1C3VA

Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
total genus 73
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1c3vA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1c3vA01
1B3BA 4HV4A 2WDZA 2POQX 3UICA 2B5VA 4YRBA 4MVJF 1E7RA 5IDXA 4Z3DA 1EK5A 1Z74A 2OHXA 1LA2A 3EVNA 1DFGA 1KVQA 3IKTA 4E33A 1QYXA 1JN0A 5T73A 2BI8A 5G0WA 2AXQA 2JD0A 4H16A 3HN2A 2PD4A 1NQAO 1YL5A 2GD1O 4FD3A 1M76A 2DBZA 3QWHA 2NM0A 4JJFA 1J0XO 2NSDA 2O4CA 2EKQA 3B20A 1RPNA 2HQ1A 2VUSA 4BGUA 3K2BA 2C5AA 4J2OA 4CMKA 2I66A 4TVBA 1TEHA 4ALNA 4FR5A 1KVUA 3UOGA 1OBFO 5G0UA 2Q2VA 3KVOA 1YO6A 3CZMA 3WICA 2TMGA 1MG0A 3WXBA 5A04A 2ZB7A 5C7LO 1KEVA 3F4BA 4IINA 4LMRA 2NU6A 4CLXA 3Q11A 2CVZA 4IDAA 4R69A 1QP8A 4DQUA 1SEVA 3WYCA 1UDBA 4U0JA 2VYNA 1BVRA 2AE2A 4OIMA 1A7KA 2DFVA 1H2BA 3FSRA 2YZ7A 1XR3A 5I9LA 5ITVA 4QO8A 2O2SA 2I3GA 4H15A 1C0PA 2WE7A 2V6GA 2GUGA 5IFLA 4BNFA 4GMGA 3E8XA 1AN9A 2IODA 4J16A 2X4GA 2XOXA 2J5KA 1U8FO 1OOEA 3HB5X 3QWIA 4O63O 2AHRA 2HJRA 2G1UA 4D3FA 4P4GA 4EJ0A 3PLNA 4WUVA 1BW9A 3KO8A 3EHEA 4R9RA 3O4RA 4FCCA 4BMSA 2YHIB 2DUWA 1W8DA 5ENDA 1A71A 1R12A 4YPOA 1VJ1A 3KLPX 1EFLA 2AEMA 1FDUA 5I8WA 1BRMA 1ZCJA 4NU5A 2NU7A 5CEEA 2CMDA 1LXCA 4BO1A 3INRA 1PJLA 5G0VA 1O0SA 4BNWA 3ZNPA 4ND2A 4RF3A 1SO8A 1UZMA 2E6UX 3W1VA 4BNKA 1DAPA 3I9NA 1HSOA 4IBOA 2R00C 4CMIA 5JC1A 1QXSA 5A05A 4IDEA 1VM6A 1SMKA 1FMCA 3D3EA 4INAA 2WTBA 4AJJA 1X7DA 3QQPA 4BO4A 3U4IA 1N5DA 4KWIA 5EN4A 3GR6A 2VUUA 3GVHA 3GY0A 3AI3A 1Z6ZA 4RPHA 3LK7A 3TZHA 3MOIA 1N7HA 3UFXA 4B7CA 5DCWA 4FS3A 2GN8A 2QYSA 4CLOA 3BMNA 5JAIA 4LRTB 3F9IA 1RYDA 4WASA 3WS7A 3EW7A 4CQLB 1LJ8A 1LTHR 4EEXA 4TZTA 4CR8A 1LNQA 3N58A 4EBFA 3KSUA 1T2FA 4IUYA 3CPSA 1ZSVA 3H6KA 4PLHA 2HJSA 4J1SA 4FN4A 1ULUA 3D3WB 1RYEA 4KWHA 2WM3A 4YXFA 4PRKA 3C7AA 3WIEA 3GVCA 4CLHA 4O1MA 1R66A 4CR6A 3ICCA 1ZNQO 4X54A 1GV1A 2F00A 3TL3A 5ITWA 3ZW8A 4GLOA 4DMLA 1F06A 2PZJA 4OM8A 5I9MA 5KTKA 4N54A 1MC4A 1C0IA 3NRCA 4JP3A 1X7GA 2B0JA 3D4PA 3EMKA 3INGA 4MVJD 3ULKA 2Y93A 1R4NB 3D64A 4BGVA 2X86A 3W4KA 5B12A 5HTOA 1I32A 1R0KA 3HFSA 3AOEC 3U9LA 5JY1A 5ICSA 1IHXA 4W7IA 4GWGA 2EP5A 3RCBA 1HKUA 5L4SA 4YJDA 4PG4A 3T4EA 2J5RA 3VH2A 1LRJA 1S7CA 1HTBA 3I9JA 4C4OA 1ZKMA 1IHYA 4WJZA 4E3ZA 1EFKA 4IMRA 4C7JA 2V7PA 4YAIA 5F1KA 3MCVA 1HYGA 1PR9A 1DDOA 3SC6A 1B14A 1ENZA 1PEDA 4YAGA 4IDFA 4JQCA 2ZATA 4OQZA 3VZRA 1GCOA 1GUYA 1M2WA 1BDBA 5J23A 3JD3A 5M6DA 1M6HA 2UUOA 2VWGA 1PZEA 3NJ4A 3MJTA 3D5TA 4RO0A 4IGEA 3ZW9A 1H9AA 2VUTA 4IXTA 4PZDA 2PWZA 3UKOA 4EUHA 4Q3CA 1MFZA 5KKAA 6LDHA 2ZCUA 1UXKA 5GZ6A 1H6AA 4DRYA 3RU7A 3TJRA 2VYVA 2IE0A 4Y6PA 2WYUA 3JQBA 2EXXA 4WNIA 1EDOA 1U7TA 3BMCA 4IQ8A 3DBVO 3ONFA 3V8BA 4R41A 4KUGA 2J5QA 3RUFA 4CUJA 4GLLA 4DQXA 2HRBA 5I7VA 2JKVA 3MWDB 1IUKA 3CH6A 3M1AA 1TT5A 2AMFA 4H7PA 2V6FA 3OJLA 8LDHA 4J7XA 1I36A 4FJ1A 4CLDA 3U62A 2EGHA 2QQ5A 2DTDA 3WYBA 5EL0A 5EINA 3LC2O 4B8ZA 4A27A 2PH5A 3VHRA 4R3NA 1BGVA 1H94A 1W0CA 2GERA 4BO2A 1LX6A 2BGLA 1JKFA 2JJYA 2PKQO 1HDRA 3IIEA 4O59O 4BOYA 3FTNA 4HNHA 4UUNA 1Z75A 1ZBQA 4ZQHA 3VOSA 1LRKA 4LVCA 1NWCA 4ND5A 3W6ZA 1FK8A 4W9NA 4CUKA 1I10A 3KV3O 1PGQA 1DJQA 2VHXA 3OA0A 1A4UA 2NVBA 5BSFA 4R9SA 1MXHA 1DEHA 2D1YA 3BYZA 3HDYA 3LT1A 2FWMX 4A7PA 1CETA 4XR9A 3M2PA 2B4RO 1MUUA 4Y9DA 1HDZA 3V5NA 1TXGA 2D5AA 4Z9FA 5JCJD 4JXKA 1DIBA 3U0BA 4I8XA 1JQBA 1SCUA 3D0OA 2X5OA 4Y6RA 1ZXLA 1IULA 1NM5A 2VWQA 3L4BA 1WMBA 3WB9A 2WD7A 2WEKA 2QW8A 1U7HA 3GAFA 4WKGA 2LDXA 4CMHA 5L51A 4U0KA 1Y9EA 4MO2A 2YV3A 3GT0A 1XELA 2Q2QA 1QORA 4D0RA 2YY7A 3GVPA 3DMTA 1NPTO 2W2KB 2Y05A 3E03A 2P5YA 3PI7A 4OXKA 1YQDA 3SXPA 4GQAA 3JCZA 3LZ6A 3IDSA 5CG1A 3JQ9A 4XB1A 2PGDA 4N7RA 4BB6A 2Q3EA 4YCAA 1X1TA 3AOEA 2YQ4A 2QHXA 5H82A 1UXGA 2OXIA 5DCYA 2Q1SA 4RF2A 3LT0A 2AA3A 3K8ZA 1OAAA 1Q0HA 2I76A 3BMNB 4B3HA 2Y1CA 1YOVA 3F3SA 2DT5A 1X1EA 4IIUA 1GQ2A 5TSDA 3AY3A 1RM3A 5TLSA 2ET6A 2X23A 1ZZEA 3QVSA 1YL7A 5DCUA 5B1YA 1VL6A 1NPYA 2X9GA 1DB3A 2RCYA 3QIVA 2G0TA 2O3SA 4BO6A 4FJ0A 4HX5A 3ZV6A 2B83A 4W82A 3ZWPA 5LDGA 4UVIA 4EGFA 1SC6A 4GPD1 1EEHA 4G5HA 1U28A 1U9JA 3GN1A 3NT2A 3NAQA 4ZJUA 1QLHA 1FDSA 4E13A 5JAQA 4AJPA 4J91A 5LDHA 4HXYA 1GYQA 4RF5A 3U49A 3LVFO 1J4AA 1DLJA 1EUDA 1NHWA 2JCXA 3DEYX 3GUYA 4I1IA 4RVHA 4YEDA 2X8LA 4CV1A 1U3VA 3T4XA 3LYLA 3DHEA 3P2YA 4OJNA 3OM9A 4JJGA 5JCJA 4LW8A 1Y7TA 2NV6A 4RV9A 2Y0CA 1KVTA 4M87A 5L40A 5I7EA 4YRAA 4RPJA 4L9RA 1DFIA 2A9FA 1BDMA 3H2ZA 5IDWA 1HZZA 2D3TA 1LDNA 1BXGA 2H63A 3RUAA 4BO9A 3CUKA 3A9WA 5CG2A 2VZ8A 2YJZA 4WCFC 1BWSA 4NPCA 4MVJM 4IDGA 1EE2A 4ZVVA 5A3JA 4ZGWA 3WDSA 4OXNA 4Y6SA 5JYFA 1E6EA 1Y8QA 4J7UA 3E9MA 4Q3AA 1Z73A 2ZTMA 2BI7A 1D4FA 2X5JO 3EGOA 2XPCA 1PQUA 1YQGA 2Y1GA 4PN3A 3PP8A 2PGJA 4TVOA 5U4QA 3O38A 4E2XA 2DAPA 4IQGA 4XX0A 1A9YA 2QG4A 2CZCA 5DDIP 3PGJA 1I3KA 2IRWA 3PZBA 4RPLA 2HLPA 1YWGO 4GGOA 3L9WA 5L7WA 5IZ4A 2EIHA 3OQ6A 4XYBA 1PX0A 1IPFA 1EZ4A 2IXBA 1GYRA 1GAEO 3KYCA 1BHSA 2A92A 3E1KA 5EESA 1KERA 3NYWA 4J0FA 2TMDA 2SCUA 5JYEA 3HN7A 3RFXA 5A9SB 2FZWA 1LDBA 5TT0A 5DP2A 3G1UA 1BW9B 4PLZA 1QKIA 1ZSNA 4YQZA 4QFDA 5MDHA 3ZV4A 3IL2A 3DAGA 3JD4A 1WDLA 5T64A 3IC5A 3GEMA 3WGGA 1ZMTA 3PVZA 1P45A 5DP1A 2ZTUA 3COSA 3P19A 1E1KA 3DZGA 2FSSA 4NDNE 4BNMA 4LCJA 1HE2A 2VT3A 4TRRA 5JDIA 2AE1A 1DSSG 2D8AA 4JX8A 1GADO 3PFWO 3DOOA 3SJ7A 1Y5RA 1VKNA 3OA2A 3FWNA 4EJMA 4YB8A 2Q46A 1GU7A 2VT2A 4TROA 3B1JA 2FRDA 2F1KA 1Y8RA 2P9GA 3HQ4O 3TSCA 4P4NA 1DHTA 3W6UA 3NGLA 3HDHA 2X6TA 2HMSA 2EWMA 3Q1LA 2I5PO 4Z9YA 4DC1A 3G17A 3OECA 4UVEA 5U9CA 2DUUA 2WMDA 3ETDA 3ZWVA 3HWRA 1HL3A 5L95A 1XLTA 1E7MA 3F5QA 4YJFB 3GNTA 3DBLA 2RH4A 5EIOA 3GMDA 3DO5A 5KWEA 4YAKA 1NWHA 1U8XX 2QIOA 3I9LA 4UAGA 4FJ2A 1TT5B 2WWRA 4AJLA 5BSHA 1T4DA 2C2YA 2BELA 4E0BA 3ROPA 4YT2A 4O6VA 4DLLA 1NP3A 2EHDA 1VRWA 1YJ8A 4E2ZA 2Y68A 5KJ6A 2O7QA 3S2FA 1OZAA 1T2AA 2IZ1A 4CLRB 4DWVA 5TNXA 3DOCA 4XCVA 4CM8B 4TQGA 2GGSA 3I4CA 4CUZA 4WCDA 1UP6A 4MIEA 4HADA 2FP4A 1E0DA 2EW2A 1WVGA 2D59A 2D2IA 3WIDA 4MP3A 1N8KA 2PD3A 4Z9XA 4CMJA 5IN4A 4XZ3A 4MVJP 1M67A 4WLOA 2AQKA 4J43A 2Q22A 4K28A 3CINA 1PS0A 2Z95A 1U4OA 3RIHA 4Q3NA 3ADOA 1GUFA 2PR2A 2ZQZA 3BTOA 1PWZA 1ADBA 3UGKA 2BFAA 4HP8A 4QUKA 2FOIA 5K0ZA 4XR4A 3HDQA 4EW6A 2P9CA 4WGGA 5IAAA 4F3YA 3C3XA 1YB1A 5ENVA 3DTYA 3ZWAA 1CEQA 4XYLA 1SOVA 1M75A 8ADHA 2OFPA 4UVGA 1I3MA 1Y8RB 1PZHA 5JBIA 2W2LD 4N18A 4BV8A 4CM5A 1P33A 3OEWA 4D45A 3IAHA 1IZ0A 4BQRA 4EZBA 1OMOA 4BKUA 1BMDA 3M2TA 5KVQA 3AUTA 3L6DA 4HBGA 4UUPA 4CQMA 5G4LA 4B79A 1E7WA 2X9VA 4YJHA 1P0FA 3BZUA 4K9DA 3CKYA 2GZ1A 2O2YA 3JYPA 2NVUB 5C7IO 4LSMA 1JTVA 2CDCA 4DL9A 1XU9A 4CM7A 2DBVO 3WMWA 3MZ0A 3EUWA 1EBUA 1NVMB 4RORA 1JVBA 3GRKA 2Z1NA 4HFJA 4CL8A 1YQXA 4BNGA 3ZWWA 2P9EA 3ZU4A 1FDTA 2VYND 3QVTA 3OIGA 3ZU3A 3RUCA 3DAPA 3R0IA 4IS2A 3LDHA 3MTGA 3RBXA 1UZLA 1H93A 5A3VA 3RU9A 2RBEA 3ENKA 5CHEA 4WECA 1E3IA 4JP2A 3G3EA 3NTQA 1VL8A 4NJMB 3DBLB 5IG2A 3JQ8B 1PJBA 3PQDA 2B36A 3DMTC 1NASA 5JC8A 1ISHA 3V2UA 2ZK7A 1HDCA 1VI2A 2VZ9A 1I5RA 4JIGA 2C5EA 3TZKA 5BNIA 3GH3A 4IZHA 1U3UA 3FR8A 3H3JA 1GV0A 1DIAA 1EBFA 3FF4A 5DT9A 4F6LA 1YRLA 4DYVA 3AY6A 3JYOA 3RUDA 3MJ4A 4YA6A 1B8UA 5HS6A 1P1KA 2NNLD 1DOHA 3GEGA 1BXZA 1FXSA 3GAZA 4GX5A 1YKFA 1DC3A 1DXYA 1ISJA 4GVXA 4MKRA 1B2LA 1GZ6A 1XQ1A 2D0IA 3AU9A 4FOSA 3JQGA 4CPDA 3Q6IA 3GQVA 3VH3A 3D4NA 5HA5A 1BVUA 3TPCA 4NIMA 3WJ7A 4CL3A 3NT5A 3RUEA 4GBJA 3UCFA 3DZFA 1LSJA 1JWBB 3T7CA 4MVJG 4KP7A 3VC7A 1CIVA 4OO3A 3VPHA 3BXXA 3AW9A 4RZHA 1O8CA 1XCBA 3IUSA 5IDQA 1RM4A 1XHLA 2OP0A 3HADA 4HFNA 3EY4A 4IS3A 5EPOA 4BUCA 1E1LA 1PJ4A 2PGLA 2XXBA 2W2LA 1NQTA 3DWFA 4FFOA 1FF9A 1G1AA 1KC3A 3QWAA 2Y0DA 1Q7BA 4Z6KA 4FFPA 4PG7A 4LRSB 3HZZA 3UAGA 3H2SA 4U6SA 1GPDG 1UP4A 3JQAB 1W73A 5TF4A 1BG6A 1GTMA 4G65A 4ZHSA 3H9EO 2GN9A 2OMEA 3LF1A 3PHHA 1UH5A 3GNSA 1ZSYA 1W4ZA 1GD1O 4FGWA 5JLAA 9LDTA 4YR9A 3FI9A 3K92A 4LVUA 2ZKLA 4CV3A 1ZXBA 2H6EA 3ZNOA 1TI7A 3NGXA 2PV7A 4N5MA 3DONA 1FDVA 4QFCA 1R4NA 3WGTA 2HAEA 4FC6A 3VZQA 1EMDA 3ZV5A 4JBIA 3CTMA 2QYTA 4CLEA 4BO7A 4ILKA 2DPHA 1GEGA 2HDHA 4E5NA 5JAMA 4BNZA 1U4SA 5JYDA 1R15A 2B4QA 3EYWA 2O50A 4RPGA 1OI7A 2FPIA 1EDZA 5T5QA 3S8MA 4PZEA 3KBOA 1PQPA 3H5NA 2DTEA 3AUUA 2OOSA 1KEUA 1K5HA 1ZK2A 3AU8A 4B4WA 4E30A 3JD2A 4IPTA 3HHPA 3LLSA 4M54A 4DIBA 4XGIA 5B4VA 4BNTA 4IMPA 5JXWA 3ORFA 4JBGA 4GI2A 5A03A 3HB4X 3UCXA 3KYCB 3CSDA 5G0SA 2DVMA 3FRJA 1E5LA 3QP9A 1HDYA 2QZ9A 2PZKA 2J8ZA 1KEPA 3ZH2A 3ITDA 5F1PA 1UZNA 3VKVA 3ZNNA 3WBBA 1B26A 1QG6A 2JAPA 1P1JA 1PJCA 3JYLA 3JQ9C 1LC0A 4E12A 4BV9A 1IL0A 1YDEA 2EV9A 4BB5A 3OJFA 4HWKA 1JKJA 5F5NA 3RUHA 3U5TA 2QX7A 2V65A 4Q39A 4Q3EA 4MDHA 1P77A 3NKLA 4CM9D 1WDMA 4AJOA 3F1KA 1DC4A 3NX4A 4NNJA 3GGGA 2WSBA 1YOVB 3E5RA 4DPLA 1XU7A 2ZQYA 1WWKA 4RQUA 1NXQA 1Q7GA 5AQ1A 4L76A 5FI3A 3SBOA 3SLGA 2GRAA 3ADPA 1VSVA 4I5FA 3FN4A 5G0TA 2LDBA 4PG8A 3F1LA 4TRMA 2X0JA 4B4VA 1JAYA 5EJ2A 5TX7A 4GL4A 2D4AA 2B5WA 3TZ6A 1H6DA 2FPGA 4HFRA 3WYEA 2IEDA 2BKAA 2AEFA 2ZYGA 4W4TA 3TNLA 1VE9A 5C7OO 1HETA 1YDWA 6ADHA 4F6CA 2VTDA 4WCFA 2RIRA 1E3SA 2PTGA 2WD8A 4I5GA 3PDJA 5BR7A 1E1MA 5CDUA 2X5KO 3ENNA 3A06A 1NFRA 3WWYA 3PK0A 4J4HA 3WSVA 3DFUA 3WGOA 1E3WA 1PIWA 3IOYA 4BIIA 4GMFA 2Y1EA 1TLTA 2HSDA 1MFPA 2IEBA 3I1JA 4IDDA 3RKUA 3RBVA 3WX0A 3I6IA 1YBAA 2DU8A 3H3FA 3DBRB 1EK6A 4AFNA 2WYWA 2X0RA 2P2SA 1BTOA 3WMXA 3RVDA 4AJ1A 1PGJA 2OL4A 3ANNA 2FR8A 4QTZA 2ZB3A 4ALKA 4BKRA 1KETA 5A02A 2Q50A 2DPGA 2BRUA 4JNKA 4D46A 4HFMA 4U5QA 4XKJA 1R16A 4XYMA 3WGIA 1I33A 1F14A 1E3WB 3SJUA 1XYGA 1M6WA 1XKQA 1V3VA 3WGQA 4FFNA 4LN1A 2CSUA 4NK4A 3WSWA 1TVEA 1OC4A 1JA9A 3VTZA 3TL2A 5ES3A 2EEZA 4WCFB 3IKVA 1DJNA 4GVLA 3VZSA 4J3FA 4XQGA 3WBFA 1C1DA 2EF1A 1PU2A 2B35A 3GDFA 2HU2A 1LDGA 4W6ZA 2CNBA 1JWAB 1CF2O 1GDHA 3GGPA 4EUEA 5B4UA 3RD5A 2JL1A 1HLPA 3LLVA 3NDJA 4G2NA 4LGVA 1NAHA 5T8KA 3SVTA 3D3WA 2DC1A 3GVXA 4MP8A 2GCGA 3HJAA 3IP3A 2YUTA 4IJUA 3LF2A 1LLQA 4PCVA 5L45A 2XF8A 5L4NA 1U2DA 4NBVA 5TJHA 3AFMA 3DXFA 5ER6A 5B4TA 4R54A 2O4UX 4BO5A 2VRBA 4GSKA 2DM6A 3JQDA 1ZMOA 4DXHA 2Q99A 3C85A 2G82A 3I9KA 1KIFA 1PSDA 3WR5A 3AI2A 4DQVA 2HMUA 1R0SA 4L73A 2Q1UA 3W8EA 1ISMA 1E7QA 4RZIA 3TOXA 1HT0A 1XGKA 3GG2A 2VTEA 4AJEA 1C0KA 3DHYA 1NFQA 2C2XA 5LCXA 5COQA 1N7GA 4R5MA 4BMNA 3Q9NA 3NJ8A 5TC4A 1I2ZA 4YT5A 3N7UA 1EUCA 3LQFA 3PDUA 9LDBA 3KM0A 3F46A 3EVTA 4KDEA 4E32A 1PS9A 4Z0PA 4FGSA 1WNTA 2GNAA 3NV9A 5JNLA 4OMUA 4AJ4A 3H65A 1AE1A 5KOIA 3RQSA 1QRRA 4GKVA 4GAEA 5JS6A 2E82A 1O94A 1HDOA 1O9BA 1I30A 4YYZA 2O23A 4L75A 4YRDA 4KUEA 2J3KA 1YBMA 3QY9A 2DKNA 4NK5A 4XWYA 3GEDA 2HMWA 4ZRMA 4ZQGA 1IE3A 1NVTA 1ID1A 5A1TA 5JDIC 3KSDO 1DIHA 5G4KB 4MVJI 2W4QA 4EUFA 3V2GA 4CMGA 1G0NA 3AJRA 5L9AA 3ANMA 2Y0EA 1A27A 2E49A 4RVUA 1B8VA 1YB5A 3PZRA 4B7XA 4OKIA 3L07A 3ABIA 1ZW1A 1NHGA 4YWJA 1VLLA 5DOZA 4ND3A 3E48A 3K31A 1K0UA 1PS8A 3JQEA 1ZUD1 1U1IA 1WLYA 4GKBA 4AICA 5JCXA 1V3UA 2DBQA 5HBRA 1QYDA 3CMMA 5T8KC 3WOHA 3GDOA 5CEJA 3BHMA 4ZRNA 1D1SA 4YT4A 3Q2KA 3B1KA 1ZK3A 2FMUA 3GGOA 4R4JA 3H9JA 4ND4A 4CMCA 3QVXA 3ZV3A 3WGYA 4E5YA 4OSPA 2AQHA 4MJLA 2BD0A 4D44A 3I3OA 4D3SA 1ZK4A 4XJTA 3O26A 3V1UA 2C07A 3JQFC 4YJGB 3I5MA 2EKPA 5DNAA 1KY4A 3MTJA 3DL2A 4CMIB 3W8DA 3VTFA 1LC3A 4UVDA 2EJWA 4J4TA 3JQ7A 4DYDA 2X0NA 1HSZA 3ROQA 4R51A 4QX6A 5JDCA 2Q4BA 1NPDA 1MB4A 2GSDA 4E5KA 1WPQA 2CFCA 4PLWA 2JD1A 2V6MA 5ICMA 1BXGB 4WOJA 1B8PA 4A2CA 1GCUA 1HDGO 1X7HA 5EQFA 1O6ZA 3ROMA 2OORA 1GZ4A 1YXMA 3PYLA 2O3JA 1QMGA 2PNFA 1QYCA 4NFSA 5AXAA 2VRCD 3MJCA 4B8WA 5A9SA 2OGUA 5IJZA 4YAEA 1ADFA 1E1NA 4LISA 1O95A 1UAYA 4NZ9A 3WWZA 2O3UA 3JQGB 3S1LA 5CDSA 5BNTA 5BT9A 2E48A 5L7YA 2GLXA 4RDIA 5JMPA 2GYYA 4CM4B 1MG5A 1AGNA 1V3TA 2W90A 3L4SO 3IUPA 4ALMA 4CMEA 1LU9A 4E5MA 1I24A 2O7SA 3AI1A 3H5RA 4OH1A 3E9NA 1K89A 7MDHA 2VQ3A 4OOEA 1Q0QA 4KTTE 2I65A 5TS3A 5AXCA 4QSMA 3FNEA 4M49A 3RWBA 1T4BA 2VRCA 3RC2A 1HRDA 4D79A 4BNVA 1Y8QB 1GEEA 1ENPA 4AJ2A 1VSUA 4JBHA 4PGFA 4MVJE 4K26A 4ZQFA 3IMFA 1HE4A 1D7OA 1XDWA 2C54A 4Q3DA 5K9ZA 3JD0A 4NJMA 3JSAA 3T7EA 3OHSX 1KVRA 1RKXA 1K3TA 2BFOA 3TN7A 5KCZA 1H0KA 4CR7A 1HYHA 3P7MA 3DQPA 2ZTVA 1R0LA 4QEDA 4RVFA 5JMWA 3FNFA 4L74A 3WTBA 4A26A 1OC2A 1C14A 1E7YA 1VPDA 4GH5A 4UEKA 5HWSA 1EUZA 5G2OA 3S2IA 1HF3A 2DQ4A 4YBZA 4J1NA 3KEQA 2VHZA 1SBYA 3BMQA 2UYYA 3I83A 1ISIA 2GASA 3AUAA 4B4UA 2YHUA 1GR0A 3VZPA 4XYEA 3ZU2A 1P1RA 1GL3A 3DTTA 4BNYA 1NR7A 3C1AA 2EP7A 3WG9A 1P9LA 4HUJA 3CMCO 3OP4A 4CJXA 3TZCA 3VPFA 2QRJA 3JV7A 2XAAA 1VC2A 4DA9A 3RROA 1V9LA 3CEAA 3JTMA 4JJIA 4UVHA 3UVEA 1IY8A 4DC0A 5JSFA 3G49A 3H9QA 3ZN2A 3WNQA 1PWXA 1ZK1A 4IJKA 5IZCA 2H5LA 4H3VA 1GQYA 1X0VA 1UJMA 3GPIA 3PWKA 1ISGA 5U1PA 1R4MA 3U4DA 1H9BA 3PFFA 4GX2A 3FHLA 4DUPA 2NADA 1QV6A 2BGMA 2JFGA 3EAGA 1XIVA 2ILTA 3GZNB 2Y66A 1Y81A 1I01A 2UUPA 1XA0A 3C1OA 3QV1A 1LDYA 3F6YA 3JQAA 5F1OA 5F3RA 3AY7A 3AFNA 2DTXA 2HMVA 3EZYA 1ADGA 2Z5LA 3AM4A 3WNVA 5KVSA 4DBVO 1WXDA 3DBHB 3PHJA 4IJVA 1K2WA 2YFQA 2WE8A 1CRWG 2NTJA 1Y1PA 1NNUA 3W8FA 1ENYA 4F45A 2PH3A 1L7DA 4J7CA 2FZEA 5COAA 2ZYAA 3N74A 3ZI0A 2C0CA 5KJFA 4R68A 2CVQA 5H83A 4WOKA 2RHRA 2Q1WA 4BGEA 1PJSA 4FBGA 3JYQA 4Y98A 4YDRA 2A94A 5JE8A 3GVIA 5IN5A 1ARZA 2JCYA 3A14A 4WE3A 1SPXA 1E92A 1MA0A 1N2SA 2AEJA 1ZIDA 4U7WA 3E6AA 4B3JA 4TRNA 3WGZA 4CM1A 5DZSA 1DRUA 2CVOA 3GNQA 1U3WA 1NQOA 4EYEA 1LDEA 2W98A 5FYDA 4TMFA 3GPDG 1UXJA 3AWDA 3H5AA 1TA4A 4AL4A 3M1LA 2R00A 2J3JA 1K6XA 4AJHA 2GR9A 3GF4A 1DLIA 3H8VA 4NQZA 4P38A 3I23A 3JD1A 5I7FA 1F0YA 1SB9A 1M66A 2FR0A 2VN8A 3GZNA 5COBA 4S3MA 3RJ9A 2HK8A 3TFQA 1V35A 3S55A 1R4MB 1EVIA 4BO3A 1T1SA 3K73O 3FPCA 1PL6A 1A9ZA 4I08A 1J5PA 4D41A 4R5HA 4J2HA 2R2GA 3QVOA 4WLVA 3ZNQA 1DHRA 4RVGA 4EITA 3WTCA 5KNLA 4U6QA 2Q45A 4ND1A 4JROA 3DB2A 3GMSA 1C3VA 3NEPX 1DPGA 3L6EA 1E3JA 2ZYDA 3JQCA 1AHIA 1U3TA 4U8GA 4TRJA 3TRIA 5K6AA 3FD8A 2FHSA 3EK2A 4ZQBA 1N92A 5CFZA 3ANLA 3DR3A 2IXAA 2NLOA 2YDXA 1T1RA 4IGFA 2DFDA 4DLAA 2BF7A 1ZFNA 4E4YA 1H2HA 3HFGA 3LU1A 1P31A 4AG3A 1YS4A 5ILOA 3OICA 2JHFA 5IF3A 2HK9A 5DN9A 3DMYA 3B70A 3MOGA 3GFBA 5T6BA 4NJOA 2RH8A 1D1TA 2Y1OA 1G6KA 3FR7A 4BNNA 1E3EA 2NTVA 4QQRA 3D7LA 4OQYA 2B69A 4DIOA 2ZIZA 3PIIA 1WP4A 1B16A 1HYEA 4CQLA 1BXKA 5JFOA 2EJVA 4B7UA 4BKQA 2RAFA 3VVCA 5ILGA 1DRVA 5EMHA 3K9QO 5LC1A 2O48X 4D7AA 3UHAA 4RQTA 3WFIA 3BHJA 4XA8A 4RLHA 3WQSB 3E82A 1ISFA 3PEFA 4XEHA 2ZJ1A 3G79A 4PLPA 4D3DA 2P4QA 4XYGA 1LSSA 1PJQA 2HRZA 1RM5A 4DLBA 3F5SA 5GZ3A 3FNHA 4XIJA 2PKRA 3GN2A 3C7DB 1LUAA 3SLKA 4BL5A 1EE9A 2PFGA 4WLFA 4DBZA 1NBOA 2JCVA 3FBTA 4CM4A 4EEZA 4YT8A 3KHUA 4BO0A 3ZCXA 1C0LA 3E5MA 1HEUA 3WFJA 3G0OA 2CY0A 3IJPA 1P1IA 4FFLA 1DBVO 5AYVA 3OH8A 1WAMA 1PTJA 2DBRA 4R16A 4ITUA 3ZHBA 2OP1A 3A28A 5KVVA 3BTUA 4XGNA 4ZA2A 3ASVA 4ONEA 1B0AA 3MJVA 4ZQEA 3INTA 3I6QA 5GZ1A 4NG5A 5A5EA 3L4BC 1A7AA 4FFMA 1Z7BA 3AK4A 2NQ8A 3HSKA 3TOZA 3K96A 3DBHA 1MV8A 4XDZA 3GZ4A 2ZB4A 1YH3A 4RGBA 4CQMD 2IZ0A 3EC7A 4M86A 2J3HA 1HZJA 3KYDA 2GZ3A 3PJDA 4UULA 5F21A 3UW3A 3FCOA 3ZHZA 1UAGA 4E31A 4FC7A 3ZZNA 2VWPA 2UVDA 2CUKA 1H5QA 1I0ZA 3TWOA 2P91A 3DDNA 1QR6A 5JAZA 1QYVA 1V8BA 4NFYA 5CAEA 3STHA 2X22A 1MLDA 2OO5A 1PGOA 3W4IA 3WGHA 4JGBA 1BSVA 4MOWA 3MEQA 4YVFA 2IYOA 1DC6A 1RJWA 4II2A 4OKNA 3CIFA 3AUSA 3O03A 1YJQA 5BNFA 2C7VA 2HO5A 1P1HA 2D5CA 3D1LA 4NFHA 3DFZA 1ZJYA 3MJSA 2GO1A 5GMOA 3EDMA 2ZB8A 5CDGA 5I8ZA 2P5UA 2ZJ0A 2CD9A 3P2OA 4MKXA 2VCYA 5G4KA 4BQPA 2H9IA 3PGXA 3DZBA 3ZWBA 2WD7B 3GHHA 4NR0A 5MGBA 4J4BA 4TKLA 3BMOB 1NQ5A 3NDIA 1VKOA 3I9MA 1HE5A 4GSLA 5IDYA 4FOOA 3RC7A 5JY6A 1DRWA 1UXIA 2GDZA 1Z82A 2EW8A 4PFJA 5I9NA 4RF4A 3OIFA 4UEOA 4BNLA 4I5DA 3Q2IA 3JQAD 2OBYA 1X13A 1B7GO 4NBRA 4DREA 1R6DA 4OSOA 3HE3A 3QSGA 3Q9UA 4PVDA 4QT0A 3VDQA 4KDFA 5L3ZA 3L6OO 1E7SA 4PIVA 1PGPA 1VJTA 4W7HA 2W8ZA 2GPTA 4M89A 3ETEA 4R1TA 1UP7A 5AXDA 5DOVA 4BNXA 3B6ZA 4DPMA 4GGPA 3KYDB 5HRUA 1LEHA 1PJ3A 4QXMA 3SEFA 4Z0HO 2Q2WA 4YQYA 4LK3A 4CM6A 1CQJA 3DAFA 2PZMA 5C5IA 5A4DA 4NMHA 4R1SA 3RC1A 3IS3A 1SB8A 2QZZA 1E6WA 1CJCA 4CV0A 1MP0A 3P5SA 4J6FA 1KS9A 4KOAA 3GC6A 3O8QB 4D43A 1ORRA 4ALJA 4K6FA 1T26A 3PYMA 1C1XA 1ZEJA 2VHVA 3PHLA 4JN6B 1S6YA 3VKUA 4BNIA 2VOEA 4MVJH 5A06A 1LSUA 5KIAA 4A03A 4ALLA 4R3WA 4Y67A 3I52A 1NTOA 3OJ0A 1ZVMA 4UEJA 4R1UA 2VZ0A 2JAHA 2EG9A 3ZWOA 3JQ7B 3LT4A 2R6JA 2GN4A 1I8TA 4XIYA 1FJHA 5HM8A 3OQ1A 4TKMA 4KQWA 3PQFA 4Q3BA 4BKPA 4FPXA 5FWNA 2X7HA 4IZIA 2A35A 3GG9A 4CMAA 1YL6A 4WPGA 1X15A 3UUWA 4YJFA 2C82A 3V2HA 3E18A 2GF2A 4XQEA 1B15A 3GK3A 1IZ9A 5C3MA 1ZJZA 1U5CA 4OL9A 5DULA 2WJPA 3VPXA 4ZD6A 2AG8A 2J3IA 2PD6A 2YV1A 3CE6A 5ADHA 4TZKA 4DVJA 1YVEI 4E6PA 4PRLA 3DBRA 4LMPA 4CODB 1I3NA 4J1QA 1XWFA 2PA3A 4A0SA 1N9GA 1YONA 2P4HX 4FQ8A 1JDJA 2FR1A 4ALIA 3E9QA 2BHLA 2NVWA 4UUMA 4IM7A 4M1QA 2CDBA 5F5LA 2NUAA 5I7SA 4PZCA 4XRRA 1GPJA 1CERA 4FW8A 4J9UE 1P44A 3I4FA 5CPBA 3DOJA 1HXHA 4J90A 4LSWA 4QO7A 3OJOA 2HMTA 5DBIA 5A5FA 4F46A 5L53A 3BAZA 1K6IA 2BH9A 1XQ6A 1JVSA 4W99A 3V1YA 4RDHA 3RUIA 5TT1A 2O3QA 1JKIA 4DGSA 1A4IA 3KXDA 1PJTA 1KOLA 1LQUA 2ZCVA 1LLUA 2OBNA 4XQCA 2EKLA 1C1XB 3ZHXA 1J49A 5H81A 4YTEA 2P68A 3GRPA 2Y99A 3VPSA 3QVWA 4NBTA 3ZGYA 4XQ9A 3ZWCA 4N5NA 2QRKA 1T25A 5EQDA 3G1TA 5KKCA 1DAOA 3LC7O 1KY5A 3PPIA 4PLGA 1H6BA 2X9NA 3ONEA 3DZJA 1PQWA 3LT2A 3PJEA 1DIGA 5EERA 4KMSA 1IYZA 3UH1A 3L9XA 4D42A 2FY8A 1U2GA 4DPKA 2VHWA 1ONOA 5DBGA 1AHHA 3FTPA 5THKA 1V6AA 1F8GA 3KUXA 1WMAA 4BNUA 2UDPA 3KOUA 4RVSA 5KVCA 1AXGA 1L7EA 1EVZA 1UR5A 1EVYA 2IYPA 3LC1O 3PJFA 4ZICA 5JO0A 1P0CA 3U3XA 3QWFA 3ST7A 4DMMA 2HUNA 4XB2A 3KTDA 3QW2A 3BA1A 2X58A 4I5EA 1LBEA 4XRGA 2NU9A 2I6TA 1O5IA 4I9NA 1LI4A 4R1NA 3ZDFA 1SAYA 1Y5MA 4CM8A 5CDTA 1O89A 3R6DA 2Y1DA 3GFGA 4R01A 3OSUA 4GX0A 4CLRA 3PXXA 4Z3KA 1A72A 2RHCA 1Z45A 2VNAA 3JYNA 5AOVA 1ENOA 1ONPA 1QSGA 5L7TA 3HNPA 1PL7A 4FFRA 3MWEB 4P4LA 4M8SA 4WEQA 3C24A 1CQIA 4OOFA 2GZ2A 3RSHA 4E2YA 3Q0EA 3FNGA 4I9HA 5IXSA 5TRTA 3UXYA 4HKTA 4IDBA 1XEAA 1PZFA 1E5QA 2FSVA 3EZLA 3ZWNA 2IZZA 5IZCC 2C59A 1SNYA 3PWSA 1HLDA 5BSGA 1ZO8A 3WJAA 2NTNA 4PLYA 1R37A 4NU6A 4A10A 3VAZA 1Z7EA 2VWHA 1CWUA 5J9GA 2NU8A 3HDJA 1KBZA 1NYTA 5DF1A 3JQFA 2I9PA 3ASUA 2PKQP 4P22A 3L0DA 3AOGA 4Q9NA 3BHIA 4C7KA 1I3LA 1KVSA 1F17A 2B4TO 2H1SA 3F47A 1EQ2A 4WK6A 2UV8A 4IQ0A 3C1TA 1ADCA 4WLNA 4RL6A 2Y67A 1QYWA 3RBZA 3UF0A 3QWBA 1L1FA 1KYQA 1PR3A 1LLDA 2I3AA 1I2BA 2YQ5A 1IB6A 5AXBA 1E3LA 2PY6A 3OIDA 1CDOA 3ZHYA 4EI2A 3VDRA 2PZLA 3KYBA 4DTIA 4RJTA 3GOHA 1EQUA 1UXHA 5T67A 2BMAA 2VHYA 2C7GA 1LLCA 2OUIA 2W2KA 2Z1MA 3BMOA 3ON5A 4J0EA 4XD2A 2Q1TA 4BKOA 3TFOA 1MXFA 3ZWXA 5C37A 4TSKA 3WLFA 3OEYA 3RI3A 2BGKA 3BMQB 3QLJA 1VJ0A 4PLTA 4BNHA 4IJWA 1P74A 1K6JA 4J49A 4CM3A 4L4RA 2E37A 2YDYA 4FDAA 1PZGA 4NHEA 1GQQA 4ZU3A 1VL0A 3DZKA 3K30A 4JCOA 4WLEA 4MP6A 4IXWA 4PG6A 5AVOA 1MGOA 3WQQA 3SX2A 3OQBA 3JQBC 3KRTA 4XJSA 1RM0A 2NWQA 5A9TA 2NQTA 4OYRA 5JO9A 4HNGA 3X2EA 4KQXA 3ZU5A 1XG5A 2FN7A 1Y6JA 4II3A 3X2FA 1P1FA 3K2EA 3R1IA 4GWKA 4AJNA 5T57A 3VVBA 3K6JA 1E77A 4BS9A 1NX6A 3NTOA 3C8MA 1W6UA 4CMEC 3V1TC 5A9RA 3MJEA 1AXEA 4M55A 4B3IA 4MKZA 3ZWMA 1ZK0A 3ONDA 4OGWA 1F8FA 1N1GA 1YGYA 3CXRA 3KLMX 5BQFA 4WLUA 3OFSA 1JU9A 5CP8A 3HUDA 4RVDA 4P8RA 3IP1A 3TZQA 1ML3A 1YB4A 2AW5A 3GA0A 3VH4A 5KJ1A 3PHIA 4K1LA 5IXYA 1Q0LA 1GYPA 2IDZA 1D8AA 1EVJA 1Q7CA 4WNCA 3KZVA 3JQ8A 3PRJA 4ID9A 3DZIA 3A4VA 3RJ5A 3ICPA 4RPKA 4ROSA 4O0LA 1LDMA 2G5CA 1N1EA 3I9OA 4RLSA 2JFFA 4IY1A 2YW9A 1OFGA 4MIOA 2JHGA 3A1NA 1Q2XA 2YFHA 2HKIA 1DIRA 4KZPA 3KETA 3ROKA 4FSHA 2AG5A 1G0OA 4NI5A 1NR1A 2EGGA 3H9GA 4MVJA 2BLLA 4AVYA 2VOJA 4I9UA 1Y9AA 1ONNA 3QE3A 4PVCA 1B3RA 4PG5A 1GFSA 1Q1NA 1LQTA 2BFMA 1C1DB 1WZIA 4MIYA 1J6UA 2AQIA 1MC5A 1V0JA 3OMLA 2NACA 2J6IA 4B4OA 5JPIA 1LRLA 1SZJG 4O5OA 4BNJA 4KUHA 2B37A 4J9VA 4NH4A 4YJHB 4MPDA 3UN1A 3GHYA 3PYXA 4JK3A 1KEWA 5TQVA 3F4LA 3QRWA 4BGIA 3FWZA 3B1FA 4A73A 3H4VA 1IPEA 3FPLA 3QHAA 4YJGA 4EDFA 2FPPA 3OETA 2OZPA 2Y1FA 1WZEA 3JQ6A 4PLFA 4CM9A 1DO8A 3PWZA 4KTVE 2O3TA 4Z0TA 4N5LA 5TGDA 5HS4A 4Y8VA 1PJ2A 1N9GB 2A4KA 4IIVA 3TDKA 4IDCA 3NT4A 3K5PA 4L8VA 1JW9B 5FI5A 1RWBA 1T24A 5JYAA 3QJ5A 1DFHA 3WQRA 4E5PA 3NDRA 1F12A 4NBUA 4UUOA 2C29D 1QLJA 3Q3CA 4UREA 4XGKA 2WYVA 5TIIA 3VH1A 1KC1A 4L4XA 2EERA 1HWYA 1NFFA 3PHGA 3C7CB 3U4HA 5KJCA 4CMBA 3RFVA 4BO8A 4MINA 1JLLA 1GZ3A 1MX3A 1TT7A 1WDKA 1PGNA 4S1VA 4CV2A 5THQA 1AUPA 3NTRA 3KB6A 5B37A 2Q49A 1HDXA 2I67A 3RFTA 4RCVA 5JDCC 2JFHA 4BVAA 4OAQA 2O3RA 2CF6A 4OXYA 1CYDA 4ZN6A 1T2EA 3FBGA 3TF5A 3SC4A 1SEPA 1YBVA 5CPFA 3M6IA 1QV7A 2G17A 3IJRA 4XDYA 3GDGA 1E6UA 4D0SA 4GX1A 3U4CA 3DHNA 5DBFA 3RAJA 3O9ZA 4OHUA 3BIOA 3DZHA 3GLQA 2JD2A 4G81A 4ESOA 5JW6A 2CF5A 4CQMB 3LSYA 3ITKA 3H9UA 3TQHA 3ETGA 4L4SA 1T2DA 3R3SA 4LCEA 4FB5A 2E4AA 3U09A 3AM3A 5BSEA 3GUCA 4YAJA 1GUZA 3BTSA 1PL8A 4URFA 3RC9A 1UUFA 1X14A 4WEOA 7ADHA 3L77A 4PLCA 1A5ZA 3VPGA 4TWRA 3PQEA 1IOLA 2V6BA 2I99A 2BFPA 1T2CA 2GN6A 1WW8A 5FF9A 1NVGA 1U5AA 5KJEA 2ZTLA 4K6CA 1GY8A 4AJIA 1I2CA 4AJKA 5FFFA 3W4JA 3ZWYA 3IQDB 1H6CA 3PJGA 4A5OA 1D3AA 4CLOB 1LSOA 2QRLA 4JLWA 1X0XA 4W9NC 1NAIA 2YV2A 5TJ9A 4EJ6A 5L4LA 4FIZA 4J1TA 5ER9A 1FDWA 2C20A 4QECA 5CEFA 3RASA 1ULSA 2Q4EA 1DC5A 3AM5A 1UDAA 2UAGA 1ZH8A 3OF2A 3R3JA 1ZEMA 3D4OA 3UCEA 2VNSA 1YE3A 2VYVD 3OJEA 3KSZO 3OBBA 4HY3A 1P3DA 1SOWA 3PTZA 3BTVA 4E2WA 5CDYA 3WLEA 2CDAA 2AQ8A 5K6AC 4L0QA 3PIDA 1UDCA 3HG7A 4YACA 5GY7A 4BMVA 4NBWA 4PLVA 5FEUA 3S2EA 2PLAA 2X0IA 2G76A 4DIFA 2XXJA 1TB4A 4E21A 4BHTA 3CZRA 3QA9A 3BMCB 3S2GA 2X1HA 3KEOA 1HE3A 2HK7A 3RKRA 2YHIA 3D5QA 1JAXA 2YYYA 2PK3A 1XSEA 2NVUA 3NUGA 3PLRA 2DLDA 2HCTA 3O8QA 3DC2A 3H7AA
chains in the Genus database with same CATH superfamily
1MJHA 3T0GA 2WDZA 1O8BA 3KBBA 1GO2A 4JI8B 4G4GA 2E9SA 2PX5A 1EK5A 1Z74A 5EWLB 2A9QA 2OHXA 5JJIA 1LA2A 1SVSA 3DOEA 1DFGA 2UKDA 4QIHA 1XWWA 4TMWA 1TQHA 1AD2A 3AHCA 5LXTB 2AXQA 4CHTA 1ML4A 2O5VA 3HN2A 4H16A 5EZYA 3OF5A 3D4LA 4IOLA 4KPEC 4LX0A 1I9CA 1S2OA 2NM0A 2C1XA 2RHDA 2O4CA 4HVLA 4JP5A 2EKQA 5JH7A 1KFEB 5J2UA 3B20A 3HM9A 2ID9A 4XVCA 4E3WA 4BGUA 2N0SA 1DNPA 2Z0MA 3NBXX 2VCEA 4J2OA 2FUG1 4TVBA 2OV1A 1BXRA 1R0BA 2EATA 1M2OA 3RS3A 1CY0A 5FNVB 3WRVA 1H5UA 2MIIA 5G0UA 2Q2VA 1RBMA 4AU1A 2FRDC 1U2DC 1YO6A 3KR1A 2TMGA 4BNDA 1WCYA 4KXNA 4DIUA 1XCOA 1D9XA 4DKJA 4LMRA 3EXHA 3WYDA 2P75A 1X1AA 1JLHA 3B53X 4DQUA 1V5WA 1YUNA 2YMPA 1TYDE 1TYBE 4OIMA 3WL8A 5LQNA 3R0XA 3UJ3X 4TLEA 4ZO6A 2BISA 4FHCA 1FTGA 1PHPA 5ITVA 5DW0A 5J2TF 4D9FA 1C0PA 3LDUA 4X65B 3W5UA 2V6GA 1SKAA 2CK3A 3AERB 4GMHA 2LCFA 1UODA 1U8AA 4NZNA 3RIEA 3WLMA 3ZW7A 5FAKA 5DTEA 3N2YA 4BMXA 5LDDC 4WL0A 1Z4IA 1IWPB 4BBJA 3HB5X 4TL9A 1NDQA 3QWIA 4PWYA 4DLXA 1O5OA 5I8PA 3PEYA 2D3WA 4YUZA 1YVUA 1EXWA 3IXLA 1ZM2A 5EHGA 2QM3A 4EJ0A 1POWA 1FQOA 3PS9A 4K9QA 5JNVA 3KO8A 1L5RA 4R9RA 1ATZA 1J0BA 2AR7A 4KGZA 4Z0NA 4DVGA 5ENDA 4BGDA 2A1UB 3HDVA 4TSFD 2FHPA 1VJ1A 2XUDA 3ESDA 4QLOA 1QYRA 1UBNA 3SZRA 3UO8B 5IX8A 1BRMA 2QRZA 4P2GA 2NU7A 2PL1A 1KJYA 4P2BA 1Z47A 4GWLA 1T0PA 1PJLA 5G0VA 4KWEA 1KI6B 2V03A 3JZMA 1UKZA 1XQWA 4YGXB 4QHYA 3M49A 4GPAA 1XTVA 1TAUA 5I9SA 1KMMA 3QE9Y 1QFJA 2Q6IA 1XJWA 3PG5A 2NNWB 1FMCA 4PWZA 4INAA 2A59A 3OI7A 1C80A 1YDHA 4G8BA 1REQA 1N5DA 1ZJ5A 3ZE6A 1FRNA 3BCSA 2IELA 4U3JA 2CVHA 3OF3A 1NLFA 3SGLA 3CKLA 3JVEA 5IYZF 3GR6A 3V1KA 3GVHA 2XDQB 3O8OA 2XYVA 3BBPA 1Z6ZA 3BB3A 3I92A 1RW4A 4FFWA 2WSIA 4R8SA 2QN2A 5ALYA 1G9XA 3TZHA 1N7HA 3RTGA 3AIKA 5B3LA 1I13A 1LI5A 3OURA 1XE3A 2BEKA 5DNCA 2YW2A 2Y92A 2QYSA 3EOBI 3BMNA 4DB4A 2NUBA 3EW7A 5KEIA 3IH5A 2COKA 1CQWA 4MW2A 2BKXA 3F67A 3OCJA 3OPQA 3OPYI 5EG5A 1XVTA 4B87A 3G8BA 3L6CA 3N58A 4BRSA 5B6JA 5AVRA 3SZUA 3UK7A 4RFSA 1ZSVA 3B2QA 3H6KA 2J4CA 3GFQA 3KLBA 3SZGA 2HJSA 5HTKA 3EPBB 2GLTA 4LJRA 4FN4A 2CW5A 3D3WB 3SQDA 4KWHA 1RACA 4I8IA 1ECCA 4ZXFA 4F96A 2MSNA 3D6VA 3LUKA 1QHFA 4PRKA 1XZAA 4NENB 5B1IA 2JFUA 4RHCA 3GVCA 4CLHA 3TQRA 1I7DA 4O1MA 1RLUA 1C9EA 1NSTA 2WM2A 1ZNQO 3HACA 1JYSA 3TL3A 5ALWA 4V1CA 1V16B 4HZUB 4MV4A 1R6BX 2FUG6 2ONYA 1QFSA 1F06A 4GLOA 4XDGA 4DMLA 3BS4A 3ZV7A 3T5AA 1MEJA 1FFEA 2ZI6A 1GPUA 1C0IA 4A82A 1WHSA 1E89A 1U0HC 3NRCA 1US8B 1SUFA 3EMKA 5K6TA 4BCDA 1E6KA 1NUAA 3G9UA 3JAWA 3B9PA 1RHQA 4QXAA 1LB1B 4RK5A 4YAWA 5KWJA 2DY0A 5CLGA 1PVOA 2BP7A 4IRXA 1F48A 2HJWA 3CLVA 2G1KA 3H4TA 3VZDA 2HNAA 4H2DA 3X1JA 2XHEA 4F3KA 5ADVA 5JY1A 3RCBA 4L22A 4KOEC 5L4SA 2P2LA 4YJDA 5JJLA 4XGQA 3VH2A 5FNVA 2CZGA 4EG6A 2OVBA 4YRQA 1HTBA 3DLPX 1EBBA 4Y3UA 3F3YA 5AVQA 4M9XA 1OTXA 3N6RA 3IJEB 3RGGA 2V7PA 4H7HA 3HA5A 1PR9A 3DZ8A 2C4UA 4RQBA 3F90A 1B14A 2YN0A 3KWFA 4N5IX 4QBGB 2PO5A 3IR7A 1PEDA 5LU8A 1EVLA 2YS6A 1V37A 4DM7A 4JQCA 1QQBA 1MIOA 1RWOA 3C16C 1CSEE 3JARB 5JSZA 2PRJA 2J87A 3RFCA 3EIUA 5TARA 2AJTA 2WJGA 1XNJA 4INPA 4OGFA 3RRFA 4Z7OB 3W77A 3STYA 5I45A 4V1CI 1KAOA 1G5TA 4O4IA 2NPFA 1M6HA 4ZAYA 3HYTA 2WM9B 1NKVA 4RO0A 2IPLA 3L79A 3O3CA 1NBAA 5HFNA 2ODEA 1E8MA 1XRNA 1GG5A 3JZFA 2MR5A 1H9AA 2IP2A 4PZDA 4UE2A 3SSOA 5KHLB 2PWZA 1RI2A 1EK2A 2HO4A 2VJPA 3NPMA 1ORVA 3ZJUA 3DVAB 3Q1KA 5KKAA 2B99A 3EQ9A 3ZZ0A 5GZ6A 2HHCA 3AJEA 2WOJA 4MUNA 5CT9A 4DV1B 1KYTA 3EW9A 1E94E 3LUPA 2C9YA 1P18A 3BIXA 2VH1A 2HLDA 4M0LA 3RV3A 3KX2A 3WO1A 2CNOA 1O7JA 3U9TA 3NBKA 4WDQA 5ECYA 5KYXB 4KUGA 2R7LA 2ZU6A 2QD2A 1PYOA 5IF9A 3AVTA 4ZGGA 1OXVA 3QUTA 1U0EA 2H4ZA 1XMJA 4PX9A 3R3VA 3PUHA 4QUEA 1IHPA 3U48A 2XE4A 1YZYA 3TGLA 1CHNA 1SOMA 2F9MA 1HLFA 4OSEA 4CLDA 1K7YA 5EL0A 3WYBA 1RRGA 3SKXA 4A27A 3IULA 1C7EA 2PH5A 1JG7A 3DJFA 4ZFNA 1UT8A 521PA 1EP2B 1GARA 4TTJA 1W0CA 3D9QX 3QH4A 4H7JA 2GSWA 1LX6A 2RKWA 2GK6A 4PF1A 1KBQA 3E84A 1QH1A 2HZBA 4PPFA 2P27A 3IIEA 3ZY6A 1A5SB 1KMIY 1ONSA 4KQ1A 4UUNA 3E7WA 1ZBQA 4ZQHA 3VOSA 2YXBA 1LRKA 3AV0B 1NWCA 4ND5A 3W6ZA 2F1OA 4X93A 3IRUA 1TVKA 4MB6A 2JJ8A 4EG1A 1O96A 3EVAA 5IJAA 5CDFE 3AKCA 1I10A 1I14A 3K53A 5FWYA 3OT1A 16PKA 1K1EA 3B52X 3T1NA 4DILA 1EIWA 2I1QA 2NVBA 2EYUA 2F9LA 2I1WA 1GTRA 2G71A 1GAXA 3BGWA 1G2OA 1KI3A 1V8ZA 3LT1A 2ZRGA 4Y9TA 3GXOA 4B2LA 4BQEA 5CITA 1GXSA 5SY9A 4RE5A 3UB3A 3VGPA 2DR2A 3V5NA 3C6KA 1R8QA 3A7DA 4D5GA 3W34A 3KKNA 4A16A 4MS3B 3ADCA 5I5EA 1SCUA 3ZCUA 1ZXLA 2HA7A 4HXFB 3KT6A 4U7PB 2X0DA 4MYUA 5T7BA 2GJSA 2VWQA 5KSYA 1WMBA 3BJZA 3GU3A 2QW8A 2A9KA 1UBTS 3CISA 1OXTA 8ATCA 1YHZA 4F2DA 4KDCA 5SZJA 1T3LA 2ZIAA 3H3XA 3NVDA 3AETA 4XWKA 4I1PA 3EPLA 1EFAA 2RGNA 2Q07A 4KLRA 1YV9A 4R6WA 1A8SA 1Q74A 1W88A 4MO2A 3ZGLA 1IQ0A 3C8DA 2CMHA 2R6HA 1INLA 1VRCA 4LC9A 5J40A 3Q8LA 3HYNA 3V8QA 3NIDB 4AO8A 1GNQA 4RADA 1ZPDA 4N0EA 4QE3A 1EDDA 2V7XA 3SXPA 2GD0A 4X1OA 5LZ4A 1U2PA 3JQ9A 4XUCA 2BHRA 3I4LA 4XB1A 2PGDA 3L0PA 1W93A 2R1TA 4Q9KA 3FLBA 4KR2A 1W29A 1UXGA 2OXIA 5T4FA 2ODTX 2A0WA 3DDCA 3TDNA 4UM8B 3K8ZA 1OAAA 4PAOA 2DT5A 5TSDA 1GQ2A 3WK9A 2ET6A 2J9RA 2W5UA 2X23A 4N3AA 5IXJA 3VRHA 1ODJA 4EJ2A 3QX3A 2FWNA 4MKGA 1K68A 3UOAB 5LJIA 4NF2A 2CE2X 2WJYA 5DBEX 4ZAVA 1HTWA 4BIMA 4E22A 3K0KA 5D3ZA 4LZNA 3QIVA 1DB3A 2RCYA 4UOEA 3T3IA 4BO6A 4EUSA 1J8FA 4HX5A 5JD6A 1P1BA 4W82A 5BN1A 1UWVA 1EGVB 4UVIA 1EZ1A 4DIEA 1FFXB 4DC1A 2QROA 4DCOA 4EPYA 4X63A 3NAQA 2CNKA 3ABQB 1G5IA 3B8EA 1FDSA 4ZVQA 2VJQA 1YHYA 1WP9A 1JU3A 4E13A 1X3SA 4HF7A 4RQAA 2FNAA 5B2ZA 2ZS9A 1RYHA 2C0QA 3NXSA 1E6LA 1GYQA 3U49A 1KFCB 4YEDA 4YPFA 1QF7A 3B2NA 2JB9A 3GP5A 1DT5A 2X8LA 1L5SA 3H87A 3M8KA 3QFSA 4OI2A 3TRDA 4I99A 1M5RA 1IZZA 3OM9A 4GI7A 5JCJA 4FXPA 1Y7TA 2NV6A 3BE5A 4NP6A 3FJ1A 4GIBA 4MLDA 5FPQA 3SMQA 3NP7A 2WYHA 2OLJA 4E5DA 2ZYUX 1QTNA 2QRQA 4N6GA 1CY7A 2A5GA 2WZQA 3WYNA 1H8EA 5I7EA 4YRAA 1NY6A 1RAEA 1LF5A 1BDMA 2Y1KA 1HZZA 1PQYA 1LDNA 3C3YA 4AZTA 3E9RA 3N87A 2ZIXA 4BO9A 4Q4JA 1NBWB 3CUKA 4MCIA 4TMVA 3VR0A 3AEKB 2QENA 9MHTA 3RS7A 3FZNA 5HUJA 1U6JA 2O7NA 4CGZA 1GPLA 4NPCA 1N2ZA 4MVJM 1FTNA 3HKCB 3E1GA 1J00A 3SDZA 4MLCA 4ZGWA 4J7UA 2CNDA 1H3EA 1Q1ZA 2XUOA 3X43A 1R18A 3AFIA 3U3OA 2UYGA 1MB0A 1V71A 1SM4A 1PQUA 2XPCA 3EWAA 3UHFA 3PP8A 1E69A 2BRUC 4C2AA 4COOA 2G9QA 2V59A 2VHEA 4CDGA 4Z51A 3O38A 4E2XA 1I6MA 3BXPA 4US2R 1AQNA 1FMLA 2PE5A 2DAPA 3ME5A 3O6VA 4MGEA 2CJYA 2CZCA 4GEKA 5DDIP 3SEQA 3WKEA 1NVUQ 2GWHA 4HAZA 3PZBA 1QHXA 5IASA 1H1LB 2UUBB 2I4NA 2HLPA 3CA8A 1E8DA 4KQIA 2R7NA 5EPUA 2C00A 5L7WA 2EIHA 5J3JA 5GIOE 2CUTA 1IPFA 4FM9A 4GE3A 4U02A 1DDIA 1OE0A 4AQYB 3DKRA 1GAEO 1SU8A 2RFLA 1BHSA 2J5XA 3GROA 4B7AA 2VH5R 5LXTA 1EVEA 2SCUA 5JYEA 1I7NA 3KKZA 1NURA 4XI9A 1FS6A 2FPNA 1P19A 3D3JA 3PFHA 3V6MA 2GBLA 2Q8PA 3AF2A 1QKIA 2J3LA 4YQZA 1OXBB 5K0EA 1FP4A 3ZV4A 3OESA 1WDLA 2YWDA 4OP3A 5KSWB 3T1HB 2BZGA 1ZMTA 2AVDA 4TZ0A 4UDYX 5JIBA 3P2MA 2O0MA 4EO9A 3GJXC 2O5CA 1H2XA 4RD0A 4YCLA 1NUSA 2FKNA 5E6UA 4Q7JB 2HR1A 5DX1A 2B8NA 4EG8A 3LMKA 4YJKA 3H83A 1E1KA 2A6PA 4OHCA 3FYTA 2FSSA 1XDSA 3BGIA 3TW8B 3R0QA 1KS2A 4AG6A 3ZZ1A 2VT3A 2C84A 3IMEA 1NP6A 1Z18A 3EHDA 2IL1A 1JPUA 3DOOA 1T10A 3P9IA 5B3AA 3SJ7A 4CFZA 2QTGA 4BRZA 1VKNA 1BZYA 2I8LA 1Z9BA 3DMDA 1RD4A 3PHBE 4HJRA 1G9SA 2IK8A 4ND8B 1XZHA 4Z8YA 4WMLA 3RTEA 1QFXA 3KOXA 2F1KA 3HJUA 4YDHB 1NT2A 2PRYA 1DHTA 2YZ2A 2CFRA 2QN3A 1JEDA 2EBHX 3HDHA 4WVLA 3TW6A 4DA4A 3T7JA 2HMSA 3Q1LA 1IHOA 3TR6A 3VC2A 3OECA 3K5HA 2WP8J 4UTXA 1RPJA 4H6VA 2DUUA 5HBGA 3EP4B 1AF4A 5A62A 3VNVA 1MJGA 1XLTA 4KJZA 2X2FA 1ZIOA 2G1JA 1KBOA 4DSAA 1RE1A 5MN6A 4L3OA 4WZBE 4YJFB 2G9VA 2Q7DA 3VU9B 2V8BA 1JHMA 1I5OA 2IPMA 1FYEA 3O74A 1SXHA 3KGDA 4Z8XA 4XIIA 4CIDA 2H65A 3ZGZA 4H1VA 3URMA 1XMXA 2GVDC 1VLJA 2RI1A 3W9BA 3U39A 3G82C 1P0IA 3OT5A 4LGMA 4UHEA 1KIAA 3RW9A 1E0KA 3FETA 3KOZA 4JUBA 1EI9A 3MCZA 4YT2A 1YHNA 4YI3A 1NP3A 2GHTA 2J7KA 1ZGAA 5H16A 1EHIA 1THZA 2CHEA 4N8EA 2F4NA 3EPPA 3S2FA 3JW8A 5AKYA 3EEIA 4WK4B 4NYJR 2J9FA 3PDIB 3SJAA 2IUTA 2QTAA 3QVMA 5ALRA 5TNXA 4DWVA 2OSBA 1J2EA 1P2UA 1KYIA 1QGUA 2C4TA 2GGSA 2L18A 2AFIA 3QF4A 4LWPA 4TQGA 5EJEA 1NE7A 1DKPA 4S1OA 5DHQA 3HUUA 5FR2A 3ZDYB 2RGDA 4X66B 4EVQA 1CRZA 3WIDA 1E98A 2BR3A 2BR5A 3AJAA 3RRXA 2AC7A 5IN4A 3CB2A 1CNFA 4RL4A 4XZ3A 5B3JA 3ROGA 1UADA 3GLGE 2VH2A 5EXDA 2RK4A 4PC2A 3B7GA 1UBCA 3CINA 4KLCA 3IHKA 2R48A 1Q1GA 4Q3NA 4NE2A 3AEQB 3R4CA 1EFTA 3JU3A 2ZQZA 4LJSA 4OGLA 3VYVA 1SHLA 3WWCA 3OZUA 1ECJA 1L5VA 5TPZA 5IUJC 2X1LA 3UGKA 5EJ9A 2XI4A 3Q9LA 4HCJA 1E18A 4KRGA 1HOTA 2FOIA 1KFBB 4BEJA 4DJEC 4XR4A 1N2JA 2PUBA 2SHKA 4RJKA 3NO4A 4RCZA 3KJQA 4WGGA 4WOBA 2G83A 5FOVA 1HY3A 4AKIA 2FZVA 2DPXA 2H51A 3C3XA 3MTIA 4Q9JA 3DTYA 4IEIA 5ENVA 1WF6A 1XLTC 2QKYA 2H4YA 4LJ9A 1E96A 3ZWAA 1ZL0A 2C61A 4HDQB 3ZHQA 4ENVA 1KAGA 1M75A 3IBYA 5PNTA 4CKCA 2R1VA 1IY9A 3EISA 4NMWA 1OHHA 1PZHA 4M4SA 4UVGA 3WWEA 4BV8A 1U8EA 1FQJA 1NR5A 1VMKA 5HG0A 5LLTA 1Z56C 5MHTA 2Q1XA 3JAKA 1E9SA 1KKUA 1Q20A 1Y3DE 1O6FA 2W42A 4UBLA 2Z9BA 3IAS1 2OCIA 2VHTA 2QUKA 3OEWA 4KAXA 1FZQA 4CNBA 1WETA 4WJKB 2PA0A 3QPDA 3OSZA 4OHWA 2NOAA 1BMDA 1ZGJA 3TEJA 4C03A 5KVQA 3AUTA 3L6DA 4MRMA 4HX9A 2GHRA 5CLFA 5G4LA 2OGSA 4YJHA 4PIPA 4RIIA 2YKGA 2BUAA 4FZ3A 4RETA 4XUEA 5A0FA 3EC2A 4K9DA 3CG4A 4KXYA 3A70A 2HMAA 3CUEF 4AUKA 2O2YA 2HREA 4MI3A 2AFIB 1C4WA 1L4UA 1ZUIA 3ZCRA 3WSTA 1XU9A 3LHSA 2M2IA 2BGUA 1G21A 1VHDA 3QKRB 3WMWA 2Q41A 1NVMB 2FX2A 4RORA 4YP7A 3B2EA 1XNRB 1ZD9A 1YZNA 5TB5A 1IDOA 3WMEA 4JVNA 4B6OA 2P9EA 3HLYA 5TVKA 3RU3A 2CJWB 3NAGA 1CEYA 2GAFA 1PFUA 3RUCA 2KQUA 4P7BA 4JI3B 3QW4B 1SHJA 1UZLA 2NXCA 1MVLA 3K1ZA 3W2EA 5A3VA 4B44A 1NVFA 4C87A 4B81A 3TS1A 2XVMA 2Q4DA 5G4KB 1TLLA 4JP2A 3GA5A 3ISTA 3TMYA 5BR1A 5C9ZA 3DBLB 1IJFA 2JLYA 1QTQA 2O0LA 1YJBA 4UFOA 4F97A 1M72A 2C31A 3PGKA 4NMMA 1V7ZA 2CLIB 4QDJA 3V2UA 2X9LA 4CU5A 2ZK7A 1HDCA 4A8HA 4B3FX 3E22A 3KL4A 3Q12A 4YJ2A 4JIGA 1K88A 2C5EA 2XB8A 3TZKA 3QXCA 4YJ2F 1YT5A 3K8YA 3DXZA 3FF4A 3OIUA 5DT9A 1J90A 1YRLA 2WFLA 4MUBA 4DYVA 3JYOA 4RA9B 1FJ2A 5P8WA 2YICA 4DSNA 2D6FA 2QW0X 4HGOA 2OC9A 3SWWA 4PNZA 3GEGA 4RABA 3NC0C 5FYQA 4BMDA 2P2YA 1FXSA 3WHKA 3V9PA 3K5IA 3D8RA 3T7RA 1ULBA 3UMVA 1DXYA 2DCMA 3BD7A 5EHIA 1A1VA 2JKZA 1ISJA 1B2LA 1GZ6A 1D4AA 1NIJA 2BDUA 1WVMA 1Z0UA 3K9NA 1KQOA 3OMXA 2ALJA 1RYZA 1YI8A 3JQGA 3PWTA 1FB5A 4YWHA 3Q6IA 5CTJA 3UHJA 3DXYA 3VH3A 2CLOB 3WJ7A 1BVUA 4Q48A 3TPCA 1MAHA 4DCCA 3RUEA 1N8TA 4MQ4A 2A1UA 4W5RA 5AM2A 2FMIA 3NHFA 2C5BA 3HBFA 4YDSA 4BLSA 2QVLA 5K8JB 1CR1A 3HKEA 5FEMA 3V80A 2O6HA 2YJGA 4KP7A 5TMBA 3WYFA 1SUWA 2GEDA 2K6GA 2HQSA 5JNRA 3DH0A 1O8CA 3IUSA 4UE3S 4LDJA 3KQYA 2F55A 1RM4A 2VUHB 1Q0ZA 4FP9A 4HFNA 2WB2A 1N4DA 1PJ4A 1L5WA 3QY0A 4X5OA 2W2LA 2QT1A 5AQEA 5L3SB 2QDKA 1BD3A 3LI2A 4PR0A 1XTPA 1RCTE 4LPKA 3UA4A 1G1AA 4A0GA 5IC4A 5FUVA 5K7SA 1KZHA 3BJRA 5C0OE 4BZPA 2G28A 1K66A 2JLCA 2FZ4A 1J06A 1QVAA 1UIMA 3PI6A 3A3KA 1C7IA 2PRIA 1GPDG 1VYVA 1YFZA 1M0EA 1IONA 1S7GA 5H02A 1W73A 1J7JA 4G65A 4TT3A 4ZHSA 2IHKA 2XB4A 2GN9A 2UZ4A 2HMYB 3EXHB 3A4YA 3Q3GE 5FTKA 3ZX4A 4B47A 3FZYA 1PKXA 1ZSYA 1PKEA 1II9A 1GD1O 2ATIA 2VNKA 5EMNA 5IJ9B 3OU6A 2C7QA 2ZRAA 1GL6A 2QF7A 1A8UA 2VF5X 1Z5ZA 1B8NA 1MX9A 4LVUA 4Y6OA 3G2LA 3TMAA 4LDPA 4MWSA 4QOGA 4CV3A 5FDFA 1NXSA 2GN2A 5JD3A 2WQ7A 4FOLA 3DL0A 3RIGA 1VMEA 4TQUS 3LHKA 4IRMA 1KE1A 4G1FA 1OI2A 1ZOSA 2XE7A 5AH0A 3DMNA 4FC6A 3DBOB 4MKIA 1CVRA 1HYQA 1ORWA 1QIGA 1R8YA 2FV8A 3OUTA 3VZQA 2C1EA 4CLEA 1GCGA 1ZC3A 3VZBA 2P3LA 2XUAA 1U80A 4N6NA 2RKBA 4KCGA 4LI0A 4RK6A 3BOSA 4M0CA 1IZYA 2IHNA 4BNZA 1U4SA 1PEKE 4PS0A 5BW4A 2VA8A 3HY4A 1LF0A 4MUXA 5G1OA 5DU2A 4DZRA 5L3SA 2XVAA 1KXZA 3Q8WA 3HRHA 3UAWA 4YMTA 3KBOA 1PQPA 4LXQA 2OOSA 2J6BA 3QVVA 3AU8A 2YCBA 4FFVA 4B4WA 4LHZA 4IPTA 1XEXA 3VJKA 1IVSA 2C4VA 4D74A 4F85A 4YCBA 2IYZA 4AYTA 4XE5A 4NOKA 3HA7A 2UZ0A 4LOHA 2BFDA 2YVKA 2ZT6A 3DL7A 5D5HA 2GTHA 3DO6A 3A31A 3SIPA 3STXA 4NU0A 3UCXA 3HB4X 4ZIRB 4AMGA 3KKOA 3EASA 4TLBA 3SM3A 5G0SA 2ZBPA 4ITRC 5BY2A 1BJRE 2L42A 3QP9A 3HI4A 2QZ9A 4DR1B 1O95C 2VTVA 2VSNA 3L40A 2BSAA 2EARA 1FSGA 2X0EA 2Z2ZA 3ZH2A 5AJZA 4DM4A 4KIJA 4Z1MD 2JH8A 5F52A 3KZNA 2IHYA 5AKXA 1P1JA 3JYLA 4E12A 2FN8A 4BV9A 1YDEA 4GRDA 4G4JA 3SYMA 3RUHA 1TYCA 3F9CA 4NCIA 4K6MA 2V65A 4Q3EA 3NIGB 3O94A 4MYRA 1QR2A 4CM9D 2FPWA 3ZJVA 3UPUA 3PU6A 3GGGA 4EAQA 1W49A 3LDAA 3ONNA 4DPLA 2ZZKA 1XU7A 3LQ4A 4AZWA 3ABOB 2JK0A 4G56A 4RQUA 1M1YB 1C8KA 5DNVA 3KQUA 1GRRA 2A58A 5AQ1A 4L76A 3DYIA 3MWFA 5K51A 3SKYA 1JR4A 1L1RA 5B64A 4QFBA 1FX1A 1V8DA 3TSAA 3OG9A 1VSVA 1U8TA 3F0TA 3QFCA 4C5AA 3NBAA 2LDBA 3F1LA 5M04A 2EBFX 4YMIA 4Q93A 3TEMA 3QLVA 2PUEA 5EE5B 5A4AA 3E2IA 3NS7A 1CJKC 4I5IA 1JAYA 3SVZA 5TX7A 5AJYA 2O2JA 1CZOA 1E1DA 2FGJA 4MUYA 2CDNA 4ROTA 3GJSA 2EHJA 5KQSA 4IKOA 1S8AA 2ZI7A 4HFRA 1R6TA 5K3FA 4RH1A 3GBVA 2B94A 2AEFA 5AHXA 2BYTA 1AZSC 3H5LA 5KPDA 1T4CA 2P9TA 1YDWA 2YL2A 3AH8A 4GOKA 2GJAA 1EJBA 4FZRA 4DHEA 1E3SA 2PTGA 3D6HA 2WD8A 1XRQA 3PDJA 4I5GA 5BR7A 3HR4A 1W48A 3U1BA 4UEQA 1QCCA 3OEHD 3O5AA 4BWFB 3UUGA 3G9QA 4ZCRA 1SCKA 3RRMA 4IV8A 1L6RA 3KG2A 2RGXA 3HHEA 3PK0A 3SBDA 3DFUA 4DM3A 4DNFA 2EAUA 4UNNA 5F9HA 4GMFA 2Z6VA 3LW7A 2Y1EA 1CLEA 1RZRD 1CG6A 1XZGA 2QRVB 4V0SA 3QTBA 1C9DB 3O2SB 4PHTA 4IDDA 4Y2YA 5AVJA 2WF8A 1FX0A 1T3GA 2R96A 3JWGA 3K6SA 3M82A 3I6IA 3BPSA 4QBIA 4R8MA 5H3CA 1TVKB 3MRSA 4IUBS 3B48A 1F9EA 5B3JC 2BGGA 1EK6A 4JUAA 4ZDJA 2CZQA 1GDDA 2V9CA 4ZO9A 4A92A 4ENTA 1A3CA 1IM8A 4BAZA 3ID6C 1YFLA 2OL4A 3IV6A 2MMGA 3ZGOA 3IVGA 5H59A 3IEPA 4QTZA 3UNXA 4E6EA 4CIYA 1KETA 2NX2A 1QG4A 2CNWD 3LPAA 4HPXB 4MEBA 1YJXA 3RAGA 1XUOA 4OHOA 1E2BA 2XVYA 4M98A 4FX2A 3RSCA 1QRAA 1TL7C 5LP1A 2H52A 1AKEA 4DCPA 3GRFA 3JALB 4WADA 1ODIA 4JI0B 3E0QA 4AKHA 3F73A 3T12A 3FGNA 1ZU5A 3EXEA 1V3VA 3RRNA 3SHFA 1GRCA 2OHIA 4IG9A 2DECA 1ZW6A 4H35A 4Y2GA 3UPDA 4ZCSA 3OQOA 1N2CA 1R6VA 1Z68A 5KYKA 3CJRA 4G67A 3DFFA 3G2JA 4HD8A 4GBED 1D2AA 4L78A 5LWQA 2JGAA 3WBFA 3I2KA 2XNSA 1LDGA 2CNBA 4F06A 3RNOA 1JWAB 1YA4A 1GDHA 2Y6VA 5AKLA 4RIHA 4EUEA 4Z54A 2JL1A 5HOEA 2JFXA 2XMQA 3HNRA 4HO1X 3QENA 2A5JA 5T8KA 3W4KA 4F60A 3SBXA 1W1WA 2GCGA 2J6CA 4K05A 2FJUA 4H6XA 4ZEMA 1VGVA 3WK8A 1JI3A 1TEVA 3PC2A 1KMHA 3TCNA 1TKBA 3E23A 2FI1A 4AX4A 4F21A 4B0PA 1RWPA 1M54A 1AKNA 4NBVA 1XDDA 3GO4A 5TJHA 5FTLA 4YUVA 3DXFA 4LZLA 2QD4A 4R54A 2O4UX 3SR0A 2OCAA 4IRUB 4BO5A 4ESVA 1FBNA 4ER5A 3SHOA 2PX8A 4R2HA 1XMOB 1BFDA 1YE8A 4GOMD 5LPNA 3RTCA 2WTAA 2CNLA 4U39A 4ZT6A 2JFBA 3ZVLA 3H0VB 3E70C 4EY8A 3DE3X 5HUHA 3PUYA 1WRBA 4L2IA 3KPWA 4J7AA 1DWUA 4D4IA 4MQLA 3THWB 4UTNA 2GYUA 3EPHA 1NFQA 1H2YA 1T5TA 1T0IA 5LCXA 4CKXA 1Q0RA 1RRFA 1JFLA 3K3PA 3NJ8A 4EM6A 4WJLA 4RZSA 4YT5A 4F86A 2BDTA 4N0DA 3QKWA 1Q2UA 3VJRA 1OGJA 1EXNA 2X8JB 4MRRA 3ZY3A 4ZAFA 1ECFA 9LDBA 1VMDA 2WFAA 3RYCB 2EJBA 5B58C 4K6KA 4Z0PA 1MC8A 4FGSA 1L7PA 2GNAA 4MARA 3L7YA 3H65A 5AM3A 5IKEA 4TKVB 3ORSA 5KOIA 3UJNA 3U4QB 1SPBS 2XHZA 2QL9A 5CYGA 1TUEA 3BE8A 3SR4A 2VZLA 1O9BA 1AS3A 1EFDN 2O23A 2ECOA 1Z5UA 4YRDA 1YBMA 1SBNE 3QY9A 2DKNA 1WNFA 4NBNA 4QREA 2WC1A 4PHCA 2GZDA 4US1R 2VJAA 4H7EA 2Y0PA 1N2XA 4R31A 3UB2A 3L0ZA 4QUHA 3V2GA 4CEHB 3PNYA 1DCTA 1IWBB 1DG9A 2IXEA 1GNSA 3ECSA 3IQWA 3IVMA 4CMGA 1R8JA 3ANMA 2YXDA 3DD1A 4GZLA 5I4BA 3VNSA 2P77A 1VE7A 4NKRA 2IIVA 5FULA 4FEYA 4QPJC 3ABIA 4RVHA 2IXDA 2XGJA 1IXZA 3EVDA 2ZJFA 1IHDA 4HN9A 2NSHA 5DOZA 5TQ0B 4BVLA 1SZCA 5CCBA 3EBOA 4J94A 3G85A 2XA1A 2HRRA 4LBYA 3IPRA 2IY7A 5C35A 3K31A 2YN2A 4LDAA 1LNZA 1PS8A 4Q1FA 2B7LA 1GZHB 1U1IA 4UAUA 4E1AA 4CT0A 1JH9A 2E87A 6NULA 2DBQA 5FXMA 1QYDA 3WOHA 4CKWB 4N76A 2DH5A 4PGMA 3V48A 5CEJA 3DLHA 3BHMA 2LWIA 3EGDB 2E2WA 3OZEA 3GGOA 3B1KA 1TF7A 2RHTA 4O2BB 1J8QA 2K2WA 2CEKA 1OX4A 2R60A 4YRLA 3KLOA 1L5QA 4OSPA 3OFJA 3ZV3A 2AQHA 1JDPA 2BD0A 1G7CA 1PRYA 4HVCA 1A88A 2QMOA 5MN4A 2JEZA 5JRJA 1C8LA 1RBYA 3ZC3A 4O0MA 4IZ6A 5AI4A 1EWQA 2C07A 2JFOA 3L7IA 3OFNA 1V1MB 3OIYA 3A4MA 1MTOA 2FWAA 4CMIB 4MMYB 1GNRA 4HB2A 4YASA 3V7YA 1ZM3A 2X0NA 2G40A 4TYWA 4QX6A 4YCCA 4YRSA 2POCA 4K1XA 3HXOA 2QK4A 1L1QA 1E3DA 2YXPX 4ZDIA 1Q7EA 2CFCA 2G4VA 4PLWA 5B1DA 4N5HX 1YQWA 1WS6A 1SCDA 2ZLBA 1J9EA 1SFRA 3BH6A 1TM3E 2FPRA 4NMLA 1SVOA 4GI5A 3VR5H 1EWKA 3UT6A 1O6ZA 2CLKB 5FOQA 1RAHA 2ACVA 4C4YA 2XNJA 4AULA 2FFHA 1RJ9A 2QL5A 3K09C 4WK2B 3MHPA 2PNFA 4NFSA 1UQUA 4UZFA 2DWPA 4O2AF 5KDLA 4ZVRA 4O4HA 1ADFA 2CMFA 3LX4A 4ZTUB 1O95A 3HCBA 3WWZA 4LNUB 1W76A 3FFXA 3ZD8A 1C9MA 4TKVA 4B80A 5BNTA 1ESNA 3N3AC 1A7UA 5GAJA 4CEIA 4MPPA 3FKSD 4AYXA 7MDHA 3IUPA 4CMEA 3LVRE 4C0LA 2OFWA 2QL7A 1VIVA 3TGPA 2O7RA 1I24A 2XY4A 3QXGA 4XX0B 4B71A 5LUAA 3L1VA 4Z4QA 3DZ6B 4YGYA 2K7FA 3B6EA 1ZQ9A 1DCFA 4LF8B 3LPDA 4JOQA 4EI9A 3AL2A 1WTAA 4FMPA 5TXGA 3RWBA 3HCFA 4C04A 2DRIA 4Q4CA 4F91B 5IVKA 1Y8QB 3IXMA 2WVAA 1GEEA 1UXOA 1YR6A 1RE0A 2XDYA 3HUFA 1AQIA 3NEYA 4KO4S 3PFIA 3R20A 3CG0A 4WWHA 2BPOA 4DG8A 1BJTA 3FKJA 4Q3DA 3O82A 3JD0A 2GPBA 3IOCA 3JSAA 4QU8A 3SYLA 2YJ4A 2BMDA 5A4FS 4MHSA 1TGVA 4LTNA 4TGLA 5DB4A 1KVRA 5KYVA 4OQEA 4BYGA 1RKXA 2ZIXB 3TUTA 1XQ9A 1J8DA 3NOQA 1XMSA 1HYHA 3RIXA 4Z1OA 2ANBA 1QTRA 2ZTVA 3HCNA 3LS2A 2P5TB 4Z4HA 2F43B 2XWBF 2PT6A 3WTBA 4CIAA 3GUZA 5C4GB 1VPDA 4UEKA 3TZEA 2XZPA 2Q9BA 3LCRA 3W05A 5ERGB 2DQ4A 3KZOA 2CN1A 2ZJYA 4YCJA 4J1NA 3ZDAA 1U90A 2QR2A 2VHZA 3FIJA 3M0EA 4ZK6A 3WO0A 3Q7IA 1NVVR 3DKVA 2PX6A 3MNFA 1WHTA 2GASA 4DS3A 1MRNA 4XCQA 5KNCA 5AJHA 3MOSA 4HXGA 4BNYA 3DTTA 5AVVA 1OJLA 2IH2A 1VCMA 1DOZA 1NR7A 4F71A 2MJLA 4GZ6A 2EP7A 1EGHA 1PF7E 1GUBA 1KYXA 4FSDA 1P9LA 2DFTA 1RPZA 1NMSA 3B8HA 3TZCA 1M2VA 2FU5C 3VPFA 2OK8A 4AB1A 4QA9A 1X2BA 3VHQA 1VC2A 4RHUA 4Q37A 1V9LA 3QNWA 2KS6A 2IDJA 2EEPA 4HH3C 5IT5A 4EKIA 4DC0A 5CLJA 1GP2A 3H9QA 1ZOOA 3LLUA 4OQPA 2VJLA 3HPRA 4PNHA 4H3VA 1GQYA 5IZCA 2EP8A 1MQ9A 3KUDA 2LV8A 2BM0A 3PWKA 4MW1A 4Q6BA 4URUR 2X0FA 1IEXA 1R4MA 3U4DA 2JGDA 1Z62A 4EFDA 3R3XA 2NADA 4YMHA 2P4EA 2BGMA 2Z2IA 4JB0A 3GZNB 3F6YA 3C1OA 2UUPA 1XA0A 2ZUDA 3UXMA 5JFGA 2CV2A 1FYWA 1NUPA 3AY7A 5IULC 1VCOA 3KQLA 3INYA 3EZYA 3P9XA 3CRNA 4IO1A 1ICEA 3GUVA 4IMJB 2WE8A 4LAFA 1Z07A 2C5GA 1DV1A 1KPHA 4MV7A 1CRWG 5K2MA 1JA1A 3IWCB 3DE2X 3WHIA 4OAPA 4BLRA 5J1TB 1XYVA 2AZ4A 4MW4A 1ENYA 1O94C 2EIXA 5T6MA 3UKJA 5K1ZA 4EJSB 4RMHA 2GB4A 3GEPA 3TMKA 3T7TA 1YULA 2WJAA 4J7CA 3KQMA 5COAA 5TR9A 1F1BA 2Z3VA 4C0BA 4LJKA 4ND7A 3L7LA 2QGZA 2ZJ6A 2ZRJA 4PAMA 4UU7A 3JPWA 1KYWA 3T0FA 3SS9X 2HSWA 4F4HA 4BGEA 5K99A 1PJSA 3PDIA 3FFWA 3OM0A 1FU4A 3BE4A 3JYQA 4YDRA 3VAYA 1JXAA 2O06A 1FUYB 1NDUA 1X19A 2H4JA 3GVIA 5IN5A 2Z5VA 2PX0A 1I6WA 3D8HA 2OAEA 3OPMA 5FL3A 1G5RA 4FR2A 3RK1A 2OCYC 3ASYA 4LHWA 3LECA 3NRJA 2PGAA 2DWQA 5DZSA 3B3QA 3KKEA 3TQCA 1JR6A 3WWPA 3C8UA 4QXPA 4TKZA 4C2UA 1XTZA 3SI7A 3WISA 3NXKA 2ACKA 4WFKA 4XEUA 4D82A 2ZS7A 3R0VA 4TMFA 3WNZA 2BFBA 4ZOCA 3GLIB 4I4TA 4AL4A 2QVGA 5JSKA 3LA8A 2PNJA 1GTL1 3VNQA 2WHPB 1WCIA 4AK9A 1K6XA 3I5XA 3UBMA 3L4JA 2Y9PB 3EFOA 1Z4QA 4AJHA 2GR9A 3PL5A 1QPBA 3RSLA 1QH1B 3SIWA 1BCRB 3EY9A 4U7JA 3TW4A 5E3HA 3K2QA 3JD1A 1KU0A 1QVWA 1M8PA 1F0YA 1RBZA 2FF7A 2QZSA 2VN8A 2Z8YM 3MLBA 2C7PA 1QZZA 1TJ5A 3I5UA 1N6LA 3WMFA 4MUEA 1WXHA 1ECGA 2ZSJA 2VPZA 1DEOA 1FFWA 1PE0A 1RC1A 2O2XA 1VSQA 4NC9A 2FEMA 3MWKA 3FPCA 4GPIB 2O59A 2R1TB 2JW5A 3T1TA 1OH8A 3CUTA 1JG6A 1E9VA 3PL1A 3N8KA 1TJPB 4R5HA 1KO7A 2HIMA 2JH3A 3C1UA 3LXUX 2QTZA 1DHRA 1ZNWA 4ZPXA 3ZNQA 4EITA 4ZEVA 3SNHA 1M7HA 2Q45A 4EHJA 5CCXA 1MDFA 1IAVA 2ZU0C 2I3BA 4FYXA 3BH7A 4JROA 3GMSA 4NTZA 1C3VA 1NYRA 4N39A 4Q02A 3AJDA 1DPGA 4TTTS 2GPAA 2VDLB 3OP1A 4U7HA 4EF6A 5KTSA 4IIHA 3JQCA 1XC7A 1Z4PX 4GDMA 3PNVA 1TTQB 3TRIA 3FD8A 1JMKC 4ZEOA 4ZQBA 2FG5A 5CFZA 3WNCA 5AK0A 4EELA 3B6MA 4GR9A 5BN3B 1OBCA 1G4UR 2VCHA 2VI5A