA 2OYSA 3COJA 3GVCA 4JYMA 2G80A 4M3NA 1A4UA 3WFIA 4YRNA 3EXEA 3IVMA 1NOIA 2W6IA 2ZXUA 4M7WA 3GRAA 1E2JA 3AB8A 3ZPXA 2VK4A 5DK6A 2NIPA 5FOXA 5JCOA 2P5TB 1NR5A 2C95A 3AG5A 4ALIA 2IFTA 4RANA 2BJWA 3FHTA 2DBQA 2IP4A 3AHCA 3K0FB 3V97A 1JR6A 1D2RA 1QONA 2HLHA 1RLJA 3F5DA 3FJ1A 2BMEA 3H1TA 1TQ6A 2X23A 2XYPA 3B5JA 1V6AA 3DFFA 1RMQA 2R48A 3G6WA 2ZTHA 4OMCA 2RC5A 1FMCA 1QTIA 4ZQIA 2V7XA 1S7CA 4J29A 3ZY6A 1FMJA 2QM7A 5IWAB 4BFSA 3HJNA 4MKIA 4RE5A 2QA5A 2J3JA 5JDIC 1S2DA 1V5EA 2I6XA 4RZ3A 5HF5A 5B58T 3VOSA 3J81A 4YRCA 4WXYB 1H1LA 3IDAA 3KAKA 1Z22A 2BY4A 3L7YA 3KJNA 3OF2A 5DM1A 2XCUA 4GBGA 2QUJA 4HCJA 2AWOA 5DGTA 4WECA 4URHA 4ZCMA 4OHOA 1LPSA 5K6TA 5KNDH 1PGOA 4I1IA 2ZBQA 2AA3A 3TH5A 2B20A 4CLRB 1QHSA 1BJRE 3OZSA 5HTOA 4I3GA 1GCGA 4ZAGA 1WEKA 1QGAA 4MRPA 4BU0A 4X7RA 1CQXA 4MUMA 1SVOA 4OLHA 3M5PA 3U16A 3LWBA 2DOKA 1BN6A 3RNLA 1G98A 3FZGA 1HSZA 2WKRA 4WKPA 2R96A 2J85A 1QF7A 1P3JA 2XMBA 3STTA 1FJ2A 2RAFA 3MQ4A 3UMFA 3C1OA 3GB9A 1C4WA 1JFFB 1I10A 1UWKA 3K2EA 3MWYW 3UUGA 1FSSA 4EJSA 1XV5A 4GEGA 5BXQC 5G1PA 3SXUB 3PA8A 4P36A 1U4NA 3NHPA 5EUCA 3G5MA 2XCIA 3DTVD 3VDXA 4X1OA 2ACVA 1WABA 1WB6A 1YB7A 5TB5A 5TNXA 4BKMA 4NZPA 1KORA 4ETWA 4UTPA 1AN0A 2G70A 3FDZA 4YAKA 4JODA 4CMCA 1EHYA 5ALQA 5HE9A 5IABA 1MAUA 2NZVG 3LUJA 2CSXA 3IURA 3JPWA 1QGUB 4WY2A 3WS7A 4X3PA 1RM4A 2G25A 3KOZA 3MC1A 2J5QA 2Z1DA 2YUTA 4NCKA 4FYPA 1E7SA 2I7TA 2ZUTA 3R7DA 4FJ2A 3WQHA 1SEPA 4YY3B 2XCLA 2VT7A 2ORYA 2H57A 4BLQA 2I87A 4U63A 4F9EA 4MRSA 5CVJA 5CDSA 1XMIA 1EXMA 1VIYA 1S8FA 1B41A 1XZIA 1T6YA 1ZJYA 1IZYA 1TUEA 2VUSA 3DOEA 4TROA 3UCFA 3TZLA 5KVVA 1HR0B 2X9VA 4GM4A 4R0MA 2XPCA 4CGZA 4JT4A 4WPGA 3F7MA 1T8TA 5LYJF 4NP6A 1H94A 1FFSA 3IPCA 1G8YA 1EFVA 3LY8A 5IHPA 3JATA 1VM6A 3MMZA 4HNAB 2R7NA 3OUUA 3QVSA 2VL7A 4HPWA 4R4JA 4QGFA 3HB5X 2F64A 1Z3IX 2C0PA 2NSYA 3FTDA 3VNRA 1ZC3A 2DR3A 4EGFA 4G25A 4B8YA 2Q50A 3U44B 3DMHA 1OIWA 3W34A 1ZESA 2J4CA 2FF5A 5J9FA 4Y0AA 1A77A 1XMVA 1CE8B 2GVZC 3VHXB 3ETEA 4Q7LA 4R01A 4OJQA 2AQ8A 3GIWA 2BF7A 4Z6KA 1BROA 1MIHA 5KDOA 5AW8A 2PR2A 4G0OA 5I8ZA 3UFBA 1A2OA 1X80A 3NIFB 2QTFA 3G59A 2O59A 4PZ9A 1SH7A 2EJUA 2PANA 4KNYA 3SN6A 2VRNA 4QDZA 4WIAA 4D82A 3I9LA 1RU3A 2XR1A 2B9VA 2WMOB 5FO0A 1LLDA 3HKDA 3KXLA 4MRMB 1FSFA 1N2JA 4JA0A 4DQ0A 2F6RA 4JSYA 1G17A 4KYTA 4D4KA 2YICA 1NJGA 2QRGA 4WEOA 4UCXA 1EGQA 1QNFA 2JL1A 3V2UA 3CHYA 4QX6A 4RYDA 1R0LA 4DDKA 3QLUC 3QKTA 4U0KA 4ZT7A 3IL2A 2XF8A 3T3NA 1Y82A 1SOUA 1JEOA 2NUPA 1FL9A 3KB1A 3SZMA 2HMSA 1TMGE 1B74A 3KB6A 3QBVA 4KU4A 2C07A 3MUOA 2F48A 3UAWA 2NXWA 4OK3A 4NJOA 4DV3B 5DK4A 2PEYA 1AS3A 3K2QA 4HS4A 2YWBA 2WM3A 3QPDA 3Q6NA 1TAGA 4NCAA 3D8BA 1T8PA 2WR8A 4HAWA 1SXJD 1MGPA 2P9HA 3E9EA 2ISSD 4RDXA 1XCMA 4GZ3A 5ALVA 2HZ7A 3FKQA 1IRXA 1I51A 2PX4A 2Q41A 3R3XA 2RHCA 4K9LA 2PE5A 1JVNA 2GZ2A 4JYPA 5A3RA 1ZM3A 2UVDA 3UB4A 1C1XA 5EMLA 4J07A 3WLRA 4E4TA 2WFLA 4PLCA 2OKCA 4OXYA 3RBAA 5JNRA 1PEAA 2BRUC 4J7CA 3OEYA 1MHPA 1GCOA 4Q7KA 3T1OA 5A04A 3TUZC 5IZ4A 1WU8A 3ND9A 3OH8A 5CGQB 2IV7A 5HJEA 3B1KA 3KVRA 3L8HA 3P2YA 4JI4B 5AR1A 4EEXA 1JMVA 3ILHA 4BTEA 1RRCA 3U56A 1FSGA 1EG7A 3R20A 4PG5A 3V4FA 3OQ1A 1RQ2A 4ONEA 1I6LA 4D0LB 3JQDA 3IR6A 3A2KA 1QLHA 2MYUA 4S1OA 4BP8A 3RVOA 2WAYA 2B61A 4DADA 4Z86A 3E81A 3PU6A 2JCXA 3QNMA 4BMXA 1XHEA 3HL0A 4BMNA 1XPUA 2OORC 2V4ZA 3PENA 4F86A 3JWJA 4ZYUA 4HGQA 5HIAA 1JDPA 4QG7A 4NAHA 1X1DA 4GLLA 4BAZA 3FWPA 3I9FA 4RF2A 1ZRNA 1FFXA 1SBNE 3CONA 3I42A 3QKUA 4GEKA 4J1SA 1JYSA 1RWBA 1ZU5A 4JVOA 3L46A 5BOSA 3T5AA 1JHZA 4EEZA 1J2UA 3GP8A 4DC1A 3VPCA 1YBHA 2VDOB 1P1RA 2A9RA 5CEEA 4DSZA 5JV5A 5FQOA 1U2EA 2BR3A 4Q9HA 5M7EA 1CHNA 4LF8B 5CNMA 2XRFA 4WOJA 1QWSA 2PFGA 4H31A 1KI8A 1URPA 1HDRA 1E8NA 1U0GA 5BXYA 2CFIA 2R5NA 3C2QA 2VBFA 5HQ3B 1M6VA 1HTBA 1M1NA 7GPBA 3IV9A 3HL4A 5DVZA 3V7UA 3MUFA 1YRQA 4BFXA 1R37A 3AF6A 3V7WA 1JA1A 3UPUA 4JUBA 1P2VA 3WB1A 2PRYA 2IYWA 1ULUA 1WMFA 2AHOA 1YAHA 3ZDEA 5C4IA 4JR0A 4OFWA 1N2SA 4IRUB 4PO9A 5G1OA 1MGOA 1K4MA 3E8MA 5MFPA 2WK1A 1KO1A 3IUNA 3S2EA 3WGTA 4S05A 3DL4A 4NEQA 4ZGGA 1Y6ZA 4HEQA 2Y0BA 4PTYA 2CVHA 5KREA 1LW6E 1NW3A 3EGWA 4PCLA 3SNKA 5CNKA 5H5JA 4ZDJA 3HUEA 1VHQA 5IAJA 1E3TA 1NX9A 4RULA 4V1CI 2X15A 1P33A 3HP7A 3MXOA 3UJ6A 4RTLA 4FD2A 3SDSA 4DMHA 3CJQA 4MB0A 1Y3HA 2OBFA 2YJGA 2PUBA 1KJQA 1XWFA 3KUUA 3BH0A 5FOUA 4AUNA 4E46A 2ARKA 3CF2A 3BA6A 1U8UA 4QGSA 5I7HA 2P9EA 1CUIA 1LLCA 5INTA 4P5DA 2C8LA 4HUTA 3EQZA 1I36A 1ZUIA 1KIFA 1BTOA 2IYEA 2WVJA 4B2YA 2WIDA 2QPAA 2P68A 4IXNA 4YMTA 5PGMA 4FFSA 2H4HA 1O1YA 4IVPA 4IR7A 1RC0A 4MW2A 2Y66A 1RLTA 2ETVA 3HCDA 1I2DA 3NH6A 4N3GA 4AG6A 1RQNA 4RQUA 3OZEA 4YRMA 2OB1A 1Z4JA 3AV3A 5EIOA 2VJQA 4ZEMA 2X77A 3EMVA 3PK0A 2P90A 3TPZA 1XD9A 4F45A 4CV2A 3RLIA 1R2QA 5BSRA 3MJVA 4L85A 1V48A 2P41A 3OIGA 1YHZA 4OSPA 5LFAA 3DE0X 2F2TA 2DSTA 1JFFA 2HTFA 2ZIEA 4B8WA 2PX3A 1UMKA 5HPYB 3F97A 2HHCA 1IG3A 3UOAB 4EEKA 4HNQA 2CLOB 4XLTA 1QHHA 1D6NA 2UZ0A 1XN4A 1OHHD 3NO4A 1H65A 3N3AC 3JYQA 4YR9A 3ONVA 4FBMA 1W0KA 2JLYA 2ASVA 1OLSB 4DEYA 2IKSA 3FWKA 2QX9A 2PZ8A 4YP0A 5B3AA 2JHPA 1QGUA 4UEOA 1Y6FA 4R84A 4Q3BA 3L7NA 2JFYA 3A1UA 4BQIA 3F73A 1EFCA 3CJRA 5EJAA 1KJJA 1TCAA 2J7PA 3LQ4A 4G24A 3ZXUB 2Z83A 1G21E 2VUIB 3KBOA 3K05A 4I08A 3CLRC 3EX7C 1IZ0A 5JAMA 4YRRA 2N0SA 2BGTA 2VZEA 4FZRA 4YI5A 3TBHA 3FLBA 4L27A 3O83A 2CEAA 1N7JA 4WJLA 2W2OA 2HI0A 2MYTA 2NTEA 2WICA 5BPHA 4FCWA 4OA5A 1SOAA 1EVZA 2K5UA 4QYSA 4EX6A 2HNAA 4LGMA 3VVMA 3QKRB 1S5PA 3L06A 1M2JA 2DJ5A 2HK6A 1CX9B 5IRCD 2QRHA 4R81A 2Q7DA 4Q6WA 1M5TA 4TN1A 2OEPA 2I8CA 3FHCB 2HMTA 3WA7A 4HZUB 4MR8A 1NP7A 5TGZA 3G2KA 3OX4A 4JNCA 1JR3D 4L6AA 3HXKA 2JAUA 4ZCTA 1T34A 3L1HA 1BCSB 1FP1D 1LBIA 1HT2E 5ITVA 2XMZA 1K4KA 2WKWA 4M55A 3RSFA 2CDBA 2O2ZA 2ZAOA 3DMFA 3PEEA 2F1KA 1UBGA 3OJ0A 4QXOA 5FADA 4DCTA 1G8JA 2G04A 1ULTA 5CT9A 1EK5A 5BQ5A 4FZVA 1E79A 2ACWA 2NV2B 3UMBA 2RCNA 2RH8A 2JHGA 4XYMA 3HDQA 4ML3A 4Y6OA 4BO8A 2XITA 1PSWA 5K51A 1W25A 4QPZA 3TX6A 2JIZD 4EZEA 3ZDFA 3RC1A 4RVCA 1UKBA 1G59A 2J46A 1QVRA 3MJSA 1BKSB 1K2VN 1RTTA 3F90A 1L1QA 5JD3A 1P9LA 2X0FA 4CM4A 4W5QA 4LXTA 3GNLA 1JNXX 3ZNQA 4R8KA 1XC7A 3HBFA 5KTOA 2WHPB 1BVHA 2CW5A 3WGKA 3KUCA 4QUDA 3HJRA 4A0HA 1VKJA 4LYHA 5DIFA 2EP5A 4PGFA 2QXTA 5LA6B 1X15A 2BI4A 2VPPA 3DV0B 1EVEA 4O5OA 3TZEA 3IEMA 2R1VA 5DRTA 4BRWA 4JD5A 4WHMA 3PXDA 1R0CA 1SHLA 3FYUC 5JECA 5KYYA 1ZJZA 5CP8A 4N7JA 1SZJG 5LL6P 4NABA 5DRYA 1INLA 4KI7A 1Z2AA 1XVTA 4HNAA 4ZPXA 3CNQS 1M6EX 1Y34E 1Z4QA 5EE5B 4IWYA 3UB2A 4QVKA 3T6KA 4JJAA 4XARA 3GFBA 3GUUA 5DBFA 3VR5D 1P81A 2IELA 2ZETA 1QM5A 4HI0E 3VHXA 3C41J 3HYLA 1XPRA 5ALYA 1L8OA 2VCEA 3THXB 3HVIA 4MA5A 5DCLA 3RANA 1NP6A 4UTRA 1VIDA 4LZPA 2G28A 4E15A 5IKMA 4BBPA 3B1ZA 4H1UA 4GX0A 4R83A 3GNTA 1R0ZA 3NBAA 1JDTA 4AY3A 4HQFA 4US2R 3N6XA 3U4QA 1U28C 1NXSA 3IAFA 4DLPA 1CUUA 1AGNA 1Z83A 4KLNA 421PA 2BHTA 4W1QA 4DZRA 1YFZA 5IXYA 1V11B 4MW7A 2ORIA 3MJCA 5COQA 3PL5A 2XMCA 3U26A 4LDZA 4I8IA 3T61A 1JA0A 3PQCA 4G5RA 2XYHA 1U3WA 4ZO6A 4ZREA 2Q5EA 1ZNQO 2HSJA 3CF6R 3VR1A 1GPJA 3HWX1 4UC0A 4XIYA 3A28A 4YAWA 1EBUA 1T2NA 4R2HA 5ILGA 2VPXA 3D6HA 4P31A 5DWDA 1KBQA 1LQTA 1TQDA 3FZYA 4X90A 3GAAA 4NYMQ 5DI9A 4BZXA 5K09A 4ABTA 1FFWA 4OPMA 2A5LA 2P0YA 3JD4A 4JLUA 4QWMA 4MUYA 3UG7A 3WXBA 1KYVA 2YUIA 3RKUA 2ZYUX 1QG0A 1XTTA 2Y2UA 2ECQA 3WNBA 4M0EA 4YFVA 3O4JA 4I7EA 1M83A 4JZYA 3ZD8A 4W8GA 3VDRA 2IYSA 2X0JA 3DEIA 1EPUA 1F1JA 1NVEA 2P2NA 3FSGD 3O3CA 4HP8A 1E2FA 2XGSA 4I4NA 3V4OA 2PXAA 3K8OE 4S35A 4NZYA 5BN5B 3IKLA 3VYSB 1MP0A 1AZSC 1MO4A 1XZNA 2GWRA 4XTCS 4DRXA 3ICQB 2G88A 3DT9A 3TNYA 1L1EA 5LZ4A 2VVTA 4RWEA 4X60A 2PS9A 4QHYA 1H3FA 1P6UA 4QA9A 2GD6A 1IHPA 1J49A 1RXUA 3LCRA 1C30B 4N8DA 3OQ6A 2O3QA 4TQUS 2RHHA 4XQCA 1KOFA 3TAHA 3U3ZA 4WAUA 4PS1A 5FOSA 5F3WB 2CL0X 2TSYB 3S99A 2EIXA 3LOUA 3LQFA 1C4XA 4C5CA 1YZTA 1FNCA 1YL5A 2A3RA 2G4VA 2OD9A 1LEHA 2VXBA 4G97A 5D84A 5A1JA 5FOQA 2V4UA 2QTCA 2MSLA 3SQLA 2F17A 2D59A 2QJOA 2CUNA 3LPNA 3NVKI 5F51A 1UINA 5KAMA 5PNTA 5K0NA 3GN2A 3OJWA 1ZMBA 3LUPA 1FYXA 4EJ2A 4E7PA 3URKA 3DE7X 1SQGA 2EF1A 3F2IA 3HYRA 2BSQA 5ULLA 3Q1KA 2FQWA 5FPSA 2FZ5A 1RXSA 5JE8A 3SC4A 2CMHA 5BV2P 4GL2A 1ZJ5A 4UE2A 1QQTA 1XLWA 4U39A 4Q9LA 2PRJA 3A6GA 1D2HA 4N54A 1I14A 4TMWA 3MTDA 5T64A 5TARA 1H0HA 1S3SA 4AAYA 1NJFA 4HMQA 5FUXA 4BO2A 4LJ4A 1NONA 4FR2A 4Q3CA 3SCZA 4LBYA 1C2TA 3K72B 2B34A 1WSBA 1VGQA 1Z5WA 1XZFA 3CRMA 3B2QA 3KZNA 4GMKA 2JJQA 4II2A 4Q1BA 1QH0A 1X7HA 4OGLA 4BFLA 1EM8A 2EU8A 4JI2B 1AKTA 1XRSB 2OXTA 3TTVA 4YREA 2EAUA 1A7UA 2JFUA 4IQFA 1YBFA 4ZCSA 5AVUA 5LMNB 3GGJA 1K9VF 1RYBA 1CUAA 2GZAA 4C21A 1QQBA 2Y0CA 2C61A 4GE0A 3KLBA 4M7OA 4V38A 4XCXA 3TRDA 5AESA 4CG3A 2QZ9A 3PDJA 2H6EA 1RBYA 3RVNA 1T26A 3DEKA 3F3SA 2VTBB 3QFHA 1B6TA 4OJMX 4YUXA 2XZLA 3AOEC 1K92A 3IEXA 3GH1A 2VHQA 1CT9A 2PPLA 5BY2A 2XCTB 2HRCA 1B2LA 4L73A 3VPSA 3U40A 1SBTA 3LCVB 2VDWB 5ERYA 1I3CA 4L4UA 3WKEA 3ODPA 4PC1A 4BMDA 2ZP1A 3FNGA 4M9RA 2I3GA 4G37A 4GGPA 2H2DA 3L49A 4U6SA 2PLAA 1AXEA 1CNFA 3OCYA 3T7SA 1IULA 5IJ0A 3CX8A 4JYBA 3LQ2A 4ZHQA 2PZGA 2JDID 5CTAA 1Z2EA 5F1OA 3WWDA 2O8EB 4CN9A 2YDYA 4M0PA 2W6QA 5FA8A 5IT5A 2V9PA 1W44A 2YQZA 4P22A 3GVHA 3D4IA 3V6MA 2Q3BA 1U31A 2GCIA 2MU1A 1X14A 1ELOA 2WNHA 2VXYA 1ZUNA 3QITA 2R97A 1JSZA 1O6ZA 4UMDA 3JPYA 5DP2A 5AO9A 3RW9A 4DMKA 3RSLA 2WUDA 3K9WA 5GONA 4EVSA 5J5VA 5FR2A 5KTYA 5FAXA 2OLJA 4CCAA 1U6IA 3PXGA 3VSAA 1X2BA 1X74A 3IJRA 1LBTA 4PXSA 2UUBB 3E22A 5B2ZA 1I4OA 4YMIA 4UUOA 2OGWA 4I0WB 4H7PA 1RD4A 3KOWA 3LUBA 3OPXA 3FUWA 2PZJA 3V2GA 3LUFA 4D5EA 3WDLA 1ENPA 4ZRNA 4X24A 2XCQA 4J1QA 5C80A 2CDRA 4CR7A 1IJBA 5CDYA 5ICSA 3GELA 4P8RA 1PL8A 2DQZA 1U2PA 1MR3F 1ZKMA 4C05A 2A0FA 4BY9E 1ODTC 4E94A 4ZYXA 2JAPA 4MR7B 1CKEA 4HN4B 5FPTA 3B2NA 3LXRA 3VV2A 2ZJZA 5LD2C 1SK9A 2L82A 4M88A 5EIXA 1PYGA 4FHDA 4PG8A 3N76A 1RWWA 3IUMA 1P0IA 3QJYA 1FLNA 2O54A 5HBRA 1GPKA 1A9RA 4POAA 4JJ4A 1JRLA 2VH5R 3U4AA 2J48A 3WV5A 2EZTA 1G1AA 4DIEA 3NHLA 5JJ5A 1Z4PX 2ST1A 3DF7A 5T8KC 3ZC3A 6REQA 1XYYA 2GK6A 1OAOA 3RYCA 2AG5A 3BTVA 5KDDA 2O20A 4L74A 1AF4A 2OTCA 5IF9A 3OSZA 1ACLA 1CFJA 1JAXA 5FL7D 3K70D 2I54A 4GNKA 5IT9A 5IH3A 2ZUFA 2XW6A 4ARBA 1YKFA 1UK7A 4HQNA 1GKKA 1IEVA 1DB3A 4MWDA 5AW2A 1K8XB 2OCKA 3QX8A 4I36A 5KUTA 3ZNOA 1YUNA 3O95A 1Y6QA 1Y8QB 3NW9A 3NFYA 1C7IA 1U1FA 2YNMA 4KAXA 1LZKA 3DFUA 1T29A 5HRCA 2ZJOA 1JEQB 1XJ5A 2R7LA 3EFOA 2ZZKA 3KQKA 3EEQA 1ADCA 4BNYA 1MA3A 2IUSA 4CF6A 4AROA 1H2RS 4D9KA 4G0PA 4MHTA 1X39A 3ZS9A 2DXIA 4LJ7A 1MTZA 3LG2A 4ZVRA 3NTLA 1B2RA 3N0RA 2OHOA 5NLLA 5IEJA 2C82A 2D0OB 1IU9A 3HXMA 2FYTA 3I9KA 1YI8A 2CZGA 3E5NA 1UP4A 1ZNYA 3HU2A 3P9RA 4GHWA 5BSKA 3H0KA 1I6WA 4H15A 3IE1A 4IHJB 3NC0C 2YJ4A 3ZWBA 4DR7B 3NHBA 4P4GA 4CM5A 1RWNA 3B12A 4UTVA 4PXAA 3RYHA 3D7LA 5DNDA 2C8JA 3FB4A 2UYOA 1LY1A 1DEHA 5JSQA 1UXOA 3BL5A 1V96A 2B2NA 3W5CA 4H7IA 3I2HA 5DX1A 1XDDA 3WIDA 1L7VC 2IL1A 3IDSA 4EGJA 5JAHA 1J39A 2PT7A 2QD2A 2ILVA 3HR7A 2R2GA 4LEIA 5ALIA 4PX5A 1JG1A 1L7NA 3TNLA 4DNFA 4F3CA 4AN4A 4UOZA 5CFZA 4B75A 1O8BA 3BMQB 1WY5A 2AMFA 2SKEA 1QCCA 3GCWA 2Y3IA 2GJKA 3QU9A 4IUYA 8LDHA 3QWBA 1C50A 1PZNA 4GOMD 3PFCA 1QYCA 4UVGA 3E2IA 3OZGA 4YAJA 1JF8A 1AKRA 1ZUD1 4NNOA 2W2PA 3FUXA 4XQ0A 2A3NA 1H0KA 4G0XA 5TQ0A 4O2LA 3ED5A 4HSGA 3WGYA 2AF4C 3V1KA 4UDNA 4IILA 1LDGA 1N2OA 3RAJA 2C0QA 3V1LA 3R3SA 5AHXA 5EAIA 2UUCB 1BIFA 1EH5A 4D8WA 4F85A 4XPIA 3EDMA 4PYOA 4Q48A 4X6YA 4M0KA 1WPQA 4UD2A 1H8EA 2MHCA 1WOMA 3THXA 3STWA 4B2LA 1GHTA 2G36A 2YS6A 1NUSA 2RD2A 2YN2A 3IAEA 3OOWA 5GIOE 4FDTA 4BZWA 4E2WA 1RLOA 1NVVR 1R6XA 2Z4TA 1UT5A 2PV0A 3R7WB 1Z7WA 3CURA 5AW3A 3H65A 1JQ3A 4TSFD 1U3UA 1TVEA 4NZ9A 3F9RA 4Q3OA 1V11A 3I2JA 3H3JA 2QTAA 1Y9AA 5TF4A 3P9KA 3TLZA 1X3LA 3H9JA 4E1VA 1YVPA 5B6PA 2I5PO 3QJGA 1L5NA 1DXYA 4JYZA 2XQGA 1G6HA 4P2BA 3T3GA 4F6CA 1JIQA 1GL3A 3C45A 5TT1A 4Y2JA 5IJ9A 1E2EA 4IJ5A 4M53A 2PX8A 3DS8A 4I5FA 3F4KA 1IQPA 1W0JD 1ZMRA 2JGJA 4Q02A 3BE4A 4G5FA 4PCAA 4RCYA 3ZWCA 4C78A 4G07A 2Q0HA 4P3KA 3KHKA 1DC6A 3CF0A 3GUHA 1T5HX 2PUEA 3FTNA 3TOVA 3V9PA 3MT8A 4X62B 2VPIA 2E0IA 2H7VA 2PSEA 3QPUA 1U11A 3PYMA 1JG2A 1FU8A 4H1HA 1QRSA 1BS1A 4RC9A 5FPHA 3DTVA 2K6GA 5LLDA 2PBLA 3L0SA 4CEJB 3MHTA 2VTVA 1E9DA 5FTNA 4FFWA 1F0PA 4MDEA 2WD9A 1BG6A 3EVBA 4U2EA 1AQ6A 2V6JA 2XXJA 3AFOA 1B16A 3OPYI 4HGPA 2W58A 4UCWA 1TUIA 2QE6A 3K6JA 2RAVA 5AMXA 5LDHA 3M3HA 1ZK3A 4HDRB 5ENDA 2F55A 2R6JA 3K5HA 4ZU6X 4ZAVA 4E5UA 1GAQA 4R6XA 4HVCA 1SZDA 3M9WA 4QQKA 2JZCA 1G7TA 3GRZA 4Y2RA 1EWVA 2GFHA 2VOEA 2J6IA 3AKEA 1RJWA 4UMVA 4ZO7A 5F98A 4H27A 1T8RA 1WXFA 3FFWA 2NU8A 1SVSA 5CG1A 3AL0C 4M9XA 2UVQA 2ZYRA 4IV5A 4PZDA 2I6QA 2X4DA 5AJTA 3H8SA 1EMDA 1KYTA 3L8CA 3RVRA 1CY8A 1GGVA 2ZI5A 3TCXB 1XMXA 3D02A 5C52B 4CIDA 1L5OA 2HLPA 3K0FA 3X1ZA 1XNRB 1VC2A 2VHTA 3IOYA 1SKUA 1CY4A 1T1RA 1VSVA 1VZ2A 3P32A 4ZVKA 4E5MA 4EHLA 5B6IA 2H3HA 4BMPB 2FHSA 2G1KA 3DFIA 4M38A 4MVJA 2FPPA 4NZOA 1KZ9A 5ER9A 2OYCA 5F7OA 1Y63A 1RCTE 4H08A 3KUKA 1ZGBA 3MVEA 4BYGA 4CLHA 2C2GA 4O0MA 2XUIA 3QBEA 2O4CA 1CK4A 3L8GA 3BGWA 3DEJA 3GNQA 3KVVA 2FG7C 4ICIA 5B4UA 5FI5A 1A82A 4RVGA 1UJ2A 3NQ41 4OL9A 2X86A 4UBMA 2R66A 1XA3A 1Z08A 2HGSA 3HWWA 3OFND 5ECGC 1P73A 3T3EA 4ZHQB 1S4QA 3W5HA 1U8AA 2O8CB 1RC1A 3HJUA 3EMDA 4A2QA 2Q49A 1C7EA 3L04A 3ZDZB 1N34B 1A3CA 3OQOA 5BSTA 4WMLA 5F1PA 3ZHRA 3ONDA 3ONEA 4U6QA 1F0YA 1XLVA 2FSPA 4ZT6A 1R9GA 1FLVA 5MF6A 2PMWB 4WK2B 1NF2A 2VT3A 3H7AA 4WADA 1DJQA 2C83A 3R5JA 4G9BA 5LXTA 2OBNA 3BUSA 2PUAA 4MAAA 2AX4A 2B82A 1Y1QA 1RJ9B 1J9GA 2JFBA 2QE7A 5FI0B 2E4YA 3T3MB 1JT9A 4YDSA 4DF3A 1BVYF 3FZEA 3SQMA 2AZTA 3SEQA 5KNCD 4YT2A 2GSWA 4GRAA 2QNIA 1PJCA 2PWAA 1Z6XA 2WHRA 3DZGA 1SIBE 1RACA 2BCEA 3HUDA 1Z4OA 4RGQA 1KVTA 3HVUA 5ENZA 4FZ3A 3GWGA 5C81A 2FG5A 3MILA 3WOHA 4EHIA 4D9CA 2HIGA 5KAPA 3KUXA 4CMBA 4MZXA 2AKEA 1E20A 4PO8A 1QO7A 5DT2A 1VBMA 2CXUA 3W5SA 3TL3A 5A3SA 3EHEA 2WZCA 2YJZA 2OHJA 4BGDA 2BM0A 1JJIA 1V26A 8AT1A 1OFHA 1Q0PA 2NXCA 2ZB4A 2QDXA 4QGAA 1U8ZA 1HQYE 3FOAA 4DHWA 4C4SA 4D8UA 4MW5A 1AUPA 1T4CA 1CY6A 2A0XA 2DWUA 2GASA 1Q6YA 3PNBA 5T3YA 3VDNB 2XE8A 5E2AA 3FN4A 2ZM6B 3KYBA 1U1CA 2ORED 2FWPA 3PLNA 1R8SA 2CE2X 2DJIA 3KSAC 3LW8A 2VDVE 1G63A 1GZDA 1PGQA 2MT9A 1ZN8A 1E6LA 1YDGA 2ZRMA 2H07A 4FR0A 5LXTF 3X1WA 4IZOA 3VSCA 3AESA 1GFIA 4DBVO 1QTNA 1WZNA 3A10A 4CGYA 4PPGA 3X1MA 3QKSA 4F21A 1OCEA 3IEKA 4F3NA 4WVFA 3IP9A 3EFHA 3URMA 3QVWA 1TRHA 3A1NA 4M98A 4II3A 4CWAA 1R64A 2VDLB 1NSTA 2WUVA 4HF7A 3UMSA 2GXQA 1A9XA 1MIOA 1PD1A 3IIKA 3MFQA 4TPKA 3VOAA 4MO2A 3SD7A 3QWIA 4L6IA 1NHWA 4HXGA 4JJ8A 3L84A 4K46A 1GZ6A 4PLFA 1G5IA 4DJ5X 4YAGA 1UWCA 4JENA 4TYYA 4DLRA 3KEQA 4KQFA 2V3CC 4NL4H 5IYZA 2PBZA 1KFBB 2ZWAA 1NLUA 3S2FA 2XNDD 1YA6A 3RIYA 1P5RA 4IGEA 4Q4JB 4ZOLA 1JSLA 4LHYA 3W7BA 4GPD1 2EFEB 4UVHA 3YASA 2CT8A 3C97A 2G63A 5K3DA 2A92A 5TIIA 4Y2PA 5LQUA 3TE6A 1Y5RA 1KYYA 3WYNA 5C18A 3VYWA 3A32A 2QLJA 4JH0A 1APBA 1O9GA 1N5OX 2O48X 5YASA 4D0GA 2XOEA 4PC3A 2R9VA 2DPLA 2JLQA 4PG7A 1GGMA 1LPAB 5IFKA 2PSDA 3DXFA 3TJZA 3CR7A 4U2DA 1LBSA 2VSYA 3VSDA 3ABIA 4CDRA 1WP4A 4EG4A 1GFWA 3TQFA 3L0DA 3VTKA 4NFHA 3EY4A 3TD2A 1UKCA 4J6EA 5AYVA 3BKWA 2IYOA 3FRJA 1E4VA 3HP4A 1Z47A 1VG9B 1MC4A 2NU7A 3NALA 1G2QA 3D3JA 1QOPB 3ABSB 4RPLA 4WXRA 3RH0A 4LNHA 3KL2A 1OXMA 4BFTA 1ZEMA 2XT6A 3TW0A 5IJ0B 4U9IS 3V1TC 3AWDA 3UAYA 1U3VA 2QLTA 3PFNA 4DCNA 4IDAA 4M1QA 3FHJA 3QUTA 4PYRA 1WZIA 2VHYA 1J0DA 4P80A 1KOGA 1U1GA 3TCKA 3GJ8A 3HY4A 3WWZA 2VBIA 4HAOA 3NNDA 3OUTA 3DLCA 4NOLA 4D44A 3LTEA 3CEPB 2OXEA 3II6X 5IAKA 2GEJA 2SNIE 2BGUA 5SZIA 4PGMA 4KVFA 1L5RA 1WB5A 4J7UA 1T0IA 3H1EA 4JB0A 3OOSA 4WX2B 1NJ1A 3QU7A 4Z8YA 2GEFA 1SC6A 2HA2A 2EJWA 2ZR7A 1EESA 1S8OA 4BIIA 3R74A 3SIRA 3GFQA 1FDSA 1P0FA 2OZKA 3KYDA 3SBDA 3QE2A 3BN3A 4AK9A 3MS7A 1IY1A 2ZIXA 4NS4A 1CYEA 3HYSA 3BWDD 1E9BA 4MVXA 1EDEA 2PS1A 2UDPA 3EQ9A 4M7PA 1N8SA 4XAQA 3OT1B 5JDCA 5TS3A 1PK9A 3DZKA 3H5OA 1O95C 2YFKA 1E1CB 4LRXA 4M6WB 4MEBA 1II0A 2A9PA 1MQ8B 1R8QA 3HS3A 4G3XA 5FOTA 5BNZA 2AC4A 1BDJA 2X5XA 3GCGA 3JCZA 3R3JA 1I3MA 2AUMA 4PZ0A 1H85A 2R3SA 1SUPA 3AGQA 1W52X 4L15A 4QM6A 3DDCA 3R3HA 4EHNA 1JMYA 4Y9UA 3DCNA 1GV0A 3RSHA 3USES 1FNSA 4RWZA 3RYIB 3HBNA 5KU1A 1DWUA 1K0UA 3RS0A 3UQYS 1LNSA 2UUAB 2W8ZA 2X7HA 1YBVA 4PONA 3BRWD 3WRYC 4HGZA 1ZIXA 3HACA 3HBLA 3TTWA 2WJ4A 4EYOA 4L0QA 4XYGA 1UJMA 2MYNA 2P40A 3B5EA 4RY0A 3GMDA 4YJDA 1OHHA 2HSWA 1FNBA 3KQSA 2ENWA 1GITA 2IHVA 3V34A 5HHTA 3EOZA 3GUZA 3KT8A 1E2UA 2XZDA 5L8VA 4OHPA 2IPMA 2YRWA 4ALLA 2Z43A 4DOMA 3O3OB 4E21A 1KH3A 1ODCA 4UEWA 2IZ0A 2R6FA 2Z04A 4GXQA 4AMUA 3FF1A 3KZMA 1REQA 3H0CA 1M1NB 1QRRA 2R6HA 2BZSA 3MLEA 4DYDA 2DWPA 1LBQA 1U0EA 1GNRA 1CNEA 3B3FA 4JMPA 5AIBA 3KQLA 3NXKA 2CLIB 1NP3A 1YZHA 4Z3KA 2VJOA 1H3NA 4C6HA 3P9XA 1XFDA 2OSVA 4R71A 1Y3CE 1DC8A 1GUYA 3R7WA 3U6KA 3KKLA 1LV8A 4BWGA 3GU3A 1UC8A 4KX3A 3DOUA 4RLHA 4DEVA 1HLPA 1X13A 5JXWA 3QXGA 5CUQA 3KR1A 5JWRA 2ONKA 2ZCUA 1T9ZA 2JIOA 4DA6A 1HNZB 2GDJA 3AKCA 3H2SA 5FPPA 3TINA 4B3TB 3E9ZA 3U4MA 1N2BA 1CERA 5AHWA 1K6IA 1SKQA 2OBMA 1NRIA 2VYVD 2R6ZA 4DQUA 4NDAA 1IBKB 4G85A 3GPCA 1H8ED 1R6BX 2I4MA 1CUYA 3A0UA 3N3BC 1PT9A 4GQBA 2F1OA 5B6JA 1D1PA 5EGSA 1XZPA 4O8ZA 3LH5A 3P9SA 1JNYA 2R6AA 1S2NA 2QZSA 4WOKA 4O2BA 1CLUA 2FSHA 4IO1A 3ZD9A 4JGIA 4D0RA 2CLSA 3JV7A 4AQYB 3Q6MA 1L4NA 1A9YA 2GJAA 4IIJB 1ZL0A 5ALRA 3M34A 3IERA 1HLFA 5JSZA 1O97D 4ID9A 1LS1A 4MB6A 1UKYA 4JBIA 1GZ5A 4KPGA 4OFBA 1N92A 3NIDB 1CG6A 2FG6C 1IDOA 2VCHA 4ND2A 3AP2A 4Z1MD 3N7TA 4KV7A 2D0IA 2EKQA 2FK8A 4I5GA 2PHZA 2PAAA 4CNQA 3EIXA 4RSRA 3I64A 2F8MA 1Z5GA 3PD7A 4ZEWA 1GG2A 3JQFC 4KXWA 5HUJA 3ZCXA 3NTVA 2V8OA 1YTLA 2VUTA 4FDMA 2HIAA 4J0EA 4E22A 1QHHB 4RVHA 4TXJA 1DP4A 2QRJA 4L3OA 4ZVVA 5BVGB 3I83A 1F12A 2NTYC 5AD1A 3BERA 1CJSA 2ZBUA 2MR6A 3IT3A 5JNLA 1N3LA 3GRUA 3DVAB 3IBTA 2PR7A 5COAA 1RBQA 1KE2A 1KK3A 2FPPB 3HRIA 3LKBA 3GPIA 1M2NA 1OW3B 3W6UA 4NJMB 1B1AA 3JY6A 4GXRA 4WBSA 1MOQA 1YK0A 4J43A 2I6UA 5A9SB 1ZG3A 2YWXA 2J7PD 1OU4A 2AG8A 1S1CA 2BUCA 1K0FA 2RGDA 2W93A 2ZRKA 4V3BA 2HNBA 3RFTA 4KO8A 1Z06A 4OG2A 2H7CA 2IW1A 1QJ4A 2YXDA 4YWJA 4J2TA 5C8YF 1BYIA 1IK4A 3GA5A 4GDMA 1XQ9A 3SKYA 5F2NA 5JC8A 4B3BA 4KNWA 3ZHCA 2H8KA 3OZCA 4G8JA 4YB8A 3PE4A 1XVIA 3D2CA 3QX9A 1FX0A 1RWXA 4IV8A 1ZCZA 2GYUA 4XIJA 1NVUQ 2GKGA 4NMLA 2GPBA 2V7QD 2XVAA 3N2LA 4V0MA 2Q1TA 5D3MA 4Q00A 4LFBB 1M6NA 5A1TA 2BFNA 2O0LA 3ELDA 4KQIA 5FFNA 2QLBA 2VPZA 2YL2A 1PVVA 3FLEA 3N0XA 1DRWA 3VC1A 1HFJA 1NUHA 3DMNA 3SDBA 4DDMA 2D8AA 2R47A 4CF4A 1YSCA 3AM5A 4XGIA 3JX9A 1K89A 4H0CA 3PB3A 2GCOA 1PGPA 3DDNA 3KYCB 2Y1WA 4J76A 5AKLA 4NE7A 1MRNA 3PPWA 4ATNA 5JNWA 5BNFA 1KNQA 3AJ8A 2WYVA 3DOFA 3C6ZA 3JQAD 3P9IA 2WWWA 4N0DA 4OMFG 5F4BA 2A9KA 5C0OE 1TO2E 4LZJA 3MD9A 3DTYA 5A6SA 4JGGA 2O5RA 4WCFA 4Q4JA 3S5JA 2YHUA 5BR4A 2JK0A 4M87A 2VJCA 3ESBA 5FA5A 2ANCA 4CT5A 2YOGA 4P5PA 2QF7A 2YX1A 3C3KA 3MTAA 1HY3A 3GUVA 3OFSA 4LC9A 1SA0B 1EQUA 1SBYA 1F4LA 1VE1A 4ZI7A 3RAPR 3B7PA 5DSXA 1Q0HA 3DV9A 5AQEA 3U7RA 4BGIA 1RXCA 3DAHA 3ILXA 3AI2A 2YWRA 1GZVA 4UQPA 1NPTO 5DNWA 4ARZB 1GO2A 4Y6LA 2KPOA 5HFJA 5CMLA 3ZY2A 3OMLA 1I2ZA 1TQ8A 4JC8A 3I5UA 3N2IA 1T5LA 4YQZA 1NFQA 4X1KA 3HI6A 3I72A 3QI7A 4R2MA 3X1DA 2Z5LA 4GAEA 1JHMA 4TT8A 4K81B 1RW4A 2M6LA 1MENA 2QHXA 2I6GA 3IPYA 4KWCA 4OEHA 1DMSA 4JUDX 5G0VA 5K3SA 5LZ5A 1SD5A 2ZJBA 2ZK7A 5K4HA 1QIJA 2OKGA 1AX9A 2VQDA 5AKGA 3PHGA 1JG6A 1JKJA 2UXBB 2ZIFA 2P6UA 1P6XA 2FR8C 1ILWA 2JKZA 1P91A 2J32A 2VHWA 3BSFA 4A4DA 4ZVLA 4EGSA 4HPJB 2NYRA 3L0PA 3TTTA 1A9XB 1SGWA 2R7KA 3D6UA 4AP5A 2X2OA 5HZGA 5ITZB 4AL4A 5AI6A 3DDOA 3BXFA 2QRVA 2IVZA 1UBOS 4R9UC 4BEJA 2B8NA 1RQRA 4XD7A 1XNHA 3TLCA 3IP7A 1Q21A 4UKDA 4NXMB 2YIVX 1TADA 1SELA 4HVTA 3CU5A 3G7NA 3MBOA 4HDQB 4WLUA 2YS7A 3ROZA 1DGQA 1PJTA 2A9VA 3GLGE 3IOBA 4HYTA 1W36D 3PD1A 1TKAA 3T5GA 3GN1A 5K3CA 3HFRA 5DNAA 3NBXX 3U4QB 2XTMA 3B3JA 1RBMA 2JEZA 5DI3A 1CRWG 3KZVA 1EHIA 2IV3A 5EE9A 2IDMA 4NZNA 4XZ3A 3FIJA 4PX2A 4Z3OA 1WZEA 5DULA 3TJRA 3LO8A 2ZUCA 5AK0A 3UAXA 2C9CA 3QV2A 4RMJA 1TYEB 3FI9A 3QEMB 4ARAA 9LDBA 3TXXA 5HG0A 4B3SB 1MBZA 3LT5A 1CY2A 3AWIA 3EZFA 2A0YA 1L4KA 4X9XA 5T3UA 3RR2A 3RTGA 2HPZA 4M46A 2JIRA 4WK4B 4XDHA 4CM8B 3SYNA 4B76A 2AMYA 2JATA 3QU4A 4JJ7A 4IWXA 3VHLB 1Z82A 1G20A 3ZHOA 2FPWA 4KN9S 1D4OA 1ZS9A 2Q1SA 3EISA 3VR3A 5B5SA 3TUJC 5IVIA 1A9SA 1GLGA 2UAGA 1NMYA 2EW8A 2ZDQA 1V25A 2WYIA 3I01A 1ZZGA 3PYLA 4G1UC 2J7KA 5DX0A 521PA 3ZCRA 4AO7A 4IHJF 3D0QA 2D00A 1IUNA 2H5JA 1SKMA 2FQYA 4ZI3A 4YCAA 4BKRA 1GQSA 1UFQA 3HZZA 1F5SA 5BSUA 2YVLA 3S7TA 3TOSA 5H7XA 4RIHA 5BUCA 4MCAA 3E4CA 1YS7A 3F47A 3MTBA 4IIEA 4BCCA 1WB9A 4KK3A 5KNCA 3WSWA 3ZZ0A 2EKLA 4C3ZA 3R5SA 4HNSA 3K1TA 5FNVF 2O5VA 4PO3X 3RVKA 3V5NA 4EG3A 1T36A 3MTJA 3MAJA 2N9UA 1XZAA 3BK2A 2EFHB 1HA3A 1UJCA 2NWQA 3IAS6 2KBEA 3BFVA 4BO5A 3EVDA 5E4YA 4EWLA 4M60A 1P60A 3TSOA 4P34A 2CHGA 4Y67A 1YJBA 3O1HB 1O96A 2BKLA 2GZHA 5FV7A 4LHSA 4CI0B 4LF5B 1GT91 2FEMA 2HA6A 1MC8A 2M98A 2NO4A 5IK2A 1HFEL 3IMFA 5K03A 1EDZA 3ZWWA 4Q9DA 1RMTA 2VEDA 3L7IA 4QTZA 5LNK1 3C3CA 2TYSB 4QELA 3BXOA 5CRIA 2NVOA 4AURA 3IAHA 2R6R1 2WSSA 1VPLA 4D45A 3E9QA 3VZDA 2C7VA 1FRNA 1KXZA 2VDPB 4ZQBA 3CB2A 4KVAA 2GRUA 5HF8A 2R60A 4RY8A 2ALJA 5CDTA 3OLYA 4YHHB 2NTNA 3I1YA 3VR6D 1DAMA 3CZCA 1VP9A 1SB8A 4WZAE 4GX1A 2ODBA 3T5BA 4YGXB 2A1IA 5T6MA 4J94A 2QUAA 2ZPTX 4DNXA 2WJZB 4NH0A 4CKZA 2FQQA 1EDOA 4S1NA 2R00A 1VE3A 4LGYA 4WUVA 1G6KA 2HPVA 2CBGA 1KZHA 1NE2A 3KSZO 4OB8A 3T9AA 2ZJFA 3PC2A 1A5SB 1N2EA 3E27A 5HUHA 2CWWA 3PX2A 3QLVC 2DPGA 3UBTA 3CO0S 2CNOA 2RGEA 1QXSA 1YJXA 2B35A 4WKOA 3E3LA 4TLCA 5E9JA 1IJEA 4X41A 3N39C 1JFSA 2CJYA 3AUYA 1U9JA 2FB9A 1K06A 2PRZA 1GKLA 4YROA 3AEKA 3WNDA 3ETJA 1NBWB 7ABPA 4CV1A 5CCBA 4QVGA 4B43A 1LDYA 1TEZA 1E5TA 2IHJA 2PH5A 2BFBB 1YZNA 3N58A 3O6VA 1CZHA 4KDCA 3IOMA 4Q5IA 5P21A 4V1CA 1O8CA 1C0PA 3DR5A 3ZW7A 2XZOA 2RAUA 4QXQA 4IXDA 1N2HA 1U2ZA 3D7KA 4LK3A 3BE8A 1ZXXA 3I0MA 3JAMA 2QAGA 1E92A 3L6CA 5FWXB 1F8YA 1BGWA 1CQIA 1NYQA 1Z6GA 2A0WA 3B3QA 2GF2A 2DVMA 1P31A 3MZ0A 3VKHA 3D54D 3RV4A 4IEIA 3HYNA 2AK2A 4LYGA 5AM0A 3H2ZA 4JHXA 5GVSA 2Q5OA 1AB5A 3KKQA 1NQWA 4EUNA 1C7RA 5IKEA 2OYRA 2X8LA 2AS0A 3U49A 1Z15A 4ER7A 4S12A 5EHXA 5LQRA 5IG2A 3GRFA 2F67A 1R15A 3U7FB 3EGCA 4JL8A 4AYTA 1NYRA 1R4NA 3BIJA 2O7QA 1DO8A 1MO3A 4N3AA 3RO7A 1KS2A 4B4DA 1WBJB 2Q2WA 1U8CB 4JFAA 1ZI6A 1J5PA 1H1LB 1LTKA 2PT9A 3IMEA 1NR1A 4RSHA 3UWKA 3VMFA 4CM6A 1IN7A 2Q6LA 2PH3A 3OKFA 1OZFA 2OV6A 5LQAA 3I62A 3IDFA 4MOWA 4R3NA 3A3OA 3WK4A 2OCIA 1SCJA 2WU8A 2AC2A 2CNWD 2AGVA 5K3AA 1E4OA 2I2DA 5EE3A 5FI3A 3UJAA 4D92A 2FPUA 1AUVA 2ZRQA 3IQWA 3LS2A 4FYXA 4OKSA 2V6GA 3DHWC 4LECA 3WFZA 3WK5A 4BO1A 3EZ9A 2O2EA 3VPBA 3QWFA 1W76A 3GJQA 1FUIA 1VPVA 1EP3B 3CLSC 3ZZ1A 1F6WA 1IN5A 2E82A 4KO4S 1PFUA 5FLEX 4URVR 3X43A 1KETA 4DUGD 4E03A 4MUNA 5HA5A 4U7HA 3AFGA 4OGGA 4Y8VA 4BV8A 2VAVA 3BD9A 3SXUA 3LUDA 5FTMA 4Y6PA 2WSMA 4BX8A 1NR7A 1E2LA 3PF9A 3E7PA 3JWHA 2FFJA 3QG1A 4M1MA 3N2NA 3SJBA 4C4XA 4WNAB 3L7LA 1Z8NA 2A35A 2ESRA 1QG2A 1BU8A 2R5WA 5DMXA 3K6SA 3DVAA 3TXAA 4B3CA 5BNTA 4IJUA 2XWPA 3O0TA 1GR0A 2W43A 1I0ZA 5AM4A 1C80A 1R8XA 4W7HA 5TDHA 1TMYA 3NHZA 5KQSA 3HUUA 1MABA 4B82A 2QEQA 1B0UA 1CFZA 1KMNA 5JALA 2OILA 2QRZA 4QU9A 4DBLE 5JXIA 3K94A 1X2EA 2F1IA 1NBEA 2AW5A 2BDUA 4I81A 4PZCA 4CEIA 3H42B 1JSXA 1UH5A 3PPVA 2IXEA 4AKEA 1PV1A 5BQFA 1Z36A 1FYFA 1CWUA 4JIGA 1YZYA 4R3WA 3TW8A 4NF2A 1UANA 4XWAA 1D03A 5EJEA 3PFBA 4LC0A 1MH9A 4C6SA 5CA1A 1AGYA 2Q4DA 5E3JA 3BGDA 1Y8QA 4BZQA 5KPJA 1JKJB 4ZAFA 3GVIA 3ON5A 4TL6A 4L16A 5GMOA 3OQIA 3EXG1 3V8RA 1AA6A 5DHFA 2NUTB 1ZUWA 2C3YA 5ENVA 3VSBA 1NI4B 4NQZA 4LRWA 3CWCA 4JXJA 4HY3A 4XVHA 4B6OA 4DJAA 4DLTA 1L5YA 3RJMA 3V2HA 3LZCA 1ZA1A 4B31A 1XWIA 2AFVA 1V5FA 1LW7A 1R6TA 4HD8A 2X5NA 4BFUA 3S5UA 3M4NA 4MV5A 2HMWA 4RMIA 1CDDA 2PGXA 2XZTA 4R05A 4B6JA 1QMGA 2D2VA 1DBIA 3Q7EA 4QLAA 2H3EA 4DCGA 1YDMA 1QPZA 3NRJA 2JGAA 1KY3A 4R8SA 5EEGA 2PLFA 2HWWA 1RRKA 1BXGB 4FONA 3DG9A 4QM7A 4B6FA 5I7FA 4TV8B 2O57A 3OZWA 2UUPA 5J2TA 1PNTA 2V1XA 2GK7A 1NY6A 1R18A 4KOAA 5CM9C 3AB7A 3T95A 3TQIA 2SKDA 1XQXA 3U3OA 2Y76A 4NXNB 3VNBA 2IY7A 2J5XA 4INOA 1E6EA 3Q8LA 4BKUA 4N6OA 4IGIA 3RVQA 1LRJA 2B78A 2Q9AA 4HX2A 4NH4A 3RVJA 2ZM5A 3KQPA 4PAQA 2LIVA 4QATA 4RVSA 1E99A 1X19A 2W9XA 4G09A 3KD3A 3MSXA 3WGUA 4EMBA 1AHPA 3M6UA 4OH7A 2SKCA 5DYTA 2NQTA 3MJFA 1CY0A 4A8PA 5KO2A 1I7NA 4UBLA 1DJLA 1PQ4A 2H9YA 4CIBA 1ZIYA 2BISA 2W6OA 5TQ0B 3NM5A 2YRXA 3HB7A 1QV9A 3MCTA 4GE3A 1ZK4A 4TKUB 5EIFA 1K8YB 4MVJI 4XI9A 1DC3A 4RABA 4QJ3A 3OHPA 4DWVA 1ZLXA 3A37A 3ORFA 1N5KA 1XMJA 1N75A 4RF4A 2QSUA 2ZAIA 3RS3A 3DPIA 3FWZA 5L3QB 4EJMA 1YR2A 3O0DA 4R40A 3SFVA 1T8WA 5J4VA 3A1SA 3FLMA 1I1OA 1NTOA 1JV2B 1RQXA 5DHQA 4YI3A 4B80A 2CYBA 4YUYA 5AVVA 5JPCA 1PW7A 1JILA 1NXVA 3VHRA 4F8YA 1QFZA 4IG4A 1KAEA 1SN7A 4M1YA 3CEJA 4OFXA 1GAXA 4PPYA 2HUPA 1SVWA 3OMXA 4JLDA 5EL0A 2CBZA 1IZ8A 3CZ4A 1KVQA 2G5TA 1SC1A 1G3RA 2NW6A 3PQ4A 4HS9A 3THRA 4F7WA 4AKGA 1SXIA 3G68A 3SC6A 1BMFA 3EWIA 1YJQA 4MWGA 3LOQA 1ISRA 2ILTA 3AY3A 3FFBA 3H18A 1WZCA 3E5MA 3RT7A 3VPFA 3FFTA 3ROGA 4EYQA 5IVPA 2I2XB 3BMNB 3I04M 1A27A 3MLAA 4W4TA 5A4IS 2QU8A 1XD2B 3LCJA 1DIHA 2EIHA 3L79A 3TS1A 3K71B 3PJRA 1SD1A 3S0JA 3SOZA 2GEKA 4DTCA 3WLIA 3IT2A 1RHQA 4DLVA 1N6PA 2CHQA 3U1TA 3K73O 3OE1A 1RR6A 5DLDA 5G53C 1KVSA 1JEJA 1PRYA 3EAQA 1JL3A 1JPUA 2ZJ2A 2QG9A 3C7DB 5LLSA 5AVYA 1KZ1A 4JMLA 4OM8A 4C07A 1JTFA 1L3IA 3DE6X 4JDPA 1QYRA 3LX5A 4E4YA 2QP9X 2QT9A 3CN9A 4AUKA 4BGUA 3U0BA 1SUWA 2QMUA 2Q4TA 3HUFA 4S0ZA 3VVLA 4HV4A 5LQMA 2M2IA 3SS7X 2WOOA 4AU1A 4HH3C 2XODA 4Z4FA 1OI4A 3KSDO 5K3EA 1WDKA 4G0ZA 4BVAA 1Z2PX 2VPWA 2YJ6A 1RWMA 2PZMA 2FFQA 3AEKB 3GFVA 4BMSA 2RFLA 3NVAA 2GTPA 3EJ6A 1IAVA 4QEKA 5SYAA 2BFBA 3E05A 1ISSA 1JU3A 3FLAA 1TO6A 1U9YA 2HBQA 3NIBA 4A10A 3L6BA 3RCBA 5TLSA 2NZUG 5B53A 2Q6VA 2F7SA 1G8MA 3J7TA 1YC2A 3E7DA 3SSMA 5HK9A 2E5LB 4UTZA 4GUDA 1A2KC 3H5VA 4BFYA 1T0UA 3DC2A 1PZGA 2G8LA 4M0FA 4OF4A 4KRGA 4BNKA 1Q0TA 4J0GA 4EMSA 1BE6A 1UR5A 2M9MA 1KEPA 1GRQA 2OP0A 2QV7A 1JQDA 2ZI7A 3MQFA 4MDYA 4C0LA 1KAHA 3G7UA 4JJEA 1WE2A 3FPCA 5KSPA 3HV0A 2Y1EA 5BVHB 1CZRA 1DMRA 1GPWB 3KQYA 3PLRA 4HEHA 3RTBA 1TVMA 1Z7YA 3STXA 3WJ1A 2FDCA 2X42A 3CYFA 4L9SA 3NTRA 4Q7MB 4NI5A 4HWSA 4G5XA 4RHCA 3PUWA 1SC3A 5IJZA 2ZANA 2OT3B 4B35A 4F96A 4AC9A 1NNEA 1R6DA 4TTTS 5KSZA 2ZR9A 1HBJA 2RGNA 1J8VA 5F4ZA 4DVGA 4MS3B 4QEZA 1O6FA 1IEWA 1PUJA 1T24A 4F11A 2R68A 2YXPX 4LVOA 3KOOA 3WLHA 1XBTA 5REQA 1VXRA 1ISFA 2DR0A 3K1YA 4ODIA 4UCQA 2W5UA 3C3BA 3CRZA 4I99A 5BWBA 2XRZA 5DTMA 3WY9A 4UXJA 3SM9A 4F84A 4BNWA 1ZJWA 4MMXB 3DZBA 3CXUA 1CQWA 1WQ4A 2Z09A 3R2JA 4RH0A 4Y9DA 3T1HB 1MC1A 1OYYA 4B8ZA 1EEXB 3H4TA 1XDGA 3NTXA 4FGLA 4JJGA 2ZI6A 4BNUA 2Q6TA 1VBNA 4FMCB 1ZK1A 2ZSKA 2GZ3A 1TCUA 2OK8A 2IHTA 3B1VA 3C3PA 5TE9A 4RPIA 3QVGB 4D5GA 3NYWA 3HO8A 1NFRA 4RPHA 1NM5C 3QFCA 4RK6A 4M9CA 4YQEA 2ZT6A 2PWYA 2V6IA 4EW6A 2A58A 5AUOB 1UPBA 2ECOA 2SCUB 1HM5A 3G02A 4Y7DA 5J43A 5AKXA 5J3JA 4K6CA 3HM9A 5HIIA 3JVVA 4WNAA 5F73A 3FCAA 2C2HA 2OK7A 1PR6A 2J3MA 4LX8A 1CQPA 4QL3A 4WE3A 5AVJA 1J21A 2QIOA 1OLSA 5CW2A 5BUQA 1ORHA 1NBMA 1GXSB 4RM3A 2Y2VA 1BE0A 2XUZA 3MOGA 1JXMA 3KE8A 3K9HA 3C39A 4PBTA 3UOWA 1YUBA 1GNVA 1ZXBA 2RGXA 2VATA 4EF4A 4EELA 1DI0A 1EEHA 1MABB 3N87A 4U7PB 1DRUA 4KO2S 4W1SA 1PBNA 3ZY3A 1KQ3A 1DDGA 1YIAA 1FNDA 1T9KA 3KHUA 4FGSA 3RFUA 2PO5A 1CU1A 1UIRA 3NX4A 2ZSEA 1BVUA 2PRSA 4A6DA 4BNNA 1DRVA 2GRJA 2JFQA 1ZH8A 1DRKA 3FOWA 4DUYB 3ZDCA 1J0EA 1XOIA 2GK3A 1ANKA 1HDEA 7YASA 1IXYA 3EBPA 2AJLI 2CFOA 2WYOA 1WR8A 3NWOA 1H9BA 4QUAA 5HX7A 5LQDA 3HU3A 4UUMA 2X58A 3CMMA 3LQ1A 1IUPA 1H2HA 4CETA 4NBTA 3D4NA 4QQNA 6NULA 5CDHA 3AVOA 2CLMB 1L8AA 1QAOA 4P0PB 5D8DA 3TSWA 4HTAA 2NUTA 4XWWA 1MX9A 1COWD 1RJEA 2C3UA 2Z6VA 5K1ZA 4IJVA 2FWIA 5TGTA 1DO2A 2J67A 1LQUA 2V7UA 3UUEA 4YMLA 1JX6A 1UWLA 4D41A 3KV1A 1G0NA 2Q1WA 3FVTA 3ZUGA 2EBHX 3GJ5A 4TX1A 4Q3DA 1YZLA 5IBCA 5D6OA 4P7FA 3WISA 1AKYA 4BAGA 1J8DA 3OO1A 4RL6A 5JBQA 1OZHA 3MWGA 1DBWA 4QJ4A 4XGRA 1I2MA 4EQ6B 3WYDA 1VYUA 3M1AA 1R10A 2AOTB 2DPYA 4NPAA 4RKFA 5KQMA 5AOCA 2QGNA 3L8EA 3B2EA 1F48A 3WMXA 3GDGA 2GNPA 3HA5A 2V58A 1DKUA 2AJ8A 2VP9A 3G5UA 3KD2A 5E0OA 3UV7A 4A6PA 2IBSA 2V6MA 3ROXA 5DGDA 3O5AA 3H8WA 4CM4B 3QPVA 5SYMA 3W5AA 1P4SA 4B7ZA 3SWWA 3GG9A 3ER9A 1E32A 1TJNA 3JQFA 4CMGA 5AM3A 1RYYA 1IBRA 3OEHA 4QPPA 3WQSB 4JI1B 3SMQA 4QDUA 1XZJA 3STYA 2GRAA 4EKGA 4U2CA 4EUSA 5AW1A 3WAGA 5ALZA 4ZOLF 4L02A 2RK6A 3SDZA 4RFVA 3CRW1 3F49S 4D3XA 4MHSA 4QPNA 1BOOA 1YGYA 3HZRA 5UKDA 5KSWB 1EFRA 4OP1A 4QNMA 3HDJA 1C9MA 2Q5QA 3LDUA 3R0JA 4U3JA 4XVCA 4WCDA 2IWHA 1CIPA 5C7LO 3W6NA 4NZZA 2IYPA 5BT9A 1NI4A 1W4ZA 1M6YA 2KSQA 3BAFA 2JJ1D 4O6VA 1NBIA 4AY4A 4LOAA 3C1UA 3A4LA 1OR8A 3WO1A 4HFJA 4NTZA 1XELA 3D7MA 1II9A 2C9ZA 4YO8A 1QGDA 3UAZA 1EFPB 5L3QA 1O5IA 1IVYA 3EPPA 4HUJA 1Q6ZA 5EJIA 1YNOA 5U9CA 3M0EA 4UVIA 1OA0A 2F59A 3KB2A 5J5CA 1WKBA 3T1YB 2ZREA 4CU2A 7AT1A 1KI9A 3AJEA 2Y8EA 4RK4A 3K9GA 2D5IA 2QMQA 4J2HA 3VR4H 4KJZA 2VAXA 4B47A 2V1UA 4JB2A 4HWPA 4R1PA 4CXMA 3DM9B 4P5EA 2ACKA 5F76A 5JARA 3K0SA 4YRAA 2JGDA 1SG9A 2FZEA 5JBIA 1RP7A 3G13A 2E4WA 4WLOA 5JTUA 3L4BA 2X22A 1Q0LA 1GEGA 3ICOA 4H7EA 4DV5B 4FFVA 2CBXA 4RPJA 2QX7A 2VK8A 3HY6A 5AK3A 1CDOA 5HMLA 2NU9A 2B1JA 4RTMA 5HUQA 3GQVA 1R0RE 4V2IA 2ZYGA 3RVLA 3OICA 3IAM6 13PKA 3D3WB 4QUJA 5LB4A 2I62A 4E07A 1Q91A 2VHCA 5JQGB 1RNLA 3G8YA 2BIFA 3KXKA 2QN1A 4YQFA 3DUWA 3UJ3X 1GNQA 1C29B 5T4HA 3A1EA 4WY8A 3R7BA 3PQ5A 1RCUA 2O5CA 3ESCA 4A2WA 1U7WA 4P6VF 1SM4A 2IUUA 3CX3A 1XJ0A 1ONPA 1CHDA 3I0NA 3Q2OA 3AF3A 1IATA 3LY5A 4XSGA 3GEBA 3KC2A 3FG9A 4NAVA 1HNWB 2JBWA 4Q3KA 4P86A 1U2TA 4DV1B 4AP9A 4DZZA 2AT1A 3AF1A 3P2MA 4ZHSA 3UK7A 1M67A 1Z17A 4YRDA 5JANA 4GMFA 4LX0A 4RHTA 1BA2A 4ENTA 4HDMA 5JNVA 4PX3A 4D9JA 1E7WA 2Q27A 1JSCA 5BOSB 4Q7EA 5AXCA 3QTTA 5IUNC 2ANBA 1E63A 2ZWVA 5A5FA 3N8IA 2HX1A 2VQSA 1J7JA 3IBYA 5BN1A 1LF5A 2IIPA 5BRNA 4DMFA 2D1RA 3HCPA 2BBSA 3TZ6A 3Q9NA 5LBIA 1I24A 3IR5A 3OCWA 1XQYA 2WV7A 1F2UA 1QIKA 3E0XA 1Z0UA 3NBFA 1P7WA 1KO4A 1CRLA 1V16A 1V9LA 1WMAA 3BJIC 3EWSA 3PHHA 1UJNA 5EJ6A 1QP7A 1GA4A 4MWEA 3KPYA 1Q77A 4HFRA 5C46F 1WHTA 4NCBA 1N9GA 1MV5A 4I14A 4Z7NB 5BW5A 1N0HA 1BFKA 5EYPA 3QEJA 5C4MA 4ACAA 1JIXA 2V65A 4XDZA 4X65B 2P4SA 3TTSA 4G0NA 3HJAA 2Z6QA 1R8JA 3KTDA 4PFKA 2AD5A 2Q2VA 1C0KA 4JCOA 4NEHB 1ZVKA 4J0QA 5ED4A 4MNTA 4UHBA 1CVRA 1K68A 2P9GA 1C81A 3CLRD 1XKXA 4YRPA 3VNQA 5BV8A 1E3QA 4XFDA 4TRRA 3L9XA 3M1LA 3SX4A 3VO8A 1WWKA 5IJWA 1PGNA 1XTKA 3BK1A 4ZYYA 1PNRA 3WR5A 1X7ZA 3SOPA 2FSVC 4HRXA 1NMXA 2J9RA