1C3VA

Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 73
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1c3vA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1c3vA01
3RC9A 1FDTA 5CDTA 1DLIA 1E3WA 3H3JA 4BHTA 2P9GA 4E5YA 5EINA 5BNIA 4BB5A 3QHAA 4RL6A 4II3A 5L4LA 3RD5A 2IODA 2GDZA 4BMSA 3ZDFA 2C59A 4IJWA 1J4AA 3IL2A 1HSZA 3L9WA 1Y9AA 2BI7A 3ASVA 3GC6A 3DZFA 3GF4A 2NU8A 4DRYA 2ZB3A 4EYEA 2HO5A 2O3UA 3P19A 1GYPA 2UVDA 1XU7A 4CUKA 3EYWA 4MVJP 1R4NB 3I9LA 1LDBA 1J0XO 4ZRMA 1MXHA 4H3VA 4ND1A 4Q3EA 2IRWA 1FJHA 4PLPA 4RJTA 1JW9B 1WDMA 1MXFA 3FPLA 3ZU4A 4B7CA 4MVJG 3IUSA 1E3LA 4CL8A 1A5ZA 1NVGA 3GHHA 3PI7A 5LDHA 4HFJA 4OXYA 1QYVA 2VTEA 1P1FA 1E7MA 1WNTA 4BO1A 4E2YA 2GO1A 2ILTA 3I9JA 4N18A 4JROA 3W4KA 1VJ1A 3QA9A 2BFMA 3E9MA 2EW2A 4D45A 5C7IO 7MDHA 3ABIA 4YJHA 3SVTA 2OBYA 3TQHA 1DBVO 4G2NA 2ZYDA 1DC4A 3NGXA 1NBOA 3H9JA 4XYMA 4B4VA 5DOZA 4BNYA 3JQAA 2OP1A 4PLHA 5BNFA 4YAEA 4J7XA 1E5QA 3L6DA 2WMDA 4TKLA 3M2PA 1EMDA 1ZH8A 4BNNA 2J6IA 3VPSA 4CM5A 1PS9A 1XSEA 4GBJA 4FFPA 1ULSA 3FCOA 5JCXA 1JKJA 1NPTO 1EK6A 4GWGA 3DL2A 4TKMA 1BXKA 3MTGA 4CV3A 2VHYA 3WJAA 3HFSA 1F06A 4MVJI 5A5EA 1P45A 1S6YA 4PZEA 3HJAA 3WXBA 4BS9A 1YH3A 4A03A 2X5OA 3CH6A 3UF0A 3OHSX 1I3NA 4DIBA 3IP3A 3I5MA 3D5QA 3ZWBA 5JDIC 4MO2A 4B4OA 3TOXA 1NFFA 2DBRA 1CERA 1EEHA 1L1FA 3K31A 3H8VA 2CY0A 2DBVO 3U0BA 3WTBA 3INRA 3AOEA 3ETGA 3UKOA 4UUNA 3L4SO 1PJQA 4KTTE 3LT4A 3DAPA 1PJTA 2BKAA 2PA3A 2ZB7A 4W7IA 5FI5A 4BNIA 4BQRA 2VWPA 4YXFA 1YE3A 4QQRA 3MTJA 2B5WA 4R1SA 3EGOA 5EJ2A 3TRIA 3OM9A 4XQCA 2GPTA 3CINA 1WDLA 4L76A 5B37A 3GAZA 2CVOA 4LRSB 3WNVA 4IS3A 1N92A 4XZ3A 3U5TA 1XGKA 2EKPA 2VN8A 3BMCA 3NKLA 3S2IA 5DZSA 1VM6A 3KYCA 4AICA 1SEPA 1M6HA 4YAIA 2PZLA 5DN9A 2GN9A 2ZK7A 5KJ1A 1QV7A 1YB4A 2CD9A 3NJ4A 2BI8A 1XCBA 4BGUA 2WEKA 4AL4A 2GSDA 1GAEO 2I3AA 2X8LA 4L9RA 2O2YA 4XDZA 3RI3A 3RUHA 1ZSNA 4OXKA 3ZU3A 4M55A 4DLBA 1E5LA 1EFKA 1MG0A 4E32A 3EAGA 5H83A 5GMOA 3DB2A 2B35A 1A7KA 4BNXA 1KVTA 5U9CA 2YY7A 4BGIA 3JYLA 4IPTA 3VZQA 2O4CA 2P9CA 2IYOA 2Y66A 1ZJZA 2YFHA 5BR7A 2YV1A 2UUPA 2C20A 3UUWA 4BOYA 1ZJYA 3E6AA 4GVLA 4PG8A 1BDMA 3AW9A 4R69A 1A4UA 2JAPA 2NU7A 3W8EA 1AE1A 4N54A 5JYAA 4TSKA 4WLUA 5G0SA 1A72A 3JQ8B 4I1IA 1H9AA 4GKBA 4IY1A 3QVTA 1GFSA 2DBQA 4D44A 1NX6A 4J2HA 1S7CA 1LBEA 2AQIA 2IZZA 3CTMA 4FW8A 4CV2A 4C7JA 4XIJA 3HDQA 1EVJA 3NRCA 4WPGA 1HE5A 2YJZA 3VPGA 5K6AC 3BZUA 3TDKA 1AHHA 2W2KB 1GDHA 2GN6A 3DTYA 1XU9A 1ID1A 4UUMA 1EBFA 4LW8A 4RF4A 3R6DA 5JY6A 4DA9A 4NQZA 2DLDA 2Z1MA 3GDGA 3CMMA 1PQPA 4BNJA 5L53A 3WNQA 2JKVA 2AA3A 4FOSA 4E4YA 1PQUA 4M8SA 4UAGA 4PLTA 4CPDA 2LDBA 3OQ1A 3KM0A 4NIMA 5T67A 2GF2A 5CDUA 1DC5A 3NDJA 4WCFB 2FSVA 1SPXA 5TJ9A 4BNLA 1UAGA 3HE3A 2HU2A 4RVDA 3WDSA 4NJMB 1BG6A 4YB8A 1N1EA 2VT2A 5KKCA 4W7HA 4DBZA 1XYGA 3U9LA 4M87A 1R66A 1DOHA 1P77A 4J7CA 5M6DA 3S2EA 4DREA 3DZJA 1PJ3A 3E8XA 4NPCA 2QG4A 5F3RA 4QO7A 4CM8B 2DC1A 3Q3CA 6LDHA 4GGOA 4GX5A 5A3JA 3U62A 2FPPA 4ZRNA 3LQFA 4B3JA 1C0LA 3L6EA 2ZQZA 2BF7A 4W9NC 4FC6A 4ND3A 2C7GA 2G17A 1QYCA 2X0NA 1I2ZA 1NVMB 3RSHA 1HRDA 3SEFA 4AJIA 3FRJA 4OYRA 5DOVA 1B3BA 4HP8A 1B7GO 2Q3EA 2QQ5A 5HM8A 3ZCXA 3RJ9A 3S2FA 2O3SA 3EVNA 4X54A 3PIDA 4AJNA 4CMHA 3TZCA 3FF4A 4DGSA 4RORA 5FF9A 1I36A 1GV1A 1Z75A 2ZCVA 4PLCA 4PZDA 3VKVA 1BXZA 3ETEA 4KZPA 4XQ9A 3WGGA 4O63O 4IJVA 4FC7A 2V6GA 3B20A 4CV0A 2QRLA 3D3EA 4ILKA 3BYZA 1ISGA 4W4TA 2Z95A 5JW6A 1D4FA 4PLZA 1W6UA 2WTBA 1R4NA 4I08A 2IZ0A 3A1NA 3WGZA 1LSOA 4HY3A 1W8DA 5LC1A 4E5MA 2YQ4A 1DC3A 5EMHA 3GVIA 3KV3O 4EEZA 1LRKA 3ZU5A 2YHIA 3TWOA 1YGYA 4TQGA 4YJFB 4IZIA 4MVJA 5JYFA 4KUHA 1QXSA 5JAZA 3PHGA 4GSKA 3BTOA 3QQPA 2BRUA 3O8QB 5DULA 1MP0A 2VZ8A 4ZHSA 2E37A 2HAEA 3GUCA 4XIYA 3I6QA 4J2OA 3OQ6A 2X7HA 3TFOA 2VRCD 2X58A 1DHRA 3GVXA 1I01A 2AEFA 3FPCA 3MOGA 3WTCA 1KYQA 4MDHA 4A2CA 4PG5A 4DC0A 4N7RA 4YBZA 3WGOA 4XR9A 1C3VA 1V35A 2OORA 1T26A 5LCXA 1C0KA 1SMKA 1C1DB 4ZJUA 4AVYA 5JC8A 4GX1A 1R16A 3F46A 5F1OA 2QRKA 5DP2A 3H5RA 2G0TA 3D4OA 2V6MA 4CM9D 5HTOA 4J4TA 1YB1A 2HK9A 1DRUA 2D4AA 1LDEA 2H5LA 3TOZA 3L77A 1LTHR 2NWQA 2FZEA 3O38A 3ONDA 2J3IA 5L9AA 1E6UA 3PHJA 4ALLA 1WPQA 4ND4A 2R00C 4J1NA 3WIDA 4ID9A 1N7HA 2X1HA 1UDBA 3QVWA 4Z3DA 4KMSA 3GQVA 4IQ8A 1JDJA 1AHIA 1B26A 1KS9A 4OL9A 2O3JA 3IOYA 4OH1A 4R1TA 4MIEA 4FQ8A 4D3DA 3ZI0A 4PLFA 3BA1A 5DCYA 4LCJA 1D1SA 5G0UA 3H9EO 4XJTA 3LT0A 1Q7BA 3H5NA 5A04A 3E18A 3P2YA 3A9WA 4IIUA 4L0QA 3VZPA 3NT2A 3OFSA 5EQFA 2ZYGA 3HG7A 2VCYA 3HQ4O 3C7DB 1LDYA 3PP8A 2XOXA 5KKAA 3ANMA 4IINA 1YQGA 1OOEA 1DIBA 2B5VA 3ADPA 4AJLA 1WZEA 4XYGA 4MKXA 3UCXA 1PSDA 4GLLA 5ICMA 2RH8A 3RBVA 2AEMA 1JWAB 3QV1A 3K2BA 4DPMA 4S3MA 4Z0PA 4L4XA 4DUPA 3RCBA 3SLGA 2RHRA 3GPIA 3I6IA 4Z3KA 4LMPA 2G5CA 3UCEA 2VWQA 2Q4EA 3JQCA 4HV4A 1HZJA 2GZ1A 3JD4A 4FJ0A 4YJHB 4DIFA 4XRGA 3E82A 5JSFA 4BO7A 1DRWA 3E1KA 2EP5A 1Y8RB 5KJ6A 4YT5A 4R9RA 4K6FA 1GQ2A 1ZEJA 3PLRA 5AQ1A 1P1RA 4A7PA 1R12A 9LDBA 1O89A 3HADA 4P38A 1JTVA 1EDZA 1A7AA 1PL6A 1R15A 4WK6A 3SX2A 1FDVA 3A4VA 1YBMA 4XYEA 2VOEA 2Q50A 2XPCA 3RFXA 4BNFA 4BO3A 1WLYA 2J3HA 2X0RA 3OIGA 4KDEA 4QSMA 3WWZA 3JQ9A 3JQ8A 4QX6A 1V3VA 2RBEA 4QEDA 3RASA 1F14A 4E5KA 3F1KA 4YT8A 2VZ9A 1E6EA 4JJIA 4AFNA 4ALIA 5KVCA 3VDRA 2HRZA 2WYUA 3F6YA 4GI2A 2P68A 3DMTA 4FB5A 1XR3A 5B4UA 1SC6A 1U5AA 1HDGO 2VRBA 2YFQA 3KZVA 4Z6KA 3JQAD 3GEMA 1PL8A 3U4CA 1UXIA 1V3TA 1M67A 2CSUA 4B3HA 5B1YA 4AJOA 3OEWA 3GR6A 2OHXA 3ZNQA 1NR7A 1ADFA 4MINA 1R4MB 3DHNA 4YYZA 1EFLA 4WOJA 1YBAA 2GCGA 3BMCB 2BGKA 1NNUA 1UXGA 3WBBA 4PFJA 4BO6A 5H81A 4CL3A 2VHZA 2IYPA 4P22A 4NJMA 1NHGA 1Q2XA 3QY9A 3NTQA 1VPDA 1MFZA 2J5KA 1YOVA 2TMDA 4RQTA 5CEEA 3H7AA 4B8WA 3OQBA 4E12A 3UHAA 3WGIA 2GUGA 2C29D 2E4AA 2IZ1A 1ZW1A 2E49A 3GMDA 5BT9A 4XJSA 4CM8A 3ZGYA 3PZBA 4RV9A 5U1PA 4R3NA 2I65A 4DWVA 4GAEA 3E9QA 4XEHA 5HBRA 1Q7CA 4BNMA 2WYWA 4JP2A 2AMFA 3GT0A 4UVHA 2D8AA 2FR1A 4B4WA 3DEYX 4E0BA 1E0DA 3Q6IA 2YDYA 4RQUA 1BRMA 1PJCA 1QSGA 1UXJA 4WOKA 1X0VA 4DPLA 1C14A 1F8FA 1XLTA 2BMAA 5JE8A 4RPHA 3OF2A 1B15A 2I5PO 5L7YA 4E21A 1NTOA 1EK5A 1F0YA 2PZJA 1UXHA 3KSUA 2GASA 5BQFA 1AGNA 1GQQA 2PH3A 1PQWA 4Y6PA 4E33A 1CDOA 1ENYA 1EUCA 1O95A 5G4LA 3PDUA 2C2XA 4U5QA 1D1TA 3JYNA 2X6TA 1YJ8A 4Z0TA 1A9YA 4XQGA 2BFOA 1Q0LA 2X0IA 3KOUA 3VPXA 4PCVA 1KVUA 3F4LA 1I3LA 4CR7A 3CEAA 1E7YA 1KEWA 3E48A 1SEVA 2JD2A 3ITKA 1OAAA 3U4DA 1TT5A 4IM7A 5A4DA 3EDMA 1JVBA 4CM9A 5CFZA 4D0SA 1YKFA 3STHA 3K92A 3OJLA 4A26A 4D3SA 4BO4A 3U3XA 3AK4A 3P7MA 5COBA 2X22A 2ZYAA 3MZ0A 1JU9A 1U7HA 9LDTA 1ISIA 3O8QA 3W8DA 5JDIA 3QWIA 3ZNOA 1ZEMA 3F9IA 2ET6A 4B7XA 5JYEA 1LRLA 5JC1A 3L07A 5JY1A 1VL8A 3H65A 3MJTA 2OUIA 4O59O 4J9UE 4J9VA 5KJEA 3R3SA 5C37A 5IAAA 1I8TA 1PR9A 2I66A 4RVFA 3C1TA 3IC5A 4RZHA 5G4KA 3V2UA 5KVVA 3WMWA 3V1YA 3T4XA 1K6JA 5CG1A 3BTVA 3AU9A 2HCTA 3HDJA 3JD0A 5KTKA 1U8FO 2UDPA 5EQDA 4B8ZA 3OIDA 3GG9A 4I9HA 2X86A 4AJJA 5IXYA 4LVCA 1KVSA 2HKIA 2Y99A 3BHJA 5COAA 3AI2A 5JDCC 4IIVA 3GNQA 1NVTA 5CHEA 1LQTA 3HNPA 3FWNA 3K30A 4RGBA 2NV6A 5FEUA 1LSJA 4UEKA 4BO8A 3LU1A 3WJ7A 3DAGA 1BW9A 1QV6A 4BKRA 2JCYA 2X0JA 3N7UA 4J1SA 2YYYA 4Q3NA 1PWXA 2PKQO 3IUPA 4LN1A 4YCAA 4YJGB 3RUDA 2NSDA 2CF6A 3GEGA 3ON5A 1CWUA 3AI1A 4JK3A 2DT5A 4A73A 2C5EA 3M1AA 1AN9A 4NK5A 4L8VA 4BKOA 1W73A 1YRLA 4B79A 5F5LA 2BFPA 3I4CA 4BVAA 1ZK0A 4BMNA 3ZZNA 5A1TA 3LC7O 4UVIA 3GNTA 5IZCC 1LI4A 2DUUA 3KEQA 3ZV5A 3ICCA 3PIIA 1T2CA 1DLJA 2I6TA 2YHIB 2Y93A 4KDFA 1PGNA 1UR5A 1I24A 3KYDA 1YL6A 2AE2A 2UUOA 2LDXA 3AM3A 4N5LA 1V3UA 2X4GA 1GU7A 4AJEA 1IYZA 4O0LA 4RCVA 1R37A 5HS6A 2VWGA 1U7TA 3E5RA 1P1HA 1KVQA 1U3WA 1BWSA 2HMUA 5HA5A 4WGGA 3RUFA 4HUJA 5BSHA 4YT4A 4IS2A 5K6AA 3JSAA 2DTXA 2B4TO 2AQHA 1Y8RA 3HUDA 1BDBA 1JVSA 1SAYA 4D7AA 1CF2O 5EPOA 5JS6A 3JYOA 2Y1CA 5TIIA 1PJLA 4HKTA 5AXCA 3KXDA 4DPKA 3QE3A 2NTJA 3AUUA 5T64A 2OGUA 2XXJA 3V5NA 1M6WA 1CRWG 2W4QA 2VYVA 5KNLA 1U2DA 5TSDA 1IPFA 1C1XA 4E5PA 5CPBA 3ZWAA 2YUTA 4XD2A 5CDSA 4MVJD 2D2IA 1E7WA 2GGSA 5DNAA 3X2EA 2D0IA 5JAMA 1EQUA 5L7TA 3DO5A 1LXCA 4CQMA 4GWKA 1RM5A 1NQOA 2HUNA 2ZQYA 4D46A 3KEOA 3D3WA 1UZMA 1DRVA 1HSOA 4HX5A 4MP6A 1LSUA 2R2GA 1KC3A 3CSDA 3R1IA 1T2DA 1XQ1A 4JP3A 3UH1A 1HEUA 3DBLA 4FFLA 5I7FA 3W4IA 3Q2KA 2HMVA 4U0KA 4Y6SA 3GAFA 2PKQP 4ALJA 4CMEA 2GLXA 3D1LA 5LDGA 3TF5A 5A9SA 2PKRA 4W9NA 4YTEA 2CVZA 1UJMA 2O48X 1WMAA 3N58A 5I9MA 3AY6A 2CF5A 2AXQA 2WDZA 3ZWYA 1X15A 1DDOA 2IXAA 1OZAA 1R4MA 2Q45A 1ENZA 2EERA 5BSEA 3PYXA 1EVIA 4R16A 3FNEA 1JKIA 2DU8A 3HZZA 3RAJA 1O5IA 4I5DA 2W90A 3LLSA 1B8VA 4IDDA 1ZK2A 2GN8A 3HB5X 4TRRA 3WICA 1P33A 4IJKA 4NH4A 3I3OA 1DJQA 1PIWA 2J3KA 1HDZA 1SOWA 3AUAA 1V6AA 3PXXA 3QVSA 3C1AA 3NTRA 4CM4A 3QWHA 2ZCUA 4HNHA 1F12A 3RU7A 1Y8QB 1O6ZA 3EZYA 2W98A 3O03A 3TNLA 4R9SA 3KUXA 4I9NA 5I7VA 4ESOA 1JA9A 3I9NA 5AXAA 3UXYA 1Y9EA 4FSHA 2Q1TA 2AQ8A 3FBGA 4CMIA 2NACA 4BV8A 2EJWA 4XYBA 1A71A 1YXMA 4KWIA 4RF5A 5I8WA 2PZKA 2OBNA 3GH3A 4NJOA 4P4GA 4D41A 2FMUA 2DVMA 1LLUA 3LVFO 2ZKLA 1XWFA 4JN6B 1I2CA 1ZXBA 5JMPA 5ITVA 3OECA 1GPJA 1VL0A 3FHLA 3TJRA 4HWKA 2O23A 5ICSA 4CMBA 4CMJA 4RZIA 3B1JA 5L7WA 3C8MA 1DO8A 1AXEA 1YONA 1BMDA 1H2BA 1PWZA 3A14A 3S8MA 1HE2A 3NV9A 4M1QA 5L51A 4ONEA 3V2HA 5TLSA 4MVJH 1G0OA 4DMLA 4IDAA 4I8XA 1MFPA 1WW8A 3MJEA 1P3DA 3C85A 3ZV4A 3ZV3A 2YHUA 4YPOA 4ITUA 5G0TA 4MIOA 4YRDA 1MUUA 3GRKA 3JQBA 4HADA 4W6ZA 4J0FA 4BL5A 4NR0A 3QVOA 1YL7A 1LC3A 1XHLA 4OMUA 3GVCA 3AFNA 5CP8A 3MOIA 1YB5A 3MJSA 1PJSA 4XR4A 4W82A 1LLDA 3VH3A 2PY6A 4E30A 3PFWO 3QWFA 3ZHXA 2I3GA 3JD2A 2PLAA 2VUSA 3VC7A 3NX4A 3HWRA 1K0UA 1IL0A 4MIYA 1UUFA 1HWYA 1HYHA 1TT7A 3PDJA 4IQ0A 1B16A 4C7KA 3I9KA 4ALMA 3H9UA 4IGFA 1W0CA 1YOVB 4TMFA 1E6WA 1Z7EA 4BO2A 2HJSA 5IZ4A 5A06A 3VKUA 3B1KA 1LNQA 3OJFA 3RBZA 2F00A 3GK3A 3PLNA 3ZWVA 3PRJA 4GH5A 1H93A 4CM3A 2BH9A 5TT1A 4EJ0A 1YBVA 2VOJA 1NWCA 4D43A 3DOCA 1G1AA 2V7PA 3GY0A 1EVZA 2G82A 4PLWA 4AJ1A 3P2OA 1GUYA 5C5IA 5CDYA 1DAPA 1RM0A 3QW2A 3D7LA 1QLJA 5JYDA 4JJGA 4RPKA 1WZIA 1Z74A 4JLWA 2DM6A 3HHPA 4XX0A 4ZVVA 3OETA 5IXSA 3WYEA 1DSSG 3GZ4A 2GRAA 1SNYA 4PZCA 3D0OA 3OMLA 1TB4A 3AOEC 3EW7A 3ONEA 4WLOA 4C4OA 5J9GA 3BXXA 1HDRA 2PZMA 3WFJA 3L4BC 2X9GA 3OICA 4MVJM 4PG6A 1TXGA 2Q2VA 4YJGA 5EN4A 2EHDA 5AVOA 4G5HA 4YR9A 1CQIA 1EUDA 1RJWA 1V0JA 2PFGA 3ZNNA 1PR3A 1UDCA 1KVRA 1NFRA 1VC2A 4A5OA 4PRKA 3KYBA 1IUKA 5TS3A 5JFOA 1ZSVA 4ROSA 4KP7A 2VHXA 1TT5B 5KVSA 4LVUA 4M54A 5T57A 1YDWA 4IDEA 3G1TA 2FHSA 1Y81A 4XRRA 3INGA 1HDCA 4ZD6A 3QSGA 3W6ZA 1U28A 4J7UA 4CLRB 1LC0A 3WYBA 3VH1A 1U3VA 5B4VA 2D5CA 4EJMA 3K73O 5IFLA 6ADHA 3CPSA 1WP4A 3VPHA 3FWZA 5T5QA 5CAEA 3LC1O 2Q2WA 3ZW9A 3BHIA 2Y68A 4F45A 4YRBA 1H6AA 1F17A 3NDRA 3AUTA 8LDHA 1NQTA 4QT0A 4UVEA 1PTJA 2P4HX 2XF8A 1BXGB 2I9PA 3IDSA 3VVBA 1KIFA 5G4KB 3PQFA 3JQGB 1HT0A 1OBFO 1DIHA 1LQUA 2YZ7A 4NZ9A 3FNGA 3L0DA 4E5NA 1GYRA 4W99A 1NFQA 2PNFA 1KY4A 5IDQA 2VUTA 3AJRA 4YEDA 1A9ZA 3HN2A 1UZLA 3G0OA 1Q0QA 1YQXA 2EEZA 3SJUA 5MGBA 2FY8A 1ONOA 3EVTA 1GZ6A 1J5PA 4BO9A 4PVCA 1NAIA 4XQEA 3RUIA 2J3JA 4F6LA 2BGMA 3PHHA 4U7WA 1TEHA 4IDGA 1EE2A 1YL5A 4JBIA 3PQEA 4GKVA 2E6UX 4J3FA 1BW9B 4OM8A 4TROA 4TVOA 1G6KA 1CIVA 4FJ2A 4PIVA 1DB3A 1M76A 4F3YA 1SOVA 2NVUA 4I5GA 3GGPA 3ST7A 3MEQA 3ICPA 4Q3BA 4AJ2A 1YJQA 4GMGA 1PGQA 2C82A 2EV9A 3I23A 1CJCA 2YV2A 1QRRA 4WEQA 4KTVE 2C0CA 5U4QA 2FPIA 4BKUA 4LGVA 1TVEA 4I9UA 4DXHA 5FYDA 3ZV6A 3SC6A 4R5HA 4RVGA 4M49A 4P8RA 2R6JA 4G65A 2CDBA 4L4SA 4HFMA 1HE3A 4B3IA 3E03A 3DBHA 4XYLA 1X13A 3QLJA 3ZHBA 1Y5MA 3KRTA 3KYDB 3SJ7A 2HQ1A 4GX2A 3O26A 4EW6A 4IQGA 4P4NA 5BNTA 3LF2A 3G17A 2UYYA 5KIAA 1PZEA 1X7GA 5TC4A 1U3UA 3BMQB 3RUCA 3NGLA 5DP1A 2PK3A 1Y8QA 2GR9A 3U4HA 2VUUA 4Q39A 3A28A 1UDAA 1DFHA 2POQX 3LSYA 1HLPA 4TZKA 2FZWA 1E1MA 1X14A 3BIOA 1WVGA 1ZMTA 3I4FA 2B0JA 3DXFA 4UVDA 1HYEA 4U8GA 1A4IA 4ZQEA 1Q1NA 1QYXA 3WQRA 4OHUA 1ZKMA 3PWSA 5IDWA 5CPFA 4ZQBA 1JAYA 3D5TA 1E3SA 3JD3A 2NU6A 3K8ZA 4RF2A 4PG7A 3V8BA 4CM7A 1C1XB 4UEOA 1DIAA 2DKNA 4NFSA 4OOFA 2NQTA 1GCOA 1RYEA 2RAFA 4GX0A 1XG5A 3AM4A 3DZGA 4MP8A 1V9LA 1Z45A 4CODB 2O3TA 4CQMB 3B1FA 1JAXA 1FK8A 4DLLA 5DBIA 4OSOA 5EESA 3D3WB 4XGKA 2JJYA 3GGOA 3UFXA 3NT4A 3ROQA 3EC7A 1UP4A 1VE9A 3VDQA 2NQ8A 3DBLB 3WLFA 4PVDA 5J23A 2BELA 3G79A 3KO8A 2V6BA 2PD4A 4L74A 4MPDA 4KWHA 4PLYA 3S1LA 2CMDA 5A9SB 2JD0A 3ENKA 5GZ1A 3HB4X 4N5MA 5JO0A 3VVCA 4BKQA 3KHUA 1P0FA 3WLEA 1HTBA 2FR8A 3GPDG 1Q7GA 2JFGA 5JDCA 1NR1A 2Y1DA 1E1KA 5KVQA 2ZTUA 2EG9A 2VYVD 1TI7A 3Q9NA 4XWYA 1NHWA 1O9BA 4BB6A 4Q3AA 3PYMA 3HDHA 5KJCA 1ZK4A 4E2WA 2O4UX 1ADBA 3G49A 1T25A 1I0ZA 4FS3A 3UVEA 3H9QA 2HMTA 1QLHA 4YA6A 4CQMD 1LLQA 3AOGA 3ETDA 2I76A 2ZB8A 4RPLA 4J6FA 2DBZA 4CM4B 1KERA 1P1JA 2W8ZA 3M2TA 4CUZA 3UCFA 5IJZA 3B6ZA 5A5FA 4XKJA 1NPYA 4WLVA 5TJHA 4LRTB 3TZ6A 1SCUA 4B4UA 3GFGA 4K9DA 2P9EA 1IPEA 2Y1EA 2PR2A 4BO5A 1LA2A 3QWAA 1N5DA 2GNAA 1W4ZA 4CMIB 5IZCA 4IUYA 5T8KC 3AM5A 2EGHA 3DFZA 3VZSA 3N74A 3OP4A 1P74A 2H9IA 1N9GA 1BGVA 1Z6ZA 3CE6A 2H1SA 3F3SA 4Y9DA 4CQLA 1F8GA 3Q9UA 2QYTA 3HFGA 3ROPA 1KOLA 3S2GA 3LZ6A 3HSKA 4YACA 5THQA 3DQPA 5ENVA 4CLDA 1IZ0A 3F47A 2GZ2A 1SZJG 4K28A 2DQ4A 2B69A 2EW8A 3HN7A 4PG4A 1NASA 4BMVA 3IJPA 3TSCA 4INAA 4XA8A 2VWHA 2BFAA 1HDYA 1EDOA 4NBRA 5TGDA 2PWZA 3FI9A 4DIOA 2JD1A 3SBOA 3DHYA 1QR6A 4GL4A 5DF1A 4ZGWA 2V6FA 4BKPA 1KBZA 3PJDA 2DFVA 2P5UA 1I5RA 1HXHA 3QRWA 2PH5A 2VHWA 4JIGA 1NWHA 3ASUA 1GV0A 4UUOA 3GEDA 3VAZA 3MWEB 5JCJA 3QJ5A 2BLLA 3WG9A 3WBFA 1HKUA 4CLRA 4OQZA 2ZB4A 1JN0A 4BNGA 3U09A 2O3QA 1X0XA 1D3AA 5C7LO 4NFYA 1U1IA 4RDHA 1B0AA 3ITDA 1PL7A 3RUEA 4IMRA 3RC1A 4RLSA 3LYLA 1H2HA 3OA2A 5KCZA 4WLFA 4R1UA 2QZZA 5FWNA 1Z82A 3JTMA 5GZ3A 1BXGA 2D5AA 2Q49A 3ZWPA 1SO8A 3JQGA 3WS7A 5GZ6A 4R3WA 1MC5A 2YQ5A 4E6PA 4L4RA 1BVRA 3CKYA 2O2SA 4H16A 1N1GA 1QORA 2NUAA 2WSBA 5HWSA 2PGDA 4F6CA 2O7SA 3FR8A 3OEYA 2QIOA 1GYQA 1I32A 1SB9A 1E92A 1PGJA 3W8FA 5DBGA 1U2GA 3DZHA 1XIVA 3BMNA 3ZWOA 1EUZA 2JCXA 4GQAA 3MWDB 4JJFA 5L4NA 1D7OA 1M66A 3DFUA 3GDFA 1LEHA 4WCDA 5MDHA 4FN4A 1ZZEA 2JHFA 1CETA 4R1NA 5A02A 3BTSA 4EITA 3DMTC 4NBWA 5DCUA 1PGPA 1ONPA 1ORRA 3G3EA 1QYWA 4GPD1 4HXYA 4M86A 4DL9A 3TZKA 1LLCA 2EF1A 4BQPA 5BSGA 1XQ6A 2BHLA 1PZGA 4AJHA 2W2LA 4JNKA 1JWBB 2C07A 4DLAA 3OA0A 4UVGA 5IDXA 1JLLA 3ZWCA 4BNKA 5JLAA 1I33A 3F4BA 2BD0A 2HDHA 4EI2A 5ILOA 3LT2A 1HDOA 3P5SA 1ULUA 4K26A 4CJXA 3I1JA 4ZU3A 3VPFA 4ALNA 4E13A 4WCFC 1VKNA 4QFDA 1V8BA 3NT5A 3W4JA 5EIOA 3ZN2A 3CXRA 1ZIDA 3ZWXA 3KTDA 4EUFA 3WMXA 4NBVA 3EHEA 3PHLA 1MX3A 1ISFA 1I3MA 4LMRA 3UN1A 1RM3A 1NQAO 3QIVA 4FPXA 4QUKA 4J49A 5IN4A 2B4RO 1T2EA 3GRPA 1PJ4A 1O94A 2VYNA 4EDFA 3BMQA 5C3MA 3JQFC 5IG2A 1KETA 4XCVA 1E3IA 3PZRA 3QWBA 5G2OA 3RKUA 2HSDA 4LK3A 3DONA 2CZCA 4DQVA 1N7GA 3GDOA 4IMPA 1DJNA 1GEGA 3EMKA 3IIEA 4FBGA 1O8CA 5T6BA 5KWEA 5FFFA 2VHVA 1BSVA 2Y1FA 3G1UA 2WD7A 4OXNA 1BVUA 4OAQA 1LX6A 3BHMA 5K0ZA 2Y0EA 4OOEA 5JXWA 1H6CA 3IQDB 1U9JA 3E5MA 2WM3A 2IEDA 4Z9FA 1H94A 4DC1A 3GA0A 1GY8A 4GSLA 2X5JO 5TQVA 1HF3A 3RC2A 3RIHA 3IKTA 1C0IA 4NFHA 5G0VA 4I5FA 1T1RA 4BNHA 3CIFA 3DZIA 3AU8A 4AJ4A 1U4SA 1ZBQA 4XB2A 4K6CA 4IDCA 4J4HA 4R54A 3ROKA 3S55A 3JQ7A 1H6DA 2EIHA 2UV8A 5THKA 3DZBA 2J8ZA 3U49A 2NLOA 3QP9A 1OC4A 1H0KA 4RPJA 2NVWA 3H5AA 4A10A 1ZNQO 1QKIA 4FFRA 4BIIA 1GADO 2E48A 1Z73A 3QVXA 1VJTA 5H82A 4B7UA 2NVUB 4CMCA 4MKZA 2FOIA 4J4BA 2RH4A 2P4QA 2EWMA 1IB6A 1HE4A 4R41A 4A27A 3TFQA 1ZO8A 4NU5A 2VZ0A 3M6IA 2CDCA 4JXKA 1RM4A 5DBFA 1SB8A 4OKIA 4BV9A 4CUJA 1YS4A 4FOOA 3DZKA 5EERA 2EXXA 2NTVA 2QZ9A 4GMFA 2HK8A 2GERA 5ADHA 3COSA 2AQKA 4R51A 4J90A 2PD6A 3GZNA 4ZA2A 1HZZA 1T4DA 1ISJA 3NTOA 3H2ZA 3DBHB 3ZU2A 2Z1NA 5KOIA 1L7DA 1MV8A 3NDIA 1ENOA 3TZQA 1B2LA 4IDFA 5TF4A 3L4BA 4KUGA 1GZ3A 7ADHA 3OSUA 3E9NA 5JO9A 3DDNA 2ZTMA 1XKQA 4Q9NA 2GZ3A 4BNZA 1UAYA 1WWKA 3W6UA 1GPDG 3SLKA 5T73A 2EJVA 3PEFA 1ZCJA 4FJ1A 3DHEA 1QP8A 2OZPA 3IS3A 1ZMOA 1OC2A 2AHRA 2SCUA 4OQYA 1ISMA 4WNCA 3PK0A 1LDMA 4BUCA 5ITWA 5F21A 2H6EA 3AY7A 3MJCA 2DUWA 1GL3A 4J0EA 4TZTA 2WYVA 3JQEA 4U6QA 4LSWA 4BNTA 3F5SA 4CM6A 2B36A 3M1LA 2Q99A 2JL1A 1YDEA 4R68A 3PQDA 4IDBA 3ZNPA 5DT9A 2QW8A 4MJLA 3WB9A 2IDZA 3JD1A 3Q11A 4R4JA 1Y6JA 2DAPA 1RWBA 3FN4A 3GGGA 4Y6RA 3VOSA 4YAJA 5G0WA 3WSVA 4DMMA 4KQXA 3GVHA 4UEJA 4O5OA 3K96A 4CLEA 3LT1A 1ZSYA 4YQZA 1R6DA 2YW9A 3JYPA 3SC4A 2CNBA 4A0SA 4JQCA 4OGWA 4Y8VA 4XGNA 4H15A 3GN1A 5KJFA 4CLHA 4M89A 3OBBA 4E3ZA 4LISA 4EEXA 2HMWA 4WASA 1FDUA 4I5EA 2C2YA 1P0CA 4TRNA 2WWRA 1WMBA 2FN7A 3ZW8A 1T2AA 2E82A 3D4PA 3CZRA 3ZH2A 5ES3A 4LSMA 3PFFA 3FTNA 3O9ZA 3WGQA 1B8PA 2FR0A 1PZFA 3L6OO 1GZ4A 1PJ2A 3MJ4A 3RFTA 1ISHA 5JMWA 2R00A 3AUSA 3PHIA 1DAOA 1DFIA 3PTZA 1GD1O 4FIZA 4WJZA 8ADHA 4JGBA 3FNFA 2F1KA 3PPIA 4J91A 1MGOA 2P2SA 2Q4BA 2ZTLA 1GEEA 3BAZA 4GGPA 3T7CA 3MJVA 1VJ0A 2ZTVA 4RVSA 3JYQA 2PGJA 4RPGA 3DAFA 3ANLA 3WR5A 1P1IA 1LUAA 3EY4A 1YQDA 3KB6A 3ZWMA 4RDIA 4CMGA 5A9RA 3WOHA 3DBVO 1M75A 4FFNA 5IN5A 4WE3A 3CZMA 4YDRA 4QFCA 3Q2IA 2HMSA 5TX7A 3WFIA 5I9LA 1TA4A 5A05A 4FGSA 1QMGA 4G81A 3RVDA 2FRDA 1J49A 2QRJA 1N9GB 3FD8A 5ILGA 3TL3A 4D0RA 4BNUA 3OJ0A 2WE7A 4CQLB 1X1EA 3V1UA 2D3TA 4J1QA 1R0LA 4ZICA 4IXTA 4N5NA 2EGGA 2X5KO 1T2FA 2G1UA 4YVFA 2AG8A 5JBIA 3UICA 3BTUA 4CMEC 1PS8A 4CLOB 1MA0A 4NI5A 4RVUA 3LLVA 2YV3A 4ZQGA 2Y1GA 4MVJF 5AOVA 3D4NA 4FDAA 1R0SA 2CUKA 4CR8A 1B14A 2HK7A 3DBRA 1E1NA 5CG2A 3Q1LA 1DFGA 3LF1A 1ZVMA 1P44A 4TRJA 1H6BA 4U6SA 5JAQA 4YAGA 1XDWA 2Q46A 5B12A 3I9MA 4II2A 4DYVA 1IHYA 1N2SA 4ZQFA 1G0NA 2OL4A 5CEJA 1NAHA 1QYDA 3MCVA 3DMYA 3RU9A 3WSWA 4FFOA 2A92A 1DIRA 1Z7BA 4WEOA 1DPGA 4CMKA 3DR3A 1GCUA 4CR6A 5L4SA 4NNJA 4J43A 2VQ3A 3PJGA 2VTDA 1ADGA 3UAGA 3X2FA 1IY8A 3PWKA 3C1OA 1NP3A 3H2SA 3OJEA 3JCZA 1P31A 3PJEA 1VLLA 1VRWA 3UOGA 5DDIP 4NU6A 3FNHA 1UXKA 3ANNA 4BNWA 4RVHA 1XELA 1UP7A 4K1LA 2DFDA 2GN4A 5HRUA 4FCCA 1PX0A 3AFMA 4J16A 2Y05A 3AI3A 3GFBA 2VNSA 4Z9XA 3H9GA 3RROA 3PYLA 3RUAA 1Y1PA 3UGKA 4LCEA 1P1KA 2WD8A 1SBYA 4EUEA 3DOJA 1ZFNA 1D8AA 4YWJA 1ZXLA 3ZHYA 4WNIA 2Q1SA 5L95A 2JFFA 4PGFA 4Y67A 1MLDA 4KUEA 3IMFA 4EUHA 3IP1A 5I9NA 1K2WA 1PS0A 4NDNE 4S1VA 2Y67A 3PGJA 2D59A 5F1PA 3FBTA 4FGWA 3VTFA 2ZIZA 3H3FA 3K5PA 1EVYA 1EBUA 5JCJD 4UUPA 3BMNB 2EKQA 1Q0HA 1A27A 2HLPA 1J6UA 1PJBA 3C7AA 4WECA 3BMOB 3R3JA 5F1KA 3CMCO 2CVQA 4PLVA 5ER6A 2RCYA 3RFVA 4NHEA 2O3RA 1ZK1A 3JQBC 2OOSA 3DTTA 1CEQA 5DCWA 4NMHA 5C7OO 1OMOA 3ZWWA 1X7DA 1JQBA 3DWFA 4HNGA 3NAQA 3ENNA 2GD1O 1KY5A 2OFPA 5L45A 4TVBA 5T8KA 2AG5A 4BGEA 2EP7A 2NVBA 1HLDA 4AJPA 1LJ8A 2J5QA 3OIFA 1K6XA 1E3WB 1BHSA 3F1LA 4NBTA 5JNLA 4AG3A 5A03A 3LDHA 2CFCA 5EL0A 3HDYA 5L3ZA 1LSSA 1RPNA 4OKNA 3WQSB 3KSDO 2X9VA 4OO3A 3ZHZA 3GLQA 4F46A 1HETA 4CM1A 4XGIA 2P91A 5TRTA 2HJRA 2OMEA 4MKRA 2PGLA 2FP4A 1NM5A 3GUYA 2NADA 4NBUA 2V65A 4QXMA 1ML3A 1K3TA 2WE8A 3VHRA 1UZNA 3VH2A 2X9NA 3FSRA 1MG5A 4D42A 3EK2A 4ND2A 2W2LD 1YVEI 3I9OA 1QG6A 3VZRA 1EE9A 3GOHA 4PN3A 4BNVA 2X23A 1WDKA 1HDXA 2Z5LA 1B3RA 3H6KA 2WD7B 4Q3DA 1NXQA 2I99A 1GTMA 1VKOA 2IEBA 1M2WA 1H9BA 1P9LA 2VT3A 4JBGA 1FDWA 1ENPA 5AXDA 1PGOA 4FR5A 2B4QA 1HL3A 3IKVA 2XAAA 3O4RA 4TWRA 1LDGA 4HFNA 2I67A 4JX8A 1XEAA 1IOLA 2A94A 1YWGO 2B83A 5JAIA 3WGTA 1K6IA 4D3FA 1RYDA 1AUPA 1IZ9A 3CUKA 2J5RA 2AEJA 3RKRA 3W1VA 5F5NA 3JQ7B 2NTNA 3NJ8A 1PZHA 2VYND 4QECA 1K89A 3TN7A 2JAHA 1U3TA 5ENDA 3PVZA 3JQAB 1R0KA 1T4BA 4WLNA 4DVJA 4JCOA 5TT0A 1CYDA 4IXWA 1XA0A 1FF9A 2Y0DA 3V1TC 2NU9A 1FXSA 2VNAA 4R5MA 4QO8A 3IJRA 1IULA 1T1SA 3JQDA 3TPCA 4EGFA 4XDYA 3WX0A 3JV7A 4GLOA 4ZQHA 3EZLA 1NQ5A 4Y98A 1E7SA 3K9QO 3RC7A 4MP3A 4CV1A 4IJUA 2Q22A 1UP6A 2O7QA 1GUFA 3L9XA 2TMGA 3I52A 2P5YA 3GZNB 2NNLD 4O1MA 2JHGA 3B70A 4IZHA 2PV7A 1Y7TA 5ER9A 2FWMX 4KOAA 4YJDA 1E7QA 2W2KA 1GUZA 5L40A 1E1LA 4QTZA 1AXGA 1O0SA 4BGVA 4DYDA 1LU9A 1MC4A 5CDGA 1DXYA 2GYYA 1T24A 1E3EA 1HYGA 4Z9YA 3KBOA 1E77A 5BSFA 1VSUA 4Z0HO 3C24A 3KLMX 1U5CA 4OIMA 3KVOA 4PRLA 4WCFA 3TZHA 1OI7A 2OXIA 3KYCB 1GR0A 5A9TA 3TL2A 3INTA 2DPHA 1Y5RA 2B37A 4UREA 3WIEA 3GNSA 3C3XA 4RF3A 2Q2QA 1I3KA 1ONNA 3KLPX 1DC6A 2H63A 4IGEA 3IAHA 4MVJE 1I10A 3T7EA 4D79A 2NM0A 3V2GA 2JFHA 4ALKA 1I2BA 3VH4A 3ORFA 1JKFA 4URFA 3I83A 2ZJ0A 2EKLA 3DOOA 2PD3A 3RJ5A 3KSZO 3EUWA 4JBHA 3JQFA 2AE1A 5TNXA 4L73A 3NUGA 3ULKA 3GN2A 1U4OA 3AWDA 3R0IA 4CLOA 2FSSA 5B4TA 3UW3A 5CEFA 2DPGA 1TLTA 1FMCA 5I7SA 3RWBA 1VL6A 4EBFA 2O50A 1E3JA 4H7PA 1X7HA 3K2EA 4YAKA 2C7VA 1U8XX 1C0PA 1DHTA 2YDXA 3NEPX 4IBOA 4ND5A 2HRBA 3GMSA 3OJOA 2A35A 1VI2A 3JQ6A 1NYTA 2DTDA 3U4IA 5COQA 2D1YA 1K5HA 5I7EA 3ZWNA 3ADOA 1WAMA 4XB1A 3T4EA 3ROMA 1H5QA 1VSVA 4EZBA 4WKGA 1ARZA 4E31A 1OFGA 2AW5A 2C54A 2VRCA 2DTEA 1X1TA 2WJPA 1IHXA 4YRAA 1EZ4A 1UH5A 3FR7A 1ZUD1 3K6JA 5A3VA 2FPGA 4E2ZA 4O6VA 1WXDA 2C5AA 3KETA 3WWYA 2G76A 4UULA 4BO0A 3WYCA 3C7CB 4CLXA 4FD3A 1PEDA 5HS4A 2Q1WA 3FTPA 2XXBA 1RKXA 3RQSA 4YT2A 3GVPA 1DEHA 1YO6A 4HFRA 3GG2A 1ADCA 3WQQA 4WUVA 4RO0A 2A9FA 1PU2A 2IE0A 3NYWA 1LDNA 4OSPA 4TRMA 5GY7A 2Y1OA 4YQYA 5I8ZA 3Q0EA 5IDYA 5AXBA 2RHCA 2ZJ1A 2JCVA 3PJFA 4DQUA 4YJFA 4Q3CA 2QYSA 5IF3A 1E7RA 3GHYA 2BGLA 5K9ZA 1DIGA 1KEPA 2RIRA 4RLHA 1IE3A 4J1TA 1KEUA 2OO5A 5AYVA 4L75A 2A4KA 3PWZA 3WGYA 4U0JA 3H4VA 1FDSA 4P4LA 1KC1A 3JQ9C 3A06A 3LK7A 1L7EA 4CMAA 3F5QA 4E2XA 3VTZA 4GVXA 4DQXA 1ZK3A 4AJKA 2ZATA 2UAGA 4NG5A 3AY3A 3LC2O 2CDAA 3RBXA 3OH8A 3DC2A 4HBGA 5FI3A 1BTOA 3BMOA 4PLGA 2Y0CA 5JPIA 4R01A 1GQYA 4DTIA 1LRJA 2OP0A 1C1DA 1I30A 1B8UA 4FFMA 4NK4A 1N8KA 2QHXA 4ZN6A 1KEVA 1MB4A 4OJNA 2PTGA 2QX7A 3WGHA 1EQ2A 3ONFA 3PGXA 3DBRB 4WLEA 4EJ6A 4MOWA 1CQJA 1NPDA 2Q1UA 4DBVO 2IXBA 3D64A 3SXPA 4KQWA
chains in the Genus database with same CATH superfamily
1Z0SA 2Y4NA 1WZNA 3QPUA 1WB4A 4NCKA 3BGOS 2WICA 2O5EA 1MO5A 4BNDA 1N2EA 4B35A 1UEJA 1QZUA 1TCBA 1KJ9A 2G1AA 2QDXA 2R25B 4II3A 3WOVA 3ZLTA 6CHYA 5JSUA 1JHOA 1KKMA 3RD5A 2ARKA 5IC6A 4B7AA 4MUNA 2C59A 2I62A 4IGIA 4Q7KA 5FWXA 2HPVA 3P9KA 3UJ8A 3P9QA 3KLNA 1SQ0A 1Y9AA 2BI7A 3GC6A 3DZFA 3GF4A 5EZ6B 1CR2A 7AT1A 4D92A 4Q34A 3P19A 4X7PA 1LV8A 4J0HA 2AG6A 4EOGA 1FQWA 1C7IA 4CUKA 4R05A 4MVJP 4OY3A 2GCPA 3OJCA 3TZLA 2WHPA 3EMDA 5FQOA 3SZLA 4ZRMA 3HJRA 5T4BA 3T7RA 2QRUA 5AK0A 3RSOA 1ZL0A 1IEXA 4P0TA 2WABA 2I87A 1VE3A 2IRWA 3BRQA 4IV0A 2RGWA 2WZQA 4Q01A 3ZU4A 1D07A 4XWAA 4DLVA 5HJ7A 4RMJA 5E38A 2N1BA 1K27A 4DQKA 1C9KA 2PSDA 4P5DA 5E6UB 4NULA 2ZBVA 1KZGB 3PI7A 4UC0A 3TK1A 1YUMA 5TQ0B 1QYVA 1UK8A 1E7MA 1K5DA 4G09A 4Z1OA 3WV4A 4X61A 1JHDA 3W4KA 2GPWA 2H59A 4WN3A 5HKKA 3QA9A 3IEMA 4BAGA 3FYDA 4YUYA 3JPYA 5TS2A 3S27A 3KOMA 1JFLA 1RP7A 3CTPA 1L5ZA 3QUCA 3QEJA 4KMOA 4X45A 4YJHA 2FAXA 2NV0A 2UVQA 1T5TA 2AMJA 2ZYDA 4OYHA 1DC4A 1MDBA 3I61A 1BNCA 2PFSA 3N8KA 3H9JA 3ZD9A 3K05A 3QENA 2FHPA 5IM5A 1BCSA 1ILWA 4A16A 2G5TA 4J7XA 1E5QA 3R77A 4Y2PA 2HXGA 2C8JA 1B4DA 2YVLA 2Q3LA 2ALJA 1ZH8A 1YR7A 4B8YA 3C87A 3MUFA 3TOSA 5IEBA 2BBOA 2JLCA 1IEQA 2VAWA 3CBQA 3UGTA 3VNAA 3LH5A 4B6PA 1JAZA 3GLUA 3FCOA 4QAQA 2B1JA 4LE1A 3L0SA 5C31A 4X95A 4TKMA 5ALNA 3KTAB 3N8DA 5EJGA 3JSXA 1Y9ZA 2CNNA 3NTLA 1E6CA 2J09A 4MRRA 4CV3A 3D4BA 3HFSA 4EY4A 3HN6A 1FL9A 1P45A 4I66A 3WXBA 1A96A 3SE0A 4Y2QA 2AFIB 2X5OA 3CH6A 1I6LA 3OHSX 1BOOA 1NI5A 1Q7RA 3ACBA 5CTJA 1XPUA 5KDDA 2PUVA 4DMFA 2HREA 3N6VA 1FNSA 3NOVA 2GLUA 4AD8A 2GN2A 3P45A 1JJVA 5DI3B 2PWYA 3K31A 4C4AA 4MR8A 3KTOA 2WM2A 3GLRA 3PCRB 1GPNA 1XRMA 4LMBA 4RD1A 4U4AA 4BX2A 5CFNA 1CUXA 1H1TA 1PG0A 3HJGA 2ZB7A 3LT4A 2E2WA 1RQ2A 4BQRA 3EJ6A 1YQWA 4QQRA 3BIWA 4MTLA 3R6LA 1YIOA 2ZS8A 4R7TA 1ORWA 1WPGA 1E8DA 3NH9A 1E4EB 1TM2A 2H1OA 2JGDA 3TRIA 2GPTA 1GQOA 3CINA 1DJOA 2Y77A 4CKEA 4F3KA 2XHEA 3GAZA 3T9AA 4IS3A 4MHOA 5E6RA 1N92A 1YSCA 2H4HA 4B32A 4KOEC 4XZ3A 3GP5A 3U5TA 1M83A 1XGKA 4RH3A 2VN8A 4D9MA 2AN1A 1JDUA 1DI0A 4QM6A 5DZSA 2QOEA 1VM6A 1H0RA 3ZS9A 1NF9A 1E32A 1CHDA 1SEPA 2HI0A 2NW6A 2WJVA 4JB8A 1KDVA 3T5DA 3X1XA 4CDGA 1G9SA 5D2CA 5A5VA 4QPCA 5KYUB 5KYTA 3FSEA 1ZJWA 2ZK7A 4OP1A 4CTKA 2BI8A 1JU4A 3AHEA 4EG3A 4BGUA 1V6SA 3EXHB 1XVVA 5DCLA 1HLGA 2ZBRA 2QWXA 5FUWA 3D0QA 4XDZA 1K4MA 4L9RA 2WV7A 1Y4DE 3L0BA 4G36A 1J00A 4HB3A 3ZU3A 4BQQA 1WTAA 5JD6A 2BGWA 2OD2A 2VCHA 1E5LA 1HQKA 2RJ3A 3O2SB 3AB3A 4C4SA 2B2NA 5IH3A 2VK1A 1GAQA 2ERYA 3DB2A 2KSQA 2IKQA 2DT8A 1J24A 2M2IA 4LPKA 3RNLA 3B53X 4DRXA 3LOPA 4ENQA 2IF0A 4XJVA 1KQNA 8OHMA 4EJSA 2RJOA 2DP4E 2O4CA 3VZQA 2Y66A 1QQTA 1ZJZA 1IM8A 2H8GA 4ARAA 1V5GA 3HNOA 5EFOA 2BP7A 2C20A 4Y0NA 3WO1A 4IIJA 3G9TA 3OHPA 4ZAVA 3IOBA 3WL8A 3UMJA 3FZYA 4WZAB 1ZJ5A 4UTOA 3UB3A 1A4UA 1PK7A 2NU7A 2WJAA 2O2JA 4N54A 5JYAA 3PCTA 4L07A 4UAUA 4WLUA 3VNRA 4IWXA 2RAUA 2OKCA 1JGTA 1JHPA 1NUHA 4IY1A 2DYKA 1M2HA 3PR2B 5T8KA 4OMDA 4ZDKA 1URPA 5CLFA 5I7RA 1RWVA 3B2NA 1XZGA 3DAOA 1KH2A 4LFBB 1VMKA 1MTOA 2G80A 2B3DA 2UYQA 3AH8A 4PYIA 4XSGA 4TMTA 3UAZA 4D44A 2QMZA 3TB6A 1RW4A 3DDUA 5JOQA 3TCKA 4RTKA 1TU3A 1X92A 3HDQA 1MC1A 1WB6A 1I0LA 2QY9A 3NRCA 1QB7A 3IT3A 1WX1A 2FWBA 3BSWA 5H3CA 1AHHA 1O57A 1O58A 4LF9B 2W2KB 1LTQA 4ZVQA 2UZ4A 1T1IA 3NMUF 1ZOPA 3DTYA 4YCBA 1ID1A 1GR1A 4K9KA 5CM8B 3PC6A 4UUMA 3REQB 1ZM4A 3CEPB 3GL9A 3N0RA 4LW8A 4N0QA 3R6DA 3PNOA 4RF4A 2Q4RA 4ZYTA 4H7EA 5KU7A 4RVOA 2GK4A 1CUAA 3GDGA 1KORA 3GLGA 4ZVTA 4NVRA 2H5EA 3GB9A 4CPDA 2LDBA 2AOUA 3KM0A 5FCDA 4A2QA 1WR8A 3NTUA 2BZGA 3VDXA 3ZBTA 4UFPA 3U1BA 2LIVA 2WOJA 1CDZA 1RWQA 4YASA 3W5JA 2JIRA 1CUBA 5AW1A 1IOVA 3H1BA 4R2XA 4N3CA 1UAGA 5FPYA 4BNLA 4RAOA 3FKJA 3HE3A 2HU2A 3L8DA 4M1OA 4NJMB 1XZCA 4RVDA 5AI0A 5HKAA 4YB8A 3FFXA 4ZKEA 3F8WA 4W7HA 5BN4A 4C7MA 4ZVKA 4BZXA 4ML3A 5BMVF 4ACBA 2RK6A 1N0UA 3TNJA 2DERA 3E81A 4IRUB 1ES9A 2HDWA 3QU4A 4FYVA 5T4HA 5JS8A 3BVPA 2I4IA 1ATZA 2CNWA 5SYAA 4CM8B 1T10A 1YZLA 4HN4B 1KMNA 4GX5A 4LSZA 3RQIA 1NNI1 2AOTA 3X1ZA 4KN8A 4ZRNA 2PANA 3E5HA 4XWOA 4N41A 4UM7A 3KOYA 1VJ5A 2R6HA 2BF7A 4N12A 5FV7A 2VQEB 2VJBA 2P3LA 3EY9A 1JHVA 3Q7QA 4MUEA 3VGJA 2XVZA 4C7VA 3L1HA 2LGJA 5JFGA 3M6XA 1HRDA 3QV2A 1OGJA 1RNLA 1XFAA 1B3BA 4PPNA 5TXGA 2PNJA 5HM8A 2QQ5A 1E9SA 3IAAA 4YJ3A 3RJ9A 3BWEA 2O3SA 4MWCA 2XT0A 4D2IA 4EUKA 4X54A 3PIDA 1Y1TA 1W4RA 4CMHA 5HZMA 1CY1A 4YRLA 3FF4A 5AKZA 4N82A 3WKAA 1I7CB 4IQFA 5CMLA 4RORA 4DGSA 1I36A 1EDBA 1VE5A 3AIKA 4CTJA 2OCGA 1US8A 4PZDA 2TSYB 4QOSA 4KZPA 3PE6A 2N9UA 2C7PA 1U2PA 4O63O 1BEZA 1NQVA 4YO7A 5DISB 3RJTA 5JXGA 2XGSA 2XAUA 4UMEA 2ZE6A 2NAFA 5JVDB 1M2KA 2QRNA 2HHAA 3SIRA 4RA9A 4ILKA 1FJ2A 1DMRA 3KOZA 1E9BA 2XJ9A 2B7BA 3KK0A 3V4FA 1FIUA 3CFYA 2OG1A 2JLUA 2XZLA 1QE5A 2B30A 1GTL1 5DNDA 1A8PA 3MWKA 2VH5R 3L8GA 4MS4B 3GJTA 3KB8A 4QELA 1BWPA 4K2AA 4NAUA 3PNQA 3PTLA 3ZJ4A 2H57A 5JPDA 4I08A 5E1DA 1GL7A 1C4OA 1I7QB 2H31A 3DMDA 3IEXA 2GPYA 4NFLA 3OX1A 2PZ8A 1ZQ1A 3GVIA 3G8YA 5D51S 3GJ6A 1DAFA 4PQFA 3RIMA 3KWLA 4MYTA 2BCEA 1TAQA 2ZXEA 1YGYA 2H92A 3KT6A 4ZI2A 1DDIA 4A1OA 3OZGA 2QW0X 3PGVA 4FOTA 5BT8A 1UZUA 2O8EB 1HQYE 5AKGA 1KOFA 4KUHA 2H7CA 3PHGA 1JHQA 2PH1A 1NURA 2IHKA 2AOWA 2DFLA 1T2UA 4ZHSA 2QMHA 1A2QA 2Q6IA 1VKHA 3OZWA 2OCPA 2O0KA 4RL4A 5K0SA 2OZLA 3OCWA 2C2OA 3TFOA 1MB2A 1TLFA 3RTCA 1DHRA 2GVZC 3I5AA 1I01A 3FPCA 3MOGA 3FHOA 2XOKD 1GRRA 1TO2E 2A6PA 3WTCA 1KYQA 1NMSA 1HO3A 3NBUA 4MDHA 4PG5A 3N2ZB 2P9YA 3PXAA 4A2CA 5JAPA 1A7JA 1J33A 4YBZA 3WGOA 1OT3A 4XR9A 1V7ZA 2OORA 1V35A 4K3UA 1T26A 4LPSA 5DX1A 3UTDA 1C1DB 2V7UA 3DO6A 3V4SA 4AVYA 4TQAA 4ZJUA 4R98A 1R16A 4QPDA 3VR5D 1AA6A 1TQ6A 5FULA 4DWJA 4LRYA 1QC5B 3D4OA 4ARIA 5FAKA 2DWUA 3QNUA 4WY8A 3BH6A 5ALJA 1U9CA 3RS7A 4J4TA 5HTOA 1EZ1A 1BMTA 1QUFA 1DRUA 2QL5A 1BKDR 4RHCA 5LZ7A 4Q1EA 1O77A 2VDOB 5CFQA 2BWJA 4DDMA 1B0PA 2D5BA 1JX6A 3KTAA 4DJ5X 3I64A 3NAZA 3UBMA 3OZ7A 4OJKA 4OXIA 4F3TA 3LA6A 1GRCA 1TECE 1TVKB 2VSXA 4KLZA 3TSYA 2VF8A 4ND4A 4C88A 3T1NA 4BPBA 3O31A 2PYZA 2GUWA 1XALA 3HDGA 2ZRJA 3FFTA 4MARA 3DM9B 2FWAA 1WSWA 5AVXA 1B26A 4I6JA 4MUKA 1JNYA 2Q5FA 4Z4IA 4LQ4A 4D3DA 2BE7A 2J5BA 3L4KA 2PLFA 4QDZA 4EG8A 4HZGA 2NZVG 4LCJA 4BJ1A 2P4UA 3HJCA 2C4HA 2VI5A 4XJTA 3T34A 1YJXA 5DH9A 1YNOA 3LT0A 4RADA 1PTKA 1EFHA 1Q7BA 3JASB 3RUPA 3DBIA 1E4EA 1B6SA 3SR0A 5LD2B 4XUDA 1G6OA 4JASB 3IERA 1S5PA 5LR6A 3E18A 5L3VA 3P2YA 2O07A 1WCV1 4QBFA 3VZPA 2QUBA 3WDMA 3TLYA 1OXVA 2SKEA 5EQFA 2A7QA 3HG7A 1E79D 3VMFA 3IXQA 1TFRA 2QXTA 4NMMA 1E2KA 1GGMA 4K88A 3Q3VA 3KLOA 4LQLA 4OA8A 1X70A 4HPWA 1VCHA 4H6PA 4DCJA 4AK9A 4JLKA 4CCYB 5KYUA 1NXTA 5KTMA 1FFGA 1AK9A 3G89A 4ES6A 5FWYB 3ZQ4A 3IHWA 4M6WA 4QXOA 4LYEA 4G4JA 1N1MA 4K03A 3EP4B 1WZEA 2R66A 1XK6A 3ODPA 3THWB 2AJ8A 3GJ8A 3R5HA 1YJCA 1HUQA 3WK7A 4TUYA 4GRDA 3O95A 1MOQA 2CXPA 1H9CA 4Z0PA 2ZUVA 4ANFA 5HKOA 5JJIA 4DUPA 4Z4GA 5FOXA 1VMAA 3O6VA 2FJ0A 4LF5B 3AW8A 1L3CA 2VWQA 1HZJA 2GZ1A 1R6UA 3JD4A 4FFBA 4ER3A 3COJA 3HXQA 1S8NA 4FU0A 4MUXA 2A3NA 1NSTA 1KMIY 2NZJA 1GQ2A 1J42A 1TPZA 3L7CA 3OZFA 4LY3A 2YRXA 4OP3A 2AB0A 2BUCA 2GFHA 1CT9A 1CV2A 1KP2A 4IDQA 1QG0A 3CX4A 4P38A 1M5TA 3KFLA 1RRGA 1A7AA 3U1TA 4C4RA 2ADOA 4U7HA 1FDVA 4UJ3A 3VR5H 4WZAA 1JSXA 2VOEA 2Q50A 4RQAA 5IYZF 2QAGC 2VTBB 3ZBUA 4B9AA 3OIGA 2AI2A 4KDEA 4NMXB 2PU5A 3JQ9A 4Q4AB 1YBHA 1P7YA 1JHMA 2JLAA 4BWVA 4AAYA 3QE0A 1REQB 2PL9A 4QEDA 4CIVA 2IH4A 2A86A 3WL3A 2ZAMA 3WB0A 1GGFA 4JJIA 3STXA 5DBEX 3UJ3X 4ALIA 3ZHQA 5KVCA 3VU8A 1K98A 5KNDD 2ZUEA 1DV1A 1I9GA 2WFAA 2YJ4A 3IAS6 1M72A 3QNWA 2A58A 2QJFA 3I04M 4NBNA 4EYGA 1VGVA 3AM1A 2FSUA 2FW7A 4LOLA 2FEXA 2OHIA 2JIPA 5KSPA 4U2BA 1SKYB 4L5JA 3HJTA 1SC6A 3FYTA 3NM4A 2WFLB 2CWWA 1JJFA 2I7TA 2GK6A 2XZOA 2AN5A 2WAMA 2FUG1 3EZ7A 4IJMA 4QDOA 2PZEA 2WDPA 4IFTA 3KZVA 3H9BA 3ENWA 2V55B 3OLXA 3JQAD 4PZ9A 1STOA 4X65B 5CD9A 5IMSA 4QGFA 3SHOA 1V3TA 4B3HA 1DS6A 2WSIA 4BEVA 1EVLA 1G6HA 4M0PA 5E2AA 2XQVA 4XH9B 3S5JA 4K9MA 4R9NA 3HYNA 2GCGA 2GZSA 3BMCB 4OJYA 2BGKA 1NNUA 1YKGA 1T8WA 3B5JA 3N2EA 4FFVA 4J0GA 4BO6A 4F85A 5JPCA 4LJ5A 4OMFG 4NJMA 3E4CA 2FEPA 2P2YA 3QY9A 1AHNA 1BE1A 3N70A 1VPDA 1MFZA 2J5KA 1YOVA 3AKDA 3EDOA 2D54A 3M6UA 1FQOA 2TMYA 4HATA 4PGHA 4RQTA 5JSKA 1L6IA 5ALMA 2KB0A 2XI4A 4EIWA 1Q1GA 2FW1A 2IZ1A 3TEFA 2XNDA 4WY5A 3THRA 4FSXA 1KMCA 4CM8A 3ER8A 5I7EA 5TF0A 2BGTA 3LV8A 4GAEA 2BOVA 3QEKA 4KAAA 4ZT6A 4ZEXA 2ZWMA 4XEHA 4YALA 4BNMA 1L8OA 2OAEA 1YD7A 3I9V6 1UJ4A 4ND8A 4UVHA 4B4WA 3CR7A 3V7UA 2QP9X 4YHHB 1E0DA 4DNPA 1L5HB 2ZPAA 2HU5A 2OXFA 4RQUA 4BE7B 1VJGA 3G5AA 1J9GA 2VS1A 5CLGA 3WNCA 1X0VA 2JIQA 3EIEA 3F90A 2QN8A 4DTCA 2QG6A 1F8FA 2BMAA 2JGFA 4RPHA 1X80A 1B15A 2I5PO 1QAOA 5L7YA 2ONJA 1EK5A 1F0YA 4I1OA 4TN5A 4K05A 5BQFA 2QVLA 1PQWA 2J9FB 4FR2A 4MKGA 3IURA 4C76A 3TBKA 3UUFA 3VSEA 5HE9A 1ENYA 1EUCA 2LPMA 1G5FA 5G4LA 3PVCA 3R9KA 3VA7A 2G6TA 2ZSAA 3JYNA 5CBKA 5JVDA 1NM5C 3A4YA 1H8HA 2X6TA 1FSFA 5REQA 1QTQA 5DXFA 4KSBA 1A4XA 2BBWA 2E6KA 3BXHA 4MZDA 3CA8A 5MN4A 3ZY6A 1M6EX 2WB4A 1OA0A 3FZGA 3L18A 4LJAA 2IP1A 2MR5A 5KNDH 4PV7A 3TH5A 1SEVA 1VE6A 1Y1QA 1OAAA 2LVBA 3ITKA 3PFBA 4RAQA 1TT5A 2JIZA 1LJLA 3SEAA 3V32A 3ZGLA 5CVEA 1KK0A 3RLIA 4CM9A 5CH8A 4G4SO 3HZHA 5J9FA 2RHDA 3QU2A 1RU3A 3TW4A 4JJKA 3U3XA 1EXVA 3W3AA 4HRVA 4XOIA 2ZI6A 1ZM3A 2HV8A 2X22A 2ZYAA 1M2VB 2QV0A 3FETA 4LC9A 3V48A 4DLSA 4IEIA 4L78A 5IARA 2C8VA 3W8DA 1C3XA 4CDMA 1J8QA 3LQKA 4OQMA 1LRLA 1ZUNA 1E18A 1MX5A 4IFBA 4HGQA 1K7XB 1SCQA 4O59O 1PD1A 2GXQA 4J9VA 3H0WB 2ZRNA 4GOJA 1ZIYA 1OKKD 4MAMA 1WKBA 2CNDA 3NB0A 1XTZA 1I8TA 2I66A 2WT8A 4ZCPA 1Q83A 4OQDA 2YIDA 3JWJA 3DMHA 1VHLA 4PYMA 3V2UA 1V1JA 2ZKIA 5GJCA 3WMWA 1Z6YA 2PUJA 4BU1A 1VMEA 2XCLA 1EP9A 5AVVA 4TV9B 5DRYA 3SQXA 4C06A 3P4UA 1J8YF 2NX2A 2WOOA 1IZ8A 1TW2A 2FPPB 3UMVA 4PSUA 3KXPA 5EQDA 2WUDA 3TIFA 5M3BA 1R8SA 4B8ZA 3U3MA 5K3EA 3K7EA 5KMGA 3C4QA 3FWYA 3T5CA 4I9HA 5CA1F 2X86A 4LVCA 3RT1A 3PKIA 2QB5A 2FE1A 3WJ1A 3HK2A 2QQ0A 1I1QB 1FFWA 1RCUA 3E53A 2G40A 3A4IA 3AI2A 2BKEA 2WYHA 3K9GA 5AK5A 4G1VA 2ZYIA 4XX0B 1EUQA 3HNPA 3K30A 2NV6A 2B20A 4UEKA 5B1EA 4UZEA 2I1LA 1ECBA 3R6TA 3G8AA 3M7IA 4YMWA 5K51A 4F8JA 3U4QA 4DCTA 5DNYB 1JFSA 4ZDWA 4UM9D 1Y82A 2PBZA 1CUUA 3CRMA 3WLAA 3W5AA 5L3QB 1DX4A 2YY6A 4TL9A 4YJGB 4Q1FA 4UXHA 3O8RA 3GEGA 2JRLA 2IVFA 1E2JA 2QX9A 4JK3A 2HOQA 5K0BA 2C5EA 3RS8A 3R0JA 2QXYA 4YV2A 3M1AA 2Q1YA 2J7PD 3PHCA 3SOPA 3SF8B 3I62A 2EEPA 4YN3A 2BFDA 4BP8A 2MWMA 1TJNA 5K3AA 2HW8A 1ZCBA 4BVAA 3DOHA 1R8QA 4QL3A 4DDHA 3LC7O 3A6EA 1OFTA 2P11A 2EZ9A 3VJLA 5IZCC 3KEQA 4GEGA 5DX8A 3S70A 3ICCA 2JAOA 5IWAB 3JVIA 3ZY5A 1T2CA 5EFZA 1DLJA 3ZK8A 2YHIB 4MDFA 3CZAA 2Q0QA 2Y93A 1UFQA 1UR5A 3BE6A 3DR5A 3GI1A 3CY6A 5CT5A 4CCYA 2VKQA 3BH0A 1RPTA 3UK2A 1N36B 3RT9A 4HH0A 1EHCA 2XUOA 3FUTA 4L8LA 4A0QA 5LXTB 5LZ5A 1PWEA 1XTUA 3D2LA 1YZKA 3ETNA 4MQ6A 4RFLA 4G0ZA 3BL5A 1CY8A 3FVRA 3C6YA 1JHXA 2VYQA 1TK9A 2EQAA 1U7TA 1ZD4A 2TYSB 3E5RA 3AB8A 5ADVA 3LUPA 3QH4A 4MUBA 3EW9A 2VVTA 2I6GA 4EW2A 1PDVA 1I2AA 3BK2A 4ECAA 2QTRA 2VNIA 2E5LB 4QBGB 5DYWA 3I42A 2B4TO 4N1AA 1LWNA 3ZTWA 2QRVB 1BDBA 4TTIA 5JS6A 4YWHA 3OE1A 3EARA 2Y1CA 5KWSA 1IVNA 3RJMA 2CLDX 2W58A 5AXCA 4LDJA 4DPKA 3QE3A 5F5XA 2FGKA 2JGLA 2JH8A 3FJOA 2WZDA 4N39A 5JNUA 2XXJA 2XBMA 4OLAA 5JJLA 2CGEA 1M6WA 4BQOA 1CRWG 4E09A 1XNRB 1IN1A 1JQEA 5EWMB 5TSDA 1IPFA 5KYXA 1UMBB 1X7XB 1P7VA 2BMJA 3L82B 2QSUA 3LVQE 5CPBA 3ZWAA 1DEOA 3USES 4D80A 5CDSA 3FYCA 1K68A 2GBLC 1U7DA 4I3HA 4R2LA 5DNAA 2NAPA 1PK9A 1R9NA 3EIUA 2G09A 5AM1A 2CDNA 5CT9A 3P9SA 1A04A 1LXCA 3CZ9A 2EBHX 4GWKA 3VYRB 2NZ2A 5FPTA 2ZQYA 2XUHA 3D3WA 4TTTS 1ESMA 4L95C 1MOPA 1UZMA 3M6MD 1RJ9B 3FZQA 5AVTA 2R2GA 3ZD7A 1VXRA 1EK1A 3SEZA 1T2DA 4WKBA 3V33A 1XVLA 3CB2A 3A0UA 4H60A 2HMVA 1R18A 3W4IA 5HF5A 2FPNA 1MA3A 1FQKA 2PKQP 5BQ5A 1KDZA 1D4AA 1EH5A 1YK1A 2PKRA 1LPPA 3LCCA 1FTGA 4BFWA 2H1RA 8ABPA 4J03A 3HUUA 5I9MA 3E23A 1L8QA 2BM9A 4I8IA 4MGYR 2ZSBA 3DHVA 4J1TC 3EVBA 3MT7A 4YBRA 2R1TB 4ZOLB 5T3UA 1FTWA 1U8CB 4WZBE 1O54A 1Z6TA 3OQPA 2DJIA 3G2OA 1OZAA 2ZBEA 5ALQA 1WUYA 5BSEA 1Z88A 1JR6A 1EVIA 3RAJA 3FNEA 1WMDA 3AUKA 2RHWA 2BEVA 2R6R1 3LLSA 1Q92A 4F72A 4UUAA 5KOHB 3PUXA 3GZJA 3G59A 4TWAA 3U7RA 2V4UA 3O94A 1QMPA 3DNFA 3DBOB 5B58T 4KQ2A 1T8YA 2QI9C 3QUSA 4QVKA 4DNFA 3AUAA 4NKRA 1EAYA 2P5SA 5TR9A 3ZHCA 2DKFA 2I2FA 3C1AA 4M0FA 1AS2A 1DBWA 5K3BA 2XQJA 2BI4A 1F12A 4EQ6A 3VOAA 5K7SA 1Y8QB 1O6ZA 4I6GA 4R9SA 4I9NA 5C51B 4BBAA 1JA9A 5ETJA 2C04A 2VSNA 3KAJA 2A1IA 4UHJA 3S68A 3A9TA 4CMIA 3MQFA 1JF8A 3DXYA 2IU6A 3EXIA 3MGCA 3AKEA 4UEWA 4X8MA 4GP7A 3SZOA 4JKYA 4LJKA 2YWFA 1AQLA 1YXMA 1O4WA 4KWIA 4F4UA 2CC2A 2HWKA 4NJOA 3RKSA 2FMUA 1XEXB 1O6CA 3LVFO 4O89A 1XWFA 3OPYI 1I2CA 4EAQA 1K2VN 2XGGA 4RVNA 1OSNA 4AZVA 1CZOA 4AKGA 4R1QA 4C2AA 3TJRA 5ICSA 4KHZA 4EY6A 4YAWA 1RQXA 1ZGGA 2ZWVA 3C8MA 2AD1A 3EA5A 1BCRB 1DO8A 4GI3A 1YONA 1DKMA 3IP9A 2ISSD 1R88A 3JARB 2BY4A 4MUFA 1H2BA 1PWZA 3ICOA 3P9XA 4I3FA 4X6UA 3BERA 4RH0A 2EJCA 5HEKA 2IA5A 1HE2A 4K81B 1YDFA 1RXWA 1XCLA 3K53A 5TLSA 4DMLA 1XAIA 3FOBA 4TYWA 1CE8A 3TLEA 1NW9B 2XOEA 3HWWA 3QVLA 1TC2A 3HDTA 1MFPA 2JJMA 4PY2A 1SQ6A 3UIEA 1OVGA 4MDYA 3VVLA 1F2UB 1XJ0A 3RARA 1YI1A 3UB4A 4I81A 2YHUA 3FOFC 3VSCA 1VKJA 4MIOA 1O2DA 2F1HA 4G8BA 2PXAA 3QKSB 4G63A 4R8KA 4YRDA 3KNZA 5K3OA 4BL5A 4NR0A 1YL7A 1PX2A 1XHLA 2R4UA 5KHOC 5GV8A 4DILA 2IEYA 1UDXA 1L5MA 1R3UA 3CEJA 1UMCA 2XWBF 5FUMA 2YVUA 2FPRA 3MJSA 5HKBA 4O4LF 4QEZA 1NMEA 4KLAA 4W82A 2PY6A 3PFWO 2I3GA 4IOLA 2PLAA 2VDWB 4ICIA 1LVUA 3VU1A 4F0JA 3VC7A 5LA6B 4IUCS 3SVLA 1KZ6A 1UUFA 2VDVE 1OQAA 4RDXA 2O8FB 3IMKA 3PDJA 3KYIB 4IQ0A 4OU5A 1B16A 2R87A 4AF8A 4C7KA 2RHOA 3BGWA 3PRKE 2ZRHA 3A3PA 1W0CA 4ZDIA 5IZ4A 3NBAA 3KX2A 4E1BA 4QBHA 4ETNA 2X2FA 2EOAA 1J8MF 1M5RA 4MA5A 4HQLA 4GH5A 4NYMQ 1TM4E 3UWOA 2JA1A 1NX9A 4LZLA 1E2MA 2QRZA 3P0EA 5DSTA 4CM3A 5C9ZA 1TAHA 3QE2A 3OEHA 3IJEB 2VOJA 2NXWA 4WXRA 1RC8A 4IF6A 4DMKA 1XPOA 1L8XA 2J4FA 2YRWA 2DQZA 3P2OA 1GUYA 2IIBA 5C5IA 2FWIA 4BECA 3GV0A 4J0DA 5JYDA 1QLJA 5HA5A 2UUBB 3DL7A 1YUNA 1NBMD 2P9TA 3HHPA 4XX0A 1ORDA 1JSCA 3NBQA 4MCAA 1QIFA 4DR1B 4ENVA 1DSSG 1GDTA 2X4DA 1GZ7A 1WOMA 5BPHA 3KJHA 5LYJA 2BMFA 5CX4A 1TB4A 1R64A 3EW7A 1OAKA 3SSAA 4RTOA 1B1CA 1G3UA 2CE7A 4C4OA 3HCNA 3Q8MA 3BXXA 1QHIA 4KQIA 4C2UA 5LM3A 6REQB 5ED4A 1NZFA 2X9GA 1JHRA 3ICEA 4KWEA 2BGIA 1TXGA 1DKOA 3R7FA 4YJGA 5EN4A 2EHDA 2GVDC 3QYAA 1GL6A 4UBMA 4WKOA 4BJHB 4YR9A 2J9GA 1LY1A 4BFCA 1WXFA 4PHFA 2V6JA 2WF7A 4GZLA 3UBTA 5HRAA 1T5IA 2QVGA 1UKCA 4GUAA 3PUJA 1KVRA 2DFKB 3TDNA 4RIFA 1I13A 2OB2A 1EFRD 1K6MA 4A5OA 3KQLA 2OXCA 4H27A 1IUKA 3DZ8A 5TS3A 2O52A 4ROSA 5KVSA 2XNKA 1N5LA 3WLJA 3G7SA 4DCPA 1YDWA 5BORA 1H1DA 3Q3JB 3SI7A 1HLFA 4CQMB 2QAGA 3DWGA 4XRRA 2V6IA 1FXWF 2OY0A 4TXHA 3QPDA 4MW2A 4KXFB 2YWDA 4N6OA 1MB0A 4CLRB 4IICA 1M2EA 1LC0A 1O97C 1QGOA 1UDRA 2P0AA 1U3VA 3DC7A 1D09A 2D5CA 3G7UA 4DZTA 2A0FA 3CPSA 1T8UA 5B4VA 5IFLA 3KIPA 5CLQA 1XRPA 5DASA 3IWBB 5CAEA 1GPKA 3LC1O 1QCCA 1G8FA 4P4SB 1VL1A 3HRKA 1XZEA 4LJ9A 4ZT7A 3ZW9A 5HVNA 4M0KA 1A97A 5EHGA 1F17A 1UJ2A 1CQZA 2D7CA 2GEDA 1XRNA 1K7CA 3W5VA 3B36A 3GELA 4YFVA 5F7JA 5I9IA 1KDYA 5KU1A 1RZRD 4Z4QA 1ORVA 2ZIVB 4X24A 3E1GA 1T5BA 4YRNA 2GA9A 1EFUA 1KIFA 2PCLA 1P7PA 3GEBA 4R8RA 3NAGA 3FYUB 5CNKA 1OBFO 1HTWA 3T54A 1A5AB 2HJHA 1H85A 3FNGA 1KYZA 2XNSA 4JI6B 1GYRA 3C8DA 4W99A 2XNCA 1BA2A 1Z2PX 4E5NA 5BQOA 4D8WA 4DADA 5B64A 4HLUA 4GNRA 4MCHA 1CUIA 5KUTA 1RMTA 4OX9B 1QUEA 3LUCA 3Q7TA 2V3VA 4ZOAA 3PX7A 5AVJA 4Q9IA 4IMIB 3SJUA 2FY8A 4C0QC 4H0NA 2RBGA 5EWMA 1U7ZA 3ESQA 1X7XA 2XUAA 3UPDA 1I7PA 1UOOA 4G85A 4P1ZA 1E66A 2F67A 1HRKA 2AMLA 2Q0HA 3FA2A 2VJQA 4W8GA 3ISTA 4MW9A 2YMLA 3PHHA 1NJ5A 3QXHA 1PJRA 4IDGA 4JBIA 2CL0X 3PQ3A 2E6UX 4OM8A 2IPNA 5F76A 1LS6A 4IG4A 3G2MA 2ZRBA 1KU0A 4KH0A 5CM9C 1N32B 4H7KA 2D1RA 2HQSA 4B6FA 1IH8A 2V9PA 1IHPA 5SICE 3MEQA 2XLBA 3INNA 4L8YA 4OXQA 3C5EA 2QT0A 1RTTA 1YJQA 1SD5A 4GMGA 2GFQA 3MINA 1J8DA 3OOEA 1R7RA 2BTOA 3IAEA 4KTVE 4HH1A 2FPIA 1VKRA 1EXNA 1T36B 3V4PB 3FROA 1TVEA 2W7TA 3O9MA 4I9UA 4G9BA 3ZIAA 4QOGA 4BUZA 4RVGA 2FMFA 4L7QA 4P8RA 1YHNA 1ZYUA 5AK3A 3OZAA 2FSVC 1Q1QA 4BVJA 5JADA 1R8YA 1FJGB 4L4SA 4LFAB 4PE5B 1XZJA 2WHEA 4TWIA 3UMYA 3E03A 3DBHA 4X3PA 3BA6A 4XYLA 1X13A 3OFNA 2A9KA 1PT6A 2VT7A 4GZ3A 3EQ8A 2NO5A 2HZ7A 2PAFA 2XYPA 3GCGA 3KYDB 3SPXA 3TO5A 3T5AA 2QNRA 3O26A 4EW6A 2GI4A 4IQGA 2YTZA 4OMCA 4P4NA 3AXSA 1BHQ1 4D9KA 4FUTA 2UYYA 2YVAA 1I1NA 4QYSA 1ACLA 4JX9A 1KFBB 4Y2JA 3UV7A 3RUCA 1JIJA 4HGYA 5DP1A 3SVTA 3C0KA 2H9YA 3MGKA 1F60A 1Y8QA 4FZJA 4KVGA 4RD3A 5E7IA 4BDSA 3ZTTA 4P92A 4WDQA 4F9TA 2W6JD 2VSQA 3MIIA 4YDHB 1EX1A 2XB4A 3HFJA 2XJ4A 1MJNA 2IJGX 3OZTA 3WRXC 2POQX 1SELA 4OFZA 2PS3A 3TI9A 5K0EA 1SC9A 3NYQA 1L4HA 1P0QA 2FZWA 4KXUA 1E1MA 3RRYA 2F9MA 3C2QA 4PGMA 3SQOA 1PUJA 1A3CA 1ZMTA 1WVGA 3I4FA 3P9PA 1A95A 2B0JA 1ANKA 2XH8A 4JT4A 5A4AA 2HQOA 1A4IA 1XEXA 1Q1NA 2A1TR 4ZQEA 3QG5A 2GN0A 3TPZA 2I8LA 4WT7A 2XDAA 3EVCA 1XEWX 1RHUA 1GGKA 5CPFA 1C9YA 2ONZA 1M54A 3G85A 5M7EA 2NU6A 3K8ZA 2H4WA 3A05A 3HB1A 1DIAA 4NFSA 4N7JA 4M1ZA 4FWTA 3OQHA 3VQTA 1RYEA 5EC8A 4D4LA 2RAFA 4F06A 1RXSA 1XG5A 2O6HA 2PX0A 1IWPB 1A9TA 2HPHA 3DZGA 4MP8A 1V9LA 1Z45A 3CX6A 1XMVA 2O3TA 3A4TA 1ZUHA 1JAXA 1MJFA 2CHGA 1GCAA 3E3NA 4LJYA 1QFZA 1PWHA 2H2DA 2EDCA 4WK4B 3QLVA 3B3QA 1OF1A 2KMLA 2GILA 1PZNA 2JJYA 4G37A 4KX5A 4M3NA 1NUQA 3NT4A 5EEGA 3EPPA 1SZDA 1VE9A 3VNUA 5K3SA 2NQ8A 1SOMA 1JMVA 2P1RA 3SS9X 3K15A 2OD9A 4JS0A 1FE8A 1IWOA 1QGYA 1YCDA 2BELA 4Q37A 4L74A 4MPDA 4ARUA 4DCUA 3LL7A 3BREA 1BJTA 3B3GA 1RD4A 3ENKA 5KDLA 4ABTA 2FDCA 1ACJA 3SM3A 1ZVKA 3NRBA 2R47A 4D9GA 3OPNA 4W6QA 5C8ZA 4M9SA 1JG6A 3N7AA 5C52B 2Y1DA 4NCBA 3F71A 3MG9A 4MI1A 2J9RA 3DLTA 3DGEC 2EG9A 4PWZA 3T5GA 3X1DA 1UEXC 2QW1A 4MULA 5SZJA 1DTWA 1THGA 1SULA 3NIWA 3MAGA 1PZXA 2E4VA 4YP1A 3ZYZA 1OZHA 3O83A 4IVPA 1A9XB 2V7GA 3PB3A 5D01A 2KWIA 4E2WA 1YZHA 4HXFB 3W2IA 1I0ZA 4B3FX 3HU2A 1ORHA 3UVEA 4M0CA 5I48A 1XZFA 1RKUA 1XF1A 3H9QA 2HMTA 3S0JA 4E11A 3AYZB 3C43A 2R48A 2OK8A 5D1HA 1W0JD 1C4KA 3QXJA 3QSYA 2ODBA 1XMXA 2JATA 3DT6A 3FTDA 4CM4B 3N2YA 1AS0A 4G56A 1WV1A 1KI6A 1OD6A 4UNSA 3HKCB 3P2JA 3QFFA 3TLBA 2CLKB 4IVRA 3IIKA 1KXZA 2GJKA 3ZC3A 3MXOA 4FP9A 4WK2B 4M53A 2AVNA 4K9DA 5JG7A 2PR2A 3UXEA 2GNAA 4TN1A 3UENA 1W4ZA 5IZCA 1P0PA 4IUYA 3Q1KA 4JITA 1MD9A 2EGHA 3RRNA 3VZSA 4QFMA 2KLHA 3N74A 4EI9A 2GHQA 5ICEA 4KLNA 2D1FA 2V0CA 4NYIR 2RKWA 4N65A 4AG5A 5CUQA 4I4IA 2PMBA 3F3SA 1Z0ZA 2E9SA 2QL6A 2WYOA 2YCBA 3HCCA 4FEYA 4JOQA 4TGLA 2FI1A 4G97A 4C5BA 4GR4A 2A5DA 2Z8ZA 4LBWA 1MR3F 3D4LA 2HWWA 2Z8XA 2DXIA 5HFAA 2ZU6A 5D3MB 1S8FA 5THQA 4R6WA 4CLDA 3D8BA 4X8LA 2FK7A 1IWBB 4UAJA 1SZJG 6REQA 4K28A 4V0NA 2EW8A 1BHJA 4RJJA 1NASA 4POOA 3C1UA 3A32A 5JQGA 1NDHA 2DPYA 1Z37A 3IT2A 1VBFA 3GLVA 2BHSA 2O2XA 2JD1A 3BJMA 4G8DA 2H1LA 4CT0A 1JFRA 4RZXA 2AJDA 4F60A 1X87A 3MVEA 3IP7A 5IPFA 3E8SA 2PLNA 3ZKWA 1I5RA 3G2LA 4FEEA 2IP4A 4IO0A 3FOZA 3L1UA 2VHWA 4JIGA 2X2EA 1NWHA 1U1CA 5F77A 4JODA 2BHTA 2WFZA 4TMYA 4RTRA 3VAZA 1WDTA 1EX9A 4TTPA 2AYXA 1T4GA 3ROTA 3X2SA 3MWEB 4BVLA 5D3KA 3WG9A 4CLRA 2GBLA 3FB4A 1SXJE 1P8JA 3ZR4B 4BVFA 2Q2OA 3ZIUA 2JJQA 2I2DA 5HK8A 1QWOA 3BWXA 3OM8A 4JI1B 3ZW7A 3KOXA 3V8PA 4Z7QB 3UHPA 2HFKA 1WW3A 5C7LO 3GDHA 4QUGA 1Z68A 4X1YB 4P4SA 4DOMA 1U8ZA 1S89A 3RUEA 3J81k 4RLSA 1UADA 2DFNA 4GG1A 3KJNA 4LYJA 2C3PA 3LYLA 1QIEA 1T3ZA 1VIAA 3OA2A 3B12A 2NG1A 4K5QA 1K7EB 4WLFA 5J2UB 4BZZA 2C5SA 3CHYA 4V1CA 4BUJA 1GPLA 4C14A 4KJZA 2IS2A 1SXQA 4B40A 4Q15A 1ABEA 1MH9A 5CCXA 1E58A 3LMKA 3CZ4A 1UC4B 4O4IB 2JZNA 3WS7A 5J5VA 2YQ5A 3JTEA 3L6UA 3N28A 4ODIA 4ZYZA 5DHQA 1ST3A