1C3VA

Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
245
structure length
245
Chain Sequence
b'MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 73
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1c3vA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1c3vA01
5DP1A 3SXPA 1T2CA 4GI2A 2A9FA 2PLAA 4FJ0A 3DMTA 4FOSA 1XG5A 1M6HA 3RUCA 3D4OA 3HG7A 3PZRA 5KJ6A 4AFNA 2FR8A 1M76A 1EZ4A 4KMSA 4LVCA 4U6SA 4BGUA 1HF3A 2Q45A 3VPHA 1I30A 2PK3A 1PX0A 4J90A 3QHAA 2RBEA 3FR7A 4XYBA 3PDUA 1P33A 3HDHA 4Z0HO 5TQVA 2FPPA 2VRBA 3LC7O 2FR0A 4JX8A 4DTIA 3DC2A 2VUTA 1NM5A 1C1DA 4DBZA 1TT5B 1D1TA 1UZMA 1XGKA 4D42A 3O8QA 5COAA 1NWHA 2V65A 5GZ3A 4Y67A 2IXAA 1M67A 5L7YA 4U8GA 3HADA 3C7DB 1HE4A 2JCYA 4NBUA 5JAQA 1WDMA 2NUAA 4OL9A 4BO7A 3L07A 5DCWA 4PCVA 3B70A 1VJ0A 4PLFA 4IPTA 3Q2KA 4O6VA 2B4RO 2NVUB 5JMWA 2DAPA 3GZ4A 2O23A 4I8XA 3ZGYA 3ONEA 4BKRA 3TRIA 1C1XB 2FR1A 3CZMA 2FZWA 4OXNA 5G0VA 3VVCA 4NFYA 1U7TA 4LMPA 1R37A 4QQRA 5KCZA 1X13A 1PJ4A 3AOEA 1ZW1A 4PG4A 1Z7BA 3GUCA 5HRUA 1YL5A 1FDVA 1O94A 2CFCA 2HMSA 3A06A 3FR8A 1IY8A 2ZB3A 3UXYA 4BGEA 4DIOA 3WMWA 3ZV6A 5L40A 1JKFA 2ZYGA 3LT0A 4TWRA 1PIWA 1GQ2A 4NQZA 2X0JA 3OETA 1QKIA 1YBAA 1UDAA 3D4NA 3S2FA 3UICA 1X1TA 4FB5A 1KVUA 4AJ2A 4L4RA 2P9EA 1ZSNA 3H7AA 3PP8A 3ZWPA 5HWSA 4U6QA 3NT2A 1BXGB 3MJVA 3OQBA 1DAOA 2J3IA 2RHRA 4ESOA 4XJTA 1GL3A 3H2ZA 3GNTA 2E37A 1LQTA 3CKYA 4CUZA 3OA0A 2BMAA 5JCJA 2PKRA 3CXRA 5G0WA 2W2KA 4E0BA 3ZWYA 2D4AA 4RQUA 1VM6A 5HA5A 5JYFA 2J3HA 1ENPA 1GFSA 1F14A 1Y5RA 4XQGA 5JSFA 1ORRA 2DFDA 3NV9A 1IZ0A 3PTZA 2IODA 3MWEB 5DDIP 1LI4A 4QUKA 3SJUA 5LCXA 4BO1A 1ENYA 2JHGA 4EUEA 3VZQA 4K9DA 1PL6A 3GPDG 2Q2QA 8LDHA 3RKRA 3WIEA 4CODB 3PWKA 3D64A 3GHHA 3I23A 1Q0QA 2C29D 3D7LA 3ADPA 3KYDB 3S2EA 1FF9A 4CM1A 1H2HA 4YAEA 5AXDA 1I36A 1KIFA 1LSJA 2AQKA 2PZJA 3G79A 4YEDA 3VZPA 4E2XA 5L7WA 1NVTA 3PJEA 1V35A 2NVBA 1PGOA 2QX7A 4GH5A 5DN9A 4BIIA 1CYDA 5JE8A 3E03A 1NFQA 1HDRA 1QXSA 1V9LA 2BGKA 1EFLA 1GU7A 1UJMA 3WJAA 2Z1MA 2GO1A 3JQDA 2CY0A 4RORA 4IDDA 5JCXA 1UXGA 4GMFA 1ZSVA 5IJZA 1ZK2A 3D3EA 1YBMA 1GEEA 2VTDA 5L9AA 4Z3KA 2O48X 3SC4A 3L9XA 2HRBA 4RQTA 4WE3A 5I7FA 4K26A 1EUDA 1ONOA 4S3MA 1I0ZA 2WYUA 4Q3BA 4BNWA 3ANLA 3Q6IA 2G17A 5JNLA 5DOZA 3CTMA 2P5UA 4CLRB 2Y1FA 4KQXA 1N9GB 1N1GA 4MVJD 3ZU3A 2Q4BA 4HUJA 4JQCA 5K9ZA 4CQMB 3WYEA 4YPOA 3QV1A 4PLYA 4NHEA 3U0BA 2R00C 2CZCA 4RZHA 4DMLA 2HK8A 3BMQB 3D5TA 5EQDA 2P4QA 1LLQA 3RU7A 1YJQA 3KVOA 2QG4A 1B7GO 3GT0A 1WP4A 1I3MA 3Q9NA 5TRTA 5T8KA 4W9NC 4K6CA 1ZKMA 5JBIA 5T73A 5G0TA 1PQWA 2BHLA 4CMIA 2QRKA 3DBLA 5JDIA 2CUKA 3VDRA 4B8ZA 1LXCA 1OBFO 1FMCA 3V1YA 2YY7A 4RGBA 3E1KA 4AJ1A 2X5JO 1BTOA 1ISHA 1JW9B 4XYEA 2BI7A 2X4GA 1ENZA 4Z9YA 1BDMA 5K6AA 1R4NB 4YJHB 1MG5A 2AQIA 1HDGO 2OP0A 4B3HA 5DT9A 4BO9A 3OF2A 4PFJA 3H9UA 2QHXA 1QSGA 4BUCA 5JXWA 3ASUA 2NQTA 3MJTA 3H6KA 3NTQA 3OA2A 4NBWA 1E3WA 3ZZNA 4E5NA 3ETGA 2EW2A 1GYPA 4QSMA 4BB5A 1YB4A 3AU8A 4GQAA 4TMFA 3LT2A 1B14A 4GBJA 4B7UA 4BKQA 4PLZA 4EEZA 3OJOA 3I9JA 2HO5A 3F4BA 5EPOA 4ALIA 4E33A 1SAYA 2QRLA 2ZTUA 1NHGA 3DO5A 4A73A 3HJAA 4DVJA 4YYZA 5JFOA 2X0IA 4CLOB 4LMRA 1U3WA 4IJKA 4CR6A 3R6DA 4W7HA 1HYHA 4FR5A 5F3RA 3P5SA 1LDGA 3EK2A 4M8SA 4EYEA 1ZBQA 5BSGA 1MFZA 3NUGA 2EF1A 5TJHA 3V2GA 1ADFA 5CPFA 5T57A 5U4QA 2NQ8A 2EHDA 3EZLA 4I08A 4NJOA 1YQGA 1QYDA 5JAMA 2PGJA 4Z0TA 1U2DA 3JD3A 1SMKA 3JTMA 4GGOA 4LGVA 1UAGA 3RC9A 2GPTA 1ID1A 1G0OA 3KLPX 4R69A 3UGKA 3GG9A 3FRJA 4CMEC 4RVDA 1MGOA 1VKNA 3QWBA 1B16A 1UUFA 2Y66A 1DFHA 4JNKA 3B1KA 3V5NA 5EINA 4DL9A 3GVCA 2EWMA 3GGGA 4PLHA 1GR0A 1E1NA 1RM0A 1HEUA 4CM6A 4FOOA 3OJFA 3DZIA 4M49A 3WFIA 1OC2A 1F17A 2GN8A 3G1UA 4FC7A 1E6EA 2Z1NA 4E3ZA 3I3OA 4IGFA 4XQCA 3ZCXA 4MVJM 3CPSA 1P45A 3E5MA 1ZJZA 4IS2A 5THKA 4FQ8A 4UVEA 2ZTLA 2OZPA 2XPCA 1HLDA 4AVYA 4C7JA 2YFHA 2CMDA 4AG3A 4KUHA 1VKOA 4NG5A 4Y9DA 1GEGA 3SC6A 1Z73A 2NU8A 4AJOA 1ISGA 2D5CA 4BQPA 3KB6A 3TFQA 1XHLA 2GF2A 4EUFA 3CMCO 1XU9A 3VDQA 3AW9A 4P22A 1WWKA 1J6UA 2D59A 4CQLA 5IN5A 2YDYA 1GPJA 4U0KA 2X86A 4TRJA 3H5NA 4CMAA 2BRUA 5AYVA 4OAQA 4CMBA 1GUFA 2Q50A 3VZSA 1P3DA 4BO5A 3DOJA 1NXQA 1PJ3A 3QQPA 4LSMA 2Q2WA 4EUHA 2ZYDA 4FFNA 1PZEA 1DRUA 5L3ZA 4YAGA 1W73A 4A26A 5JYAA 5KJ1A 3MOGA 4IQ0A 3ZWOA 1PQUA 1LJ8A 2HUNA 2NTNA 3QRWA 4NPCA 5GZ6A 4QFDA 4ILKA 3GMSA 3OSUA 3PGJA 3VH3A 3W8DA 1ZXLA 5TIIA 1ONNA 2FHSA 1AGNA 1QLHA 2I67A 5HS6A 4CMGA 3G49A 2EJWA 2DLDA 3C85A 3LT1A 2EEZA 1ISMA 2XF8A 1T2DA 2ZB7A 1HETA 4J6FA 5ITVA 5FYDA 3P7MA 2EW8A 4IQ8A 1X7GA 4IDEA 4DWVA 1C0IA 4OO3A 3I9KA 5ILGA 3L0DA 1JWBB 1UAYA 4I5GA 2EXXA 2YHUA 1LSUA 1B26A 1KY5A 3WYBA 3W8EA 1SZJG 1TT5A 4R5MA 4GKBA 1LLDA 4QXMA 4BNKA 3PQDA 1KVRA 2CSUA 3FNHA 4OQZA 1I10A 5IF3A 3JQ9C 2FZEA 3UHAA 5I9LA 1CQJA 3K8ZA 4Q9NA 2NVUA 3QWFA 3GAFA 3RJ9A 1UXIA 4E5KA 1Q7GA 1DHRA 2C5AA 1PJLA 2HLPA 4I9HA 1C1XA 2PV7A 2QRJA 3JQGB 1PR9A 4X54A 3TDKA 3I9NA 1MLDA 3ROMA 2HQ1A 4GLOA 4TKLA 4UAGA 4B4WA 3PJDA 5DCYA 4DQXA 3KBOA 2O3RA 4EITA 5KJCA 4R54A 1EUZA 5IZCA 1CERA 5KNLA 1KEUA 2GLXA 2GN4A 2HRZA 3RUHA 5F1KA 4INAA 3AFMA 4OKIA 4ZU3A 2HSDA 3DTTA 4YAJA 4C7KA 4CLEA 4XCVA 5F21A 4MVJE 3EUWA 1SEVA 4AJHA 4TRRA 5MGBA 4CMCA 3DBRB 3KOUA 3UUWA 3WLEA 1XYGA 4LVUA 1DLIA 3M6IA 4NZ9A 4XYGA 3RBZA 4YQYA 3ZDFA 3ZWMA 3PYMA 5H82A 2VYVA 1PZHA 4UVHA 3SVTA 4YRDA 1NVMB 1HT0A 2ZYAA 4CUJA 1BXGA 4JN6B 1I8TA 3VPGA 1NWCA 1F0YA 3MOIA 2IEDA 3NT5A 4PLVA 3AK4A 1H6CA 1KEVA 4BV8A 1U3TA 3V1TC 4RPGA 4F46A 1O6ZA 2NM0A 4MINA 4ID9A 3O38A 1U5AA 2E82A 2I76A 4UEOA 5L95A 5AOVA 3H4VA 4JROA 4L75A 3GPIA 4D45A 1NPDA 4BKPA 3AY3A 4WEOA 4Y6RA 4YR9A 3GC6A 4ZA2A 1QYWA 4II2A 1N5DA 3FBTA 4JJIA 4TRMA 4D7AA 1SEPA 4BO6A 2UUPA 2UYYA 2VT2A 3PIDA 3R3SA 1IE3A 4RF4A 3RAJA 3LLVA 4L76A 3HN2A 1DFGA 1EVZA 3RKUA 3SLGA 4BNJA 2GRAA 3KYDA 4ZN6A 2Q46A 3WOHA 2GCGA 3I4FA 3QWAA 1LUAA 4MVJG 3ROKA 4HFJA 2BFPA 2IRWA 1B8UA 1PJBA 1M66A 3KRTA 2BGMA 3DAFA 3JQ7B 3WS7A 1W8DA 3DL2A 7MDHA 4D0RA 1IOLA 3KSUA 4K28A 3DB2A 4RPJA 2HMVA 2PGDA 3IMFA 2Y93A 4DC1A 1ADBA 4NNJA 4D0SA 3KV3O 4U5QA 3C3XA 3U09A 3LLSA 1LLUA 1T2AA 1GQQA 4ZRMA 4AJNA 1XELA 1H2BA 3ZHZA 1YQDA 4CV0A 3RSHA 1X15A 1IHXA 1QYCA 3L6EA 5B4VA 4FIZA 1LTHR 3B20A 1HXHA 4XB2A 2EKQA 4CJXA 5FI5A 3WYCA 4LW8A 1ENOA 2AW5A 1WXDA 3I6QA 3FN4A 3WG9A 1HDXA 3K2BA 4CLRA 3E18A 1LDMA 1Z45A 1N9GA 5JLAA 4KTTE 1BHSA 1L7DA 4CM3A 1LDBA 4CQMA 3MZ0A 2YQ5A 3MJEA 1CEQA 4ZHSA 2XXJA 1T2FA 2NV6A 4OKNA 5JO9A 4Y98A 3BZUA 1LA2A 3C1OA 3BMQA 4DYDA 1YXMA 2OP1A 4N5MA 3ONDA 4MPDA 4FSHA 3DMYA 1KVSA 4CM9D 2I3GA 1OMOA 4HNGA 1MXHA 1NP3A 1O0SA 2D0IA 3AFNA 1U7HA 4WJZA 3HSKA 3ZV3A 4R16A 4Q3DA 4AJJA 1VSVA 4HFRA 3WGTA 4DC0A 2JKVA 1PSDA 2O7SA 5C5IA 5CFZA 1DSSG 1KVTA 2VUSA 3U49A 3PGXA 4FGSA 5CDYA 2X5OA 4I5DA 4BNGA 3NTOA 3UFXA 3VZRA 1JDJA 4UULA 1PL8A 2DM6A 2ZTMA 4RLHA 4XZ3A 4GPD1 4KP7A 2IYOA 1PZFA 1GV1A 4TZTA 1B3RA 3ZHBA 1ZEMA 4XD2A 1W4ZA 2J6IA 1V3UA 4E30A 1P0FA 1JWAB 1G0NA 4R68A 3DOOA 3BAZA 3AU9A 4LISA 4TSKA 3ZU2A 2YHIB 4OSPA 4J43A 5KOIA 1R4NA 4YJHA 3WICA 3CZRA 3VC7A 4Z6KA 2F00A 3H9QA 3IQDB 4BKUA 1UDBA 1E7WA 1P1RA 2DC1A 1EK6A 1Y9AA 1HTBA 2BH9A 3ZWCA 1T25A 1YJ8A 4N18A 4IDFA 4I1IA 4LK3A 3DFZA 2YZ7A 1NBOA 3ZV5A 4BL5A 2JHFA 4E6PA 3PRJA 3G17A 5THQA 5BSHA 1JN0A 1FK8A 2A4KA 1YRLA 1R0LA 1JKIA 1P9LA 5L7TA 1TI7A 3O26A 1X7HA 4CL3A 2P5YA 3ETDA 3U9LA 5U1PA 3W8FA 1I5RA 5H83A 2XOXA 1DXYA 5ES3A 5CP8A 3I6IA 4O5OA 4CLOA 4P4GA 2OOSA 5ER6A 5CDTA 1YQXA 5I8ZA 4GVLA 3TPCA 3NX4A 4KOAA 1HZZA 2Q2VA 1HRDA 4TVBA 4GMGA 3UH1A 4E5PA 3GH3A 3HB5X 2DBVO 3OEYA 1J4AA 2C2YA 3OMLA 2HK9A 3HB4X 5TJ9A 4DQUA 2J5QA 2IZ0A 5A5EA 1TT7A 3QSGA 2I66A 4ALNA 4O59O 3AY7A 3S2GA 1E6UA 1BWSA 5JDCC 1U9JA 2D1YA 3JQ8B 1WNTA 4D41A 1LU9A 2J3JA 2W90A 4B3JA 3AWDA 1K0UA 1AHIA 3BYZA 4R9RA 5LDGA 3ZWNA 3PHHA 1XIVA 5L45A 3P2YA 1NQOA 1F8GA 3MJSA 4XYMA 4WUVA 1YBVA 1NVGA 3PYXA 3IUPA 2X8LA 2DU8A 3DQPA 3S1LA 3OJEA 3KSDO 4PG6A 4UEJA 1JQBA 1CWUA 4PLCA 3OQ6A 3PHLA 4AL4A 3ULKA 1O89A 1DIBA 1DBVO 9LDTA 3W1VA 1E6WA 3FF4A 1DAPA 3TOXA 2BI8A 1H6BA 4OYRA 2PZKA 5EN4A 1ZIDA 3ETEA 5TX7A 4OXYA 4R01A 4YT8A 1XWFA 3GMDA 5BT9A 3DAGA 4A10A 1IUKA 1WW8A 4EGFA 4CR7A 2RH4A 4PIVA 1A27A 1DRWA 3CE6A 2FWMX 4OSOA 4P38A 1H9AA 5KVVA 2Q1SA 3WWZA 1GUZA 2J8ZA 3WX0A 4ZQGA 4A5OA 3VPXA 3HUDA 4TZKA 4QTZA 2WD7B 3CINA 1QYVA 1HYGA 2ZTVA 3TL3A 1PJ2A 4P4LA 3ZWAA 4ZICA 3OBBA 2VOEA 3H8VA 1Y7TA 4OXKA 1DIHA 1H9BA 4I5FA 3GVPA 1I2BA 2YV1A 1EVYA 3B6ZA 3RJ5A 1Q2XA 3WTBA 3BA1A 3E9NA 4RZIA 3ST7A 3GGOA 1B8VA 2C0CA 2X1HA 3DONA 4J3FA 4PRKA 2C07A 1G1AA 1CF2O 1ARZA 5EESA 1E1KA 1R16A 1TVEA 1YKFA 2OXIA 2X58A 4IDCA 3TNLA 4LRTB 3GGPA 1VRWA 4MP8A 1ONPA 4QEDA 5DCUA 4BO3A 1R0KA 3W4KA 3GNQA 2X23A 5KKAA 3C8MA 1ZMOA 4JBIA 4IY1A 3VAZA 4HKTA 4FFOA 2FN7A 2IZZA 5BNIA 3GN1A 2GZ3A 3C7CB 2C54A 3KTDA 1LNQA 3FI9A 4BNVA 4BNXA 3BMCB 2B35A 3OIFA 2H63A 3U62A 5K0ZA 4H16A 5T6BA 1KERA 1J5PA 4JK3A 1ZNQO 2POQX 1U28A 2A94A 2X9NA 4IIUA 4JIGA 2NU9A 1YB1A 4YA6A 1SBYA 1GV0A 4R41A 4FDAA 2YFQA 2NVWA 3EDMA 1CIVA 1RYDA 3UAGA 2NTJA 1TEHA 1MXFA 1ZSYA 1UP4A 5JYDA 1V3TA 2CF5A 4IGEA 1EUCA 3F1KA 3ZN2A 4DPLA 5L4SA 3WQSB 2WYWA 4YACA 1ZO8A 1I2ZA 4YJDA 3SX2A 3HHPA 3JQGA 4ZQBA 4D46A 4NI5A 5B37A 3JQBA 4MVJH 4J1SA 2W2LA 2BLLA 3L4BA 3H3JA 3JD0A 1CQIA 4BNTA 2NU6A 4BQRA 3DHNA 5JO0A 1EDZA 1ZCJA 5JY1A 1LX6A 1N2SA 4BO2A 2UUOA 2FSVA 3DDNA 4HX5A 4I9NA 5F5LA 3DBRA 3U4CA 5L53A 2WM3A 3ASVA 1RWBA 2QW8A 3EAGA 3GHYA 4J4BA 1O5IA 4DQVA 5G4KB 1WVGA 4KTVE 5TT1A 2GZ2A 1PGJA 1M75A 1D7OA 2AG8A 3BHJA 4JLWA 4RPLA 1PS0A 2DUUA 1OOEA 2FPIA 2V6MA 5AXCA 4O63O 2UVDA 2P4HX 1YONA 1HE5A 1ADCA 1IYZA 4J16A 3RC7A 2JFGA 2YYYA 3IJPA 4KWHA 4MIEA 5BNFA 1NAHA 3WMXA 1P1FA 1YDEA 4NH4A 4Q3CA 4HADA 3SLKA 1XLTA 1EK5A 1RJWA 2QYTA 5L4LA 3UCXA 1PJTA 1ZK3A 1V3VA 4XR9A 4XRGA 2ZKLA 3GEDA 4EBFA 3GRKA 3DZGA 3TJRA 3EVTA 4G5HA 4JCOA 4W7IA 3NTRA 5BNTA 1HDZA 3C7AA 1HDCA 1N7HA 1R4MB 3ZWBA 1M6WA 2TMDA 1VSUA 1Z75A 4P4NA 1WZEA 4BS9A 3JCZA 1P1JA 4KUGA 5EL0A 3BTVA 5C7IO 1ZEJA 2ZJ0A 2PZMA 3CUKA 3MTGA 1DJQA 5F5NA 4MIYA 1E7SA 1ISJA 2C59A 1KEWA 2NWQA 4Q3EA 3BHMA 1TA4A 2WE7A 3JQ7A 2YV2A 3OQ1A 3JYNA 1ZK0A 3LQFA 1LQUA 1DB3A 3G1TA 3LT4A 1CRWG 5EIOA 2J5KA 5DBFA 2X22A 3KYCB 3FHLA 2JCVA 1X0XA 3RCBA 3VH2A 1NPYA 1XEAA 2Y1OA 2CNBA 2E6UX 4GWGA 4IJUA 3AUTA 3PFFA 4RDIA 4E4YA 1T1RA 1XKQA 3PPIA 4FS3A 4A2CA 4Q3NA 4R3WA 1W6UA 4WCFC 4NBRA 3U3XA 4PZEA 4UUMA 1SCUA 4LCEA 3QA9A 4B3IA 4UEKA 3I4CA 4BHTA 4PLWA 4DMMA 4GX5A 3NT4A 3I52A 2PY6A 3DR3A 2AA3A 3N58A 2HKIA 2UV8A 4W99A 1NASA 1WZIA 3SEFA 3U4DA 4BNMA 2JJYA 3RUEA 1U1IA 1NTOA 4GGPA 3DZFA 1RM3A 2WSBA 1PJQA 1XR3A 1UXHA 4IUYA 1YGYA 2EGHA 2EJVA 3F6YA 5A3JA 3ZWXA 4CM5A 4WLEA 3IP3A 4CM7A 1U3UA 4W4TA 3K31A 1DOHA 1K6XA 4MOWA 2GZ1A 1U2GA 3INGA 1NYTA 2X9VA 3ENNA 5TLSA 4CLHA 2DPGA 3HNPA 3ZU4A 3NJ8A 3PI7A 8ADHA 3N74A 2EG9A 1E7QA 3ICCA 3JD1A 3RWBA 5DNAA 3C1TA 3OHSX 2NACA 1UZNA 4H7PA 2W98A 3DZJA 4DPKA 3WGGA 3RC1A 4HWKA 2D3TA 5TNXA 3TQHA 5ICMA 1T4DA 3I9MA 4L8VA 2OGUA 1AHHA 1Q1NA 4B4VA 3WGHA 3IS3A 3IOYA 3L4SO 5ICSA 4CLXA 1DC3A 3A14A 2DKNA 1LDEA 2HAEA 5GMOA 4BMNA 2YHIA 1AN9A 1XDWA 5C3MA 1W0CA 1ZJYA 2CDBA 4FC6A 4DXHA 2Y0DA 4J2OA 4QX6A 2Q99A 3WWYA 1GYQA 1RM4A 1E3JA 4F3YA 1PWXA 3WSVA 4JJFA 1E1LA 4D3SA 3LC2O 5IFLA 1K5HA 1YL7A 4K1LA 3P2OA 2X9GA 4QECA 3Q0EA 5DF1A 3IL2A 1X1EA 4E31A 2HJSA 1Q0HA 1JAYA 2ZIZA 4BVAA 1JVBA 5CDUA 3WGYA 4PLGA 1B3BA 2Y1EA 3AUSA 5AQ1A 4PZDA 4XEHA 1ZUD1 4PRLA 1FDWA 4XGKA 3ZNQA 4IMPA 4Z3DA 5BR7A 1UP7A 4MP3A 4OQYA 4CLDA 1DHTA 5ER9A 1DEHA 1BW9B 1QORA 4F6LA 5JAIA 4N54A 1VPDA 3ITKA 3PWZA 3ROPA 1O95A 1HE3A 1JVSA 2Y67A 3JYQA 5BSEA 4MVJA 4ALLA 1C0LA 4N5LA 2Y1GA 4NDNE 3STHA 2J5RA 1U4SA 2I5PO 3ENKA 3ZHYA 3GVHA 3EHEA 4WNCA 1SC6A 3LU1A 2WD8A 4ZQEA 3GEMA 1D1SA 1Q7CA 4P8RA 4CUKA 3DAPA 3JQ8A 3RASA 3HDQA 1GPDG 5KJEA 4Q39A 5KKCA 3AM4A 3NDIA 2X5KO 4NR0A 1ZMTA 3EW7A 1KETA 4GAEA 4ZQHA 5ILOA 1SPXA 4TROA 2O4UX 4O0LA 4RCVA 1DIRA 1H5QA 2H9IA 2IYPA 3GK3A 5ENDA 5JAZA 3E5RA 3HQ4O 3WXBA 2R00A 3QY9A 1AXGA 4UVDA 3I9LA 5G2OA 4EEXA 4URFA 2O3UA 4R9SA 2HMWA 4MO2A 4YAIA 2WWRA 2HMUA 4W9NA 4BNUA 5J23A 1HSZA 4L74A 4M86A 3AM5A 3K5PA 1SO8A 3U4HA 3NDRA 4UVGA 1GY8A 3UVEA 1LC3A 5JC1A 2CDCA 1U4OA 5A05A 4TQGA 4BNIA 3K96A 4YRBA 2X0NA 3VKUA 2NLOA 2VWGA 3DMTC 3E6AA 3GG2A 4M89A 3KM0A 2H6EA 4BNZA 1WDLA 4G65A 1LBEA 2I9PA 2IDZA 4RF3A 3BIOA 2PWZA 1NAIA 1I24A 4R51A 3WGIA 3S2IA 4H3VA 3PFWO 2VN8A 4G81A 4ITUA 4XDYA 2X7HA 4MDHA 2BD0A 3TZCA 4M54A 5JS6A 2W8ZA 2DUWA 2YDXA 4OIMA 2WD7A 3I5MA 3KEOA 5GZ1A 3PLNA 4JXKA 1N8KA 1LDNA 5I7EA 4JP2A 4CPDA 3VKVA 5C7LO 4FGWA 3NJ4A 5B1YA 2B0JA 4HXYA 2PD6A 1PTJA 1MX3A 4HBGA 5T67A 5I9MA 2EKLA 1LRKA 3R1IA 2VHYA 1LRJA 5FEUA 1PGPA 3RUIA 3QIVA 2C2XA 3LZ6A 3W6UA 1FXSA 2R2GA 2PKQP 1VE9A 4J1QA 4R3NA 1R6DA 3WQRA 4BMSA 3PHJA 3VHRA 2DTXA 1KY4A 1OI7A 3JQAB 1BRMA 4ND2A 3RC2A 2BFMA 4BNHA 2QZ9A 3WIDA 1JU9A 2E4AA 3AOEC 5C37A 1GZ6A 5IZ4A 4IZIA 1Y8RB 1YO6A 2G0TA 5A03A 2QYSA 3UN1A 4XJSA 4BNNA 1ML3A 2SCUA 1QLJA 1JA9A 4CM8B 3D0OA 1VC2A 3CEAA 3BMCA 3W6ZA 4R1TA 1M2WA 4FCCA 3OJ0A 1UH5A 3DEYX 3L77A 3DZBA 3GDOA 5I8WA 3KSZO 3QP9A 3WQQA 1SNYA 1BXZA 4KDEA 1E5QA 3HWRA 4YB8A 5EERA 3FCOA 3LK7A 3PVZA 4CMEA 4ALMA 5AXBA 4W6ZA 3K6JA 2DBQA 2I6TA 1MB4A 1MG0A 3JV7A 3UCEA 1N7GA 2WE8A 3F1LA 1A71A 3TZ6A 3UF0A 4PN3A 5FI3A 1FJHA 1A5ZA 4E32A 3VTZA 1HE2A 5F1OA 5A9SB 1VL0A 5EMHA 4AICA 5TGDA 4F6CA 4B7XA 1TLTA 3QJ5A 3UW3A 4RDHA 4XDZA 1Z82A 1ADGA 4R1UA 4IDBA 1DPGA 4XYLA 4RJTA 4OM8A 1KEPA 2B4TO 2P9GA 3PQFA 4ZQFA 4IZHA 3H65A 5KVCA 3H2SA 1YOVB 3F9IA 1N1EA 2VHVA 4XA8A 1P1IA 1YS4A 4RVFA 1T4BA 5CEFA 1AE1A 3LVFO 4HNHA 3QVOA 2OBNA 4WGGA 1KS9A 3IP1A 4RVHA 4WLNA 3DBHB 2CDAA 2AEJA 4YQZA 3PIIA 3ZHXA 1ZK4A 2C82A 1V8BA 2AE2A 2BF7A 1X7DA 3EVNA 3MWDB 4ND1A 5G4KA 4IQGA 4WK6A 3WGQA 1YVEI 2PTGA 5G0SA 2PD3A 4LSWA 1PJSA 3TL2A 9LDBA 1EDOA 4CV3A 2ZQYA 2C5EA 4XIJA 3WDSA 4II3A 1KC3A 3ZWWA 3IAHA 3NDJA 1LRLA 4YJFB 5JC8A 2I65A 5T5QA 3SJ7A 4J9VA 1PU2A 5JYEA 2FSSA 3RBXA 1RKXA 3TF5A 2RIRA 4CV1A 4YDRA 1A72A 2AMFA 4E5YA 1HYEA 2GYYA 3LC1O 6LDHA 4W82A 2Q1UA 1LSSA 2ZCUA 2IXBA 4I9UA 4PG5A 2OL4A 1E3SA 5MDHA 4NJMB 3WTCA 2AQHA 4FFLA 5KIAA 1K6JA 3WBBA 1P77A 3MCVA 2HCTA 1R4MA 5CAEA 2OORA 3TWOA 3BXXA 1R15A 1P44A 5DBGA 1UR5A 1U5CA 1QV7A 4XQEA 5TF4A 5AVOA 1Y81A 2Y1CA 2AE1A 1TB4A 4R4JA 1VI2A 4M87A 4CL8A 3BTSA 3TFOA 3F3SA 1KC1A 1NR1A 3PQEA 4BKOA 3KXDA 4N5NA 5T8KC 5CG2A 4BB6A 4YT4A 3JD4A 1I3LA 4FPXA 3KYCA 5JDIC 1DFIA 4RL6A 3JQ9A 2Q1TA 4CM4B 1ZZEA 4Z9FA 1C3VA 1XCBA 2HK7A 2WTBA 5A4DA 3D3WB 1QR6A 1NX6A 3UKOA 1GD1O 4WOJA 4J1NA 2HMTA 1E5LA 3R0IA 4DLLA 4NFSA 3SBOA 3JQAD 1DIGA 2TMGA 3CMMA 4OH1A 1NQTA 3GAZA 4MP6A 4YT2A 4EDFA 5K6AC 1GAEO 4PVDA 5IAAA 2JD2A 3HFGA 3NGXA 4FN4A 4PVCA 3PXXA 2V6BA 5HM8A 4OMUA 3IUSA 2O3JA 2IZ1A 4NK4A 4YBZA 3T4EA 1MFPA 3AY6A 2DT5A 3DFUA 2JD1A 3DHEA 1ZXBA 3D4PA 1F06A 2Y99A 2O3TA 1AXEA 3BTOA 4TVOA 3K2EA 3RVDA 3ON5A 4AJPA 1WLYA 3JQFC 3V8BA 4ALKA 3AJRA 3KYBA 4IDAA 5A04A 1A4IA 1H0KA 2EP5A 1HL3A 4IIVA 1P1HA 1A4UA 3M1LA 2AEFA 4WNIA 3ZW9A 1H93A 1H94A 2CVZA 1D8AA 4ROSA 2GNAA 2FPGA 5DBIA 3GA0A 2RH8A 3GQVA 2PGLA 4BO4A 3KZVA 2LDXA 2AG5A 1OFGA 3H9GA 1PL7A 4UUNA 4NBVA 3KETA 2OHXA 4LN1A 5TSDA 4DLAA 1YB5A 3FD8A 1U3VA 2Z5LA 5CEJA 1OZAA 1B2LA 4WASA 4YJGB 4DLBA 1CDOA 1C0KA 1DDOA 3T4XA 3GEGA 4GWKA 4YRAA 1BMDA 2H1SA 3NYWA 5KVQA 4FJ2A 2UAGA 3H9EO 1GCOA 3CH6A 1KVQA 3PYLA 1V0JA 3I9OA 3GFBA 4Y6PA 3LF1A 1HSOA 2WEKA 5B4TA 1F12A 5CG1A 4ZD6A 5IXSA 3K92A 2E49A 2JFFA 2VNAA 3LDHA 3IIEA 4AJLA 3A1NA 1S7CA 1QV6A 1A9YA 1PEDA 4FD3A 3PK0A 2FP4A 3O03A 5HTOA 3PLRA 1T24A 1RPNA 2FMUA 3FTNA 1BW9A 3E82A 1T1SA 1EE9A 1NNUA 3C24A 4WLUA 3WR5A 2HDHA 2YV3A 2P9CA 4EI2A 3NRCA 4B7CA 3PEFA 2VRCD 3GUYA 2EP7A 1L1FA 3QE3A 4WECA 4WCFB 3VPSA 3NEPX 3GR6A 2VYND 3IKVA 3X2FA 1FDUA 3Q11A 1EFKA 3H9JA 4NU6A 4CM9A 4EJ6A 5IDWA 4IJVA 4U0JA 2O50A 3INRA 4RO0A 5KWEA 2DTEA 1X14A 3H3FA 4YTEA 3LSYA 4QO8A 4E5MA 3U4IA 1Y8QB 2NSDA 3MJCA 4JBGA 3ZH2A 2RAFA 3QVXA 2I3AA 3B1FA 3AI1A 4EW6A 2OO5A 2ZK7A 1QYXA 3BMNB 3RUAA 3T7EA 2WYVA 3GRPA 2D5AA 1BGVA 4MKZA 3FWZA 5DOVA 1DC6A 1MV8A 3AI2A 2EGGA 3JD2A 5B12A 1H6DA 1EQ2A 1DIAA 1PGQA 4ALJA 4IS3A 1R66A 1LSOA 2B69A 2G5CA 4KWIA 2YUTA 3GZNB 3IDSA 2Y05A 4D43A 2P2SA 1E1MA 2Q49A 3DWFA 4WKGA 3BMOB 5DZSA 4D79A 1P1KA 3ANMA 3F5SA 3TZQA 3EMKA 3F5QA 3NAQA 2ET6A 1UXJA 2ZQZA 3JYLA 4QFCA 1NR7A 3WNQA 2IE0A 4M55A 4BNYA 4AJEA 1ZK1A 3T7CA 1SOVA 1FDSA 4E12A 1Y5MA 1T2EA 4KUEA 4AJIA 4MIOA 4IJWA 5GY7A 3KEQA 5JMPA 2GERA 3OM9A 1E7YA 3K73O 4G2NA 4RF2A 4YVFA 3C1AA 3PZBA 1GZ4A 1EVJA 2ZB8A 4GX1A 5A5FA 4MVJP 4DBVO 4KDFA 3OEWA 1B8PA 1KBZA 1NPTO 4RLSA 4FBGA 5A06A 4J4HA 4B8WA 5L51A 1LLCA 3TZKA 4A27A 4JBHA 3FNFA 4IM7A 2VT3A 5IDXA 1JLLA 5B4UA 4R1NA 1SB9A 3JQAA 5FWNA 2X6TA 2B5WA 3ROQA 4B4OA 2QZZA 2E48A 1SB8A 1AUPA 3RFTA 4DIFA 4J49A 4WCDA 2VOJA 4TKMA 4DGSA 2ZCVA 1Y8RA 3D1LA 5IZCC 2O2YA 1BVUA 1PJCA 3INTA 1E7RA 3G0OA 5ADHA 1E3LA 4CM8A 1YWGO 2VHWA 1ISFA 3PJFA 5DULA 1U8XX 5G4LA 3DOCA 3HDYA 4BO0A 3W4JA 2WJPA 1BVRA 5JDCA 3OIDA 4WLVA 1Z74A 1Y9EA 5A02A 5CPBA 5LC1A 2FRDA 1LDYA 3ABIA 4PLTA 4F45A 4R5HA 4O1MA 1I32A 2F1KA 3GDFA 4ND4A 4K6FA 2VHXA 2JAHA 5J9GA 2O2SA 4BNFA 3WBFA 1YE3A 2BELA 2OBYA 2BFAA 4BGVA 3HDJA 4PLPA 1HKUA 2NNLD 4AJKA 1EVIA 2RCYA 1TXGA 1A7AA 2PH3A 3JQFA 4RVUA 5A9SA 4XGNA 1IZ9A 1GZ3A 4J7CA 3ADOA 1C0PA 3RUDA 5A9RA 5BSFA 4L73A 2VYVD 2B36A 3MTJA 2DBRA 2NU7A 1IPEA 2DFVA 4BV9A 1C14A 1P74A 1QRRA 3TZHA 4XWYA 4GL4A 6ADHA 2O3QA 3G3EA 3PWSA 4JP3A 4NIMA 5IXYA 4LRSB 1NFFA 4UREA 1YOVA 1PWZA 1KOLA 3QW2A 3JYOA 4OHUA 4PGFA 1WDKA 1I01A 2CF6A 2VWHA 5G0UA 4L9RA 4E21A 2PNFA 2VZ0A 4CR8A 2VNSA 3NGLA 5LDHA 5C7OO 1DO8A 2BKAA 2GSDA 2P68A 2A92A 3DBHA 1YL6A 2VHZA 3P19A 1VJ1A 4IXWA 2EV9A 3I1JA 3Q3CA 3WFJA 3DHYA 1IULA 2NADA 4CV2A 3E9MA 1C1DB 4NFHA 2IEBA 1L7EA 2Y0EA 3GLQA 5JPIA 1J0XO 3O8QB 3QWHA 4A03A 5KTKA 3KO8A 1NHWA 1D4FA 3RQSA 2B5VA 3ZU5A 4WLFA 1E7MA 4DREA 2ILTA 1K6IA 3V2HA 3E8XA 3ITDA 4YJFA 4XKJA 3WLFA 2VRCA 3V1UA 3D5QA 4IINA 2GD1O 3DZHA 5EQFA 1EMDA 4RPKA 2DQ4A 4FW8A 3KHUA 3VH4A 1A7KA 1Q7BA 2JCXA 3FPCA 4D44A 3OICA 4I5EA 3HFSA 5IN4A 3IC5A 2VYNA 2G82A 4D3FA 1BXKA 4WLOA 3AUUA 3WSWA 3TN7A 4BOYA 1BG6A 1PGNA 2DPHA 4J1TA 3ZV4A 5U9CA 3PHIA 4NJMA 2Y68A 5H81A 2Q4EA 2VQ3A 3S8MA 4LCJA 4BMVA 4XGIA 1GYRA 3QVTA 3FBGA 1KYQA 1WPQA 1CETA 4ND3A 2NTVA 2PZLA 5COQA 2VWPA 3ZWVA 3PJGA 3OP4A 2C7GA 3GVIA 4H15A 4L4XA 3FSRA 3B1JA 2AEMA 4IXTA 3ANNA 5L4NA 3ZNPA 1PR3A 1B0AA 3ZNNA 5IDYA 1O8CA 1J49A 4J0EA 3EZYA 3UCFA 3BTUA 3QLJA 4XIYA 4CQMD 2I99A 1E77A 4FJ1A 4CM4A 3MJ4A 2YJZA 1VJTA 4IBOA 2XXBA 1OAAA 4BGIA 3D3WA 1Y6JA 2VCYA 4EJMA 2W4QA 2A35A 1NFRA 2W2KB 5TS3A 1GADO 2GN6A 4EJ0A 4HV4A 1VLLA 1BDBA 4J91A 2PKQO 3QVSA 4C4OA 4E2YA 3GFGA 1CJCA 2O4CA 3GDGA 2WDZA 3TSCA 1MA0A 3H5AA 1QP8A 3WNVA 5CDSA 5T64A 4PG7A 2V6GA 3K9QO 4MKXA 3RI3A 4Z0PA 3JQ6A 4BO8A 1D3AA 1NQ5A 1H6AA 4JGBA 4UUPA 3VTFA 4ZGWA 2O7QA 2FY8A 4PZCA 4D3DA 4DRYA 1XQ1A 3RUFA 2VWQA 4CMHA 1XSEA 2VUUA 2XAAA 2V6FA 1BSVA 3BHIA 4RF5A 1HWYA 4E2WA 2CVQA 2JAPA 3ZNOA 2AHRA 1NQAO 1VL8A 2WMDA 3M2PA 3F46A 3ONFA 4HY3A 2P91A 3VPFA 2JL1A 1ZFNA 1R12A 3ICPA 2Y0CA 5TC4A 1EBFA 1XA0A 2VZ9A 1E3EA 3K30A 3VH1A 1PZGA 2D8AA 5A3VA 3S55A 4J7XA 1B15A 1MC4A 4CMJA 1XQ6A 3OJLA 4B4UA 2CVOA 3EC7A 3AM3A 4IMRA 1YDWA 1A9ZA 1DJNA 4YJGA 1E3IA 1GUYA 1JAXA 1EE2A 1GDHA 3RIHA 4Y6SA 1EEHA 3EYWA 3WB9A 5IDQA 5KVSA 3CIFA 4J0FA 4FFMA 3DBVO 5HS4A 4MKRA 3DTYA 1G6KA 3H5RA 3L6DA 4UVIA 2R6JA 3JYPA 3RFXA 5JY6A 4TRNA 3OFSA 2HJRA 2B83A 4GSKA 2GDZA 1UXKA 2DVMA 2Z95A 3I83A 2PA3A 1QMGA 2PH5A 2EIHA 1Z7EA 2OFPA 4FFPA 1XU7A 1Z6ZA 2BFOA 3HE3A 5COBA 4J4TA 2AQ8A 5HBRA 3OIGA 3W4IA 3ZI0A 2EKPA 1UDCA 2DTDA 4GX0A 5ITWA 2C20A 1DC5A 2CD9A 3L6OO 4RPHA 1VL6A 4CMIB 2QQ5A 1PS8A 3DBLB 1P0CA 4HFNA 1OC4A 4QT0A 4WOKA 1RM5A 1LC0A 3MEQA 1K3TA 3WGZA 4WCFA 4L4SA 1I33A 2GGSA 1HLPA 4E13A 3FNEA 1N92A 4YAKA 3A28A 4OJNA 3RFVA 1R0SA 3FTPA 3RU9A 3PHGA 1E0DA 4AJ4A 2GASA 2GUGA 1ZH8A 1O9BA 2Y1DA 4NK5A 4BNLA 4WPGA 1E92A 2PFGA 4PG8A 3FPLA 5DP2A 1ULUA 1FDTA 1Y8QA 4M1QA 1I3NA 4KQWA 3RBVA 3E9QA 2PR2A 1UZLA 4YWJA 5A9TA 1S6YA 1E3WB 2C7VA 3JQCA 5I7VA 1EBUA 3KUXA 2JD0A 4A0SA 2ZATA 3HZZA 3BMNA 1YH3A 3M1AA 4E2ZA 1GTMA 2X0RA 3Q9UA 4OGWA 4DIBA 5FFFA 5CDGA 3F4LA 2B4QA 3TOZA 5ENVA 2BGLA 1ZVMA 3RROA 1I2CA 1ISIA 2O3SA 4XR4A 4YCAA 4N7RA 5TT0A 3L9WA 3EY4A 4YT5A 3OH8A 4JJGA 4J9UE 3WJ7A 1IL0A 5IG2A 4CMKA 3GZNA 4GKVA 4A7PA 2JFHA 3QVWA 4RV9A 3BMOA 3COSA 5FF9A 2RHCA 4RVSA 3EGOA 4U7WA 2GR9A 3A9WA 1WAMA 3AI3A 1WMAA 3V2UA 4FFRA 3DZKA 3WGOA 1MC5A 4QO7A 3O9ZA 5JCJD 4ZVVA 1V6AA 3IJRA 3AOGA 1UP6A 1K2WA 2Q1WA 2PD4A 3GOHA 4GX2A 3VVBA 4Q3AA 2EERA 4XB1A 3RD5A 3UOGA 1HDOA 3JSAA 1EQUA 3FNGA 5KJFA 2AXQA 3Q1LA 4MVJF 2GN9A 3M2TA 3JQEA 5EJ2A 4ZJUA 4HP8A 1IHYA 2YW9A 3E48A 1SOWA 3LYLA 4DUPA 4GVXA 2YQ4A 1PQPA 1HDYA 2VTEA 4J2HA 4WEQA 4GSLA 3GNSA 4DA9A 3F47A 1QG6A 4DYVA 3U5TA 2ZB4A 1U8FO 1I3KA 4YXFA 4DPMA 3AUAA 2J3KA 3GVXA 2D2IA 4L0QA 4ND5A 4OOEA 1F8FA 1JKJA 1T26A 3NKLA 1Q0LA 1DLJA 1MUUA 3HN7A 3CSDA 1RYEA 3JQBC 2HU2A 2B37A 3L4BC 4MJLA 3O4RA 5CHEA 4ONEA 5AXAA 5BQFA 7ADHA 5I9NA 1JTVA 3QWIA 5M6DA 1HZJA 4NMHA 3IKTA 4ZRNA 1LEHA 4KZPA 4NBTA 3ORFA 2G1UA 2LDBA 4MVJI 1IB6A 5A1TA 1X0VA 4EZBA 3GF4A 2W2LD 2OUIA 3ZW8A 1IPFA 4OOFA 1Y1PA 2Q22A 2FOIA 3GN2A 3KLMX 4RVGA 2UDPA 4S1VA 4Y8VA 1MP0A 1P31A 3LF2A 1PS9A 4CQLB 1GCUA 2H5LA 3PDJA 5F1PA 4IDGA 3Q2IA 1ULSA 4Z9XA 5I7SA 4UUOA 4J7UA 4NU5A 1DC4A 4HFMA 2OMEA 3X2EA 5CEEA 5JW6A 1WMBA 3VOSA 3A4VA 2VZ8A 2G76A 2V7PA 1DRVA 2QIOA 4GLLA 4XX0A 3R3JA 2DBZA 1GQYA 2Q3EA 4R1SA 2ZJ1A 3DXFA 4XQ9A 1K89A 3N7UA 3OECA 3GY0A 4XRRA 3FWNA 4B79A
chains in the Genus database with same CATH superfamily
5DP1A 4DNQA 3SXPA 4GI2A 3I09A 1RHJA 2PLAA 1XFDA 4MI9A 5TDHA 3RLIA 1M5TA 1XLVA 4QGHA 3AIKA 3CPEA 3HG7A 4RSRA 4A4DA 1M9NA 2C1EA 4II7A 1HF3A 3GZTB 3VPHA 4MI3A 3L6RA 3QBTA 4X6YA 1I30A 3AEQA 3KT0A 3MRTA 1PK8A 2O5RA 1V5WA 1W2GA 2HOQA 2RBEA 4B3DA 3F8WA 3FR7A 3R41A 4MWDA 5B1HA 1P33A 4ZEVA 3IV6A 3K0FB 3TIGA 5IM4F 4YI3A 5I51A 1UM9A 2GEDA 1N5JA 4ARIA 1GT6A 2QP9X 3LC7O 2EL9A 1XTJA 1OROA 1UMBB 1Z4JA 2CXNA 3QOYA 3DMRA 3X1DA 3ZY6A 2GN1A 4FNGA 1SVKA 1UFOA 2H54A 4HZGA 4ZOLA 3O1IC 5FEMA 3UUEA 1CIJA 4D9KA 4EG1A 4Q4JA 3BULA 2E6KA 5LA6F 1JEOA 4MQ6A 1JFFB 1NWHA 3LCMA 5C4MA 4ZU1X 4XM0A 4Y67A 1BX1A 2Z2KA 2Z30A 2JK1A 4IWXA 4X3CA 4OL9A 2EG5A 1OUMA 4BO7A 1RP7A 3L07A 3EBPA 5CA1A 1GQOA 4O6VA 4L2IB 3G5MA 2RHJA 4M2LA 1O87A 1D0VA 5K4HA 3ONEA 2JGRA 2QRZA 2CXOA 1N0VC 4X7BA 5DYGA 3RTGA 4IOLA 4XWAA 3VVCA 2IHNA 1R37A 4QQRA 4ZOEA 5K0FA 4E07A 4POOA 5LQJA 3GUCA 1YL5A 2CFCA 1G21B 1O94A 4DIOA 2XZPA 4JIMA 1FOEB 3SDZA 3WMWA 2ACKA 5HCUA 4XOUA 4CGYA 1D4OA 5M7EA 1T35A 2H7YA 5AR1A 3LT0A 4X90A 4MA0A 2X0JA 5KX5A 1GUDA 1IC6A 3CVUA 1UDAA 4CG1A 4FB5A 3AR5A 1KVUA 1NG1A 3K0CC 3SYLA 3D8NA 2Q9BA 3MTIA 5DJ5A 1W36D 1WW3A 1IVYA 2QVLA 4M76B 5LZ8A 3ZWPA 2YRWA 3M8KA 3K0KA 4EI9A 1Z6AA 1RR6A 2H4JA 3RSCA 3WNQA 1M2GA 4RTRA 1DAOA 2NUTA 2IYEA 4CIWA 3NHFA 2RHRA 1M3SA 1TYCA 4IDNA 2ZWMA 3AJEA 1GL3A 4XJTA 3VUEA 3M4ZA 3SCZA 1LPOA 3HA5A 3KZCA 1LQTA 4EPRA 1D0IA 3O8DA 3WE7A 5I01A 1RLMA 1QF6A 4QYTA 3OA0A 3OTGA 5DTQA 2CL5A 5LQUA 2PKRA 3CXRA 4QHYA 2W2KA 2FUG6 3R9XB 1VM6A 1X9GA 3F6EX 3MCAA 4FMCF 5FRDA 3EP7B 1WXQA 3FOEC 1WUYA 4JH0A 3T9CA 4BV3A 2DFDA 4OQNA 1IZ0A 1T15A 2IODA 4TM7A 4D9HA 5A3QA 5DGDA 1UIRA 5BO5A 4K9LA 2QTZA 3SJUA 1CE8A 2F3QA 3TGPA 2GPWA 1KI1A 1WNFA 4EUEA 4F0JA 1Q0ZA 2BFDB 3CLHA 3VZQA 1S8OA 1PL6A 3GPDG 2GILA 2IW1A 4LY3A 3ZLBA 1YAJA 3RKRA 4L5YA 1C3OA 1M6EX 3CN9A 3WB1A 2QDKA 3GHHA 5GM1A 3I23A 3F3KA 3GEBA 2JGMA 3EEQA 2C29D 1VPVA 2EFHB 1J2TA 2FWPA 1Z4NA 3ADPA 5J5AA 4A8HA 4YAEA 1I36A 2PZJA 1GARA 5K09A 2UXCB 1NVTA 3W6NA 2NVBA 1PGOA 1LNZA 2WFLB 1P8JA 1CY4A 5CB0A 1CNFA 5JE8A 3KVYA 3E03A 4WERA 2D06A 1V9LA 2CMFA 1EFLA 2E5WA 1XQVA 2CV1A 5FLYA 1GU7A 4QC2A 4Z2YA 1HNXB 3G2OA 3OTIA 1N5MA 3KP1A 4MYUA 4M37A 4ZZIA 1EHYA 3JQDA 4ENSA 1UEXC 2VDRB 2XRFA 4GHWA 2OYRA 1TKCA 2AG1A 5JCXA 1TNDA 1Z39A 1U6IA 4GMFA 4XQ0A 4ZCTA 2V7GA 3L7JA 3TINA 3ZE0B 3H2GA 4IH9A 2WVJA 1VMAA 2HJGA 4MCJA 1JDZA 5L9AA 3DE5X 2H1VA 2HJHA 3K94A 4NE2A 2C2GA 5KWVA 1JHVA 3GJ6A 4K26A 4LZWA 1RACA 5KNBD 1EUDA 1Q14A 1I7NA 3EVDA 3IXMA 3QU9A 3GFFA 4UW9A 5GV8A 1COWA 5JS7A 3LP6A 4ARZB 4B40A 5LL6P 3ANLA 2G17A 3R7LA 4CF6A 3OM0A 5LWHA 4WIAA 1XMQB 2P5UA 4CLRB 3VJMA 1YQTA 2W6JD 1N9GB 3VPCA 3EA4A 4OAOA 1L4UA 3VR4H 4H1WA 5LSAA 2B6NA 2PUWA 3G23A 4HUJA 4JQCA 3B89A 4N3GA 4CQMB 4YPOA 4YK7A 4ZZ1A 4LYGA 1XTIA 5IW8A 1XCOA 4WZBB 3TQSA 1LLQA 3K35A 4D81A 1Q1ZA 1G8AA 3OUUA 1I14A 3B1YA 5EHIA 1B7GO 3GT0A 1Q1BA 3QQ5A 5IAOA 3I61A 4NYMQ 3ILVA 3MGAA 1EGVB 2VUIB 3NGMA 4Z9BA 3ZPXA 3PTAA 4W9NC 3PE6A 2EKZA 3DVAB 1ZKMA 2O2HA 3UMBA 1UPXA 2F3RA 3CC8A 4RHXA 3TSOA 2QB5A 3AG6A 4EY5A 3AVXA 1OZFA 3QUCA 4B8ZA 4G56A 4RMJA 1FMCA 4LXYA 4Y1RB 3V1YA 3AVWA 3KXLA 2XLCA 4DMUB 3AESB 1Y3FE 4BVKA 2JHPA 4BGDA 4C2TA 2WJGA 4ZVPA 1SHLA 1NY6A 3KAJA 4AZ0A 3A05A 5DHAA 4XYEA 4DCTA 1J24A 3VR0A 2AC4A 1ENZA 4GOXA 2OB1A 4BNXA 4EWLA 1NBMA 3C5EA 3G88A 4AF6A 2GMWA 4LDNA 4WZZA 4DV1B 3LG2A 4B6JA 1R4NB 1KI4A 1WTAA 2MMGA 4C4XA 3Q3VA 3M49A 4P53A 4WFIA 2O8CB 3BDVA 5KSWB 1SCDA 2OSVA 2A78A 1X7WA 3EIWA 1UDXA 3DDWA 1AZWA 2CFIA 3LS2A 4BMZA 5KYYA 3MGGA 5TQ2A 3MJTA 5IRCD 1W581 1IK6A 1PKXA 2YOHA 3MS4A 4ON9A 3W77A 3NTQA 4TYWA 2DE0X 2DR2A 2HGSA 3OTQA 4KSBA 1TECE 3G59A 4L7QA 3AQIA 3T4PA 2ZCJA 5FA5A 4QSMA 4GF5A 4BB5A 2IH2A 4E4RA 3H5LA 3I58A 4GQAA 1L8XA 1FPMA 1PN3A 1B14A 2ZRGA 4K9KA 4LTDA 5DGHA 3W2IA 4B7UA 4BKQA 1LH0A 1XVTA 3CF0A 3B52X 3WWPA 3I9JA 3FDXA 5EPOA 5A71A 4G2TA 1UK9A 1NHGA 2QVGA 2VDJA 3HH8A 4S0XA 1GA6A 3D4IA 3HJAA 3FMGA 3FDFA 3ZBQA 4DMKA 1EKXA 1U3WA 4HGYA 1EM6A 2ZR9A 3EIFA 4GOJA 4W7HA 3RYIB 3U7QA 3NUQA 4L27A 2E4VA 5F3RA 4BX2A 2JEYA 1MQSA 3B8EA 1ZBQA 5BSGA 1GAXA 3NUGA 2GAFA 1FP4B 3QNWA 4ODIA 4H60A 5DN6A 3V2GA 5IFKA 4U6NA 1H4QA 4X0EA 1R1DA 1A9PA 3ENZA 1S3GA 3EZLA 3TLBA 2XYGA 3SQMA 1V8ZA 5K8IA 4LRQA 3IALA 1SVUA 4QDZA 3SK0A 1QYDA 3T7JA 1KE1A 4V1CA 3L8ZA 3AVYA 2C2BA 3JTMA 3AHCA 3TCNA 3LKDA 4MW0A 3DXXA 1KMIY 1UAGA 2PLNA 3NCTA 4Q7KA 5CGZA 1ID1A 4HB4A 5TIIA 1VB5A 3KLPX 1V16B 1TAGA 1ZHOA 1OX4B 3H1GA 3UK2A 1NNI1 3FZNA 3RTCA 3VX3A 3OWOA 5J3JA 1XUOA 1Z6XA 4AF8A 1QHHA 1B16A 1BMQA 1UUFA 2Y66A 4B79A 4AN1A 2VLIA 4PHHA 1NW3A 5EINA 4LHEA 2EWMA 4QG7A 3L7NA 5B58T 1V41E 2OXCA 2R6DA 1NATA 2Q6IA 3DXZA 4X85A 3NBZC 1TE2A 3J7TA 3TIFA 1P9WA 4FFVA 3X3HA 5C46F 1F17A 2ORYA 2JFZA 4RY8A 4FC7A 5E6RB 3G2NA 3TTVA 5FHRA 2W2VA 2BFCB 1GSOA 4MVJM 1NJFA 4WA8A 2ZSKA 5L3SA 1RXVA 1U1EA 3UMRA 1U0RA 5THKA 2OGSA 4K40A 4R2LA 3ZY3A 3HTXA 5IHPA 2IDKA 2J1LA 4PHFA 4DCOA 4B35A 3EGXB 2XPCA 4MHSA 4KRYA 4RFLA 2ANBA 3QTTA 1K9VF 4M36A 4AVYA 2YFHA 4UFPA 1C8LA 3MWKA 2AZXA 4DV2B 4ZXPA 2MYPA 1QMIA 2KQUA 4DANA 3P32A 2VVTA 1XDSA 3CW2A 3DYVA 4HGNA 4COOA 1ISGA 4ZIRA 3OCYA 2YFYA 3HBNA 3V1MA 3LI2A 1L8LA 1MDFA 2GF2A 2WMYA 3BREA 3L02A 3KOXA 4NULA 3BGOS 1XU9A 2BEUA 3I37X 1QK5A 2OPBA 2R8RA 2M32A 3A4TA 1TRHA 1YR1A 2V4MA 2Z4SA 3DCNA 3L2OB 3ZK7A 4RS3A 2ZSEA 2PZBA 3GIWA 3IBTA 2FEMA 3P4YA 1JQ3A 3ZQ4A 4CMAA 1Y63A 3OZCA 2WU3A 2R84A 2GB4A 4DT1B 1F6WA 1VSQA 3OZIA 2H51A 4D74A 5C8YB 5BUQA 1PQYA 1CXZA 4DLPA 5CTJA 2BPOA 4EUHA 4OHOA 1PZEA 1WY7A 3OX4A 1DRUA 3LOUA 3KB8A 1O57A 1GKUB 3TGWA 3OOEA 1CY7A 5FJIA 3MOGA 1MZPA 3O31A 4OVKA 2A84A 4AX8A 3FTQA 1EGAA 1LJ8A 2XKAA 5DNDA 3BG5A 2BHNA 5H9VA 5FLEX 2ZBFA 1JI0A 1UZUA 2VNKA 4RK4A 3FXAA 4A23A 2BOVA 1OZ0A 3W06A 2YZ2A 4RUKA 3V7UA 1ZXLA 1LB1B 2JFWA 4N82A 5IVPA 2FHSA 4PM4A 2XLBA 2ZRJA 3ZJ5A 2PKWA 2BDUA 3DGEC 3D8TA 2EEZA 2GKGA 2FEOA 3DLPX 3NIDB 3BOSA 2ZB7A 3DUWA 1HETA 3PVSA 5AKHA 4BN4A 2OORC 4MGEA 1TM5E 1JQDA 4E7PA 4LV8B 5ITVA 4WINA 2AMYA 2DPXA 4MK4A 2XTAA 4DTCA 4DWVA 1C0IA 1ML4A 1K8ZB 2XW6A 3TIIA 4LZZA 2BSXA 2QNIA 2W42A 2BZGA 1JWBB 4UBIA 1L7PA 3EZ9A 2NU9B 2EXXA 4ZO9A 5GQSA 5EYPB 1EFTA 1KIAA 5AW8A 3HKCB 2W93A 4QBHA 2QUZA 1RC1A 1ZAKA 2ZGVA 3D8UA 3W8EA 1TT5A 3DKVA 1VKJA 1F0NA 3U39A 1DKMA 4L8FA 3ZH9B 5A4FS 1JH8A 1L4GA 1WO8A 2VXOA 3NATA 3KWFA 5E0OA 2ALJA 2WF7A 1XD2A 4CEIA 3MMSA 5I9LA 3X1MA 3T5PA 2JNWA 2ZWOA 2CC2A 3NPAA 1QAOA 4YXWA 5T6MA 5KYVA 1E59A 2ZZKA 3T5CA 3WMRA 3GLFA 2JGNA 3GRAA 3L0OA 3FROA 3CLVA 4W7SA 5EFOA 1EWVA 3GJRA 1OHHD 3RJ9A 1UXIA 3ACCA 3TQQA 1DHRA 4UAJA 2IY9A 2JC3A 3CUTA 1TJYA 2BM8A 3TDKA 3M83A 4OMCA 2OFWA 3BSFA 3ROMA 4UAGA 3AR2A 1Y48E 3KBOA 4EITA 5KJCA 2RKBA 4Q3KA 2V8OA 3AI7A 3EIUA 5JQGF 4XSHA 4OI1A 1KEUA 2GN4A 1A88A 1NVKA 1TA0A 3DFKA 4PQYA 2AKAB 3G9XA 4INAA 5AW0A 1CC1S 2HSDA 5KTTA 5F21A 4EG4A 4MVJE 1SEVA 4WJLA 3ICQB 1NDQA 2VBIA 2WSIA 2IDMA 1OT5A 2JH9A 2ERYA 3CU5A 3DBRB 3KOUA 5JUWA 4WN3A 4YRFA 1DCKA 4BQIA 1NJ5A 2P6OA 1XYGA 2I7VA 2NG1A 2Q0QA 4LVUA 4NZ9A 4TLDA 3K9GA 2REQA 2NOAA 3RBZA 4CDRA 1D9ZA 2QUIA 2XSZA 3ORYA 1DARA 2BEVB 2OHFA 4MUFA 1YUMA 3SVTA 4KO3S 2XCOA 3G0HA 4JN6B 4UAVA 3AEKB 3TKYA 3VPGA 2ZPTX 4QSHA 3V46A 1EJBA 4J75A 5DNUA 5KYUA 3HVRA 2W48A 1KPGA 1B74A 2B5OA 2FSUA 4I81A 5DW3A 3SJAA 1KEVA 3LWDA 3EP9B 1N5KA 2QG9A 4LOAA 4RPGA 2BEWA 4F46A 2PZFA 4JI3B 5CB6A 2IUFA 2P4SA 2A8YA 2E82A 2I76A 5ITZB 3BC1A 5AOVA 4A0RA 4JROA 3RGGA 4X94A 4F56A 4RDXA 1M1ZA 2J7KA 3AY3A 3N39C 3E4CA 2QSUA 3GC6A 4MWCA 1E61A 2CLDX 4UUAA 2VTBB 3PEYA 1AO3A 3P4XA 1YC2A 3KLBA 3F7TA 2XMBA 1N5DA 2XMDA 4HH3C 4JJIA 4TRMA 2Q28A 1B00A 4BO6A 3EIXA 2GD2A 4Z8XA 4Y2QA 3U4GA 2UUPA 2VT2A 3R3SA 3WKEA 3G6WA 3HN2A 1EVZA 4P3YA 4P7JA 3SLGA 3V4SA 1NVWQ 2I8CA 2GRAA 3GA5A 4DWOA 3KYDA 3QXXA 1RZRD 2EDAA 1W76A 4N5HX 4ZN6A 2HY7A 3QE0A 2GCGA 3LPAA 3I4FA 2QXYA 3QWAA 1RMQA 1U3FA 2FP3A 4MQ4A 1QVZA 2IRWA 1WUKS 1VP3A 4NEHB 4GOMD 3LUAA 5T4BA 2BGMA 3LKBA 3HABA 1OYOA 2WYIA 4KLCA 3DL2A 5WRFA 7MDHA 3SFZA 5KC8A 5HTKA 3SXUB 1XZHA 1ZRSA 3VUFA 3VR2A 3VVMA 1JLSA 1TMGE 1VQ1A 2N46A 3IMFA 3GQBA 5JOQA 2IYQA 2Y93A 3D81A 4NNJA 4QXQA 1Y1TA 4DC1A 1PVDA 2B21A 4AZ3A 3VM6A 5ALVA 3C7KA 4HQ0A 1LLUA 3RH0A 2C3YA 1Z26A 3ZE1B 1FMFA 1S96A 3EJ6A 4ZRMA 4PU0A 4P3XA 3AFOA 3UUFA 1H2BA 1B42A 1U31A 1XNJA 4GLJA 1NBIA 2PRZA 1JR3D 4KBYA 3FYUC 1X15A 2JAWA 2IW3A 2KS6A 5AH0A 1IHXA 5ALEA 1E9FA 2QS9A 1FQWA 3IP6A 1CUHA 1SBCA 2DULA 2HJWA 2QT9A 3NEAA 4P36A 1KZYC 3MM4A 4Y3UA 3B20A 4CJXA 1AGYA 1XP5A 1RAGA 3BXHA 1ENOA 4CHTA 2PV0A 1Q12A 3EZNA 3I6QA 4XARA 3U1TA 3WG9A 2JARA 4NU0A 4MUYA 4OYLA 2VDOB 1JIUA 2M9MA 3G0IA 4JC8A 1C9MA 4MQFA 3NBXX 2O7NA 2ZI7A 4MV8A 4EG6A 3IRVA 3NDBB 5HYVA 2CXUA 3L06A 2Y71A 1JJFA 1T2FA 1ZNWA 1E6KA 1GWNA 4OKNA 4XD7D 3BIFA 1LA2A 1KYXA 3GYBA 2HBZA 3A1DA 2V9PA 2X2FA 3W2GA 2OFXA 4WAUA 3Q72A 5E6UA 1S9DA 4HNGA 4TXJA 3SOZA 3RF6A 4CEHA 3AFNA 1O96B 4QGBA 3UHOA 1EHCA 4ZVMA 5CITA 3DCJA 4A91A 2JKVA 3NCHA 2B34A 1MIHA 1US8A 2O7SA 1DSSG 1DDIA 4HZIA 4PNPA 2XNCA 5AKJA 4B17A 2Q8QA 1RRVA 5H59A 4DNOA 2X5OA 4I5DA 2NAFA 2BF4A 1M6VB 4Q1AA 3MRSA 4LF9B 4UULA 1GLVA 2DM6A 1QAQA 2ZTMA 3KKEA 4O2AB 2NXNA 4XZ3A 2BFNA 4GPD1 3NXKA 1TF7A 4MRVA 1D5WA 5FTNA 1GV1A 4WD3A 3V9AA 2VK1A 1QFXA 1Z3CA 1OLXB 1L1QA 2QTFA 4M0UA 4A6XA 4E30A 5KNDH 1AGRA 2C5GA 3FLMA 4BRSA 2NZJA 3RV3A 2H65A 1SBIA 3MWGA 4E1BA 3E81A 2FWIA 4Z6KA 3WICA 2WVHA 1ZHHA 3GLHE 4I50F 1JLMA 4MUXA 2CCKA 2YTZA 4BKUA 1WXHA 3OCVA 3NP7A 3IUQA 2QD3A 2DC1A 2CVPA 3P97A 1R00A 5F77A 1ZR2A 1X94A 2JGEA 2OM2A 1A98A 3C3KA 3FTDA 3WHLA 4MLPA 3PFGA 4CQJA 4IDFA 3HS3A 1LF5A 4FWIB 1NBOA 3Q0TA 5T3UA 2JHFA 4ZVNA 3FYSA 3VGJA 4D4MA 4FGJA 1JN0A 1Q3HA 4F4CA 5HKKA 1DIOB 2A4KA 4Y9SA 3JU3A 4N12A 1COZA 2WHYA 3KQNA 4AD8A 3D4BA 4RY9A 1P9LA 1FL9A 3VPDA 5L7TA 4F5DA 1G8YA 1EP9A 1WBJB 1X7HA 2VPTA 2RI6A 5KHOC 2OHJA 3O74A 1GXSB 4QKQA 2K5UA 1IXRC 4G0QA 5IMSA 4OLAA 2YNMC 4MI1A 4KPYA 1TPYA 2XOXA 3RB8A 1SQ0A 2KJQA 1DGQA 2IIBA 4B5KA 4PCUA 5FNVB 1YQXA 5EIFA 1TUIA 2CUTA 2HGZA 4ZZ0A 3E8SA 3AF2A 2Q2VA 3M70A 3QF4A 4LC0A 5EEHA 3VU3A 4TVBA 3FPEA 2ZG6A 4E5PA 3GH3A 4DUZB 2DBVO 2H08A 3OEYA 4H3KB 4Y2UA 2C2YA 5D2CA 5IVDA 4YUXA 5JXGA 3OMLA 1QZZA 3IVMA 1ORTA 2Z9BA 3OJWA 2JAXA 5EFZA 3ZCQA 2J5QA 2IZ0A 5DASA 2I66A 2RGBA 4ALNA 1XRNA 3KJIA 1V11A 4O59O 5KQRA 1MRSA 3EVFA 5KNCH 1SUPA 4YRLA 1TW2A 1XJQA 2OAP1 3AVOA 4TXHA 1O4VA 1WNTA 3SOPA 1LU9A 1U3DA 1I0IA 1D04A 3SDBA 4MWBA 3FYDA 3U3JA 4R9RA 2PQ0A 3GFPA 1XIVA 4U2FA 3P2YA 3EXG1 1NQOA 3LW8A 3MJSA 1QB7A 1PWEA 4YRNA 4OK3A 3K6RA 3IUYA 3EGIA 1J97A 2H5IA 2X8LA 4CFZA 5AUOB 4LUCA 1UOPA 3DQPA 1YZYA 3S1LA 1IBKB 1H2ZA 4XIGS 3CRZA 3ASZA 5J9FA 5DLQC 5JMTA 2O19A 1TM7E 2OC4A 1TEZA 1NF2A 1KK2A 1KFKB 4Y6QA 2HTEA 1DIBA 3H5VA 1S1CA 3OLQA 3RVRA 1DBVO 4C4ZA 3T99A 1DAPA 3LCUA 1C4OA 2QNBA 4EMTA 3TOXA 2VUHB 2FB9A 2B2XA 2F90A 4OYRA 4YMGA 2OBBA 2PZKA 1DAMA 1ZIDA 5AVYA 5K0TA 3E0QA 1CYEA 1UC9A 3IILA 4R01A 4PXYA 5LZ4A 1AU9A 3GMDA 1G8SA 3QVVA 4OJYA 1A2QA 2H9AA 3LUFA 2HCBA 4B2YA 4CR7A 4TM8A 2UXBB 3GO4A 2EYUA 4CN9A 3WLQA 3OSZA 2FWMX 4OSOA 3DZ6B 1W9HA 5FADA 3CUUA 10MHA 1GUZA 4M6WA 2J8ZA 4MZXA 2WIGA 4C7OB 1NW4A 3MCTA 1D07A 4U3JA 4FEGA 4QBIA 3THXB 3VX4A 1E3MA 2WPDA 4MSUA 2OMKA 3O73A 3H04A 4JZYA 1ZGZA 1NI4B 1AQUA 1UFRA 4R1OA 5HIJA 3TR0A 1QZTA 5KC9A 3DL4A 3S27A 1SKYB 2HHCA 2CNOA 2WD7B 1HYGA 1Z38A 3C6XA 3DQZA 2AMJA 4P4LA 1N2CE 3TD2A 2Z5FA 2ZXEA 1WPXA 1Y7TA 3OKCA 2VLBA 2WM8A 1DIHA 1JRLA 3UY4A 4I5FA 2Z2YA 3D59A 1I2BA 3HBFA 1JIVA 1QCDA 1WU8A 5AI0A 5I4IA 3WTBA 3E9NA 5F7XA 5AK3A 1Z0IA 1EDEA 1FVXA 2J9YB 5ALKA 1HFKA 4J3FA 4C2BA 1ILEA 2HRQA 1MORA 3M6AA 1G1AA 3L7AA 3VHXB 4BMYA 5EESA 5CX1A 4B85A 3U7FB 4LFAB 1TVEA 2GBCA 4BYMA 3FPJA 5EWJB 4G0UA 2JH8A 3WLOA 4MP8A 3RAFC 4ZK6A 1C1YA 1S02A 4PCAA 1R0KA 3N75A 2QG6A 4EDHA 3ER8A 5AK5A 3GD7A 4OATA 2A1UB 4HAXA 4PNEA 2FN7A 5LP6F 2IZZA 3KL2A 3HKBA 5BNIA 4CL0A 3PQ5A 4UZFA 2C54A 3H5IA 5CT9A 2SCUB 1LNQA 1QUEA 3FYUA 3OFKA 5FD8A 3BFXA 2D5IA 1F1BA 3I0NA 4BNVA 4U7TB 5BN3A 4H16A 1HG0A 2I78A 3KKOA 3R9WA 3QOFA 3L4EA 2FZVA 1CVLA 2P2GA 4G4GA 3DPUA 5AJXA 5K8LA 1JPUA 4XI9A 1RXWA 4L28A 4EPTA 1VB3A 2A94A 3AHFA 1GVHA 2EKDA 3LXMA 4DMCA 1QNFA 3EPKA 1YB1A 2X5NA 3PUKA 4ND7A 2HQBA 4YA6A 1SBYA 3GI1A 4R41A 4OU5A 2WU8A 2YFQA 2W58A 3EDMA 1F9EA 2ONJA 4LYYA 4GI5A 4FP9A 1PEKE 3UAGA 3F5DA 4MUAA 1SBZA 1WHSB 4JASB 2OPHA 2NTJA 4NEQA 4DR5B 1MXFA 1GZHB 1UIMA 5FOSA 1GGFA 1JT2A 1N0HA 2CF5A 1A1SA 1EUCA 4HLCA 2OKCA 4OHZA 1H3NA 4B47A 2DEUA 1THTA 3BWDD 4YAFA 1KI2A 3WQSB 1YJAA 1XMJA 2WYWA 3F5FA 4YJDA 3PUVA 3HHPA 4ZQBA 3K4PA 1B2RA 5B37A 4LYHA 3JQBA 4MVJH 2YZNA 3DULA 3ESCA 3H3JA 4GOKA 3FFTA 3NRJA 2NU6A 2R44A 3CB2A 3HNOA 5J2TB 3QUBA 4JP1A 1II9A 1NYQA 3UJCA 4LXTA 4BO2A 2UUOA 2ID4A 4YREA 3LDGA 1LY1A 1RHRA 2J31A 2ONKA 3B1XA 4I9NA 7MHTA 1QVWA 2B7LA 1P2FA 1LS1A 5JALA 2WM3A 4DMGA 1RWBA 2XNSA 5LFAA 1B6GA 3ZD8A 2OV6A 3B51X 3GHYA 1Y3CE 3IEVA 2AL7A 2B0CA 2H16A 3FZEA 4HWOA 5G4KB 1FTWA 1D4ZA 2YVUA 3V8PA 4EUSA 2ZI5A 4EJSC 1BDIA 4R0NA 2D1TA 3RRNA 2CLEB 2QLBA 3H0WB 3HMKA 3T3DA 2V6MA 3ITEA 4O63O 2IS1A 3QMVA 2OV1A 3IHKA 3PG5A 2YASA 1XQ9A 1E58A 2PZEA 1WZNA 3KYJB 2CFTA 2WTEA 5IVIA 1MA3A 3P27A 2ZXUA 1FUKA 3IJPA 3F8SA 4NHOA 4HS9A 2AB0A 4BMDA 4P08A 4CI0B 3LUJA 3AZPA 1KU6A 4YMIA 3O9VA 4W8OA 5FTKA 5K0NA 1XLTA 1EK5A 2QYTA 3QENA 5AI8A 4N8EA 5L4LA 1MNAA 1ZN9A 3WLNA 1JYFA 4YPFA 3UAXA 4XR9A 2ZKLA 2NVOA 3GW8A 1FUUA 5TVKA 3HM9A 4EBFA 5LOVA 3LYAA 3HJFA 1W5EA 1D2CA 2BISA 2H4WA 2J5XA 2O1SA 2WTXA 5B58C 2QVYX 4HWPA 1U02A 5AJTA 4P9NA 3U56A 3BE8A 1QO7A 3BFPA 1M6WA 3HJGA 3N53A 4DZRA 1J5XA 3A3YA 4BS9A 5LZ7A 3Q3JB 4KUGA 1Y5IA 5EL0A 4BN0A 3MTGA 5C7IO 2I1WA 1GSIA 2Q29A 3MS7A 3OLWA 2HHJA 1LPMA 4TGLA 5G41A 3VO2A 5KYWA 4ENRA 1XZJA 4RVCA 5KSPA 4MIYA 1Q95A 4YRZA 5JH7B 4QUJA 3P0EA 4U9UA 2HXSA 3HEBA 1I7MB 1ISJA 1JXQA 2DH6A 2ZYVX 3GUVA 3BSSA 2NWQA 3HI6A 2NZ2A 4Q3EA 2GKOA 2YV2A 1JWLA 1RWNA 1BCSA 2A0WA 2FA9A 4JLOA 1DB3A 2P8JA 1P9OA 3KAPA 3G1TA 1CUVA 2F4VB 5EWMA 1CRWG 3MRXA 4TYQA 2J5KA 5AI6A 2X22A 5DSTA 2JCVA 1FTGA 5ESDA 1NPYA 1ATZA 2YXNA 3DAOA 5C1IA 3NZEA 3WHKA 2CNBA 2E1PA 3PNSA 4ZPXA 4E4YA 1VSTA 3KUUA 3UWKA 1SURA 3M81A 1XKQA 4JI4B 1T6XA 3PPIA 4I66A 3SSMA 4DIEA 6CHYA 1JB9A 1QG4A 1W6UA 4ZVKA 3TNDA 3MLAA 5I5EA 3OZBA 4JUAA 4NBRA 1OE0A 2YMPA 3R5TA 2WSLA 5GTDA 1OTHA 3EBOA 4Q1EA 2Z3VA 4ZYVA 2HIHA 3IYLW 1EP2B 5K8UA 4DMMA 1ZH6A 4TKZA 4NCJA 4PINA 2PY6A 4FT2A 4G97A 3IQIX 3ODGA 4W99A 2C4KA 5BNZA 5CB8A 2A6PA 2R751 3Q6NA 2XQIA 1VIAA 4HO1X 1GUBA 1KAGA 1KAMA 3AR8A 3DZFA 3QOXA 5BSTA 2CYBA 1PJQA 5A7GA 2W83A 1A5TA 4NPHA 1YFKA 4CIXA 5TY0A 1J9ZA 1NVEA 2GEKA 2BP7B 2EJVA 3F6YA 1Y8ZA 2O7VA 1EWTA 2E1RA 4ZVLA 3FPGA 3TV1A 4WLEA 4CM7A 5BQXA 2QJOA 3K31A 1DOHA 1GPNA 1PKEA 3ENNA 4HJRA 5TLSA 3DCYA 2DPGA 4EA6A 2VDUE 2WWFA 3KZMA 1KFEB 2EG9A 3TLZA 5MN4A 2PVPA 1W35A 3CGGA 3JD1A 5FPSA 4DV6B 3DNMA 1HTWA 4CIYA 4S1WA 2NACA 1QFYA 1S8FA 2XGMA 4KQCA 1UZNA 2ZT5A 4H7PA 5DCLA 2IF0A 3IEUA 3I5XA 5U4XA 2RI1A 3RC1A 1W5TA 1KR5A 4HWKA 2D3TA 2C8JA 3WGGA 4D97A 2OCDA 2ZSDA 1WF3A 2GF0A 2OGUA 2DKOA 1JJVA 1XKTA 1OYYA 4NYIQ 2BKLA 4HRVA 4O0MA 2WJIA 2WOOA 3IOYA 3RYCA 2WTMA 2IV3A 4FYKA 3A14A 2DKNA 4LXQA 2J45A 3STTA 4H6PA 2GXUA 3G0CA 5GMOA 4BMNA 5CVTA 1XDWA 4AQ7A 1ZJYA 3G85A 1J25A 2G80A 2LUOA 2AOUB 4Q82A 4CHGA 2Y0DA 4J2OA 2X0FA 4IEFB 4CF3A 3ET4A 1PZMA 3FW1A 2QN9A 2XCSB 1G3QA 2Q6KA 1SA0A 1E3JA 4F3YA 1FCJA 1Q91A 1MPXA 3LC0A 3OY7A 1NW5A 1E1LA 1HTTA 3F67A 3DKPA 1OXBB 4JJFA 1K5HA 4WDQA 4F3CA 1PNRA 3CNOA 4UE6A 5HRAA 2A1IA 3IL2A 1X1EA 3I5UA 4NYJQ 2CE2X 4LHXA 4BQFA 4E31A 3UHFA 2ZIZA 3AF3A 2PT6A 1F4VA 1QOZA 1VBFA 5ALUA 5LP6C 5IKXA 2ZVDA 3NHLA 2PUTA 2O8VA 3AUSA 5AQ1A 3N8NA 1IIBA 1O5TA 2PL5A 4PZDA 4M0KA 4XFJA 1FDWA 4GPEA 2ZAOA 2WF9A 4B73A 4L78A 2I9KA 5KYNA 2Q4DA 4NKRA 4CLDA 2RGYA 1DHTA 4MA5A 4UBOA 1UOQA 3SD7A 4YCLA 5AKZA 1QORA 5IUKC 2DY0A 2AI2A 4MA4A 1E2EA 3ROPA 2CLOB 2A0KA 2FZ4A 4DRXA 4P54A 1HE3A 1FLAA 4JBWA 4EKEA 4BCBA 1UC8A 4MVJA 5DM1A 2WWIA 3VKFA 3GLGE 2XYPA 3I39X 3G02A 2RJOA 1ISRA 1K08A 1QIMA 3HBMA 5F12A 1J07A 2PWAA 3QSYA 5IKEA 2F3SA 3L0SA 4EKDA 1DT5A 1FBNA 2I5PO 1ZW6A 2GVDC 2OENG 3ENKA 5BW6B 1SC6A 3S2SA 1SKQA 2WD8A 2Q21A 3GEMA 1KQOA 4ID3A 2AYXA 5F73A 5B3JA 4CUKA 4F3RA 4EG3A 3SEQA 3RASA 3HDQA 3VJRA 1FDIA 2IEAA 1JHDA 2QZPA 4Q39A 2ERXA 1V4VA 3GH1A 2BC9A 1U3GA 4NR0A 1O9GA 5ILOA 4GAEA 3W7AA 1KP9A 1SPXA 5A4AA 4TROA 4RCVA 2CXPA 5JAZA 1H5QA 1YHNA 2H9IA 4YECA 3W5SA 3HQ4O 1JTFA 3WXBA 4BFYA 3WL8A 5KKNB 4D8TA 3MCUA 1W0JA 2B99A 1U8ZA 2COUA 3I9LA 4A16A 4EAAA 2HWKA 3X2SA 2OLEA 2ZE6A 1S2DA 5DTJA 2YMLA 4C29A 4F2GA 5AD1A 4UNRA 2IHVA 4TV9F 4DABA 4EJSA 4C4AA 1FYEA 1SVSA 1ZONA 2QQEA 2FG5A 4KFUA 4L74A 3UVEA 4C3OB 4F97A 2QRNA 3ANSA 3LCCA 1GY8A 1M2OB 4W8HA 3GJQA 2XYVA 2XOEA 2OBMA 4YRBA 1ZCBA 5LJIA 3THRA 1E1RA 5CLGA 4G37A 2W8BA 2I03A 1JLKA 2I2AA 2H6EA 3K9BA 2RH9B 2NXCA 3HXPA 4G36A 3W9BA 2R2AA 3JATA 3LXRA 3D4LA 1QNLA 4O4IF 2IU6A 4TT3A 4TX1A 2RGUA 3IAM6 4D4KA 2YWRA 1QDUA 1XVIA 4F6RA 5LQKA 3JALB 4I19A 3WGIA 4JR2A 4KDCA 4ITUA 4RCYA 3EJWA 5BW8A 4DF3A 4LOLA 1L5SA 2W8ZA 1ST2A 4RAOA 1XEXA 3TK1A 1SCNE 5F76A 1VE5A 3I5MA 3NM5A 3CY6A 4QPJC 1TM2A 4JXKA 3V7YA 1G42A 3DDZX 2P0YA 2B20A 1TGYA 1NM5C 2R68A 1L9KA 3EFHA 4CPDA 3VKVA 4EA8A 1XDDA 1QHNA 3P5BA 1X80B 1T1IA 1Q0UA 2R7MA 3GAAA 4HNAA 3LUCA 2DG2A 2VP5A 4X61A 1MX3A 1OA0A 5LUBA 4HBGA 4BFZA 2CL6X 5JECA 1QPBA 4JL8A 4QU5A 1GNSA 3Q7TA 4ZARA 2AZTA 2YYZA 1OXUA 1LRJA 2QL7A 2VHYA 2YN2A 1EFRA 1XB2A 3E2PA 1UBKS 3GELA 3TRKA 5HJEA 1JSRA 1BHO1 3LZ6A 5JNUA 4EP1A 2J33A 1DL5A 1QS0A 2FSFA 2PKQP 2DTXA 1KY4A 4FOLA 1OI7A 4JUDX 2ZVQX 3NAZA 2I6XA 1CUEA 2QUBA 3NR2A 4PC6A 2QZ9A 1M6YA 1JU9A 5FPHA 2DR0A 2AVDA 5K3BA 3AOEC 3S29A 5C37A 4LRWA 4IZIA 1Y8RB 4BBAA 1ZVKA 3IV9A 1AQ6A 5A03A 1Z47A 3B5EA 2W9XA 4AO7A 4RH1A 3P1JA 1ML3A 1RJGA 1VC2A 5K2MA 5HZMA 2VIIA 4LDZA 1TOAA 3W6ZA 4ZWNA 1AKQA 1NJ8A 3TQOA 4DCGA 2XWJI 1FFXB 2P0AA 3DZBA 3KLNA 1YQEA 2HLNA 3NG1A 1GFZA 2HDNB 2OR3A 1SNYA 3R5KA 4QAQA 1BXZA 4YB8A 3STUA 3VR5H 2WAAA 1CZKA 5EERA 5GPBA 1TLLA 1XTPA 3EG5A 3OOYA 5BQ5A 1KWKA 4ZI2A 4CMEA 3AL0C 3VHQA 1VJDA 1V71A 4A3SA 4UBJA 4MVWA 1CJTC 2VDWA 4G9EA 5E7JA 4YJ3A 2QW1A 3TZ6A 2WJ6A 3UF0A 2VBFA 3N59A 3I2IA 1FJHA 3EOBI 3OP1A 5EPEA 1EEXB 4R8LA 4E32A 1IVSA 3F74A 1HE2A 1J90A 1Z17A 4G01B 1QG2A 5F1OA 3THOA 4BJ3A 1T9GS 4F6CA 3AHIA 5BW5A 4C5CA 3DTVB 3JWGA 3UW3A 1VCNA 1YK0A 4XDZA 4URXR 2PFSA 3Q8LA 1Z82A 2P2ZA 2ZE7A 5FI0B 5JSZB 1DKRA 1EUQA 5EJ5A 1E2KA 3IELA 4OM8A 4XVHA 3U40A 4B7ZA 1BJKA 1VHJA 1GZSA 1J8YF 3K7EA 3SQXA 5H4GA 3LBFA 4QRHA 4XA8A 5E1DA 1GPUA 4H1TA 4WCVA 4BC0A 1Z68A 3WI7A 1T8SA 1Y4DE 1FYFA 1T4BA 2DUMA 1BD4A 4DG9A 5JTTA 1K63A 1Z2CA 2R65A 2OBNA 4IHJA 4RVHA 4G41A 1NXVA 5CD1A 1RT9A 1H69A 2PJZA 3B9PA 4YONB 1J21A 1SJ9A 3WSTA 2VZLA 1ZK4A 2C82A 3U7HB 5FO0A 2PTGA 2FAXA 4LSWA 1I6LA 1PJSA 4QHTA 3TL2A 4BECA 4OI4A 4P84A 2CHGA 4G07A 2E4XA 1EDOA 4PPQA 2ZQYA 1FNNA 4K3VA 1DUVG 4RIEA 3WDSA 3HKDB 3ZWWA 1BS2A 4EO7A 4YJFB 2YIVX 4D4LA 2Z3ZA 4GNRA 1Q0PA 1PU2A 4J9VA 4PGHA 2J0VA 5JYEA 2HSZA 2QD4A 4L07A 5DYNA 5HOEA 1A72A 2AMFA 3H5OA 3NEJA 2J5BA 2Z43A 3RWOA 1V39A 6LDHA 5HK9A 1YB2A 2LR0A 3BK2A 4ZYYA 4BP1A 1LSSA 2FCRA 1NXOA 1JDNA 2GZSA 5CYGA 3KQVA 2GHTA 4V39A 1XDGA 3IWDB 4PG5A 2G4LA 5G3YA 5HJ2A 5MDHA 4MW7A 2X7JA 3RSLA 1C7EA 3OPVA 3SQLA 2CSXA 4ZDWA 4OY3A 4JT8A 1L7MA 5IKMA 2HCTA 3TR5A 3V2IA 1R4MA 3CZPA 1H2YA 3KJNA 1C9NA 4HAVA 1JG6A 4BCDA 1B8NA 3N6RA 5FHQA 1M72A 4XJVA 2XUAA 4JB3A 1U5CA 5SZIA 1QV7A 3S2UA 3MPUA 3PX3A 3A6HA 4R2WA 3A4IA 1P2TA 3UPTA 5KNDD 1EWRA 2AE1A 2JLBA 2ZI9A 2X6RA 3E22A 1K3FA 3MD0A 3MUFA 4FHZA 5GIOE 1ULHA 1VHDA 4I9FA 1RPTA 1NJSA 3N2LA