1C3VA

Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 73
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1c3vA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1c3vA01
2ZK7A 5HA5A 4ILKA 1H6AA 3CIFA 2HO5A 1ZIDA 3LYLA 2P9GA 4GX2A 4YXFA 2X1HA 2NU9A 1A9ZA 3NX4A 4O5OA 4PLHA 1I5RA 1R0SA 4OSPA 4XX0A 4ND2A 5EQFA 5B1YA 1PZFA 1P44A 2AQKA 3ZWNA 3D3WA 1GCOA 3GOHA 3F6YA 5L3ZA 1K3TA 5BNFA 4IDGA 1QYVA 4GMFA 2POQX 5EIOA 1D7OA 2Q99A 2X7HA 2FSSA 3JV7A 5EMHA 4L76A 4BB5A 4BNIA 1N5DA 3W6UA 3JQBC 1Z82A 5JE8A 1FJHA 1VJ0A 5A3VA 3ENNA 5DBFA 1R12A 4HKTA 3JQEA 4YAJA 2OGUA 1HDGO 2X86A 2QRKA 1GPDG 3T7CA 1G0NA 4CL3A 1E7QA 1LDNA 1YVEI 1ONPA 1DAOA 4AG3A 3ZW8A 4RL6A 3WXBA 4I08A 3BMCA 5B4VA 5I7VA 3GZNB 3FWNA 5HBRA 1HE2A 3GEMA 1VM6A 4PZDA 1PZHA 1ZXLA 1OC2A 2O50A 4W99A 2CDAA 4IIUA 3C85A 4UUPA 3ZU3A 1UZLA 2ZTMA 4OHUA 3WR5A 5L51A 5KCZA 1GAEO 4J1NA 1LNQA 1HXHA 1W6UA 2GCGA 1ZH8A 4W9NC 4CMIB 4BNGA 1DFIA 3FNHA 4D44A 5U4QA 4IM7A 4YJHB 4UEKA 4GKBA 4EI2A 1KVRA 2NSDA 1E3WA 4M54A 2NADA 1CWUA 1K6XA 5COAA 4PLFA 5F5LA 2DU8A 4BKUA 5F1KA 3ZWAA 1DPGA 3KM0A 5CP8A 4J16A 4WLFA 3KB6A 4IQ0A 2G0TA 5A3JA 1UDAA 4ND1A 4FFRA 1YDEA 4CLOA 3MZ0A 3DHYA 4BKQA 3G17A 5A1TA 3L6OO 2ZQYA 1MC5A 3KLMX 1H93A 4E2ZA 5CHEA 2W8ZA 1RPNA 3AI3A 5JO0A 4CM1A 1DFHA 3FCOA 1SOWA 2YY7A 5IF3A 1ZK0A 2EG9A 1IZ0A 4QFDA 3ZWPA 3ZU4A 1PZEA 1R4NA 1X7HA 3KZVA 4Q3BA 2ZYAA 3SBOA 2EEZA 3Q11A 4UEJA 1EQ2A 1ADBA 5TLSA 3OQ6A 1PQWA 2H5LA 2CY0A 4R1TA 1X0XA 4E5PA 1RM4A 1GQYA 4MVJE 3WDSA 3GPDG 5IDYA 4FOSA 1O6ZA 2J8ZA 1N8KA 3GUYA 1XQ1A 3TNLA 1VRWA 4FC7A 4IIVA 1Y1PA 5KVSA 4JLWA 4BNUA 4ZQBA 5CDTA 1OBFO 3A4VA 4MPDA 3D3WB 4N5LA 1BRMA 3DQPA 3JQAD 4D0SA 4FFPA 4PLCA 1H94A 1QYXA 3I52A 2RHCA 1DFGA 2IEDA 2PR2A 5JDCA 4WJZA 4L4SA 1HZJA 1NTOA 3PHJA 4MDHA 3EAGA 3OIGA 4OKNA 4JX8A 1D1SA 4BNYA 4KQXA 1PJ2A 4GX0A 1DRVA 2CD9A 1GTMA 1E3LA 3I6QA 3VPFA 3EZYA 2B83A 1PX0A 3KOUA 4UVGA 5A9RA 4HADA 3U3XA 2DPGA 2PK3A 3NJ8A 1WP4A 1PR9A 3BMCB 3QP9A 4Y6PA 3EUWA 1Y8RA 3GHHA 4OKIA 2PFGA 1UR5A 4FS3A 2UDPA 3ZHXA 1XLTA 2IODA 4GLOA 4L73A 1IL0A 4IMRA 4BNVA 2Q1UA 4YCAA 4ESOA 3QHAA 5ENVA 4C4OA 2EKQA 2W2KA 3K8ZA 2DTEA 3TOXA 3DXFA 2BGMA 3UGKA 3CZMA 4LCJA 2GLXA 2Y1OA 5B37A 4MIOA 2Y1DA 4ZGWA 3QVWA 5I9LA 4PG4A 1UXHA 4YAGA 1E3WB 1HTBA 2JCVA 4KUHA 2V7PA 4YAIA 4GVXA 1IHYA 4BV9A 1U5AA 9LDTA 3FWZA 3MJTA 1GZ6A 3PHHA 4MKXA 1N92A 3AI2A 3IKTA 4KOAA 1LRJA 1A7KA 3C1TA 4J2HA 4HY3A 2IEBA 4DIBA 2UUOA 3D0OA 4N7RA 3JQDA 1T2DA 4TKMA 4CLOB 4ZA2A 4MKRA 4EGFA 4K1LA 4Z0HO 1P1IA 2B35A 2IXAA 1DRUA 1LU9A 1ARZA 5BSEA 5TJ9A 3ZWYA 5BQFA 3AOGA 1O89A 4NNJA 2CF6A 4IPTA 3TWOA 2X23A 1R4NB 4MVJI 3U4DA 3O38A 3VZSA 2A92A 4JBIA 3PYXA 3K6JA 4BKRA 3WWYA 1PS9A 3PP8A 2AE2A 2W2LA 4KTTE 1NHWA 1ZFNA 1ZCJA 3PWKA 3IOYA 2B36A 3QV1A 4RJTA 4L4XA 1LBEA 1HKUA 4R9SA 3ETDA 3A28A 2ZB3A 4PVCA 4WCFA 4GVLA 1F17A 3H9JA 3HE3A 3AW9A 5TJHA 3KYBA 2B4RO 1A72A 2A4KA 4O63O 4L75A 4JXKA 5LDGA 3UCXA 1WDLA 4P8RA 3OEWA 1V0JA 1Z45A 4NR0A 4XR4A 5G0WA 2FR1A 4R9RA 5DZSA 4CR8A 1ONOA 1TT5A 4CMEC 1LDMA 3D5TA 1ISJA 1HYEA 3EHEA 1M66A 4WEOA 4A10A 3WGYA 1V3TA 1ORRA 3RASA 1NNUA 3AY7A 3RIHA 4CMBA 1W8DA 4EDFA 5CG1A 4INAA 5A9TA 1XIVA 3GT0A 4YQYA 4HWKA 1PQPA 1CETA 4UUMA 3GVIA 3EZLA 2ET6A 1NVTA 1VI2A 1Y8RB 4BGUA 4PG5A 5IG2A 3JQAA 5MGBA 1DIBA 3KRTA 3KYCA 5T6BA 3ZWBA 3FBTA 3HB5X 2AXQA 3VH4A 1KY5A 3PQEA 2O3TA 2W2KB 4ZRMA 5JAQA 4IDAA 3I23A 2EHDA 2JHGA 3L9WA 1K6JA 1Z6ZA 4H16A 2RCYA 4R1SA 4XQCA 4XDYA 4GMGA 1CDOA 5K6AA 3BA1A 2VQ3A 5MDHA 1YB1A 1K6IA 1B7GO 1Y81A 3QSGA 4H7PA 4B79A 3VDRA 1PS0A 3G3EA 5JC8A 3MWDB 2HKIA 1XCBA 3ROPA 2C7GA 1QXSA 1VKNA 4TRJA 4XRGA 1WDKA 4AJJA 2WJPA 4XQGA 2GYYA 4UUNA 3OHSX 1DHRA 4XQ9A 4PG7A 3TZKA 4J6FA 2Z95A 3H9EO 3FSRA 3MCVA 1T2EA 2JCYA 4R1UA 3WNVA 2JCXA 1SZJG 1HETA 3LC1O 3NV9A 3VH2A 3WYEA 2A9FA 4E2XA 3HADA 3TDKA 4DIFA 3JD4A 1QV7A 3FBGA 1E1MA 4G65A 2NU8A 1PWZA 3K9QO 1B14A 1ULUA 2P5UA 1Q1NA 1A4IA 1NPDA 2PZLA 3GRPA 4E21A 1WPQA 4E5NA 2J3JA 3TF5A 3LF2A 1F12A 2GDZA 2A35A 1E1KA 2B4TO 3WX0A 2D5CA 1JW9B 4FSHA 4HFMA 2GN6A 4WCFB 4IS2A 3MJCA 1KEPA 1N9GA 5I7SA 9LDBA 4FN4A 1GV1A 3C3XA 4MO2A 2H6EA 4XQEA 2NWQA 2NU6A 2OBNA 4RLSA 1EMDA 1NQ5A 2GZ2A 3WB9A 3GZ4A 4RDHA 5COBA 4FPXA 1TT5B 4NJOA 3ZWVA 3P7MA 2Q4BA 1ISMA 3WGOA 4OXKA 1P1JA 5LC1A 5L45A 2C0CA 4LRTB 1ZMTA 4XWYA 1D3AA 4XGNA 5BNIA 2BFAA 2I99A 2X5JO 2DFVA 3INTA 4N54A 4Z9FA 4E3ZA 2EGGA 1E0DA 4U0JA 2FZWA 1PQUA 3TL3A 1IULA 1R4MA 1OFGA 2SCUA 4CLXA 3QA9A 4M55A 3JQFA 1O95A 4KQWA 2D8AA 4J3FA 3JQAB 3GEGA 1YKFA 3E6AA 2NV6A 3ZGYA 3KYCB 4UAGA 3RC1A 2P68A 1HDRA 3ROQA 1UUFA 4FGWA 4JJFA 1H9BA 5FEUA 1O0SA 4RLHA 3QY9A 2CDCA 3ZU2A 1EVIA 3UXYA 5T73A 3Q6IA 1RM0A 2UUPA 3HNPA 4I9UA 3RBXA 3RC2A 4B4VA 5FWNA 3EVNA 5H82A 3Q9UA 2NTNA 4KUGA 3O26A 5A5EA 2X4GA 4QUKA 4HP8A 3F5SA 3VAZA 3LDHA 5CDGA 2HMVA 1H6DA 1DC6A 2Q1SA 3C7AA 1XU7A 3ANMA 5JXWA 4HX5A 4CQMD 4EZBA 2JFGA 3DOOA 3IP3A 3I3OA 1XGKA 5DP2A 1HT0A 4R51A 3RU9A 4BNFA 1BW9A 1FMCA 5TF4A 5F1PA 5L7TA 3ON5A 2W4QA 2YZ7A 4M87A 1R0LA 1YJQA 5G4KA 2OMEA 3OJOA 4YR9A 4ALIA 4R4JA 4Z0TA 5DCUA 3NAQA 1GEGA 3CMMA 1M67A 5G0UA 4GGOA 4AVYA 2DBQA 3BTSA 4CMJA 1GFSA 2I6TA 2NTJA 4LN1A 1QKIA 2NNLD 5EESA 1DO8A 4BO8A 4IINA 1PL6A 3LLSA 1ZSVA 4KWIA 1XELA 4BNWA 4O59O 3LT0A 3DR3A 1U7HA 5JY6A 4E6PA 4GL4A 2QIOA 1B3BA 3HHPA 3DAFA 4CMHA 4CM6A 3ONEA 3RAJA 5AVOA 1M6HA 5G2OA 5K0ZA 1N7HA 4DYVA 2Y0DA 5DF1A 3KVOA 4A7PA 4LSMA 1EVYA 4BKPA 1N9GB 2BF7A 2W98A 3K73O 3B1KA 2E4AA 4ZQGA 1EBFA 1JWBB 3S2EA 1MXFA 4XRRA 2WYWA 4ALMA 1A4UA 2Y1CA 4PRKA 1HRDA 2VOJA 5IN5A 3TFOA 1B15A 1UZMA 4WEQA 1PTJA 3O9ZA 1NPTO 1TVEA 1P3DA 3A14A 3OFSA 4YBZA 3ZZNA 2CVOA 2RBEA 1NPYA 1RKXA 1ZK4A 1GQQA 3K31A 1HSOA 2H1SA 3E03A 1Q2XA 3PQFA 3F5QA 4MOWA 4Z9XA 3Q2KA 3JQBA 3JQ7A 3OECA 3VKUA 2C2XA 1XR3A 1R4MB 1XA0A 2X5OA 1DC4A 4FBGA 4PVDA 5BR7A 1PR3A 4E4YA 5BSFA 2LDBA 3HWRA 1U2GA 2ZCUA 1AXGA 1GL3A 4CV2A 4J91A 4OQYA 3HDYA 5ILGA 4GWGA 4DL9A 1B26A 2DBRA 3TJRA 2VTEA 2JFFA 3IJPA 5L95A 4I9HA 3NTRA 1ENPA 2C07A 4N5NA 2RIRA 4XEHA 1KBZA 1HWYA 1QSGA 2GR9A 4OMUA 1PJSA 3X2FA 3VH3A 5HTOA 2VYVD 4RF2A 5FI3A 2JAHA 5J23A 3PHLA 4E5MA 3RFVA 2DKNA 4PLWA 1H9AA 4QECA 5F21A 4EYEA 4IDFA 1FDUA 2I67A 4W9NA 1I3NA 5DDIP 1Y8QA 3MOGA 4CM8A 1ISFA 5KVQA 1G1AA 3MTJA 4NDNE 4YJDA 3U62A 1CQIA 3B1JA 1BW9B 3QRWA 2PZMA 2PZJA 4FIZA 4E2YA 3ENKA 5TRTA 3C7CB 1WMBA 1I36A 2J3HA 5G4KB 2O2YA 3H8VA 4YT8A 2CUKA 3KHUA 4NFHA 3ANNA 3GMDA 1AHHA 3RUDA 3B20A 3FD8A 4GX1A 4ZICA 1EUZA 1LC0A 1PJ3A 2GGSA 4OO3A 2B0JA 1NQTA 4K9DA 4XGIA 1LDGA 7ADHA 1NVMB 1T2AA 1AE1A 2EXXA 4FOOA 5B4TA 1NM5A 1GQ2A 4JIGA 1ZSNA 4IS3A 4WKGA 1GYQA 4DLBA 2I76A 1QRRA 3PWZA 2CMDA 3C1AA 4F3YA 3C7DB 3JCZA 1IHXA 1BDMA 1E3IA 2GSDA 3WFJA 3STHA 1EK6A 1WLYA 3ICPA 3L4SO 1ADFA 1DIGA 3H5AA 1SEPA 5EL0A 4A0SA 2R2GA 4BS9A 4IJKA 4Q39A 4UUOA 1MA0A 2BFMA 3HZZA 4BOYA 4IDDA 4TRNA 3ETEA 3ZWXA 4BMNA 1Y9AA 4IJUA 4ZHSA 4TRMA 1QMGA 1XSEA 2BI8A 3IJRA 4DPMA 3O4RA 3GHYA 1KVTA 4CMAA 4J4TA 1K0UA 3WIDA 4ALLA 5A9SA 4PLTA 1UAGA 3IDSA 3CEAA 3S2FA 3GN2A 5JC1A 5DNAA 1ZMOA 3GUCA 4XYBA 4D79A 1JLLA 3INRA 2VHZA 1KS9A 2GF2A 4IBOA 4NK5A 5TT0A 3H2ZA 2X9GA 5IJZA 1RYEA 2HMWA 3NT2A 4LK3A 4RZHA 4HNGA 4U6SA 2Y1EA 5I7EA 1NR1A 3JQ7B 3BTUA 4B3HA 2G5CA 2PA3A 1I2CA 2NACA 3JD0A 1H6CA 3I4FA 3QLJA 3D4NA 4XIYA 1CJCA 3RKUA 3WSWA 1I10A 2CZCA 1LI4A 4AJHA 5DCWA 1L7DA 1GUYA 1ZW1A 1KETA 4GSKA 4BO6A 3T4EA 4LVCA 4QO8A 3WQQA 4F6CA 2Q45A 3L07A 4FJ1A 1TLTA 3DTTA 3IQDB 1KIFA 2Z1NA 4GI2A 3GN1A 4RVUA 4YJFA 4CM5A 5HS4A 1EBUA 4CM4A 4B7CA 3UVEA 1F8GA 1T1SA 4FFLA 3ABIA 4NBRA 2GPTA 4YWJA 2GZ1A 1UH5A 1XWFA 4D7AA 5ADHA 4MJLA 5IFLA 5L4LA 4BGVA 1PJCA 1WZIA 3DAGA 1Y8QB 3F1LA 4CM8B 3TZQA 5KNLA 4J0FA 5L4SA 4OXNA 1QORA 3FR8A 2VZ8A 4XJTA 4A26A 1D8AA 1KEUA 2B5VA 3GK3A 4OOFA 3QWIA 1P1FA 1T24A 2HQ1A 4DQVA 3QW2A 4NU5A 3NUGA 3WQSB 2FPIA 3GNQA 4R69A 5JBIA 3H3JA 3VPGA 4IDEA 2VYVA 3PFFA 3OSUA 4OQZA 3D4PA 3WGHA 2P91A 3PTZA 1GDHA 5JYEA 5AXDA 1MB4A 3PGJA 4J0EA 1Z7BA 4CQMB 4M1QA 3E18A 1ADGA 4E5KA 1I0ZA 2O3UA 1HE4A 2IYPA 4GH5A 1MP0A 2P5YA 1A5ZA 4IGFA 5THKA 5DOVA 2IZ0A 5C3MA 2V6MA 1B3RA 1V8BA 3OF2A 1EQUA 5G0TA 4NPCA 4AJEA 3GGPA 4EJ6A 2BH9A 5A04A 2Q3EA 1RJWA 2CVZA 4TMFA 2VUTA 2QX7A 5JCXA 3VZRA 5COQA 1I2ZA 2VT3A 2HCTA 3D64A 4L74A 3ASUA 4NFSA 3ZHBA 4A2CA 3MOIA 3U49A 5A9SB 4CJXA 4YT4A 4YYZA 1E5LA 2FHSA 5F5NA 4ROSA 1DDOA 2HK8A 3LQFA 4CUJA 2JL1A 1Z7EA 3FTNA 3I6IA 3S8MA 3DONA 2BGLA 1O94A 2JHFA 3GR6A 3M2PA 4BO2A 2W2LD 2YQ4A 4R5MA 5FYDA 4BL5A 4CMEA 5I9MA 1X13A 3OETA 1DLJA 3GVPA 1KEWA 1U3TA 4YAKA 3W8DA 4BO0A 4HNHA 2X5KO 4L9RA 1DLIA 1DIRA 3RBVA 3SC6A 3OEYA 4F45A 2ZB8A 3EC7A 3RWBA 2I66A 3TSCA 2PV7A 1P0FA 1LQUA 1NWHA 1MFZA 1VJTA 4H15A 2XF8A 4Y98A 2EJWA 1SEVA 4N5MA 4BGEA 3Q2IA 3DWFA 5L7YA 5ICSA 1W73A 2G76A 4XZ3A 5K9ZA 4YJFB 1LLDA 1B16A 2WD8A 1HDXA 1TEHA 4A73A 4CM4B 2JD2A 4ALNA 1ISGA 2HMTA 4JQCA 1Y9EA 4RVDA 1ZK1A 4K6CA 2ZCVA 1YO6A 2JFHA 3H7AA 1F06A 2VWHA 5JMPA 3DZKA 4WPGA 5L40A 4R3NA 1X14A 3SEFA 1SAYA 3PJDA 4CQLA 1YONA 2NVUA 4QQRA 3K30A 5JYAA 2DUWA 2ZYDA 3VTZA 4TQGA 4ONEA 2GN8A 1Q7GA 2AE1A 5JFOA 4YRDA 2V6GA 1P9LA 5CEFA 3KV3O 1T4DA 3ZWCA 3BTVA 2X0IA 3SC4A 3KEOA 5T64A 4BQRA 3K5PA 3VDQA 1GZ4A 3AY6A 3PGXA 4A27A 1N2SA 1ZBQA 4GKVA 2IZZA 4D3FA 3HDHA 1V6AA 1IUKA 4GWKA 5DULA 4BNJA 4NJMA 4D43A 4QXMA 2YHIA 3G79A 1HEUA 5U9CA 3VPSA 3OJEA 4K26A 4B4OA 2DBZA 2FSVA 4IGEA 1PEDA 5GZ1A 4HFNA 2QYTA 3KTDA 1C0IA 1I8TA 1MG0A 5DBGA 1EDZA 2Q50A 1LDBA 1BSVA 1HZZA 4N18A 2DM6A 1C0KA 2O23A 4EJMA 1WWKA 3CXRA 3H5NA 3RSHA 3WOHA 4DIOA 4Z9YA 1WZEA 2AW5A 2NLOA 4IXWA 4FJ2A 5CPFA 3FNFA 1D1TA 2C54A 3WMXA 5HS6A 1ENZA 3I9OA 3HB4X 3WFIA 3DZHA 2QZZA 2AEMA 3ZN2A 4DREA 4ZQFA 4C7JA 1LDYA 4K28A 3EDMA 3HQ4O 4E12A 4CMGA 3WTCA 1XU9A 5A03A 3GNSA 2C59A 4BO4A 1X7DA 2WE8A 4QTZA 3B70A 1I3KA 1UP4A 2CSUA 3OIDA 4NBUA 1NQOA 4KTVE 3WTBA 3GQVA 1E1NA 5KJEA 3A9WA 4DBVO 3ONFA 2Z1MA 3GG9A 2YUTA 2WDZA 2NU7A 2VNAA 3PRJA 5AXCA 3JYPA 1G0OA 3T7EA 1I01A 1DSSG 5ER9A 2J5KA 3RUHA 1E7RA 3HFSA 4J7CA 4DLAA 3PJGA 2VWGA 3LT1A 4HBGA 4DPKA 5C7OO 2XAAA 4D0RA 4L0QA 3PJFA 4CQLB 3M2TA 3OP4A 2NVUB 3WGGA 3V1YA 4BO7A 3ZDFA 3FTPA 1GUZA 2EERA 5BNTA 2B37A 3GGGA 4U6QA 4DVJA 3I1JA 5T5QA 4BNNA 4J43A 4P4NA 5IDXA 3KETA 4BO5A 3ROKA 3PJEA 5GZ6A 2C5AA 5LDHA 4R01A 3LC2O 3MJSA 5JCJD 4BNLA 1YGYA 2Y67A 1OI7A 2IE0A 4CUZA 4DMMA 3UKOA 2AEJA 1PJBA 1VKOA 1BXGA 2D3TA 1B8PA 2PD6A 5A02A 2D2IA 3DOCA 3FI9A 5G0VA 1K5HA 2QHXA 3E5MA 3GRKA 2O2SA 4NJMB 2YHIB 2PKQP 4W4TA 1VPDA 1DIAA 3NEPX 3R3JA 2R00C 2GN9A 3KYDA 4S1VA 4A03A 3GDFA 3I9LA 3GY0A 3R0IA 4KMSA 2BFOA 2YV1A 3TL2A 4CODB 5T8KC 4F46A 4H3VA 2FR0A 1C14A 1E7YA 2BRUA 3I9JA 3PDUA 4J9VA 4CLEA 1VE9A 2VT2A 1YL5A 3L4BC 3ASVA 3FHLA 3QWBA 4II2A 1NFRA 2VHVA 1FF9A 3TPCA 1B0AA 3FN4A 3LK7A 4BNTA 2XOXA 3D4OA 3H9UA 1X15A 1UZNA 5A5FA 3AM3A 4TZKA 3N58A 3DEYX 2QW8A 3RC7A 2Y1FA 3WNQA 1J6UA 4JP2A 1OOEA 1DXYA 1NR7A 5EQDA 2VYNA 2QRLA 4NBTA 4GAEA 1SNYA 3L0DA 2HSDA 1XKQA 1U3WA 3JYNA 4AJOA 3Q3CA 2DTDA 1ZNQO 3N74A 3SLKA 1JU9A 4TROA 3RD5A 3QVSA 3HDJA 3D3EA 4G5HA 1SCUA 4OSOA 4EEZA 1IOLA 1AHIA 4FD3A 2O3SA 1A27A 1LRKA 4DUPA 1L7EA 1MC4A 1E5QA 1SBYA 1JKJA 1SMKA 3ITDA 3IUPA 4HXYA 4W7IA 5EN4A 3AI1A 5TS3A 3DFZA 3AK4A 4R68A 2Q49A 3RUIA 5FFFA 4WLVA 2IZ1A 4CV1A 1PU2A 1YJ8A 2FPPA 5IAAA 1HDZA 2O3RA 2UAGA 1PJLA 2FY8A 3ZU5A 2JAPA 1R15A 1YOVA 1I33A 1F8FA 3FNGA 1G6KA 1EZ4A 3C24A 4E13A 2GNAA 1WDMA 1EE9A 2V65A 2DLDA 3RUFA 2GZ3A 1GADO 1LLQA 1CYDA 1NAIA 1LUAA 3ADPA 3Q0EA 1XQ6A 4OGWA 5KWEA 4XYGA 1R0KA 4U7WA 1NP3A 4JCOA 4HV4A 1K89A 1I3MA 2NQTA 3PIIA 1X1TA 1BXGB 1YL6A 2X6TA 3QWAA 1HDYA 3NDRA 2VRCA 3I9MA 3ZCXA 5TX7A 1DHTA 1SOVA 3UAGA 3RJ5A 4B4UA 1P1HA 1EDOA 4FJ0A 4ZVVA 4R41A 1E3EA 5HRUA 3N7UA 1QP8A 3I4CA 3IAHA 5DOZA 3DZFA 2EWMA 4WLOA 5KJCA 2GO1A 3KYDB 5KTKA 2EJVA 2VHXA 3WIEA 4I5GA 1Z74A 2WWRA 1JAXA 4IXTA 5JMWA 4YRBA 2Q22A 1BMDA 3HDQA 5JCJA 4PG8A 1OZAA 4B7XA 3CPSA 1E3JA 1N1GA 4HFRA 5KJ6A 3ZW9A 3IIEA 4GBJA 4RORA 5ITWA 4HFJA 4UULA 2WYUA 1PL8A 2CFCA 2X8LA 3NKLA 2E6UX 5TSDA 3LF1A 1LSUA 5I7FA 1ML3A 3M1AA 3ZV3A 5B4UA 1SB8A 1PGJA 1GCUA 4JJGA 3DZBA 4X54A 1BVRA 1YBVA 3P2OA 3EVTA 1BXKA 2C20A 3G1UA 3JQ9C 3NGXA 5T57A 3O03A 2ZYGA 4RZIA 4TZTA 1P0CA 3HUDA 3WQRA 3NYWA 4CLHA 3GMSA 3L77A 5HWSA 4EBFA 1E77A 3E82A 3OA2A 1JTVA 3VZQA 3G0OA 3WYBA 2ZQZA 1HDCA 3AUTA 4DTIA 1YQDA 2G1UA 3W4KA 3RKRA 1LSJA 4ZQEA 4XD2A 5JAMA 2JD0A 2QQ5A 1V9LA 1ZEJA 3OICA 4Y6SA 5KVVA 2BGKA 5EJ2A 4RVHA 4O1MA 4Y6RA 2EKPA 3IKVA 3PYMA 2WEKA 5BSHA 4D46A 3S1LA 1NYTA 4EUHA 1ONNA 2FWMX 4JP3A 4BB6A 2FPGA 3P5SA 1KC3A 3E8XA 3H4VA 3IP1A 1JN0A 3Q1LA 3QVXA 2UYYA 1LTHR 3NDJA 3RCBA 3PLRA 3HJAA 1P33A 2IDZA 1F0YA 1R6DA 4FW8A 5G4LA 4RF3A 2X0NA 4ZJUA 5I9NA 4HUJA 1HLPA 5L7WA 2ZTVA 5IN4A 1J5PA 2WTBA 5AQ1A 4IMPA 3R1IA 4WUVA 4WASA 2OL4A 3WS7A 4YT5A 2P2SA 4XR9A 2Q1TA 3PXXA 2I3AA 4W6ZA 3V2GA 3K92A 3U4IA 4AJ4A 4TKLA 3ZWOA 4QO7A 1IE3A 2X22A 3PI7A 2HMUA 2BKAA 4AJKA 1E7SA 3HSKA 3VTFA 1HL3A 1Q0HA 1TB4A 2Y93A 1YB5A 4OAQA 3RJ9A 1A71A 3TN7A 2ZTUA 4AJ2A 1NHGA 4OL9A 5DT9A 4RF4A 4CM3A 2FP4A 2Y0EA 1IYZA 3UN1A 1TXGA 3DAPA 2J3KA 4CR6A 1TI7A 2ZIZA 3IC5A 3M6IA 1NAHA 1WNTA 1V3UA 2WE7A 2WYVA 2OXIA 2AMFA 4RPHA 4YB8A 1U7TA 2Y66A 1NQAO 3ANLA 3NGLA 4QT0A 4R16A 4ZD6A 1PJ4A 5KOIA 3SVTA 1HDOA 3QJ5A 4JROA 2EW2A 1LXCA 1LLUA 1PGNA 3HN2A 4JN6B 4FB5A 4MVJH 4NHEA 1DJQA 5L4NA 1MGOA 3BXXA 1ZSYA 4R3WA 3DBLA 1QV6A 4CMCA 1ZUD1 1O8CA 5TIIA 2YQ5A 2RAFA 3KSUA 3DB2A 1KYQA 3RBZA 3WGQA 4OH1A 5CDSA 1Y5MA 2V6FA 5IDQA 5C7LO 1DOHA 1NASA 1QR6A 1GYRA 4XB1A 4UREA 4FFMA 3CMCO 1Q7CA 3FRJA 5L53A 1CERA 4BNHA 1DBVO 4D45A 4YT2A 3GH3A 5IZ4A 2HK9A 2E48A 5KKCA 1WAMA 2E49A 3DBHB 3EYWA 4UEOA 3WWZA 4DC1A 4WOJA 1HF3A 3WGIA 2H63A 3H2SA 1C0LA 3LU1A 4J49A 4YDRA 2HMSA 3C1OA 3VVBA 4PZEA 4DMLA 1T25A 1WMAA 3JQ8A 3BMNA 1XYGA 3AOEC 3M1LA 4GSLA 4IY1A 3LZ6A 3PHGA 1W0CA 1WVGA 1JVSA 3RFXA 3A06A 3NT5A 3NT4A 4R5HA 3OH8A 4J2OA 4BNZA 1GU7A 4NH4A 2XPCA 4LW8A 3JSAA 1YWGO 2DT5A 4RVGA 4XDZA 3UHAA 2PD3A 2DBVO 4ND5A 3H5RA 2VWQA 4FFOA 1I3LA 1L1FA 3JD3A 4PLPA 2VTDA 1JWAB 2EV9A 3ETGA 4I5EA 4QFCA 1Q7BA 2C7VA 2ZJ1A 4IDBA 3BIOA 1ZKMA 3AM5A 4WCDA 4E0BA 3U09A 2P9EA 2EF1A 4RDIA 3BYZA 2O4CA 2DQ4A 1WXDA 3HN7A 4KWHA 3GFBA 5KIAA 4Y8VA 3VC7A 4Q3CA 5U1PA 3WLEA 3PEFA 3RUAA 1E3SA 4YA6A 2Z5LA 5DN9A 2O7QA 3TQHA 2DFDA 5HM8A 2Y05A 1PWXA 4AL4A 1FDWA 3PIDA 3JTMA 1U28A 1LRLA 1X7GA 1PGPA 3AM4A 4JJIA 1YL7A 1YXMA 3QIVA 2DUUA 3DC2A 3GG2A 3W1VA 1H5QA 4PG6A 3DHNA 4AICA 3ZH2A 3L9XA 1YE3A 4RV9A 4P4GA 7MDHA 3ZV6A 4XB2A 1GPJA 1U2DA 1PJTA 4ALJA 1ZXBA 4OOEA 3DBLB 5CDYA 3AJRA 3AUUA 2DC1A 4AJNA 4BMVA 2CVQA 3PHIA 3OJLA 4XIJA 1V35A 2FR8A 4XCVA 4RPKA 2QZ9A 4YJGA 5JAIA 3BTOA 3E9QA 3L6DA 4MIYA 3PK0A 3PZBA 5GZ3A 5DP1A 1M75A 1Y7TA 1JKIA 4R54A 4CV3A 3IMFA 3PFWO 3CZRA 4MP8A 3KLPX 4B8WA 4RPJA 4CM7A 4KDFA 1SPXA 1WW8A 4PLGA 2GD1O 4PFJA 4E33A 3V2UA 4CUKA 1T1RA 2H9IA 4CPDA 1T2FA 3RU7A 3UF0A 1MFPA 2XXBA 3JQ8B 3WGZA 3BMNB 3ZNOA 4LRSB 3G49A 1FDTA 3I5MA 4E30A 1LX6A 1H2HA 3RC9A 4XA8A 3WJAA 4NU6A 4RPLA 2J6IA 4PLVA 5M6DA 1PGQA 5EPOA 4I5DA 1N1EA 4G2NA 3AU8A 3OBBA 1EUCA 4UVDA 3SX2A 1MX3A 1O5IA 3KEQA 3ZV5A 2BHLA 3WYCA 2EKLA 4JK3A 2NTVA 1B2LA 2PH5A 1JKFA 3K2BA 2QG4A 1AUPA 4BMSA 2PWZA 1LJ8A 1BTOA 2C5EA 4CR7A 1ZK3A 4EJ0A 1PZGA 5IXSA 4LMRA 3KSZO 4M89A 1VSVA 1BG6A 1T26A 4L4RA 4OXYA 1YB4A 4WK6A 1HLDA 1U3VA 3VZPA 4WLNA 1FK8A 2Y1GA 1U8FO 3DBVO 1LLCA 1HSZA 5CDUA 4FDAA 1U9JA 1M76A 2Y0CA 4ITUA 1AN9A 1ZJYA 5IXYA 2D5AA 1QYDA 4EEXA 3DFUA 2Q46A 1E1LA 3P2YA 3DTYA 3QE3A 4Z3DA 4NZ9A 3CUKA 4NQZA 2CDBA 2D59A 3ZHZA 4W82A 5TT1A 2R00A 1YS4A 4Q3EA 1KVQA 1VSUA 5L9AA 3GNTA 1I30A 1VJ1A 4XKJA 3VPXA 3UCEA 1UJMA 4RVSA 1E7WA 4O0LA 5BT9A 5T8KA 5JDIC 2HUNA 4UVHA 1QYCA 3T4XA 1XG5A 3HFGA 2VWPA 3JYOA 3L4BA 4JNKA 3S2IA 2JJYA 2HRZA 2QRJA 4YVFA 4CM9A 3OM9A 5JYFA 1I24A 3ICCA 4BO3A 4BIIA 4YQZA 4BVAA 1KOLA 2HJRA 2YYYA 1HYHA 3JD2A 2ZB4A 2BI7A 2FRDA 4KZPA 1HYGA 4AJ1A 3DOJA 4DXHA 4AJLA 4YJGB 1R37A 2ILTA 2AA3A 4J4BA 3AFNA 5ENDA 5IZCC 4G81A 3BHIA 5JY1A 3MTGA 2G17A 5TGDA 3U0BA 2W90A 5LCXA 3DMTC 3H6KA 4TWRA 1N7GA 2ZB7A 4XJSA 2D4AA 3LC7O 1NBOA 3KO8A 4Q3AA 1KY4A 1SB9A 1RYDA 2I65A 1W4ZA 1TT7A 3B1FA 3JQGA 4J1QA 4E31A 5JS6A 1JQBA 3DZIA 3ZV4A 2IYOA 3DO5A 2PGLA 2BLLA 1XHLA 2WMDA 1YRLA 3BMQA 2VYND 4WGGA 3RVDA 1YDWA 4B3IA 3V2HA 1IY8A 2EIHA 4WNIA 4MVJA 1VL8A 4B4WA 2G82A 3P19A 1M6WA 3GGOA 4Q9NA 2PD4A 3PVZA 3PLNA 1DRWA 1EFKA 4ND4A 4RQUA 4YACA 3E1KA 1MXHA 1U8XX 4DA9A 4J90A 3GEDA 4LISA 4BO1A 4NK4A 3RQSA 1C0PA 2OP0A 5GMOA 1NWCA 1ZEMA 2AEFA 5ITVA 2QYSA 2X9NA 1XDWA 4XYLA 1NXQA 4TVOA 3V1UA 1UDCA 4GQAA 3IL2A 4A5OA 1KVUA 3W8FA 4M49A 2PTGA 4BNXA 3CINA 2HJSA 2YJZA 5ILOA 4I1IA 4R1NA 3ZNQA 1E6UA 1DIHA 4RCVA 2R6JA 4L8VA 4RQTA 4LMPA 2PKRA 3PQDA 1A9YA 4Y9DA 1ISIA 4EW6A 1IPEA 2GN4A 6ADHA 3RUCA 4ALKA 2P4QA 4B3JA 1YBAA 1ULSA 4MP3A 5H81A 2OBYA 3F9IA 3JQCA 2C2YA 3LT4A 4IJWA 4UVIA 3U5TA 4PGFA 2VRBA 3ZNNA 1CIVA 1RM5A 1OC4A 3ST7A 2YV2A 1GD1O 1D4FA 5CG2A 2Q4EA 4CL8A 2VRCD 4K6FA 2PKQO 2XXJA 3ADOA 1R66A 2ZJ0A 3HG7A 2C82A 3MJEA 3SXPA 4CLRA 3U4HA 2P9CA 3PYLA 1IZ9A 2GRAA 2PGDA 1RM3A 2EW8A 3MJ4A 2Q1WA 4PLZA 5JW6A 4OYRA 1EK5A 3S2GA 1H6BA 4NIMA 1EVZA 4NFYA 4LSWA 4Z0PA 3OIFA 3BAZA 3JQ9A 2YHUA 4DPLA 4Z3KA 5B12A 1NFQA 1A7AA 2X58A 4XYEA 1MLDA 3R6DA 2DTXA 1LDEA 2JD1A 2FN7A 4B8ZA 2RH8A 2FZEA 3JQGB 2OZPA 1GEEA 3CSDA 2HLPA 3I9KA 3MWEB 5G0SA 3ROMA 1E6WA 4URFA 5KKAA 5DCYA 3BMQB 4S3MA 4IZHA 5KVCA 1JDJA 1YQXA 3W6ZA 5EERA 1CRWG 3PPIA 4GLLA 1TA4A 1K2WA 4MP6A 3OJ0A 2V6BA 3FPLA 3V8BA 4YRAA 5BSGA 1DC3A 2BELA 3GPIA 3SLGA 4BNKA 3DZJA 2YDYA 1F14A 2I3GA 4U5QA 4PZCA 2Y68A 4D42A 5C7IO 3VVCA 4PRLA 4FC6A 3DBRA 4MKZA 1FDVA 2YFHA 4DC0A 3BZUA 4RPGA 1JA9A 2EP5A 3MEQA 1J0XO 5C37A 2VUSA 3NRCA 4W7HA 1AXEA 1EEHA 2O48X 5AOVA 1P45A 1SO8A 4J7UA 2NUAA 1C1XA 2TMDA 1I32A 5AXAA 5KJFA 4E2WA 3GVXA 3R3SA 1PS8A 4ND3A 4CV0A 1ZVMA 2Q2QA 3GVHA 3NJ4A 1P77A 1AGNA 2DPHA 2OFPA 3O8QA 4XGKA 2Y99A 5JDCC 1DAPA 4DLLA 2PNFA 2RHRA 4RVFA 1ZK2A 4MVJP 2C29D 2TMGA 4EITA 4XYMA 2F1KA 3QQPA 2WSBA 1C1DA 3TFQA 4PN3A 2HAEA 3EY4A 2YFQA 3GVCA 3W8EA 2IXBA 1HE3A 4Z6KA 4MIEA 4FQ8A 4CLRB 4JGBA 4TRRA 3DZGA 3KXDA 1CQJA 4KP7A 1BVUA 4I5FA 3FPCA 1VL6A 1T2CA 8LDHA 5H83A 3OMLA 3H3FA 3F1KA 4IQGA 4Q3DA 4PIVA 4AFNA 1Q0QA 4OIMA 2OOSA 2OUIA 3WBFA 4RGBA 1Q0LA 2HU2A 3COSA 1LC3A 4IQ8A 1QYWA 1PJQA 5GY7A 1B8UA 1O9BA 5CAEA 5TQVA 3EK2A 4KUEA 4EUFA 5A05A 1KEVA 2F00A 1JAYA 1EE2A 3LVFO 1ENOA 1P74A 1PIWA 5CPBA 1MUUA 3FF4A 1VL0A 3KSDO 3WSVA 1FDSA 3IS3A 4PCVA 2JKVA 3NDIA 4J1TA 6LDHA 3AY3A 4UVEA 1OMOA 4RO0A 3CKYA 3JQ6A 5F3RA 2Q2WA 3AOEA 1EUDA 3TOZA 3ZHYA 5EINA 1RWBA 4F6LA 4E5YA 1U3UA 5C5IA 4P22A 5I8WA 2NVWA 1JVBA 2RH4A 2EP7A 2O3JA 5IDWA 3QWFA 1PGOA 3FR7A 3RUEA 4KDEA 1Z73A 4DRYA 1ZJZA 1Y5RA 3TZCA 3DBRB 4YEDA 4WOKA 3OA0A 1P1RA 5JO9A 4DQUA 3I9NA 4M86A 5JSFA 4DYDA 1P1KA 4WCFC 4TSKA 3ZNPA 4WLEA 4DWVA 4LGVA 4YAEA 4AJIA 1E7MA 3AU9A 1C1XB 3CTMA 1KERA 2WD7A 4Q3NA 1U5CA 2CNBA 4QSMA 3D5QA 5ES3A 3D1LA 3JYQA 4CMKA 1VLLA 2HDHA 1LQTA 3OQ1A 4QX6A 4YTEA 2D0IA 3SJUA 3VH1A 3O8QB 3KBOA 4U8GA 3UOGA 1I2BA 5JPIA 1UXKA 2VN8A 1GUFA 2O3QA 2J5RA 2VZ0A 1V3VA 2PGJA 1C1DB 4GPD1 5KJ1A 2OORA 4IDCA 1EVJA 3DHEA 3LLVA 3V1TC 1NVGA 1YOVB 5FI5A 3PWSA 2NVBA 2OO5A 2E37A 1EFLA 1X1EA 1UXIA 4LVUA 2FMUA 3CE6A 3UFXA 4BNMA 1ADCA 5CEEA 3ZWMA 4P38A 3AWDA 1Y6JA 3ZWWA 4J4HA 5JYDA 3X2EA 4DBZA 3ULKA 1GYPA 3V5NA 2BMAA 1HE5A 2UVDA 4D3SA 4PLYA 5F1OA 1CF2O 3GDGA 4NBVA 5I8ZA 4MVJG 2A94A 2I5PO 2VCYA 5K6AC 4ZQHA 4CLDA 2O7SA 1R16A 2AQHA 2P4HX 3IUSA 3INGA 2AHRA 2Q2VA 2J5QA 3A1NA 5FF9A 5JAZA 2X9VA 2PLAA 1E6EA 3BMOA 2OP1A 2YW9A 3EW7A 1SC6A 4E32A 1MV8A 4BQPA 1DJNA 2AQ8A 4WLUA 4NI5A 3RFTA 2PZKA 2WM3A 4MVJM 3VPHA 4AJPA 4WNCA 2O4UX 3S55A 4QEDA 1MG5A 1C3VA 8ADHA 3E9MA 4FFNA 1YQGA 5CFZA 2NQ8A 4ZU3A 2YV3A 4RF5A 1QLJA 3GDOA 4EUEA 5JLAA 3QVTA 1BHSA 4JBGA 3EMKA 2GUGA 4DQXA 3LSYA 1J49A 3AUSA 3JD1A 4FCCA 3VHRA 2VUUA 3UH1A 3WJ7A 2CF5A 4BUCA 4ZN6A 1LEHA 4BHTA 1DEHA 1U4OA 4WE3A 4FGSA 3E9NA 3F4LA 4OJNA 3WLFA 3MJVA 4J9UE 1NFFA 2VHWA 3RI3A 5ER6A 1BXZA 1ZZEA 3UUWA 2B5WA 3F46A 4I9NA 1GR0A 2DVMA 1ISHA 3KUXA 3DBHA 4BKOA 1ZO8A 1ENYA 1KVSA 3RROA 1UAYA 3BHJA 5A4DA 2WD7B 2FOIA 1UXGA 3NTQA 3F4BA 3UCFA 1UP7A 3E48A 3L6EA 2X0RA 5ICMA 4MINA 2OHXA 2J3IA 5A06A 3OJFA 3QVOA 3GF4A 1VC2A 3DDNA 3AFMA 3GA0A 3GLQA 2BFPA 1X0VA 1UDBA 1FXSA 3DMYA 3GAFA 4WECA 3ZI0A 1H2BA 1H0KA 4YPOA 4GGPA 4B7UA 4NBWA 3UICA 1Z75A 1GY8A 2D1YA 3C8MA 1PSDA 2B69A 4I8XA 4FR5A 3VKVA 3AUAA 3K2EA 4P4LA 2GERA 5AYVA 5JNLA 4J7XA 3NTOA 3TZHA 5TNXA 3PZRA 3UW3A 1T4BA 2BD0A 3JQFC 4CQMA 2IRWA 5JDIA 1DB3A 1LSOA 1BDBA 3TZ6A 2PY6A 3F47A 3G1TA 3I83A 4TVBA 5AXBA 3WBBA 1U4SA 1S6YA 2HRBA 1M2WA 1CEQA 2B4QA 3W4JA 3H9GA 2YDXA 3H65A 5T67A 4D3DA 4II3A 3GZNA 2E82A 2ZKLA 4GX5A 4J1SA 2GASA 3FNEA 5TC4A 1LSSA 2PH3A 1NX6A 4Y67A 3GFGA 4D41A 3LT2A 4U0KA 1ID1A 1GV0A 4ID9A 4BO9A 5IZCA 3DL2A 3BHMA 3D7LA 3BMOB 1YH3A 3GC6A 2VZ9A 1B8VA 4NMHA 3U4CA 4ZRNA 2ZATA 4CMIA 5CEJA 3DMTA 3ITKA 2AQIA 2AG5A 4CM9D 3PDJA 4YJHA 4C7KA 2HK7A 1UP6A 3OQBA 3E5RA 1U1IA 3H9QA 2LDXA 5THQA 1IPFA 1OAAA 1E92A 4M8SA 2UV8A 3JYLA 3QWHA 2AG8A 3ONDA 2VHYA 1BGVA 4IUYA 4O6VA 3U9LA 4DGSA 1QG6A 2NM0A 3F3SA 2I9PA 4LCEA 2DAPA 1BWSA 3TRIA 1KC1A 1DC5A 1S7CA 4JBHA 3W4IA 4BV8A 5J9GA 3WGTA 1PL7A 3CH6A 3VOSA 3WICA 3Q9NA 2ZTLA 1UXJA 3WG9A 1GZ3A 1P31A 2VNSA 4NG5A 2VOEA 5DBIA 3SJ7A 2X0JA 1LA2A 1QLHA 4IJVA 1XEAA 2EGHA 3B6ZA 4BGIA 1YBMA 3GAZA 1IB6A 1J4AA 4OM8A 4IZIA 3K96A 3EGOA 4MVJF 3ORFA 3WMWA 4MVJD
chains in the Genus database with same CATH superfamily
2G1AA 2L17A 2ZK7A 1L4FA 3O1HB 1KIMA 3K53A 4O4LB 3COWA 3QE2A 4TLCA 2HO5A 2P9GA 5T6MA 4UBLA 4BTLA 1HMPA 2NU9A 2MMCA 3IMKA 3NX4A 4G67A 1UWVA 1I5RA 4PLHA 5ALZA 5HJEA 4OSPA 4HT3B 3ES9A 4FLEA 1PZFA 5B1YA 2H1IA 3NU1A 2PCLA 2C1XA 3FMVA 1JG6A 4NV0A 1WSBA 1NW7A 2OQIA 2AQKA 1PT5A 3SGLA 3SG0A 3MJHA 3GOHA 2Z2JA 3OQOA 5AM4A 4FKMA 5L3ZA 1KEZA 5IJ0A 4LXHA 5TY0A 5BNFA 1QYVA 2Q99A 4OLJA 4BNIA 1E2JA 3IAXA 3JV7A 4QYTA 3S81A 4N39A 2PXXA 5AI0A 1V2HE 1GNVA 2AV6A 4W5OA 1KOGA 4LJ7A 1CUJA 1FJHA 2FZKA 4LYAA 4XCQA 2VSYA 4MRNA 5A3VA 4PM4A 1DP4A 2Z6VA 4HKTA 4KACA 2OGUA 1HDGO 1PFVA 3KL2A 2XUZA 2X86A 4P5DA 3NCTA 4TYMA 3S2ZA 1G0NA 4HOYA 2NW6A 1EKXA 3BFPA 4LV5B 5SZJA 3ZHQA 5CA1A 5EP2A 5E7JA 3RTDA 1OIXA 4P3YA 4TMXA 3RABA 4EYGA 4F4FA 1T43A 3IT0A 4QATA 4RL6A 5IEJA 3RS5A 3LC0A 3GZNB 4NU0A 4JT8A 3PKJA 4ZAWA 4JMPA 1PZHA 4RWZA 1ORTA 1TGYA 1HFWA 1OC2A 1TRHA 2XITA 3DEKA 2B8EA 3GO4A 5JXIA 4IIUA 3H13A 4KQGA 4UUPA 3ZU3A 1P2VA 3RPEA 1YFKA 5H5JA 3WR5A 1RVDA 3DKVA 5KCZA 2QVGA 1LNQA 1YHNA 1HXHA 1N5OX 1SCNE 4CETA 5JPCA 1ZH8A 4Q1AA 4CMIB 3R5KA 1M1NB 3UUGA 2CC2A 3ZGZA 4HDOB 1A8SA 4UEKA 3NCHA 5D85A 4BEWA 5K0CA 1HYBA 1OIVA 5KYYB 4EI2A 3UHFA 4LMAA 4EG7A 4FSDA 1P7PA 2A9KA 3CKLA 4LCBA 5HQJA 5F1KA 3PVSA 1I14A 1DPGA 4B1FA 2FK7A 4EO7A 4RVOA 1ABFA 5JASA 5CP8A 3QF7A 1N0HA 1UBNA 3AI7A 4IQ0A 3PNBA 5E2BA 1UDAA 2IQIA 4FFRA 4ND1A 1P3Y1 1XZ8A 3R3YA 3WB1A 2CLIB 5AKJA 4FYJA 4GKKB 4ZEWA 2AMYA 1TF2A 3MZ0A 4EG3A 2ZJOA 2EAUA 1HLGA 4JLMA 1UBTS 3QBVA 4RA6A 3ZVLA 3K70C 3SICE 1DQYA 2VPPA 3KLMX 3LFHA 5CHEA 1QOQB 3AI3A 4D3DA 4G4JA 4CM1A 2G36A 3FCOA 2GA9A 2YY7A 3ZH9B 5KOJA 2MSDB 3O83A 1M2OB 4GYYA 4JI0B 3ZWPA 3ZVMA 3DB1A 1PZEA 1R4NA 3KZVA 1Q15A 1KO1A 1AA9A 1XZFA 2ZYAA 2QN6A 4Q3BA 2E5WA 4ZZ0A 4ICIA 1YA8A 2DKOA 4TS4A 2GUWA 1DAEA 3A37A 5C4GB 3OQ6A 1ZOPA 2CY0A 5DX1A 1E2EA 4ECEA 5JANA 4QUBA 2PXCA 5C52B 1OXVA 1SWVA 3NW9A 3NH9A 4MVJE 2XVMA 3LUKA 4ZJYA 3GPDG 1W87A 5IDYA 5CVCA 1EX9A 4FOSA 4O4HB 3X1DA 1O6ZA 5I3CA 1G8GA 5EKUA 4BE7B 2LUOA 2C92A 1OWPA 4JWKA 4XX0B 4ZDKA 3KQOA 1VRWA 2D0DA 4FC7A 4IIVA 4JL8A 3FDXA 5KVSA 4V0QA 2JFOA 3C5HA 2QRZA 4GECA 4B2YA 1TUIA 3AJDA 4DIKA 4Z2AA 4MPDA 2RHTA 1B76A 4O4JF 1XKTA 3BZBA 4FHZA 3D3WB 3D7SA 1TZCA 3DQPA 1J1ZA 1RCFA 3DPIA 3ITNA 3TVYA 5AIBA 4D0SA 2QPAA 4FFPA 4PLCA 3P0RA 4ZAGA 4U2EA 5HFAA 4RFSA 3RSQA 2RHCA 1SURA 3KJGA 1SZPA 3VDNB 1SR8A 2XHEA 4MVWA 2IEDA 3ERCA 1QKKA 4JP1A 1XAGA 4L4SA 4WJZA 1H2FA 1OLSA 5HF5A 2G08A 1Q1ZA 1D1SA 4WXHA 3G88A 4P0QB 2R7AA 1DRVA 4GX0A 1DAMA 2XUHA 4NICA 5EQTA 3ONWA 1KZ6A 4MS4A 3T61A 4XPZA 1UPFA 4F8YA 2A30A 2DPGA 4MV3A 5ECYA 4OI0A 3IUYA 3BMCB 2B9EA 4DCJA 1Y8RA 3A1SA 3GHHA 1BGXT 1X7XB 2EL9A 3HA7A 5ESWA 3ZHXA 2UYQA 4L73A 1IL0A 2Q5CA 4BNVA 4ESOA 3ZIDA 3B2QA 3U7HB 1AV6A 3QHAA 4C4OA 4V0LA 2EKQA 1JSRA 5E7IA 4X97A 3RGGA 3TOXA 2HHCA 3UGKA 3T1VA 2WW8A 3P9CA 4LCJA 3VO2A 3ESYA 1CR6A 1SFRA 3WJ1A 5ALNA 3J80A 1XDBA 1XHFA 1BE6A 3B52X 4GP6A 2G09A 1T2NA 5AW0A 1V16A 3V4LA 3G23A 3A1DA 3BRWD 3H97A 1XZJA 1AZLA 1QZ3A 1W2GA 1YR3A 1J2JA 3I2FA 3MWDA 3UM9A 2V7PA 2H4FA 4YAIA 4GVXA 2RHBA 4O02B 5KMGB 1LNZA 3FWZA 1GZ6A 3PHHA 4V0KA 4BMSA 4MICA 1RWQA 1XDZA 4KOAA 5JJLA 3EXFB 2UUOA 1UK6A 3MRXA 4M0EA 3RK4A 3PUVA 3PUIA 5K3FA 2WSIA 3NETA 5LQKA 3UH0A 5CTJA 4CL2A 1T0UA 4MDEA 2B35A 3K9FC 4DAOA 3HH8A 2AN3A 2GLUA 2ECQA 2J32A 4ADSG 4AG5A 4C0XA 4XWOA 5FWYA 2O07A 5TJ9A 1B6GA 4KQ9A 4NNJA 2CF6A 4INOA 4PIPA 3S29A 2X23A 1UJCA 3PV0A 5AOAA 3QEOA 3CJQA 4H7IA 4PSKA 3U1BA 2PGAA 2V3WA 2A92A 2OCLA 4UTRA 1KQFA 4BKRA 2UYHA 2FFJA 3NM4A 1MQAA 2W2MA 3EQZA 5ECGC 4RLFA 1PS9A 1K63A 2WG0A 3B3AA 3PP8A 3K5HA 1Z13A 2V7UA 2W2LA 4JOQA 4KTTE 4OGLA 1FTWA 1BJKA 2Q6TA 1CR1A 1GTVA 2ZT6A 4ARBA 4DY4A 4HNAB 3TLYA 4TYNA 4ZTUB 4I4IA 1GQRA 4L4XA 1LBEA 3LK6A 4S2EA 2P7HA 5GQSA 3ETDA 3ZBQA 4GZLA 4GOXA 3NPMA 5AW9A 1M6VB 2GZAA 3G7SA 4RVNA 1XFAA 4WCFA 3H05A 3EFOB 1WXEA 3FJOA 4PZ9A 5D3MA 5TJHA 3SF0A 1R0RE 2RARA 3C7KA 3SCZA 3TB6A 3M49A 5LDGA 1QE5A 2AMVA 4E4RA 4P8RA 5FUBA 3DEFA 1K92A 4FE3A 4WY2A 1BEUB 2CHFA 2HSEA 3OKAA 1CZLA 5B36A 5DZSA 3DT6A 1ONOA 2EQBA 2J9GA 3QG5A 3RJTA 2WV9A 4CMEC 4DNOA 1LDMA 2FMXA 5JPDA 4MJ7A 1ISJA 1M66A 3WGYA 1K5PA 3IB6A 1GQSA 1KDYA 3AY7A 1H69A 5NULA 4C4AA 3JQRA 1W8DA 5CG1A 4HEHA 3W5VA 1XIVA 3L79A 2GPWA 1A2KC 4UTNA 4B87A 4CE6A 5AKHA 4UBOA 4FMDF 1L7VC 1AS2A 4CU5A 4CIDA 3IOEA 3E3OA 4UUMA 3VA7A 3AG5A 4W5NA 1INLA 4JEIA 2ET6A 3EAFA 3QI7A 4MGKR 1HMYA 4BGUA 1EFAA 1G5TA 1DEAA 4PG5A 2WV7A 1S5PA 2AC2A 2RB4A 4EY3A 5MGBA 1NDQA 2IXEA 5IT0A 2A58A 4MW6A 2QJTA 2R1VB 4CI0B 1XP8A 2EX0A 2PX3A 1KY5A 1AK2A 1SVNA 1RYFA 2XMBA 2O3TA 4RH1A 3VVLA 3I23A 2PGOA 1NF3A 4ZGGA 1V7ZA 1AO3A 1YULA 2J6HA 4FZJA 5K0SA 2IYWA 3DD5A 3L9WA 1K6JA 2G88A 3FXAA 4B5LA 1PUJA 2RCYA 4ZPXA 5ABPA 4R1SA 3K0AB 1YV9A 5LQSA 4GMGA 1U7DA 2FLKA 4J2TA 3W05A 1D6JA 1YB1A 4MYHA 4HZUB 4MCIA 1JPUA 4R6XA 3UANA 5IF9A 2H2IA 5CYOA 5FA6A 4B79A 2H8GA 4R2HA 4Z8XA 5EJAA 1CUAA 1PR1A 5E9WA 3T54A 4KI0A 3KDAA 3LW7A 2HKIA 2J3EA 2ZSFA 3FPBA 4F38A 5LNK1 1XCBA 2WWVD 2BV3A 1H85A 5C7YA 1FP6A 1VKNA 5BWOA 2XNKA 5J5AA 4TRJA 4G5FA 2E4VA 5T41A 3CX3A 3ETNA 2WJPA 3N8NA 4GF5A 4H7JA 5LDDC 2NZXA 3OHSX 1VE3A 3MMXA 4Q1EA 4GRAA 1C2TA 2V3CC 3PE6A 4KRYA 3LX6A 1DS6A 2C5SA 3BXEA 3CCCA 3V4RA 3OCYA 3FSRA 5B2FA 1QHXA 1HLFA 2ZUVA 1T2EA 4K87A 5HKKD 2QP3A 1SHKA 4B0PA 2YIJA 3WYEA 1E94E 3VH2A 4G07A 1FLNA 2NT3A 4JEHA 3HADA 4UASA 1YFLA 2QA5A 1KU0A 1N6PA 2Q8PA 1E1MA 3CZ9A 3JD4A 4DOMA 2XKBA 1IBMB 1TQ6A 1C41A 5FOXA 4DSTA 1B14A 1ULUA 4HDSB 3WRYA 4ZO9A 3W5JA 5I7HA 3TF5A 3N0WA 1WPQA 2PEYA 4RK5A 4DA6A 3HR7A 4LYJA 5JQGB 1DE0A 1F12A 3IXLA 3OX1A 2A35A 2G6TA 2QTWB 5AHRA 2HIMA 4Q7QA 3BWBA 4YMTA 1Q74A 4FSHA 3AY0A 1DKMA 2ZVJA 1F0PA 1Q21A 4JYZA 3VU3A 4MHTA 3NTLA 1TQ8A 3MJCA 1F2VA 1N9GA 2HLDD 1P2DA 3VNAA 5I7SA 3CS3A 2XKJE 1GV1A 3C3XA 4J94A 4IG9A 1JYFA 2VH1A 3L01A 5EZYB 2OBNA 4ZV9A 1G16A 3EGVA 5A2GA 1NJ2A 1P61B 2PMBA 4AUNA 1NQ5A 1UPTA 5DNEA 3GJ5A 3GZ4A 2DHDA 2VJQA 4JJKA 1N6LA 1WBJB 3SQXA 3G8CA 3B60A 1H2YA 2QRVB 1QHYA 2GFHA 2XUQA 2ZRJA 2JZOA 2Q4BA 3P7MA 3WGOA 4I19A 1TKRA 2FGKA 4N6NA 5E6RB 3ZLJA 5CLGA 5LC1A 3V9AA 1KRHA 2I4LA 2N46A 4HWPA 2V1XA 4IWYA 5TQ0A 3WGMA 4ZIRA 5HIAA 5D5PA 1B74A 4LRTB 1ZMTA 4FDTA 1D3AA 2RHLA 4KAXA 2GEJA 2FOXA 1H2WA 2DFVA 2A86A 2I99A 4MR8B 2WIGA 1C7RA 2BAGA 2QMHA 4TUYF 2PZAA 3LCJA 1SU4A 4IICA 4XJXA 3WFZA 1EK2A 3G8BA 4P81A 1JJVA 4AKHA 3G2QA 4EIWA 3KQQA 1O95A 4KQWA 3HC7A 3JALB 1V4NA 2GKGA 1WZCA 3DP9A 3D54D 3VNSA 2DWQA 3STWA 1FFWA 1RJ9A 4LZWA 2NV6A 4QULA 3TIXB 3ZGYA 1KR2A 1UOQA 3I42A 4LJSA 4NXNB 3ROQA 1R5BA 3T52A 4WFKA 5KDDA 1JG1A 1O0SA 5DMXA 4BO1A 4C3ZA 4EJSA 4B6SA 1C81A 2CDCA 3M6WA 2Q2OA 4ZYTA 3HEMA 3T38A 1H2RS 4PINA 1QFZA 2C57A 4RGQA 4ZTZB 1RM0A 3HGMA 1G7TA 4WNYA 4X65B 1EHCA 3RC2A 1EFHA 2AFHB 3FYCA 3BWMA 5FWNA 3DZ5B 3Q9UA 4UOQA 1C4OA 3OEEA 1Z5PA 4RK1A 4ER5A 2YXNA 3CUWA 2ZSAA 3I5UA 3ANMA 2GLTA 5JXWA 5JG7A 4CQMD 3DOOA 1RVV1 4MEAA 4ZK2A 3KQKA 3OTQA 4WOPA 3HLYA 3FVQA 3O47A 5CCEA 4RESA 3RU9A 4YXWD 4YCLA 2W93A 3RODA 3BE6A 4AZVA 5DYIA 4F60A 4K9PA 2RAVA 3V8PA 5K0FA 3ON5A 1ZD9A 4PRYA 5CXXA 5K8JB 4X94A 2HU8A 2R96A 4UDNA 4YROA 2J87A 3EH1A 4KYVA 4QIHA 4K5QA 5G4KA 3R7FA 2PL3A 4MB2A 3OJOA 2GO7A 2VATA 2QPLA 5IC4A 3DGFC 2L2QA 3ZHSA 4BLOA 1SHLA 5G0UA 1NMXA 4GGOA 3QV2A 1WJGA 1T6XA 3BJMA 4IIFA 3I2IA 3F90A 2NU8B 3N8GA 2PYZA 2GN0A 4UM9D 1MO4A 3DTNA 1JF8A 2BHTA 1Z6YA 3I0ZA 3N86A 5CUQA 5AT1A 2G9NA 5B5SA 1XNGA 2H54A 4TT8A 1ZNWA 3ZI7A 1HFKA 1RMYA 3CEHA 3SXJA 1P2GA 2X8JA 4B3MB 4E6PA 2BMVA 2GARA 5CFPA 1YD7A 1GFZA 3IESA 2P75A 4YJKA 2ZI5A 4DNPA 4B73A 1A5AB 1Q3KA 2YIDA 4DYVA 2WAXA 1P3JA 2YVQA 4L95C 5ALUA 3R3WA 2RK3A 3ROTA 1AGXA 1JMVA 1EUQA 1MVLA 4BP9A 4ER0A 3ORRA 1ZVKA 4ZQGA 4YONB 1JWBB 3S2EA 4KFCA 2NZJA 2ZITA 4ARUA 2WYWA 2ZSIA 3QUCA 4ALMA 2LKCA 4AN4A 4BB0A 1PFKA 1HRDA 4M1MA 2CL6X 2OV8A 3HNOA 3P52A 5IN5A 4CN9A 5TMBA 3TKYA 3O0DA 3TFOA 2HRQA 4OJQA 1B15A 1UZMA 2HB6A 3UW1A 2EATA 2WDPA 1GL6A 3CSUA 2AKYA 2BFCB 3SU8A 4E09A 3KSAC 1P3DA 2XWJI 3CSSA 3ZZNA 1A50B 2DLCX 2OSBA 3LG2A 2BSXA 1Z18A 4RD0A 4QREA 1HSOA 5J1SB 4QU9A 1FSSA 3PE3A 4YDSA 3OQIA 5L8VA 3F5QA 4DV2B 4ISCA 4HEQA 4Z9XA 3HN6A 5ALXA 3Q2KA 1ZH0A 2I7VA 3M1IA 1TQDA 1EM8B 5AMXA 1EUYA 1Y1LA 3JQBA 3R0JA 5FPTA 1J2EA 3EYAA 3OZGA 4CT5A 2BMWA 2NXJA 2X5OA 4FBGA 1E4VA 2SCUB 3Q8XB 5INTA 4IIGA 2LIVA 1PR3A 2MSCB 3AF2A 2NX2A 1NSTA 4E4YA 1NC3A 3ED5A 2XX3A 1S3FA 4U2FA 3MQ2A 4YY3B 1LVUA 2JA2A 4NBSA 1QTIA 3L5OA 3JASB 1C7IA 1IBCA 1TMOA 5IC6A 4ZT3A 5AK4A 2DBRA 2PV0A 3P71T 4XX1A 3TJRA 5CB0A 5KBYA 2AI2A 2JFFA 4XJVA 5L95A 4I9HA 4MV7A 1TIBA 2RG1A 1ENPA 2CV0A 1X9GA 2RIRA 3FB4A 2Q6VA 3GXOA 4FGUA 5FDFA 1P5RA 2IYFA 2CXHA 1H05A 3FIUA 2BGIA 2R6HA 1X6VA 3CCFA 4E51A 5J23A 2B7LA 3PHLA 4HB3A 5E9JA 2EARA 4EPVA 4P80A 2QL7A 4ZO7A 4PLWA 2OWEA 2ZETA 4EYEA 1MNQA 1WXWA 3F6EX 3HZRA 3ODGA 3UWOA 5J4LA 4HLNA 2CK3D 4X41A 1FDUA 1NVKA 2UYOA 4W9NA 4TUYA 4XLZA 3GRVA 8ATCA 1ISFA 3DE1X 1M1YB 1E2LA 3U62A 3JZFA 4YJDA 4QAJA 4ARSA 1PDVA 3U44A 2GVNA 3QRWA 2DSNA 3I2HA 3CO0S 3M5CA 4EKNB 2C3UA 3NR2A 2EWWA 1BQ4A 2JLZA 5DIFA 1YJCA 3IUJA 5ERYA 4MZDA 4MULA 4P3XA 1J7KA 2GHIA 1IC6A 1YMVA 3VYWA 4NFHA 4NU8X 1TPYA 5FBLB 1WX1A 1LK7A 2BKUA 3BM5A 3CNEA 4GX1A 4U7FA 2JGIA 1NRJB 1RE0A 2YMLA 2DRIA 4D4MA 4P92A 2QLLA 4K9DA 2FQXA 2O6LA 3IXQA 1LDGA 1NVMB 4PYNA 3V2IA 1SC9A 1AE1A 3DYVA 4Q19A 5DISB 4DV5B 3H2HA 2DFKB 3HU1A 1GQ2A 4U7PB 3KAKA 1SVIA 1ZMBA 3VXKA 4FDUA 3QE9Y 3DULA 4DLBA 3UJ3X 4WZAB 2CFIA 1QNLA 1MOPA 3KV1A 3PWZA 5JQWA 3RYHB 3ZK9A 1BDMA 4GKAA 3NONA 1Q57A 3WFJA 4US0R 3STHA 4L6AA 1WLYA 1Z3IX 4O2BB 4LJAA 2BW0A 2OA0A 1DIGA 3H5AA 4FR0A 3BOSA 4PCUA 1CEEA 3K9WA 3SK0A 1FS4A 1ZH6A 4A0SA 3SR4A 1FP4B 4X62B 1KI9A 4LJ8A 5BV2P 2X13A 2VRWA 2Y1KA 1YVUA 1QP7A 4E11A 2BGWA 1MABB 1WOMA 3ETEA 3ZWXA 5AKXA 2G67A 1HNXB 4DDUA 4IJUA 4TRMA 2ZAMA 1XSEA 3WO1A 2FYTA 1EXMA 3AR4A 2FF5A 2F64A 3KR0A 4J4TA 1E8MA 3M4YA 1MR3F 1QHHB 2BISA 1K7FB 1BHQ1 1WHSB 1UAGA 3KAPA 2IP2A 5J4HA 3TZQA 3ELDA 2QM0A 5DNAA 4D79A 3VNBA 3O2SB 3PD1A 3WBJA 4P0PB 4FZ3A 1KS9A 2L19A 2WJ6A 4IBOA 4DTCA 1CY8A 4Y1EA 5TT0A 4G5QA 4D80A 2OD9A 2ATXA 4UPVA 3L7DA 1IM2A 3B2NA 2D2FA 1HTTA 3T7JA 5I7EA 1IDN1 1NR1A 2PGXA 3FPEA 3RS9A 2G5CA 2R8PA 2HBRA 4MQFA 1F60A 2OC9A 3OOHA 3DOIA 1B8NA 1XI2A 3EIOA 4DLUA 1KDPA 3QLJA 5DM0A 2GK3A 1K7XB 1QWOA 1CJCA 4FMCB 4HYQA 4JFRA 1I10A 2CZCA 1WQ4A 2E2WA 2GJKA 2Y2VA 4OB6A 2M6RA 4UEQA 4WBXC 2FE1A 4Z4HA 1CVLA 3BJIC 3L7NA 4XSHA 3TEFA 1LPSA 3WQQA 4BO6A 3ZTWA 1G7CA 3B2EA 2GAOA 5A4IS 3AM1A 3JY6A 1ML4A 2VAXA 1D2HA 4TXMA 5JJ5A 4UCFA 1ND5A 3CRRA 3GN1A 4CFSA 3BWXA 4RVUA 2ZDGA 3JVDA 4N3CA 3NB0A 4CM5A 1EBUA 1M0TA 2GF0A 2GHTA 1S0UA 2ZRBA 3UC9A 4CM4A 5KQRA 2W42A 3ZVKA 4B7CA 2VK4A 3NRJA 1IQPA 1GLGA 2ATIA 3M6LA 3OZBA 3QU5A 1U0GA 2R25B 3UVEA 4NBRA 4YWJA 2GZ1A 2C1ZA 1RNLA 2VZLA 4BGVA 1WZIA 3DAGA 1VCNA 4CM8B 1C30B 2VJDA 3CJRA 1PR4A 1TM5E 2PRYA 1CQIB 1TTPB 2J5BA 3I05A 2VZ8A 4JUFA 1XBTA 4XJTA 5IUNC 4A26A 1U63A 3CX6A 3QPDA 3LHSA 4OOFA 2MSWA 4MROA 3KJIA 3LOPA 1VP9A 1ZYUA 1THMA 1SIOA 2I62A 4J0QA 1MBZA 1VMIA 2OVFA 2CJFA 4NULA 3I34X 4JR0A 4ENSA 2YMQA 4BLSA 4MV5A 4KJXA 4EFMA 1U2QA 3PFFA 2P4UA 3OSUA 4OQZA 4UXJA 3RSGA 4AY5A 3D4PA 1VYUA 4IKPA 2B8WA 3N6VA 4ABYA 3PTZA 1RYNA 8ABPA 3K70B 3EGDA 3C5EA 2R65A 5E95A 3GA7A 2XR1A 4FVTA 1XVLA 1Z7BA 3NUZA 4ZOEA 5F73A 3E18A 2E5FA 2BM9A 2HJGA 1L3CA 4WOBA 4ZODA 3KD3A 3L5KA 2O3UA 3ZCQA 1HE4A 1O2DA 3TLMA 2RE8A 4IGFA 2AYXA 4MQLA 4UTVA 4MUYA 1V8BA 1PDOA 1BGWA 3NO4A 4OY3A 4RH3A 4CDMA 1EQUA 1Z7GA 1Z6TA 5G0TA 5LYYA 2RFLA 3GGPA 2AZDA 5FUYA 2B34A 3UKJA 2QTGA 1URPA 5BOSB 1RTKA 5GJWC 1RJWA 4TMFA 2QUIA 5JCXA 4DM7A 5CFQA 1DEXA 1IRIA 2LGJA 3R76A 3QVGB 2ZIGA 2VT3A 3LIPA 5A5VA 1CFZA 4ETNA 1U2EA 1RADA 3AR6A 4Q66C 2BCEA 1JAZA 1L5FA 4DZRA 1MX1A 4Q7EA 3I45A 1JUDA 4F06A 5BWMA 4ROSA 4LGMA 3LQFA 4NV3A 4AZSA 1PBNA 2JLYA 1TE2A 3AFHA 3DONA 3S8MA 1QPBA 3GR6A 4RTMA 3M2PA 5C4IA 3MWGA 2W2LD 3PG5A 4NCHA 2Y2UA 1X13A 3RS7A 3GVPA 3QOYA 4R2KA 2PSDA 3N5CA 3CURA 4OHMA 4BO0A 4CGZA 2V9ZA 1Y1RA 4OK3A 2X5KO 1MDBA 2MWMA 2P1ZA 3JWPA 4DEXA 2E9SA 2DUJA 2ZWOA 1Y1QA 3SZUA 3C6QA 1DIRA 3RBVA 3SC6A 1MEOA 2ODWA 2ZB8A 2OBXA 2Z2IA 3N87A 4WVFA 4U1RA 5CD1A 4KDRA 3H2YA 5EP1A 1M5UA 3MHTA 1VJTA 4JWTA 2C8KA 3K94A 4MRRA 1RE1A 1ADYA 1H8EA 3EC1A 1JJIA 5JBQA 3EPHA 4B46A 2OXTA 3A1VA 1TEHA 2BJVA 2DFTA 4KN9S 4O1IA 3H5LA 4G8JA 4K8OA 4KFUA 4ALNA 3C6MA 2I2FA 4M1ZA 4CN8A 4RTKA 2A67A 3A9TA 1OW3B 1L1RA 1NOJA 1T8WA 2ACVA 4JQCA 3L0YA 2M1ZA 1YO6A 3B51X 2CNWD 2H2AA 5LZ9A 2I2CA 1F06A 1R5OA 2XTAA 4UAUA 4WPGA 5JMPA 5BN4A 2P9YA 4R3NA 4TMYA 2Y1XA 2ZJ5A 3QLUC 1SAYA 1L5GB 4NVRA 4BX2A 1YONA 2NVUA 3PFKA 1NXWA 3DKRA 1B2RA 5IEBA 2H2DA 2IIBA 2YWXA 2V45A 5JYAA 5KCMA 4F4UA 1FTYA 4AMGA 3HABA 4HDMA 2ZYDA 4MKHA 4TQGA 3U7EB 4LZJA 3GJSA 3A10A 2XNDA 2AE1A 2B21A 1UFKA 2V6GA 4Q4HB 3B85A 2BMFA 2GI4A 2YNMC 1XOIA 1X19A 3KCQA 3KV3O 4OP1A 5DTMA 4ZARA 5ARDA 4UU8A 3R9WA 2XZTA 2ERYA 1W47A 3F7TA 4Y9SA 3A3OA 4PZUA 4RZSA 1A9OA 5T64A 4DBLE 2XT0A 3VDQA 4RKFA 1GZ4A 4FYMA 3PGXA 1ZUIA 4A27A 5LXTB 4QQ8A 4KC0A 4BZWA 3WY9A 2B30A 4FBLA 3NHRA 4Q4LA 1ONBA 4CKEB 2HIGA 4GWKA 1VIVA 1OFHA 5DULA 4UPDA 4Q4JA 2A0WA 4QXMA 3C8UA 2IDJA 1HEUA 1AB5A 4WZBA 3VPSA 1FW8A 1U28C 4HPXB 2FSGA 4X1IB 4B17A 4BFTA 1U2TA 2WF8A 4B4OA 2CFRA 4HGQA 3VPAA 4IL5A 4KGVA 4IHJA 3EP7B 4AWBA 1C9KA 1C0IA 1MG0A 3N8HA 4PPNA 1AM4D 4X71A 1N5JA 3GB9A 5H3HA 1LDBA 2I4OA 1MO6A 3DC7A 2XXAB 2QX4A 4KO2S 1FX1A 3RB8A 4MJ3A 3ZCTA 2AFRA 4Z9YA 5D8DA 1WZEA 1BWQA 4IXWA 5CPFA 1D1TA 4QQKA 5E2AA 3I9OA 5HS6A 3IJEB 2B1QA 2PSFA 2K7FA 3NOOA 3DZHA 1UBUS 4DREA 4EGJA 1Z34A 4K28A 2QMUA 3EDMA 1N36B 1T3SA 2D5BA 5FNVB 3E15A 3IP8A 4IGIA 1KO5A 4IDHA 2C78A 4WKNA 3BD6A 2DHQA 2GZRA 1JEAA 2XVYA 3WTCA 1U5BA 1UPUA 1XU9A 4CMGA 1YS9A 5A03A 2R0QC 4WHMA 1Z4JA 1S3IA 5AKGA 3SOPA 4HPWA 3HUUA 1OGIA 1ZUNB 4ID3A 5JSUA 3HS3A 3ZGOA 3OIDA 2HTFA 2Q07A 5HP4A 2H59A 1FFXA 3WSTA 3VHLB 2NO7A 3F71A 3GJ6A 5L3SB 1E1NA 1FSGA 3CF6R 3N53A 4MR9A 3F4KA 2Z1MA 1TM4E 3DXZA 4A2CA 2NU7A 3STXA 3UNXA 1HOXA 4Z4CA 3T7EA 1I01A 3DZ3B 1RDFA 3A6HA 2J5KA 3LM8A 4UQPA 1FXUA 4DDTA 1C1YA 4M60A 2XJ4A 1IM5A 1GXSB 1JP7A 2P7IA 5C7OO 2RAPA 4OKSA 4D0RA 5FPKA 3PC3A 2PUDA 2XB6A 1XHEA 4QL3A 1Z33A 3A1EA 3H86A 3W9UA 3UJBA 1YZUA 1EA5A 3M2TA 1XP5A 2A9JA 3UJNA 3IBYA 4DMKA 1GUZA 2O0LA 3T9FA 5BNTA 4URUR 3M89A 2RCNA 2NN3C 3GGGA 1I1NA 4DVJA 1OUMA 4ESEA 5T5QA 5HG0A 4BNNA 5KU7A 1RMQA 2QQFA 1DKUA 3HCFA 5K6RA 3ROKA 3IRUA 3MXTA 5GZ6A 5LDHA 2EVWX 1TJYA 1VBNA 3LC2O 2X6QA 3NC0C 4NENA 3EWIA 1WULS 3VMMA 5HQ3B 1RQPA 1Y34E 4A0RA 1SXJA 1BS2A 1Y4AE 2IIVA 1A7JA 2RGEA 1OI7A 2CNKA 1U7ZA 2ZYRA 4D92A 3OEED 4CUZA 4DMMA 2JIZA 3U9SA 1D2MA 5A0TA 3UKOA 1Y6GA 1GCGA 3D6AA 4G5SA 1PJBA 3KQUA 4OU5A 3DFKA 1Y9JA 2SECE 3D6TB 4EKYA 3E9ZA 1GG8A 1SKYB 2VDUE 2ZIFA 3BH0A 3KQYA 2G70A 4YC7A 3DAYA 1U6KA 4BECA 2ZBRA 3E5MA 3QYPA 2AZ4A 1GL9B 1YE8A 3LRPA 4NJMB 4QE3A 4CZ2A 1VSQA 1DIOB 3SDZA 4EB6A 4KIUA 1IVSA 2P9BA 4OHVA 1YA4A 2GN9A 3I01M 3TX2A 4N0MA 1PW5A 1WCIB 4LZNA 4A03A 3MB5A 3GDFA 1E58A 1CYEA 3I0MA 1G9TA 2YVAA 1IPHA 4KMSA 1Z29A 1E1CB 2BFOA 2WJJA 4D8XA 4DVGA 2YV1A 5IVDA 3TL2A 3U3OA 2NVOA 2OQ2A 5T8KC 4CODB 1K6EA 2HBQA 5AJHA 4F72A 3QKWA 1BS9A 3I9JA 3OT1B 2OXFA 1VE9A 3C2QA 1YL5A 2LIPA 4OL0A 5A7FA 3AVPA 4PQYA 3EODA 4BUJA 2WJGA 2VHVA 4KXLA 4DRZA 1TIPA 3FN4A 3K20A 2DYKA 2XOXA 4GPIB 3DE2X 1CG6A 1Z5ZA 2J9XB 3H9UA 4QU5A 1YR7A 4NE9A 4QWWA 4PO3X 5A5FA 3AM3A 1Y3HA 2UZ0A 4JOCA 3ZHRA 3N58A 2QW8A 4UCXA 1JEQA 1MEEA 2IL1A 3K71B 1DQZA 2Y1FA 3WNQA 1G8SA 1FVXA 3X1YA 1OOEA 5EQDA 4X1KB 4ENUA 4Q21A 3T9BA 2ZU6A 3D2BA 3FYUC 3L0DA 4FYWA 2HSDA 1XKQA 4X7MA 3NNNA 3SBDA 2RK4A 1N5KA 2R84A 3L7MA 3F73A 3OM8A 3OX4A 3S4YA 3Q3CA 4FHFA 4YPFA 3IELA 3SLKA 4AMBA 4BEVA 3OFNA 3R0QA 2VH2A 3LLMA 4TROA 2JLUA 5CHYA 5GONF 3R3HA 4G9BA 3NHKA 4GOKA 1AHIA 5AVZA 1AMNA 4KLCA 4WWHA 4WH0A 5U4XA 4DUPA 4I8IA 3L0CA 2EYUA 2JEZA 1E5QA 1SBYA 1JKJA 1SMKA 2HC9A 2HUPA 4YRNA 2Q5IA 3SX0A 3WL7A 3M82A 2Q49A 3KWJA 3RUIA 5FFFA 4WLVA 2IZ1A 3UQZA 3FZNA 3V48A 4CV1A 3NNDA 2XYHA 1YJ8A 2Z5VA 2WMNB 2YWRA 2OFFA 1RAGA 3BXHA 2F1IA 2JAXA 3TTTA 5K09A 1YHZA 2W6ZA 1I33A 1ACLA 2CHQA 2A5GA 1G6KA 2XYGA 3BJEA 3FNGA 1UC9A 3MOSA 4MJXA 4NMXB 2GNAA 5FL3A 1WDMA 2P3SA 1I1QB 2PUBA 2Q4TA 4UEWA 2W2VA 3V7NA 1FFDA 4D25A 5EQJB 3PL1A 2M6SA 4C7VA 1UZAA 2GXAA 3ZE7A 3FM9A 1Y37A 2YN2A 3GPCA 4U9HS 2V7GA 3HA3A 3ASZA 5AICA 5CXQA 5EHNA 4IMIB 1CQZA 5ALEA 4U7WA 2ZTSA 4KB5A 5EIHA 3T94A 4HV4A 1K89A 3IKLA 3MYRA 3NI2A 1WW3A 2OHGA 2C77A 5HF9A 1I3MA 4GMXA 3TJMA 3EG9B 3L7JA 4DBLC 1AKRA 2AKAB 1UCFA 1X1TA 1Y3BE 3DXXA 1FU7A 3W5IA 3PICA 2J08A 3L7YA 5AVVA 5TX7A 4C14A 3Q5EA 2XYQA 4QWMA 2C5BA 2YCLA 3SYMA 1OT5A 3UAGA 3AEUB 1EDOA 3GBSA 3JWHA 1M5TA 3PXDA 1OI3A 5GJVC 1Y7LA 2QP4A 4NYMR 5DX0A 3OZ7A 4OQXA 4PN7A 1QP8A 2XWPA 5DOZA 4IF6A 4E2FA 2Y0PA 2ECKA 4RX1A 2EJVA 3WIEA 1DI0A 2Z8ZA 4I5GA 1AC5A 1JDTA 5D5QA 2O52A 4LV6A 1JAXA 4IXTA 5JMWA 2ZPUA 4BWVA 5CB6A 2Q22A 4GM1A 3DL7A 4Z1OA 5JCJA 1QGAA 4UUQA 2VHJA 2O54A 2ONCA 5A5DA 1CY2A 2FVYA 3WKBA 4BFSA 3IIEA 1BJRE 3AR7A 2YVLA 1RP7A 3T7RA 1IZZA 2GD2A 1DKQA 5F5XA 3WNBA 3HBNA 3UTDA 3LF1A 2I6GA 5B4UA 3ZV3A 1KQOA 3L92A 4M4SA 4C0AC 3M70A 4AULA 2F1RA 1LBHA 4OB7A 3K16A 2QUHA 1C50A 1NXVA 1FUIA 4EPWA 1Y7IA 1BVRA 4D9MA 1YBVA 3P2OA 5IBCA 2O0JA 1NLUA 4C20A 5FOTA 1N2ZA 3JQ9C 3G5MA 4M7RA 1ZX1A 2WTMA 2ZYGA 3AR5A 4RKRA 3STUA 4ZO4A 4QSHA 1Z22A 4HGOA 3T15A 3VISA 1N57A 4BFZA 3FYSA 1SCUB 2E18A 3PGVA 4X7PA 1SM4A 1VKZA 3CBGA 3QFHA 3TVDA 3VZQA 3WYBA 4KYIB 2ZQZA 3AUTA 4K9QA 1FLAA 3E23A 1XRRA 4Z9AA 3MTEA 3SIPA 4ZJZA 2GM5A 3IFSA 3LBFA 1LSJA 3RKRA 4ZQEA 5FHRA 3AUYA 4FGKA 1E32A 1JLKA 1Z2AA 2HNKA 3P9SA 2AXEA 4OUDB 3FOZA 1K8ZB 2P3OA 4O1MA 4B3FX 3K0HA 2ECFA 1WTCA 3IDZA 5TC4A 4M7WA 2ZUDA 4ZJPA 3WHPA 5CLJA 4GYWA 2FUG1 3LGSA 4UDXX 1NVBA 4EY6A 3E8XA 3S1AB 3IBFA 5E1MA 3QVXA 1LTHR 3HDTA 1TNDA 3P4UA 4FW8A 3GEPA 3MAJA 3PLRA 3TLJA 4BB5A 4E4TA 4KR2A 5G4LA 5GONA 4MLPA 1ECFA 3THYB 1ODTC 1PLJA 1KZHA 4NZYA 4EARA 1NVWQ 2W6IA 2ZRDA 2GAJA 3CEPB 3NH6A 1BKSB 1ZUHA 1VHWA 3E7WA 1SVSA 4R84A 3D1VA 4XVQA 1Q12A 2P35A 4IMPA 5K3AA 3AT1A 3EGWA 2HU7A 1EH5A 2ZUEA 2ODTX 1DTWB 3SS9X 3GOQA 1XZEA 4KYTA 4HWOA 3HO6A 1T3LA 4AKEA 1RYYA 2ZU0C 3GRYA 2A9VA 1AUOA 1HPLA 3JWIA 4FGZA 4OHXA 5HMMA 5SV2A 3M0EA 4LJKA 3SJCA 4E6EA 4CEHB 5HIKA 1XMSA 1L7NA 1EJ6A 1RW4A 1OHHD 3KS9A 4J0DA 4RZUA 4KH1A 4M0PA 3UJ8A 4OK6A 4AY3A 3EDCA 4AJKA 4BIMA 3WLPA 2QT1A 4C4PA 1VFPA 5KAPA 1E2BA 4PWZA 3EXIA 4QBKA 2PT9A 1ZN8A 3TN7A 3WP1B 3EULA 1KFKB 4F1JA 3S8YA 1JDPA 1RMTA 3TQQA 3O2NA 5EJEA 4GPBA 3CB2A 3OQMA 4RF4A 1D1PA 1MA3A 3P97A 2Y0EA 4QPDA 3V8VA 2R751 1W76A 3KPWA 1GU1A 1K8YB 5DHPA 3ZDAA 1TI7A 5CVEA 1ZNXA 2WE7A 2PZBA 2P90A 4QGFA 3ENZA 2FU5C 1A96A 2P2YA 4IUCS 3UWPA 4ZYLA 1Z12A 3AC0A 3FTQA 1NQAO 2ZSDA 3ANLA 3NGLA 3NC4A 4HC4A 3EWAA 3AHCA 2FOLA 4QT0A 9ABPA 1W5FA 3QJ5A 2EW2A 1PGNA 3PXGA 3J81A 4WNAA 1KF0A 2F48A 4X24A 2ZRGA 1G3RA 4MVJH 2REOA 3W78A 2VK2A 3GPLA 1RYMA 5CJJA 1BEZA 1RKBA 1DKNA 3BXXA 1TD9A 4X00A 5TPZA 4R3WA 4CMCA 4JMLA 4ZEXA 3WQHA 1C29B 3MYYA 3S5UA 3QEBZ 4XOUA 1JPJA 1K4YA 3M9XA 4S35A 5B58C 1KYQA 2I0FA 3CRW1 3NDBB 3WGQA 4OH1A 3DR5A 4LF8B 1R4ZA 2V6FA 1M8FA 1TECE 2OCBA 4C5AA 4K6GA 3FMIA 2J9FA 1JHAA 1GYRA 1LCIA 1ZOSA 4ZCRA 4FFMA 1GAJA 3O95A 1YKGA 3PUZA 5SYMA 3PA8A 3TR5A 3ICOA 5L53A 4BMDA 1BMTA 2FPLA 1DBVO 1CEXA 2FZ5A 3R7SA 3COYA 3V7FA 2E48A 3IPYA 5JSZB 3AVOA 2RGNA 3DZ4B 4WOJA 3SSOA 5LUAA 3H2SA 3B36A 1MJNA 4B33A 1FXWF 4YDRA 4JUDX 3DVAA 2GEUA 4LZAA 1CFJA 2DPLA 2BLNA 3NBXX 4PZEA 4DMLA 3V7YA 4EFKA 4AK1A 1QF7A 1Z4MA 3JQ8A 4GSLA 4IY1A 2FPGB 4ZOLB 1SBQA 3BWCA 5BMVF 2F1HA 3A06A 1O95C