1C3QA

Crystal structure of native thiazole kinase in the monoclinic form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
284
structure length
284
Chain Sequence
MRGSHHHHHHGSMDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLSKESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAHTVGVTDWLIKGVDAGEGGGDIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGCLLTSVVGAFCAVEENPLFAAIAAISSYGVAAQLAAQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 4-methyl-5-beta-hydroxyethylthiazole kinase from Bacillus subtilis at 1.5 A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Hydroxyethylthiazole kinase
total genus 102
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.7.1.50: Hydroxyethylthiazole kinase.
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02110 HK Hydroxyethylthiazole kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1c3qA00
1YHJA 4S1HA 3NM3A 4KAHA 4N08A 3RRBA 5TRWA 4KANA 2I5BA 4S1MA 2AX3A 3QAIA 3RSFA 3UQ6A 1RFTA 4C5NA 3RRFA 2A9ZA 2QHPA 2ABQA 2RBCA 3HPDA 3NL6A 1ESJA 4X8FA 3W4SA 3IQ0A 1VK4A 2AWDA 3RT7A 3DRWA 4E3AA 3RQ6A 2DCNA 3QA2A 3B1OA 3IE7A 4XF7A 4DC3A 3RS9A 3GO7A 3K9EA 1V19A 3B3LA 3RQXA 2I6AA 3B1QA 4EUMA 5BYEA 3RTCA 3LJSA 4O1GA 1KYHA 5CGAA 1JXIA 3FHYA 4KBEA 3B1NA 1UA4A 1YGJA 2HW1A 1VI9A 3I3YA 4LCAA 1YGKA 3RQHA 1V1AA 1RKDA 4KADA 1TZ6A 3N1CA 5C41A 2AJPA 4EBUA 3GBUA 3LHXA 3RY7A 4K9IA 3DZVA 3K5WA 1TZ3A 3RTEA 3KZHA 5BYDA 4LBXA 2JG5A 2Q5RA 5EYNA 5CGEA 5B6AA 2AB8A 3RTBA 3Q1YA 4KALA 1V1SA 1V1BA 4N09A 4YWRA 3RREA 3IKHA 3LOOA 4UBEA 1EKKA 1TD2A 3FHXA 3RS8A 3RQ2A 3UBOA 2C4EA 1LHRA 2ABSA 3RRJA 1RK2A 3UQ9A 2FV7A 4K93A 3NBVA 5C3ZA 5BYFA 2VARA 2PKKA 2DDWA 5COJA 1EKQA 2PKNA 3RQ8A 3RSGA 3VASA 4EOHA 2JGVA 2F02A 4JKSA 4E8WA 2PKFA 4YL5A 4K8TA 4C5LA 3GO6A 4E69A 2I6BA 5CM5A 2PKMA 4E8YA 3Q92A 3RQ5A 2R3BA 3H49A 3IBQA 2DDOA 4C5JA 5BYCA 5F0ZA 1LIJA 1ESQA 4JJPA 3IN1A 4DU5A 4LC4A 3RTGA 3RU3A 4XCKA 3VAQA 1RFUA 4XDAA 1RFVA 3LKIA 1LIKA 2AFBA 3IH0A 3OTXA 3UQEA 4WJMA 5TQIA 2JG1A 3RT9A 2V78A 3MBHA 4GM6A 1GC5A 3NL2A 2YXTA 3PZSA 2QCVA 4PVVA 4K9CA 3RSQA 3RU2A 3MBJA 4U7XA 3HYOA 3UMOA 5C3YA 3KEUA 1L2LA 3BF5A 3PL2A 4JKUA 5EY7A 1LIOA 3KD6A 1RKSA 4O1LA 3RSSA 1U2XA 2YXUA 2F7KA 3CQDA 3RPHA 1BX4A 3NL5A 3ZS7A 1WYEA 3NCAA 3RPZA 2NWHA 4S1IB 5C40A 3KTNA 3HICA 1RKAA 2HQQA 3RTAA 1GQTA 1C3QA 3BGKA 1UB0A 2XTBA 4B8SA 3JULA 3RTDA 3NM1A 4K8PA 4LBGA 4K8CA 4S1IA 2AA0A 3UQDA 4C5KA 3NBWA 2C49A 2A9YA 3H74A 1JXHA 2DDMA 2AJRA 3NC9A 1DGMA 4E8ZA 3RQQA 3B1RA 3UMPA 3NC2A 1LIIA 4K8KA 1LHPA 1VM7A 3B1PA 4B8RA 4E84A 3NL3A 5F11A 2R3EA 3EWMA 1TYYA 4XF6A 4C5MA 2HLZA 4EN4A 3RM5A 3RO4A
chains in the Genus database with same CATH superfamily
1YHJA 4S1HA 3NM3A 4KAHA 1O5ZA 4N08A 3HJ6A 2Y66A 4KANA 2I5BA 4S1MA 2AX3A 3QAIA 5TRWA 3RSFA 4CVMA 3UQ6A 1RFTA 4C5NA 3RRFA 2JFGA 2A9ZA 2QHPA 1UAGA 2ABQA 2RBCA 2UAGA 1ESJA 3HPDA 3NL6A 3IQ0A 1VK4A 2AWDA 2VOSA 3DRWA 3RT7A 2VTEA 4E3AA 4QDIA 3RQ6A 2DCNA 3QA2A 2F00A 1P3DA 3B1OA 3IE7A 4XF7A 4DC3A 3RS9A 3GO7A 3K9EA 1V19A 3B3LA 1W7KA 2I6AA 3B1QA 3RQXA 4EUMA 3RTCA 3LJSA 4O1GA 1KYHA 2Y67A 1JXIA 3FHYA 4KBEA 5CGAA 3B1NA 4CVLA 1UA4A 1YGJA 2HW1A 1VI9A 3I3YA 4LCAA 1YGKA 3RQHA 1V1AA 1P31A 1RKDA 1TZ6A 3N1CA 4KADA 2AJPA 2Y1OA 5C41A 4EBUA 3GBUA 3LHXA 3RY7A 4K9IA 3DZVA 2UUOA 3K5WA 1TZ3A 3RTEA 3KZHA 5BYDA 4LBXA 2JG5A 2Q5RA 1W78A 5EYNA 4HV4A 5B6AA 2AB8A 3RTBA 5CGEA 3ZM5A 3Q1YA 4KALA 1V1SA 1V1BA 4N09A 4YWRA 3RREA 3IKHA 3LOOA 2WTZA 4UBEA 1EKKA 1JBWA 1TD2A 3FHXA 3RS8A 3RQ2A 3UBOA 2C4EA 1LHRA 4QF5A 2ABSA 2VORA 1RK2A 3RRJA 3UQ9A 2FV7A 4K93A 3NBVA 5A5EA 5C3ZA 5BYFA 5A5FA 2VARA 3HN7A 2PKKA 2DDWA 5COJA 1EKQA 2PKNA 3RQ8A 3RSGA 3VASA 3W4SA 2JGVA 4BUBA 5BYEA 2F02A 4JKSA 4E8WA 2PKFA 4YL5A 4K8TA 4C5LA 3GO6A 4E69A 2I6BA 5CM5A 2PKMA 4E8YA 3Q92A 3RQ5A 2R3BA 1J6UA 3H49A 3EAGA 2DDOA 3IBQA 4C5JA 5BYCA 5F0ZA 1LIJA 1ESQA 4JJPA 3IN1A 4DU5A 4LC4A 3RTGA 3RU3A 4XCKA 3VAQA 1RFUA 4XDAA 1E8CA 1RFVA 3LKIA 2GCAA 1LIKA 2AFBA 3IH0A 3OTXA 3UQEA 4WJMA 2JFFA 2JG1A 5TQIA 3RT9A 4CVKA 2AM1A 2V78A 3MBHA 4GM6A 1GC5A 3NL2A 2YXTA 3PZSA 2QCVA 4PVVA 4K9CA 4ZIYA 3RSQA 3RU2A 3MBJA 4U7XA 3HYOA 3UMOA 3ZM6A 3KEUA 1L2LA 5C3YA 3BF5A 3PL2A 4BUCA 4JKUA 5EY7A 4C13A 1LIOA 3KD6A 3RO4A 1RKSA 4O1LA 3RSSA 1U2XA 2YXUA 2F7KA 2GCBA 3CQDA 1BX4A 3NL5A 4X8FA 3RPHA 3ZS7A 1WYEA 3NCAA 2GC5A 2XPCA 3RPZA 1EEHA 3ZL8A 2NWHA 4S1IB 5C40A 3KTNA 3HICA 1E0DA 1RKAA 2HQQA 2UUPA 3RTAA 1GQTA 1C3QA 3BGKA 1UB0A 2XTBA 1FGSA 3JULA 4B8SA 3RTDA 3NM1A 4K8PA 2AM2A 2JFHA 4LBGA 4K8CA 4S1IA 2AA0A 3UQDA 3RRBA 4C5KA 3NBWA 2C49A 2A9YA 3H74A 1JXHA 3PYZA 2DDMA 2AJRA 3NC9A 1DGMA 2WJPA 4C12A 3RQQA 4E8ZA 4EOHA 3B1RA 3N2AA 3UMPA 3NC2A 1LIIA 2Y68A 3UAGA 4K8KA 1JBVA 3QCZA 1LHPA 4UAGA 1GQQA 1VM7A 3B1PA 1GG4A 4B8RA 2GC6A 2XJAA 3NL3A 4E84A 5F11A 2VTDA 3NRSA 2R3EA 3EWMA 1TYYA 2X5OA 1GQYA 4XF6A 2HLZA 4C5MA 4EN4A 3RM5A 3LK7A
chains in the Genus database with same CATH topology
1YHJA 4S1HA 3NM3A 4KAHA 4N08A 3RRBA 3HJ6A 5TRWA 4KANA 2I5BA 4S1MA 2AX3A 3QAIA 3RSFA 3UQ6A 1RFTA 4C5NA 3RRFA 2A9ZA 2QHPA 2ABQA 2RBCA 3HPDA 3NL6A 1ESJA 4X8FA 3W4SA 3IQ0A 1VK4A 2AWDA 3RT7A 3DRWA 4E3AA 3RQ6A 2DCNA 3QA2A 3B1OA 3IE7A 4XF7A 4DC3A 3RS9A 3GO7A 3K9EA 1V19A 3B3LA 3RQXA 2I6AA 3B1QA 4EUMA 5BYEA 3RTCA 3LJSA 4O1GA 1KYHA 5CGAA 1JXIA 3FHYA 4KBEA 3B1NA 1UA4A 1YGJA 2HW1A 1VI9A 3I3YA 4LCAA 1YGKA 3RQHA 1V1AA 1RKDA 4KADA 1TZ6A 3N1CA 5C41A 2AJPA 4EBUA 3GBUA 3LHXA 3RY7A 4K9IA 3DZVA 3K5WA 1TZ3A 3RTEA 3KZHA 5BYDA 4LBXA 2JG5A 2Q5RA 5EYNA 5CGEA 5B6AA 2AB8A 3RTBA 3Q1YA 4KALA 1V1SA 1V1BA 4N09A 4YWRA 3RREA 3IKHA 3LOOA 4UBEA 1EKKA 1TD2A 3FHXA 3RS8A 3RQ2A 3UBOA 2C4EA 1LHRA 2ABSA 3RRJA 1RK2A 3UQ9A 2FV7A 4K93A 3NBVA 5C3ZA 5BYFA 2VARA 2PKKA 2DDWA 5COJA 1EKQA 2PKNA 3RQ8A 3RSGA 3VASA 4EOHA 2JGVA 2F02A 4JKSA 4E8WA 2PKFA 4YL5A 4K8TA 4C5LA 3GO6A 4E69A 2I6BA 5CM5A 2PKMA 4E8YA 3Q92A 3RQ5A 2R3BA 3H49A 3IBQA 2DDOA 4C5JA 5BYCA 5F0ZA 1LIJA 1ESQA 4JJPA 3IN1A 4DU5A 4LC4A 3RTGA 3RU3A 4XCKA 3VAQA 1RFUA 4XDAA 1RFVA 3LKIA 1LIKA 2AFBA 3IH0A 3OTXA 3UQEA 4WJMA 5TQIA 2JG1A 3RT9A 2V78A 3MBHA 4GM6A 1GC5A 3NL2A 2YXTA 3PZSA 2QCVA 4PVVA 4K9CA 3RSQA 3RU2A 3MBJA 4U7XA 3HYOA 3UMOA 5C3YA 3KEUA 1L2LA 3BF5A 3PL2A 4JKUA 5EY7A 1LIOA 3KD6A 1RKSA 4O1LA 3RSSA 1U2XA 2YXUA 2F7KA 3CQDA 3RPHA 1BX4A 3NL5A 3ZS7A 1WYEA 3NCAA 3RPZA 2NWHA 4S1IB 5C40A 3KTNA 3HICA 1RKAA 2HQQA 3RTAA 1GQTA 1C3QA 3BGKA 1UB0A 2XTBA 4B8SA 3JULA 3RTDA 3NM1A 4K8PA 4LBGA 4K8CA 4S1IA 2AA0A 3UQDA 4C5KA 3NBWA 2C49A 2A9YA 3H74A 1JXHA 2DDMA 2AJRA 3NC9A 1DGMA 4E8ZA 3RQQA 3B1RA 3UMPA 3NC2A 1LIIA 4K8KA 1LHPA 1VM7A 3B1PA 4B8RA 4E84A 3NL3A 5F11A 2R3EA 3EWMA 1TYYA 4XF6A 4C5MA 2HLZA 4EN4A 3RM5A 3RO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHJ A;  4S1H A;  3NM3 A;  4KAH A;  4N08 A;  3RRB A;  5TRW A;  4KAN A;  2I5B A;  4S1M A;  2AX3 A;  3QAI A;  3RSF A;  3UQ6 A;  1RFT A;  4C5N A;  3RRF A;  2A9Z A;  2QHP A;  2ABQ A;  2RBC A;  3HPD A;  3NL6 A;  1ESJ A;  4X8F A;  3W4S A;  3IQ0 A;  1VK4 A;  2AWD A;  3RT7 A;  3DRW A;  4E3A A;  3RQ6 A;  2DCN A;  3QA2 A;  3B1O A;  3IE7 A;  4XF7 A;  4DC3 A;  3RS9 A;  3GO7 A;  3K9E A;  1V19 A;  3B3L A;  3RQX A;  2I6A A;  3B1Q A;  4EUM A;  5BYE A;  3RTC A;  3LJS A;  4O1G A;  1KYH A;  5CGA A;  1JXI A;  3FHY A;  4KBE A;  3B1N A;  1UA4 A;  1YGJ A;  2HW1 A;  1VI9 A;  3I3Y A;  4LCA A;  1YGK A;  3RQH A;  1V1A A;  1RKD A;  4KAD A;  1TZ6 A;  3N1C A;  5C41 A;  2AJP A;  4EBU A;  3GBU A;  3LHX A;  3RY7 A;  4K9I A;  3DZV A;  3K5W A;  1TZ3 A;  3RTE A;  3KZH A;  5BYD A;  4LBX A;  2JG5 A;  2Q5R A;  5EYN A;  5CGE A;  5B6A A;  2AB8 A;  3RTB A;  3Q1Y A;  4KAL A;  1V1S A;  1V1B A;  4N09 A;  4YWR A;  3RRE A;  3IKH A;  3LOO A;  4UBE A;  1EKK A;  1TD2 A;  3FHX A;  3RS8 A;  3RQ2 A;  3UBO A;  2C4E A;  1LHR A;  2ABS A;  3RRJ A;  1RK2 A;  3UQ9 A;  2FV7 A;  4K93 A;  3NBV A;  5C3Z A;  5BYF A;  2VAR A;  2PKK A;  2DDW A;  5COJ A;  1EKQ A;  2PKN A;  3RQ8 A;  3RSG A;  3VAS A;  4EOH A;  2JGV A;  2F02 A;  4JKS A;  4E8W A;  2PKF A;  4YL5 A;  4K8T A;  4C5L A;  3GO6 A;  4E69 A;  2I6B A;  5CM5 A;  2PKM A;  4E8Y A;  3Q92 A;  3RQ5 A;  2R3B A;  3H49 A;  3IBQ A;  2DDO A;  4C5J A;  5BYC A;  5F0Z A;  1LIJ A;  1ESQ A;  4JJP A;  3IN1 A;  4DU5 A;  4LC4 A;  3RTG A;  3RU3 A;  4XCK A;  3VAQ A;  1RFU A;  4XDA A;  1RFV A;  3LKI A;  1LIK A;  2AFB A;  3IH0 A;  3OTX A;  3UQE A;  4WJM A;  5TQI A;  2JG1 A;  3RT9 A;  2V78 A;  3MBH A;  4GM6 A;  1GC5 A;  3NL2 A;  2YXT A;  3PZS A;  2QCV A;  4PVV A;  4K9C A;  3RSQ A;  3RU2 A;  3MBJ A;  4U7X A;  3HYO A;  3UMO A;  5C3Y A;  3KEU A;  1L2L A;  3BF5 A;  3PL2 A;  4JKU A;  5EY7 A;  1LIO A;  3KD6 A;  1RKS A;  4O1L A;  3RSS A;  1U2X A;  2YXU A;  2F7K A;  3CQD A;  3RPH A;  1BX4 A;  3NL5 A;  3ZS7 A;  1WYE A;  3NCA A;  3RPZ A;  2NWH A;  4S1I B;  5C40 A;  3KTN A;  3HIC A;  1RKA A;  2HQQ A;  3RTA A;  1GQT A;  1C3Q A;  3BGK A;  1UB0 A;  2XTB A;  4B8S A;  3JUL A;  3RTD A;  3NM1 A;  4K8P A;  4LBG A;  4K8C A;  4S1I A;  2AA0 A;  3UQD A;  4C5K A;  3NBW A;  2C49 A;  2A9Y A;  3H74 A;  1JXH A;  2DDM A;  2AJR A;  3NC9 A;  1DGM A;  4E8Z A;  3RQQ A;  3B1R A;  3UMP A;  3NC2 A;  1LII A;  4K8K A;  1LHP A;  1VM7 A;  3B1P A;  4B8R A;  4E84 A;  3NL3 A;  5F11 A;  2R3E A;  3EWM A;  1TYY A;  4XF6 A;  4C5M A;  2HLZ A;  4EN4 A;  3RM5 A;  3RO4 A; 
#chains in the Genus database with same CATH topology
 1YHJ A;  4S1H A;  3NM3 A;  4KAH A;  1O5Z A;  4N08 A;  3HJ6 A;  2Y66 A;  4KAN A;  2I5B A;  4S1M A;  2AX3 A;  3QAI A;  5TRW A;  3RSF A;  4CVM A;  3UQ6 A;  1RFT A;  4C5N A;  3RRF A;  2JFG A;  2A9Z A;  2QHP A;  1UAG A;  2ABQ A;  2RBC A;  2UAG A;  1ESJ A;  3HPD A;  3NL6 A;  3IQ0 A;  1VK4 A;  2AWD A;  2VOS A;  3DRW A;  3RT7 A;  2VTE A;  4E3A A;  4QDI A;  3RQ6 A;  2DCN A;  3QA2 A;  2F00 A;  1P3D A;  3B1O A;  3IE7 A;  4XF7 A;  4DC3 A;  3RS9 A;  3GO7 A;  3K9E A;  1V19 A;  3B3L A;  1W7K A;  2I6A A;  3B1Q A;  3RQX A;  4EUM A;  3RTC A;  3LJS A;  4O1G A;  1KYH A;  2Y67 A;  1JXI A;  3FHY A;  4KBE A;  5CGA A;  3B1N A;  4CVL A;  1UA4 A;  1YGJ A;  2HW1 A;  1VI9 A;  3I3Y A;  4LCA A;  1YGK A;  3RQH A;  1V1A A;  1P31 A;  1RKD A;  1TZ6 A;  3N1C A;  4KAD A;  2AJP A;  2Y1O A;  5C41 A;  4EBU A;  3GBU A;  3LHX A;  3RY7 A;  4K9I A;  3DZV A;  2UUO A;  3K5W A;  1TZ3 A;  3RTE A;  3KZH A;  5BYD A;  4LBX A;  2JG5 A;  2Q5R A;  1W78 A;  5EYN A;  4HV4 A;  5B6A A;  2AB8 A;  3RTB A;  5CGE A;  3ZM5 A;  3Q1Y A;  4KAL A;  1V1S A;  1V1B A;  4N09 A;  4YWR A;  3RRE A;  3IKH A;  3LOO A;  2WTZ A;  4UBE A;  1EKK A;  1JBW A;  1TD2 A;  3FHX A;  3RS8 A;  3RQ2 A;  3UBO A;  2C4E A;  1LHR A;  4QF5 A;  2ABS A;  2VOR A;  1RK2 A;  3RRJ A;  3UQ9 A;  2FV7 A;  4K93 A;  3NBV A;  5A5E A;  5C3Z A;  5BYF A;  5A5F A;  2VAR A;  3HN7 A;  2PKK A;  2DDW A;  5COJ A;  1EKQ A;  2PKN A;  3RQ8 A;  3RSG A;  3VAS A;  3W4S A;  2JGV A;  4BUB A;  5BYE A;  2F02 A;  4JKS A;  4E8W A;  2PKF A;  4YL5 A;  4K8T A;  4C5L A;  3GO6 A;  4E69 A;  2I6B A;  5CM5 A;  2PKM A;  4E8Y A;  3Q92 A;  3RQ5 A;  2R3B A;  1J6U A;  3H49 A;  3EAG A;  2DDO A;  3IBQ A;  4C5J A;  5BYC A;  5F0Z A;  1LIJ A;  1ESQ A;  4JJP A;  3IN1 A;  4DU5 A;  4LC4 A;  3RTG A;  3RU3 A;  4XCK A;  3VAQ A;  1RFU A;  4XDA A;  1E8C A;  1RFV A;  3LKI A;  2GCA A;  1LIK A;  2AFB A;  3IH0 A;  3OTX A;  3UQE A;  4WJM A;  2JFF A;  2JG1 A;  5TQI A;  3RT9 A;  4CVK A;  2AM1 A;  2V78 A;  3MBH A;  4GM6 A;  1GC5 A;  3NL2 A;  2YXT A;  3PZS A;  2QCV A;  4PVV A;  4K9C A;  4ZIY A;  3RSQ A;  3RU2 A;  3MBJ A;  4U7X A;  3HYO A;  3UMO A;  3ZM6 A;  3KEU A;  1L2L A;  5C3Y A;  3BF5 A;  3PL2 A;  4BUC A;  4JKU A;  5EY7 A;  4C13 A;  1LIO A;  3KD6 A;  3RO4 A;  1RKS A;  4O1L A;  3RSS A;  1U2X A;  2YXU A;  2F7K A;  2GCB A;  3CQD A;  1BX4 A;  3NL5 A;  4X8F A;  3RPH A;  3ZS7 A;  1WYE A;  3NCA A;  2GC5 A;  2XPC A;  3RPZ A;  1EEH A;  3ZL8 A;  2NWH A;  4S1I B;  5C40 A;  3KTN A;  3HIC A;  1E0D A;  1RKA A;  2HQQ A;  2UUP A;  3RTA A;  1GQT A;  1C3Q A;  3BGK A;  1UB0 A;  2XTB A;  1FGS A;  3JUL A;  4B8S A;  3RTD A;  3NM1 A;  4K8P A;  2AM2 A;  2JFH A;  4LBG A;  4K8C A;  4S1I A;  2AA0 A;  3UQD A;  3RRB A;  4C5K A;  3NBW A;  2C49 A;  2A9Y A;  3H74 A;  1JXH A;  3PYZ A;  2DDM A;  2AJR A;  3NC9 A;  1DGM A;  2WJP A;  4C12 A;  3RQQ A;  4E8Z A;  4EOH A;  3B1R A;  3N2A A;  3UMP A;  3NC2 A;  1LII A;  2Y68 A;  3UAG A;  4K8K A;  1JBV A;  3QCZ A;  1LHP A;  4UAG A;  1GQQ A;  1VM7 A;  3B1P A;  1GG4 A;  4B8R A;  2GC6 A;  2XJA A;  3NL3 A;  4E84 A;  5F11 A;  2VTD A;  3NRS A;  2R3E A;  3EWM A;  1TYY A;  2X5O A;  1GQY A;  4XF6 A;  2HLZ A;  4C5M A;  4EN4 A;  3RM5 A;  3LK7 A; 
#chains in the Genus database with same CATH homology
 1YHJ A;  4S1H A;  3NM3 A;  4KAH A;  4N08 A;  3RRB A;  3HJ6 A;  5TRW A;  4KAN A;  2I5B A;  4S1M A;  2AX3 A;  3QAI A;  3RSF A;  3UQ6 A;  1RFT A;  4C5N A;  3RRF A;  2A9Z A;  2QHP A;  2ABQ A;  2RBC A;  3HPD A;  3NL6 A;  1ESJ A;  4X8F A;  3W4S A;  3IQ0 A;  1VK4 A;  2AWD A;  3RT7 A;  3DRW A;  4E3A A;  3RQ6 A;  2DCN A;  3QA2 A;  3B1O A;  3IE7 A;  4XF7 A;  4DC3 A;  3RS9 A;  3GO7 A;  3K9E A;  1V19 A;  3B3L A;  3RQX A;  2I6A A;  3B1Q A;  4EUM A;  5BYE A;  3RTC A;  3LJS A;  4O1G A;  1KYH A;  5CGA A;  1JXI A;  3FHY A;  4KBE A;  3B1N A;  1UA4 A;  1YGJ A;  2HW1 A;  1VI9 A;  3I3Y A;  4LCA A;  1YGK A;  3RQH A;  1V1A A;  1RKD A;  4KAD A;  1TZ6 A;  3N1C A;  5C41 A;  2AJP A;  4EBU A;  3GBU A;  3LHX A;  3RY7 A;  4K9I A;  3DZV A;  3K5W A;  1TZ3 A;  3RTE A;  3KZH A;  5BYD A;  4LBX A;  2JG5 A;  2Q5R A;  5EYN A;  5CGE A;  5B6A A;  2AB8 A;  3RTB A;  3Q1Y A;  4KAL A;  1V1S A;  1V1B A;  4N09 A;  4YWR A;  3RRE A;  3IKH A;  3LOO A;  4UBE A;  1EKK A;  1TD2 A;  3FHX A;  3RS8 A;  3RQ2 A;  3UBO A;  2C4E A;  1LHR A;  2ABS A;  3RRJ A;  1RK2 A;  3UQ9 A;  2FV7 A;  4K93 A;  3NBV A;  5C3Z A;  5BYF A;  2VAR A;  2PKK A;  2DDW A;  5COJ A;  1EKQ A;  2PKN A;  3RQ8 A;  3RSG A;  3VAS A;  4EOH A;  2JGV A;  2F02 A;  4JKS A;  4E8W A;  2PKF A;  4YL5 A;  4K8T A;  4C5L A;  3GO6 A;  4E69 A;  2I6B A;  5CM5 A;  2PKM A;  4E8Y A;  3Q92 A;  3RQ5 A;  2R3B A;  3H49 A;  3IBQ A;  2DDO A;  4C5J A;  5BYC A;  5F0Z A;  1LIJ A;  1ESQ A;  4JJP A;  3IN1 A;  4DU5 A;  4LC4 A;  3RTG A;  3RU3 A;  4XCK A;  3VAQ A;  1RFU A;  4XDA A;  1RFV A;  3LKI A;  1LIK A;  2AFB A;  3IH0 A;  3OTX A;  3UQE A;  4WJM A;  5TQI A;  2JG1 A;  3RT9 A;  2V78 A;  3MBH A;  4GM6 A;  1GC5 A;  3NL2 A;  2YXT A;  3PZS A;  2QCV A;  4PVV A;  4K9C A;  3RSQ A;  3RU2 A;  3MBJ A;  4U7X A;  3HYO A;  3UMO A;  5C3Y A;  3KEU A;  1L2L A;  3BF5 A;  3PL2 A;  4JKU A;  5EY7 A;  1LIO A;  3KD6 A;  1RKS A;  4O1L A;  3RSS A;  1U2X A;  2YXU A;  2F7K A;  3CQD A;  3RPH A;  1BX4 A;  3NL5 A;  3ZS7 A;  1WYE A;  3NCA A;  3RPZ A;  2NWH A;  4S1I B;  5C40 A;  3KTN A;  3HIC A;  1RKA A;  2HQQ A;  3RTA A;  1GQT A;  1C3Q A;  3BGK A;  1UB0 A;  2XTB A;  4B8S A;  3JUL A;  3RTD A;  3NM1 A;  4K8P A;  4LBG A;  4K8C A;  4S1I A;  2AA0 A;  3UQD A;  4C5K A;  3NBW A;  2C49 A;  2A9Y A;  3H74 A;  1JXH A;  2DDM A;  2AJR A;  3NC9 A;  1DGM A;  4E8Z A;  3RQQ A;  3B1R A;  3UMP A;  3NC2 A;  1LII A;  4K8K A;  1LHP A;  1VM7 A;  3B1P A;  4B8R A;  4E84 A;  3NL3 A;  5F11 A;  2R3E A;  3EWM A;  1TYY A;  4XF6 A;  4C5M A;  2HLZ A;  4EN4 A;  3RM5 A;  3RO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...