1C4PA

Beta domain of streptokinase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
137
structure length
137
Chain Sequence
b'KPIQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKTHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYEINKKSGLNEEINNTDLISEKYYVLKKGEKPYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (STREPTOKINASE)
publication title Crystal structure of streptokinase beta-domain.
pubmed doi rcsb
source organism Streptococcus dysgalactiae subsp. equisimilis
molecule tags Blood clotting
total genus 31
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c4pA00
1BMLC 1QQRA 1C4PA 1L4DB 1L4ZB
chains in the Genus database with same CATH superfamily
1VRAB 1K53A 2MHJA 1VJKA 3AB5A 4N6EB 5H92C 3HUIA 2PW9A 1QOBA 1G6JA 2KT7A 3PO0A 1OTRB 2E6XA 1UBQA 3E9SA 4NY0A 3HK0A 3V6CB 2BYVE 4PK1A 4II2B 4GXBA 4NAWA 3Q8AA 2ZZPB 5IA7A 2PEAA 3RZFA 4FHJA 2RGFA 1YQ3B 1F1HA 3U4EG 2QILA 1ZPSA 2JVCA 3KW5B 1GOZA 5D6JB 2SEBD 4EE2A 3VXWA 1UWMA 3OG5A 1V8CA 4N58A 2ZEQA 3S2AA 3VH3B 3HM3A 1ISNA 3V61A 2UWQA 3H9DA 3I57A 1UF0A 2WDRB 2WXFA 4NJ7A 2D10A 3PZDA 5IAAC 2KYWA 4J3OD 4PT5A 4FULA 3TEZA 3AE4B 1ZDVA 2ZVOA 2WXOA 1YQBA 2BS4B 4ZRQA 2K6QA 3LB8C 4BZAA 4W9KA 4CO7A 1M4VA 2JF5A 3PGEA 3BVGA 2RPQA 4EZKA 1WYWB 2AL6A 2VH2A 3R3MA 5E6OA 4A6QA 3N1XC 1NYRA 2M4NA 1ESFA 2PE6B 2K3UA 3RNCC 1WGHA 2WDQB 1XLPA 3PREA 2JXXA 3B1LX 1HTQA 4F8CB 2JPHA 4HPLB 3V60A 2UU7A 2JQRB 4LLGM 3A9JB 1IBXB 5G2NA 1V80A 2ZJDA 2FIFA 2BGFA 2FAZA 4B0MA 4S17A 2KWVB 1KH0A 1J7CA 5CTRC 2JYTA 2G4DB 1PYWD 3ZGZA 1HZ6A 2NTSA 4MM3A 1STEA 4BFRA 2NMQA 3VTWA 2MEKA 1UBIA 2LHDA 3GB1A 1IUEA 2J0MA 5BO4B 4MGYE 5E6PA 1XLNA 2HTME 2O6VA 1KJTA 3MTNB 2PKOA 1KLUD 3RZWC 1JWBD 4RH6A 5AEKB 4TQ1A 5DPSA 3RFZB 2L1AA 2KFKB 1J19A 1Z2MA 1ET9A 2AEHA 3U7ZA 3Q8FA 1YN4A 2D3CA 1MG8A 2PPHA 1K8RB 3NZUA 3VUYA 3ML9A 4KZCA 2V4IB 3UINB 1WXVA 3A4RA 3ZNID 1ROEA 3R2TA 3A9KB 1WY8A 2WXPA 4HJKA 4W9LA 3M62B 4NAWB 4MGZE 3ZO5B 1RYJA 3U8ZA 3ZNGC 1P1AA 2PIAA 1D5ZC 5C23A 2EELA 1TT5B 3EFCA 2ZVNA 1WJ4A 1WFYA 1E8WA 1FRDA 5BYRA 2RDBC 2K5PA 3RNFC 4K7UA 2W3RA 1NYQA 2K1FA 2LD9A 3RD2A 2VRRB 2KJHB 2JWUA 2WXLA 1K51A 2G1EA 4II3B 5JH5C 2EMTA 3RULA 3PS6A 2KTRA 4RF1A 3RNBC 1SB3C 1QOGA 1JMLA 3EHVA 2A4ZA 2FIDA 4ZRKA 4A3PA 3VFKA 3AXCA 1JWAD 2KWUB 1GJZA 2JWZA 1IGCA 1Y8RC 4FJVB 1UZXB 4C56C 3QJZA 1FM0D 5AUKA 4AQ7A 1QILA 4GLSC 1E6EB 1A70A 5JHAA 1DOIA 3ZXRA 1FO4A 4TKNA 4ACFA 2AL3A 4WJOA 2QJLA 2LMCA 2N0SB 3FAHA 1GC6A 4IUMB 4IWOA 2LJIA 5FR6A 1YQ4B 2WXIA 4IOIE 3QK0A 3CF6E 1MI0A 4OHJA 4YXDB 4L23A 2JRHA 1L0VB 1I4HA 3KQ4A 4ANWA 5D3DA 2IO0B 4KIKA 3DVNV 1R4NI 4W9EA 3ZIMA 4MGIE 2KX0A 2C7NB 2SAKA 2RD0A 2KD0A 4NJ6A 5EE3A 3AH7A 4I6PA 2KHWB 3VTUA 2W82A 3OWEB 2MA9B 2V1YA 1MPEA 4M01A 3T3OA 1TY2A 1KLVA 1I42A 3AE5B 4HPPA 2M8SA 1WZ3A 1FPYA 2KZRA 5CHVC 1FNWA 1L0YB 3UF8A 1TZOA 2N1VA 5HI1A 3BVZA 1HEZE 2V3SA 3KUCB 3W9CB 2KLGA 3B2FA 5DPRA 2GB1A 3EA6A 3GOEA 1YJIA 2MH7A 1DOXA 1VZ7A 1SXTA 3P2BA 3QARA 4GOCA 2WP9B 4D2KA 2V4LA 1GB1A 1FIQA 3HRDD 3H7PB 3PT2B 3DDCB 4P1CC 1P3QU 2H88B 3EECA 1WF9A 2WXMA 2KMAA 2D5GA 3DHIC 1C9FA 3M95A 1Y56A 4NPNA 4RGNA 2N9XA 3PLVA 1LXDA 1XCTL 4OW0A 4CQNA 3IBEA 3N30A 4EFOA 1J0GA 2MP2A 2DLBA 3U7DA 2KWCA 3PPAA 2BKRB 1VCBA 5IP4D 2MBBB 3AULA 1R4MB 3DBLI 1P98A 4DBGA 1JROA 4TUUA 4E74A 2NCNA 1F77A 4RGOS 2AYOB 2N9EB 1DYQA 4US8A 4OZBA 5E6NA 4GB9A 3CWIA 3M63B 3AEGB 1XEEA 2CHXA 3NUHB 1R4NB 2OJRA 1XF5L 1KTKA 4RCOA 2LRWA 1N5XA 2OJWA 1NENB 1YJ1A 2NS5A 1VZ6A 3ZVVA 5H8YE 5IO9A 4LJPB 1I4PA 2Z0DB 4RGMA 1XQQA 4QAYA 3Q3FA 5JXVA 1N61A 2BYEA 3FKYA 1GNUA 3AI5A 2Z0EB 4YT0B 4KIKB 1L4DB 1D4BA 4HEA1 2KXJA 1SE4A 4WQOB 1QQRA 1AW7A 3B2GA 1WGGA 1V81A 1V5TA 1ZXHA 3Q3MC 4ICVA 4XC2A 1HE8A 4DXAB 4OVVA 1B1ZA 2FBWB 3RMKC 1PDXA 1N60A 2E3TA 1SJHD 4NAMA 4RNAA 3MC8A 2K39A 4ANVA 1WRDB 1ZXIA 4YTNB 5J18A 1LGRA 4JL9A 2D11A 4JIOU 4LNFA 1ACCA 1Q1OA 1V1OA 1WGKA 2GMIC 2CKHB 4AJYB 5AZGA 1E7PB 1HZ5A 3IT6B 3UQAA 1KF6B 5I4DA 5LXIB 4BOZB 3AU5A 4P7IA 4XWTA 4ZHOA 3ZDMC 2G9HD 2WHIA 3WALA 4E71A 2BKFA 3A9JA 1GC7A 1IBXA 2PVGC 1WH3A 1JWUD 1HTOA 3IHPC 1GUAB 1NVID 1E5WA 3BINA 1QOFA 4MT5A 3GS2A 3N1ZC 1TS5A 1RRBA 1EU4A 2W3SA 2IO3B 3NHEB 1EWCA 1SE9A 1RLFA 3P4RB 2CHWA 4A3OA 2Y3AA 3VRAB 4YWGG 2R2OA 3C8YA 4G11A 5TR5A 2J52A 1WGRA 3ZDTA 1IYFA 2KFKA 3B0AA 4ITKA 2OOBB 2RPVA 1N6ZA 4FBJB 1TKYA 4KKJA 3HVZA 2L0TA 3R66C 4XX5A 3ALBA 4K81A 2JZ3B 1NBFC 3BYYB 1GAQB 4N59A 5D7GA 3Q8BA 1TBEA 4KX6B 1TGZB 4JLCA 2KDBA 4HJGE 3N3KB 1FMAD 1RAXA 4WURA 2PLPA 2X38A 2JXTA 3UI3A 4ASWC 4HWIB 3HVDA 4KGTA 3A9KA 3DCGA 3AEAB 3JYUA 3NVYA 4WWOA 1JWSD 2ZCBA 4WIPA 1A5RA 1J8CA 4DXGA 2KLCA 5FKAC 1DOYA 1YMHE 4M0WA 4K1RB 4PS8A 4W9DA 1P0RA 2RSUA 4MSQB 4C7ZA 4IDIA 2Y5BB 1I4QA 2G4SA 2O2VB 1H8CA 3DHGC 4W9IA 2WX0A 5CHWA 1NI2A 1QLBB 2BB5A 4LK0M 4B95A 1P7EA 4M00A 1FCLA 4B9KA 4DDID 3VQIA 2QCZA 2L8JA 3UQBA 2KTFA 3L4PA 2ZW0A 2FCNA 4RF0A 4R3DA 4TQ0A 2HDEA 4C4VA 2I1KA 2WLBA 4S0RA 2NBUA 3KYCD 4AUQC 3R7RA 3BVMA 1WMHB 4G0NB 4ANXA 4ARIA 5HFYA 1S3SG 2LEKA 4MACA 3H6NA 2KJRA 4KDLB 3SEBA 3VH4B 1RM6C 2BWES 3PRZA 1TKEA 3CIRB 4DK5A 4DHJB 3N9YC 2DAJA 3ZTCA 2MWSB 4NQLB 2MBQA 4FXCA 3NS8A 4I6NB 3PLUA 4XGAB 2LZ6A 3ZKJC 2MRPA 1TIFA 2YVCA 1FXIA 5L95C 1I35A 4JX1C 3GE8C 2WXGA 1LO5D 2L52A 2N9PC 1WXMA 4CYEA 2NPTA 2G45B 1YNTE 3AMZA 2C5LC 2KKCA 3R8BA 4HK2A 2KK8A 2LGXA 1J7BA 3QHTA 1NEKB 3GP7A 4RM8A 4BKTA 3LYYA 2N9KA 3MC9A 2JYEA 2D3AA 3IAM1 4M8NA 3AEDB 2IJ0A 2B76B 4PYUA 4EZLA 2FCSA 2KX3A 3DHHC 3RUIB 2PJHA 2K9XA 3TEXA 3VR9B 2HJ8A 1AWDA 2WXQA 4HKZE 3NOBA 2KACA 4GU2A 1EWYC 2XBBC 4EOYA 3I5JC 1WGYA 3BIID 3BK1A 3X23A 4DHZB 2CHZA 1SE3A 3ZW3A 4I6LB 4WJPA 2KDEB 3H8HA 2DYOA 4MEMA 3KWVA 2N7EA 1ZP0B 1L2NA 5BMIA 2MBOA 2AQ2B 2REXA 2EKEC 4A8XC 1E10A 1C76A 2JX5A 3TBLD 4FN2A 3TEWA 1E8XA 3WAMA 1WJNA 3H7PA 4M0WB 1D3ZA 4BKGA 3A4SC 3IXSA 1ZE3D 4HCPB 3ZNHB 4AS1A 3P4QB 4PS7A 2GLSA 3DOWA 2KQ7A 3L13A 3N20C 4DHJD 4JE3B 4DQOC 1VZ8A 1VD2A 4KZ0A 4ARCA 2L0FA 2GBRA 2L00B 1SF0A 4W9HA 1UNSA 4C7YA 1E90A 1QF6A 3DBRI 3X0WA 2KMCA 2V3PA 1PUTA 1S1QB 3DQVA 2KQ4X 1WR1A 5EDSA 1EF5A 4DXFA 3I63C 3SFEB 1H4RA 4C4VB 3APDA 3Q3JA 3KLSX 1WXQA 2FNJB 2DHZA 2XN9C 3HM6X 2BTEA 4K3BA 1XLOA 4ANUA 4F1SA 2HD5B 4YTMB 5G5GA 2AQ3B 5C1ZA 1U4AA 4EEWA 4YSZB 5IOIA 1R4MI 2LHEA 4ZRJA 2PE9A 2CJOA 2CR5A 4M8MA 1T6BX 3P4SB 5DPWA 2I2YA 2DWQA 2MJDA 3W1SA 4XE0A 2NPTB 2IPKD 3ZJVA 2XEWA 2N7JA 4A20A 3BY4B 3EUB2 2IY0B 2DAFA 2TSSA 2LXAA 3K9OB 5IKCM 1EF1A 2XK5A 2BB6A 1TS4A 4RMAA 1WWTA 4WAAA 2CJNA 2BS3B 1WJUA 2NBWB 1UH6A 2Y5CA 1TYGB 4B6WA 3AE9B 2IZVB 1T3QA 1CMXB 5LXHA 3Q2AC 3AEEB 3UGBB 3U30A 3DVGY 3ABVB 3P1MA 1GG3A 3AE6B 3BK2A 4GN1A 3IVFA 3KUZA 4BBNC 3AN1A 2YLMA 2KMMA 3RT3B 3PV1A 1TS3A 1VLBA 2JZPA 4AP4C 4NQKE 4IG7B 4A9AA 1FNUA 2MQJA 1WI0A 3RN9C 1ZGUB 4IW0A 5C3JB 3ECIA 1E0ZA 3O65B 3B08A 3HIZA 3DBRB 2BYTA 1FFUA 3V05A 2WXNA 4YSXB 1L5PA 2QDFA 1L0XB 3WIMA 4XWWA 1GPXA 4DDGD 4BKSD 3O13A 1QKZA 4ZOHC 4YTPB 3AEBB 1LM8B 3PVLA 1NDDA 4DHZE 5BYQA 1UD7A 5E6JA 3QWZB 2I1JA 3ONSA 3SD5A 4KGRA 2ZCCA 1LQBA 3DVNU 1ET6A 3OJ4B 1HXYD 4YSYB 3L17A 3ZQ4A 1F2RC 4HKQA 1F52A 2K6DB 1BUIC 1ZUD2 2KNBA 2C60A 4LNKA 5J17A 1PGAA 3VTVA 1GB4A 1PQSA 1QZEA 2FUHB 3NG0A 5EE0A 2B3AA 3AE1B 1IP9A 1YD8U 4HVBA 4LCDE 4W9JA 5CX3A 1IPGA 3RNEC 1VR9A 2JT4B 3AE8B 3RNAC 3DBHI 5HG2A 2CS4A 3MJ5A 2EKIA 4GDKB 2OEDA 1WIAA 4L2YA 4LTUA 3UIOB 3JSVA 2LFIA 2LVOA 3A33B 2YEPB 4RM9A 3UIPB 3SR6A 2I38A 3ZJTA 4DWFA 4LNNA 4P1BC 2X8XX 4ZRIA 2ZW1A 3Q3NC 1FFVA 1YX6B 2XK5B 2J7QB 2O2VA 4URKA 4N9F4 3H7SA 2JY6A 3Q6BA 2L83A 4GSWA 3VVWB 2LWPA 2MSED 3OAWA 1DGJA 3GZNI 4AJWA 1C78A 5T8IA 1KLGD 4NJCA 3M3JA 4W9CA 3CSTA 2KN4A 1JW9D 1V97A 4GDLB 1V2YA 1E8ZA 2L05A 1YN5A 2L32A 2MLBA 1WMHA 2BBCA 3A1QB 3U52E 2LVPA 2WGSA 4C00A 1N5WA 2KC1A 4IKGA 3R2IA 4LNIA 2ZNVB 2LJ5A 2WU5B 4MH0E 4P16A 3FILB 5FK9C 2KJ6A 1WZ0A 4NZLB 2WDVB 2JRIB 1SBBB 1WX7A 1RFKA 3LJ3A 3VR8B 3CSFA 2KC2A 2LXCA 1MG4A 3QCAA 4XYCA 1JWMD 1WM2A 4UDUC 1K50A 2IYDB 1UWXA 1J7AA 2ASQA 2Y5PA 1V1PA 3ZTDA 4W9FA 3RI7C 2WWZA 2GBNA 1R7SA 2VZKB 2WX1A 2CU3A 3SFDB 2HE7A 2D3BA 3E56A 5FR3A 2GI9A 1E9MA 2K0PA 2MJ3A 3DBHB 2KQSA 3URYA 1I4XA 3WAPA 2NVUI 2RDHA 4MGKE 4WWNA 3BYTB 5D2MB 2ONQA 3GE3C 3N32A 3LDZE 4GMVA 3RNGC 2BS2B 2GOWA 3H1UA 2DBYA 2INDC 2C7MB 1F9JA 4FHKA 4IM3A 2LUEA 3KUDB 3IG3A 1MHHE 3DWMA 4OZAA 2CU1A 3WANA 4KGSA 2Z59B 2LUMA 3MHZA 2C7HA 2RDGA 3RCZA 1XXGA 4J6IA 2M17A 2YEPF 3WA0A 1E7UA 1YJJA 1N63A 2ACZB 4OZCA 3AE3B 1Q5WB 2WDTB 3GZNB 2IBIB 4KKIA 3TUOA 1BXTA 3JSVB 1TJEA 2WQYB 4WWMA 2M1MA 2DZIA 1MJDA 2PVOD 1UUPA 4RFBA 4MELA 3JW0X 4MSMB 3AE2B 1OQYA 1JALA 4EKUA 4OVUA 5G55A 3TL5A 3QIJA 4JWSC 3EC8A 1Q10A 3IT4B 2J0KA 1OFFA 1YN3A 2V3NA 3V3XA 4FLHA 2LGIA 1T0RC 5G5HA 3I9V1 3VUXA 3ZRCA 1T5XD 5LLIA 2K25A 4M02A 4KV2A 2BW2A 4CHKA 1D5XC 1OEYA 1I4GA 3BWUD 4FJZA 1V6EA 4AWJA 1WM3A 2R61A 2K8HA 3Q8EA 5BMGA 4BKSA 1C4PA 5GXGB 1WRIA 1XT9B 3NZ3A 3EFUA 2VZKD 3NVWA 5J2RA 2JU6X 4XZ4A 4WJNA 3BZDB 4A90A 2IGGA 1E7VA 2PTLA 1NI3A 2J42A 1AARA 3OLMD 2Z8LA 2WNMA 1JQ4A 2WU2B 3QC8B 3PHXB 4TMAB 2KFJA 4WJQA 2UYZB 1Q0WB 4O1NA 3AM9A 1Z5SB 4K3CA 2JZZA 2LGYA 5DPTA 3TIXA 2DZJA 1YOVB 3L08A 3FC4A 4OVZA 4LNOA 2DYBA 2N1WA 3EGRA 1C3TA 2K8CA 4IM2A 1V1PB 2DZMA 3Q69A 4RGTA 3VUWA 1L6UA 2KANA 1FCCC 4IWPA 4GGQA 1ENFA 2GRIA 3APCA 2JUOA 3J9CA 1SIFA 2WS3B 3PHWB 2LRUA 1WX9A 2XNAC 2BQQA 4JPSA 2QIEB 2BWFA 3SU8X 4GIVA 1L6VA 3PSEB 1X1MA 3QX1A 5EE1A 2N4FA 3KWLA 1SSNA 2LVQA 5D3IB 5DCNA 4TV3A 3QAQA 4MJSB 2D2QA 2AX5A 2V9HA 2NBVB 2EMSA 4WQMA 5AZFA 5EE9A 1BMLC 4LDTB 3JVZX 3C0RB 3TSSA 1SJED 3ZUNA 3QA8A 4MDKE 2WYQA 2QSDA 2WXJA 2DZKA 2PMVA 2IGDA 1T0QC 1FNVA 5L83A 4KSLC 2D07B 3ZLZA 2BPSA 1HA5A 2QHOA 2M0XA 3VRBB 3K9PB 3NY5A 2GBKA 1FRRA 1EO6A 1XO3A 4JGHB 2MBHA 2NTTA 3W1YA 4EUTA 3PZ8A 1QOAA 2ICIA 1F2RI 3WAOA 2IO2B 3KVFB 3WCQA 4FJYA 4MH8A 1WJ6A 2INNE 3T8MA 2FCMA 2DNFA 4K7WA 1ZKHA 3ZYYX 4FADA 4HDOA 3VDZA 2L76A 2MJEA 2W55A 3QQ8B 4ZYSA 5BYSA 2R2QA 2DYMA 3N1YC 4TSSA 3APFA 4F7ZA 1ZDXA 1FD6A 3DWGC 1SE2A 4GDKA 2QMTA 4B0EA 3IFWB 1WXSA 4G50A 2IO1B 1WE7A 1LFDA 1FXTB 2IGHA 3MJWA 1RFAA 4WAFA 4US9A 2IY1B 4YL8A 3NVZA 4ZHPA 2WXHA 2BYFA 3KYDD 1QT9A 2LASA 4WH4A 1MHXA 3MP9A 4A55A 3P4PB 2LGDA 2INPE 3LXFA 3DPDA 4REZA 4EZJA 2QC8A 2ON8A 1WX8A 1XD3B 3B9JA 4LDTD 4MM3B 1B9RA 4W9GA 3NRZA 2KDIA 3DBSA 2RR9A 2DENB 2NR2A 2INCC 4GDLA 2N7DA 2O6VB 3ZNZB 3ML8A 2BT6A 3TJPA 4JQWC 3DVGX 3A1QA 4HROA 1CQVA 4FA6A 3PZ7A 1P9DU 2A5UA 1MVKA 1UGJA 1FXAA 2M0AA 2W54A 1PFDA 3TMPB 2M56B 2W9NA 3L54A 1WXAA 1UELA 2N9LA 3FILA 2AQ1B 3ETRA 2KVZA 4JWUC 2K22A 2ZPYA 4HPMB 4AOFA 4L1BA 3L16A 3NVVA 4G3XB 1JCKB 1T0SC 2MCNB 3T3NA 3D32A 2DX5B 1WYGA 2QEJC 4KVGB 3ZJUA 1FEHA 3ENEA 3AU4A 5HKHA 3Q8CA 4C80A 4ZDVA 2K8BA 1YX5B 1N62A 1C79A 5AZHA 3VAWA 1PGXA 1V86A 3AEFB 1V49A 3L10B 3L0WB 4IC7B 2KAJA 4H2AA 3W5UB 1E8YA 2KDFB 3TCAA 1WGDA 1SGHA 1HQRD 3P63A 2KTRB 3R7QA 2M19A 2WXRA 1T0YA 2H89B 3PTFC 3KH0A 1ZW7A 1ZOYB 1V9JA 3PRMB 2MX2A 5KHOA 1WSPA 1C4CA 5AUIA 4E3CA 1KRHA 1PGBA 4Q2JA 1CZPA 5HHDG 1AYFA 4HDQA 5CHFA 2BVCA 4BBNF 5D94A 1WR6E 3PRPB 3Q14C 1TKGA 1XCQL 1TZ1A 5GMVA 2LI5A 3TEYA 2FE8A 1C1YB 1JRUA 2O6VD 4HLEA 5LNK1 2G3QB 3MC0B 1OGWA 3W2DA 2KDMA 1SEBD 3AECB 5IN7A 2GBMA 3V6EB 1F0ZA 2J4XA 3CMMB 1TS2A 1TY0A 1SIJA 3C19A 1M94A 1BT0A 2FUG1 2C9WB 3OJ3A 1EM7A 3SHQA 4BAXA 3RPFC 5KHQA 2D3GA 1CK1A 1L4ZB 4IM0A 1AN8A 3VHTC 1KFYB 2HJ1A 2FCQA 4WWPA 1C77A 2HTHA 3P42A 3MHSD 3AV8A 2LGSA 2KO3A 3ZXVA 2Q5WD 2J0JA 3T9LA 4XDDA 2AWTA 1K52A 1UGMA 3HHMA 2GBJA 1EUVB 5MPOA 2L3ZA 1RWSA 3W1SC 3IAS1 2L7RA 3NZSA 2KOXA 1I4RA 4HCNB 1EU3A 2J53A 2KN5A 1C4AA 4ZYNA 5C2TB 5JZEB 2ZPNA 5JHBA 5BMHA 2KWDA 2BF8B 2OHFA 4K7SA 1L7YA 1TTNA 1OQQA 4XDCA 3NJTA 1JRPA 4ZRPA 1P7FA 2RMMA 1IGDA 2JSVX 4ICUA 3DBLB 4USAA 3W5VB 1KM7A 1OQRA 1CJEA 2IDYA 1WE6A 2WXKA 5TSSA 3SDLC 4X57B 3RYTA 4PYZA 1VDVA 4BVUC 1XLQA 3AE7B 3MFGA 1V5OA 1OEYJ 2V0GA 1KOTA 4HXDA 2MP2B 4HRSA 3ZRFA 4BOSC 2ZNVC 3I3TB 4PS3A 2VH1A 2MBEA 1D6EC 4KSKC 2MW5A 4LJOB 4KDIC 1MFWA 4MJSA 3NS1A 3U2SC 1D5MC 2KVRA 1YIWA 3V62A 4NNJB 1I7HA 4IWQA 4P6VF 3Q3OC
chains in the Genus database with same CATH topology
1NENB 1VRAB 1K53A 1VJKA 3AB5A 1WWTA 4N6EB 1VZ6A 5H8YE 5H92C 3HUIA 1L6VA 2BS3B 2CJNA 2PW9A 1I4PA 1QOBA 4RGMA 3PO0A 5EE1A 3KWLA 1SSNA 2E6XA 3E9SA 5D3IB 2Y5CA 5JXVA 1N61A 1TYGB 3AE9B 1T3QA 2AX5A 3AEEB 3Q8AA 3ABVB 4WQMA 4YT0B 3P1MA 1L4DB 3AE6B 3BK2A 1D4BA 4HEA1 5EE9A 1SE4A 3AN1A 1BMLC 1QQRA 1YQ3B 2KMMA 1AW7A 3B2GA 3U4EG 2QILA 1ZPSA 1ZXHA 1GOZA 1SJED 1TS3A 3TSSA 1VLBA 2JZPA 2QSDA 1B1ZA 2WXJA 2SEBD 4EE2A 2FBWB 2PMVA 2IGDA 4A9AA 1PDXA 1FNUA 1N60A 2E3TA 1SJHD 1UWMA 1FNVA 1V8CA 4NAMA 4N58A 4RNAA 5C3JB 1E0ZA 1HA5A 1ZXIA 4YTNB 2BYTA 1FFUA 3VRBB 3V05A 2WXNA 4YSXB 1FRRA 1L5PA 1ACCA 3I57A 1L0XB 1V1OA 1WGKA 1XO3A 4XWWA 1N5XA 1GPXA 2WDRB 2WXFA 1E7PB 1HZ5A 3IT6B 3O13A 1QKZA 4ZOHC 2NTTA 1KF6B 5I4DA 4J3OD 4PT5A 3TEZA 3PZ8A 1QOAA 2ICIA 1F2RI 3AE4B 1ZDVA 4YTPB 3AEBB 2WXOA 4ZRQA 2BS4B 3LB8C 3WCQA 5BYQA 4MH8A 4XWTA 4ZHOA 1M4VA 2G9HD 2INNE 3BVGA 5E6JA 3ZYYX 1IBXA 2PVGC 4KGRA 2MJEA 2W55A 4A6QA 4ZYSA 1JWUD 5BYSA 1NYRA 1NVID 1ET6A 1ESFA 2K3UA 1HXYD 2WDQB 1XLPA 4YSYB 3ZQ4A 1F2RC 4HKQA 1QOFA 4MT5A 2DYMA 3GS2A 4TSSA 1BUIC 1TS5A 1ZUD2 1EU4A 1PGAA 2W3SA 1ZDXA 1FD6A 2JQRB 1EWCA 3DWGC 1SE2A 4LLGM 1GB4A 2QMTA 4B0EA 1IBXB 3P4RB 5EE0A 3AE1B 4B0MA 2Y3AA 3VRAB 4YWGG 2IGHA 3C8YA 1KH0A 2J52A 1J7CA 4WAFA 4US9A 2JYTA 3NVZA 4ZHPA 4ITKA 1VR9A 1PYWD 2RPVA 3ZGZA 2WXHA 1HZ6A 2NTSA 1TKYA 3AE8B 1STEA 1QT9A 4KKJA 3HVZA 2NMQA 2MEKA 4WH4A 1MHXA 3MP9A 2LHDA 5HG2A 3GB1A 3MJ5A 4A55A 1IUEA 2EKIA 4GDKB 3BYYB 1GAQB 2OEDA 4L2YA 4N59A 3P4PB 1XLNA 2HTME 3Q8BA 4LTUA 5D7GA 2INPE 4KX6B 2PKOA 1KLUD 3LXFA 2LFIA 4HJGE 1JWBD 4RH6A 1FMAD 4TQ1A 2YEPB 3RFZB 4WURA 2L1AA 2PLPA 4REZA 2X38A 2JXTA 3UI3A 2ON8A 3B9JA 3HVDA 4KGTA 3SR6A 2I38A 1ET9A 3ZJTA 4MM3B 3U7ZA 3Q8FA 1B9RA 2ZW1A 1YN4A 3NRZA 3AEAB 3NVYA 1FFVA 1JWSD 4WIPA 4DXGA 2L83A 5FKAC 1DOYA 1YMHE 2BT6A 2V4IB 4M0WA 4HROA 1CQVA 1DGJA 1ROEA 3R2TA 1C78A 5T8IA 3PZ7A 2WXPA 4NAWB 1KLGD 4NJCA 4C7ZA 1MVKA 1RYJA 1FXAA 1UGJA 2M0AA 4IDIA 2W54A 1I4QA 2KN4A 1JW9D 1PFDA 1V97A 2PIAA 1D5ZC 4GDLB 2M56B 1YN5A 2EELA 2L32A 2N9LA 3FILA 2AQ1B 3ETRA 4JWUC 2K22A 2BBCA 4LK0M 1QLBB 2BB5A 4L1BA 3U52E 1P7EA 3NVVA 1JCKB 1FRDA 5BYRA 3T3NA 1FCLA 2K5PA 3VQIA 2W3RA 1NYQA 1WYGA 2QEJC 1N5WA 3ZJUA 3L4PA 1FEHA 4IKGA 2JWUA 3R2IA 2WXLA 1K51A 2G1EA 2ZW0A 4TQ0A 4RF0A 4R3DA 2HDEA 3Q8CA 2WLBA 2WU5B 4C80A 4P16A 3FILB 4RF1A 5FK9C 1SB3C 1QOGA 3BVMA 4NZLB 1JMLA 2WDVB 1N62A 1SBBB 1C79A 4ARIA 5HFYA 2LEKA 1RFKA 4MACA 1PGXA 3VR8B 3AEFB 3SEBA 1RM6C 1TKEA 3CIRB 3N9YC 1JWMD 2KAJA 4H2AA 3W5UB 1JWAD 4UDUC 1K50A 4FXCA 1UWXA 1HQRD 1IGCA 3P63A 1J7AA 4C56C 2Y5PA 1V1PA 1FM0D 5AUKA 1FXIA 2M19A 4AQ7A 1R7SA 2VZKB 2WXRA 2CU3A 1QILA 3SFDB 2H89B 3E56A 4GLSC 5FR3A 1E6EB 2GI9A 1E9MA 2K0PA 1ZOYB 4JX1C 2MJ3A 3URYA 1A70A 1DOIA 1WSPA 1C4CA 5AUIA 1I4XA 1FO4A 2WXGA 1KRHA 2RDHA 1LO5D 2L52A 1PGBA 3BYTB 2ONQA 4Q2JA 1CZPA 2BS2B 5HHDG 1YNTE 3AMZA 3R8BA 2DBYA 1AYFA 2QJLA 2LMCA 1J7BA 2N0SB 3FAHA 1TKGA 1XCQL 1NEKB 3GP7A 2LJIA 1MHHE 3LYYA 1YQ4B 3DWMA 2N9KA 2WXIA 4OZAA 3TEYA 4IOIE 2JYEA 2FE8A 3IAM1 4KGSA 3AEDB 2IJ0A 2B76B 2LUMA 1MI0A 3MHZA 2RDGA 5LNK1 4OHJA 1XXGA 3MC0B 4YXDB 4L23A 2YEPF 1L0VB 1I4HA 3KQ4A 2K9XA 3TEXA 3W2DA 2KDMA 1SEBD 3AECB 3VR9B 1YJJA 1N63A 2ACZB 4OZCA 5D3DA 1AWDA 3AE3B 1F0ZA 2J4XA 2WXQA 4HKZE 4KKIA 3TUOA 1TS2A 2SAKA 2KACA 1EWYC 1BXTA 1TY0A 1TJEA 2WQYB 4WWMA 3BIID 3BK1A 5EE3A 1SIJA 1SE3A 3AH7A 2PVOD 1UUPA 4RFBA 2FUG1 3H8HA 2DYOA 1EM7A 2W82A 3KWVA 3OWEB 3RPFC 1ZP0B 5BMIA 3AE2B 2AQ2B 1CK1A 1L4ZB 1AN8A 1JALA 4A8XC 1KFYB 1E10A 1C76A 1MPEA 2JX5A 1TY2A 3T3OA 4JWSC 3AE5B 1Q10A 1C77A 3IT4B 3TEWA 1OFFA 3P42A 3AV8A 1YN3A 2V3NA 3IXSA 1FNWA 1L0YB 3V3XA 1TZOA 1ZE3D 2LGIA 2Q5WD 5G5HA 3I9V1 5HI1A 4AS1A 3BVZA 1HEZE 3P4QB 3W9CB 1T5XD 3B2FA 2GB1A 4XDDA 2BW2A 3EA6A 1YJIA 2MH7A 1D5XC 1DOXA 1VZ7A 1I4GA 3BWUD 1SXTA 4JE3B 4DQOC 1K52A 1VZ8A 2WP9B 5MPOA 2R61A 4ARCA 4D2KA 1RWSA 3Q8EA 5BMGA 1GB1A 1SF0A 1FIQA 1C4PA 1UNSA 3HRDD 3IAS1 5GXGB 4C7YA 1WRIA 1I4RA 1QF6A 2H88B 3NZ3A 1EU3A 2J53A 2V3PA 2VZKD 3NVWA 1C4AA 5C2TB 1PUTA 2WXMA 2D5GA 2JU6X 2KQ4X 1C9FA 5BMHA 2KWDA 3BZDB 1Y56A 4A90A 2IGGA 4RGNA 2OHFA 4DXFA 3SFEB 2PTLA 1NI3A 1OQQA 4XDCA 1JRPA 1XCTL 2J42A 4OW0A 3KLSX 4ZRPA 1P7FA 1WXQA 4CQNA 2Z8LA 2RMMA 1IGDA 2JSVX 2XN9C 2WNMA 1JQ4A 2WU2B 4USAA 2DLBA 4TMAB 3W5VB 1OQRA 2BTEA 1CJEA 4O1NA 3AM9A 1XLOA 2IDYA 4YTMB 2WXKA 2AQ3B 5G5GA 5TSSA 3FC4A 4OVZA 1JROA 4YSZB 3EGRA 1V1PB 1VDVA 3Q69A 4RGTA 2LHEA 1XLQA 1F77A 3AE7B 1L6UA 3MFGA 4RGOS 1FCCC 2V0GA 1DYQA 4US8A 2CJOA 4HRSA 4OZBA 1T6BX 1ENFA 2GRIA 3P4SB 1D6EC 2I2YA 2DWQA 3CWIA 2MJDA 3J9CA 3AEGB 1XEEA 2WS3B 3W1SA 4XE0A 3NUHB 2IPKD 3ZJVA 3NS1A 3U2SC 1D5MC 2N7JA 2XNAC 3EUB2 2TSSA 1XF5L 1KTKA 1I7HA 4RCOA 4JPSA 4P6VF 2QIEB 1TS4A 2BB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BML C;  1QQR A;  1C4P A;  1L4D B;  1L4Z B; 
#chains in the Genus database with same CATH topology
 1VRA B;  1K53 A;  2MHJ A;  1VJK A;  3AB5 A;  4N6E B;  5H92 C;  3HUI A;  2PW9 A;  1QOB A;  1G6J A;  2KT7 A;  3PO0 A;  1OTR B;  2E6X A;  1UBQ A;  3E9S A;  4NY0 A;  3HK0 A;  3V6C B;  2BYV E;  4PK1 A;  4II2 B;  4GXB A;  4NAW A;  3Q8A A;  2ZZP B;  5IA7 A;  2PEA A;  3RZF A;  4FHJ A;  2RGF A;  1YQ3 B;  1F1H A;  3U4E G;  2QIL A;  1ZPS A;  2JVC A;  3KW5 B;  1GOZ A;  5D6J B;  2SEB D;  4EE2 A;  3VXW A;  1UWM A;  3OG5 A;  1V8C A;  4N58 A;  2ZEQ A;  3S2A A;  3VH3 B;  3HM3 A;  1ISN A;  3V61 A;  2UWQ A;  3H9D A;  3I57 A;  1UF0 A;  2WDR B;  2WXF A;  4NJ7 A;  2D10 A;  3PZD A;  5IAA C;  2KYW A;  4J3O D;  4PT5 A;  4FUL A;  3TEZ A;  3AE4 B;  1ZDV A;  2ZVO A;  2WXO A;  1YQB A;  2BS4 B;  4ZRQ A;  2K6Q A;  3LB8 C;  4BZA A;  4W9K A;  4CO7 A;  1M4V A;  2JF5 A;  3PGE A;  3BVG A;  2RPQ A;  4EZK A;  1WYW B;  2AL6 A;  2VH2 A;  3R3M A;  5E6O A;  4A6Q A;  3N1X C;  1NYR A;  2M4N A;  1ESF A;  2PE6 B;  2K3U A;  3RNC C;  1WGH A;  2WDQ B;  1XLP A;  3PRE A;  2JXX A;  3B1L X;  1HTQ A;  4F8C B;  2JPH A;  4HPL B;  3V60 A;  2UU7 A;  2JQR B;  4LLG M;  3A9J B;  1IBX B;  5G2N A;  1V80 A;  2ZJD A;  2FIF A;  2BGF A;  2FAZ A;  4B0M A;  4S17 A;  2KWV B;  1KH0 A;  1J7C A;  5CTR C;  2JYT A;  2G4D B;  1PYW D;  3ZGZ A;  1HZ6 A;  2NTS A;  4MM3 A;  1STE A;  4BFR A;  2NMQ A;  3VTW A;  2MEK A;  1UBI A;  2LHD A;  3GB1 A;  1IUE A;  2J0M A;  5BO4 B;  4MGY E;  5E6P A;  1XLN A;  2HTM E;  2O6V A;  1KJT A;  3MTN B;  2PKO A;  1KLU D;  3RZW C;  1JWB D;  4RH6 A;  5AEK B;  4TQ1 A;  5DPS A;  3RFZ B;  2L1A A;  2KFK B;  1J19 A;  1Z2M A;  1ET9 A;  2AEH A;  3U7Z A;  3Q8F A;  1YN4 A;  2D3C A;  1MG8 A;  2PPH A;  1K8R B;  3NZU A;  3VUY A;  3ML9 A;  4KZC A;  2V4I B;  3UIN B;  1WXV A;  3A4R A;  3ZNI D;  1ROE A;  3R2T A;  3A9K B;  1WY8 A;  2WXP A;  4HJK A;  4W9L A;  3M62 B;  4NAW B;  4MGZ E;  3ZO5 B;  1RYJ A;  3U8Z A;  3ZNG C;  1P1A A;  2PIA A;  1D5Z C;  5C23 A;  2EEL A;  1TT5 B;  3EFC A;  2ZVN A;  1WJ4 A;  1WFY A;  1E8W A;  1FRD A;  5BYR A;  2RDB C;  2K5P A;  3RNF C;  4K7U A;  2W3R A;  1NYQ A;  2K1F A;  2LD9 A;  3RD2 A;  2VRR B;  2KJH B;  2JWU A;  2WXL A;  1K51 A;  2G1E A;  4II3 B;  5JH5 C;  2EMT A;  3RUL A;  3PS6 A;  2KTR A;  4RF1 A;  3RNB C;  1SB3 C;  1QOG A;  1JML A;  3EHV A;  2A4Z A;  2FID A;  4ZRK A;  4A3P A;  3VFK A;  3AXC A;  1JWA D;  2KWU B;  1GJZ A;  2JWZ A;  1IGC A;  1Y8R C;  4FJV B;  1UZX B;  4C56 C;  3QJZ A;  1FM0 D;  5AUK A;  4AQ7 A;  1QIL A;  4GLS C;  1E6E B;  1A70 A;  5JHA A;  1DOI A;  3ZXR A;  1FO4 A;  4TKN A;  4ACF A;  2AL3 A;  4WJO A;  2QJL A;  2LMC A;  2N0S B;  3FAH A;  1GC6 A;  4IUM B;  4IWO A;  2LJI A;  5FR6 A;  1YQ4 B;  2WXI A;  4IOI E;  3QK0 A;  3CF6 E;  1MI0 A;  4OHJ A;  4YXD B;  4L23 A;  2JRH A;  1L0V B;  1I4H A;  3KQ4 A;  4ANW A;  5D3D A;  2IO0 B;  4KIK A;  3DVN V;  1R4N I;  4W9E A;  3ZIM A;  4MGI E;  2KX0 A;  2C7N B;  2SAK A;  2RD0 A;  2KD0 A;  4NJ6 A;  5EE3 A;  3AH7 A;  4I6P A;  2KHW B;  3VTU A;  2W82 A;  3OWE B;  2MA9 B;  2V1Y A;  1MPE A;  4M01 A;  3T3O A;  1TY2 A;  1KLV A;  1I42 A;  3AE5 B;  4HPP A;  2M8S A;  1WZ3 A;  1FPY A;  2KZR A;  5CHV C;  1FNW A;  1L0Y B;  3UF8 A;  1TZO A;  2N1V A;  5HI1 A;  3BVZ A;  1HEZ E;  2V3S A;  3KUC B;  3W9C B;  2KLG A;  3B2F A;  5DPR A;  2GB1 A;  3EA6 A;  3GOE A;  1YJI A;  2MH7 A;  1DOX A;  1VZ7 A;  1SXT A;  3P2B A;  3QAR A;  4GOC A;  2WP9 B;  4D2K A;  2V4L A;  1GB1 A;  1FIQ A;  3HRD D;  3H7P B;  3PT2 B;  3DDC B;  4P1C C;  1P3Q U;  2H88 B;  3EEC A;  1WF9 A;  2WXM A;  2KMA A;  2D5G A;  3DHI C;  1C9F A;  3M95 A;  1Y56 A;  4NPN A;  4RGN A;  2N9X A;  3PLV A;  1LXD A;  1XCT L;  4OW0 A;  4CQN A;  3IBE A;  3N30 A;  4EFO A;  1J0G A;  2MP2 A;  2DLB A;  3U7D A;  2KWC A;  3PPA A;  2BKR B;  1VCB A;  5IP4 D;  2MBB B;  3AUL A;  1R4M B;  3DBL I;  1P98 A;  4DBG A;  1JRO A;  4TUU A;  4E74 A;  2NCN A;  1F77 A;  4RGO S;  2AYO B;  2N9E B;  1DYQ A;  4US8 A;  4OZB A;  5E6N A;  4GB9 A;  3CWI A;  3M63 B;  3AEG B;  1XEE A;  2CHX A;  3NUH B;  1R4N B;  2OJR A;  1XF5 L;  1KTK A;  4RCO A;  2LRW A;  1N5X A;  2OJW A;  1NEN B;  1YJ1 A;  2NS5 A;  1VZ6 A;  3ZVV A;  5H8Y E;  5IO9 A;  4LJP B;  1I4P A;  2Z0D B;  4RGM A;  1XQQ A;  4QAY A;  3Q3F A;  5JXV A;  1N61 A;  2BYE A;  3FKY A;  1GNU A;  3AI5 A;  2Z0E B;  4YT0 B;  4KIK B;  1L4D B;  1D4B A;  4HEA 1;  2KXJ A;  1SE4 A;  4WQO B;  1QQR A;  1AW7 A;  3B2G A;  1WGG A;  1V81 A;  1V5T A;  1ZXH A;  3Q3M C;  4ICV A;  4XC2 A;  1HE8 A;  4DXA B;  4OVV A;  1B1Z A;  2FBW B;  3RMK C;  1PDX A;  1N60 A;  2E3T A;  1SJH D;  4NAM A;  4RNA A;  3MC8 A;  2K39 A;  4ANV A;  1WRD B;  1ZXI A;  4YTN B;  5J18 A;  1LGR A;  4JL9 A;  2D11 A;  4JIO U;  4LNF A;  1ACC A;  1Q1O A;  1V1O A;  1WGK A;  2GMI C;  2CKH B;  4AJY B;  5AZG A;  1E7P B;  1HZ5 A;  3IT6 B;  3UQA A;  1KF6 B;  5I4D A;  5LXI B;  4BOZ B;  3AU5 A;  4P7I A;  4XWT A;  4ZHO A;  3ZDM C;  2G9H D;  2WHI A;  3WAL A;  4E71 A;  2BKF A;  3A9J A;  1GC7 A;  1IBX A;  2PVG C;  1WH3 A;  1JWU D;  1HTO A;  3IHP C;  1GUA B;  1NVI D;  1E5W A;  3BIN A;  1QOF A;  4MT5 A;  3GS2 A;  3N1Z C;  1TS5 A;  1RRB A;  1EU4 A;  2W3S A;  2IO3 B;  3NHE B;  1EWC A;  1SE9 A;  1RLF A;  3P4R B;  2CHW A;  4A3O A;  2Y3A A;  3VRA B;  4YWG G;  2R2O A;  3C8Y A;  4G11 A;  5TR5 A;  2J52 A;  1WGR A;  3ZDT A;  1IYF A;  2KFK A;  3B0A A;  4ITK A;  2OOB B;  2RPV A;  1N6Z A;  4FBJ B;  1TKY A;  4KKJ A;  3HVZ A;  2L0T A;  3R66 C;  4XX5 A;  3ALB A;  4K81 A;  2JZ3 B;  1NBF C;  3BYY B;  1GAQ B;  4N59 A;  5D7G A;  3Q8B A;  1TBE A;  4KX6 B;  1TGZ B;  4JLC A;  2KDB A;  4HJG E;  3N3K B;  1FMA D;  1RAX A;  4WUR A;  2PLP A;  2X38 A;  2JXT A;  3UI3 A;  4ASW C;  4HWI B;  3HVD A;  4KGT A;  3A9K A;  3DCG A;  3AEA B;  3JYU A;  3NVY A;  4WWO A;  1JWS D;  2ZCB A;  4WIP A;  1A5R A;  1J8C A;  4DXG A;  2KLC A;  5FKA C;  1DOY A;  1YMH E;  4M0W A;  4K1R B;  4PS8 A;  4W9D A;  1P0R A;  2RSU A;  4MSQ B;  4C7Z A;  4IDI A;  2Y5B B;  1I4Q A;  2G4S A;  2O2V B;  1H8C A;  3DHG C;  4W9I A;  2WX0 A;  5CHW A;  1NI2 A;  1QLB B;  2BB5 A;  4LK0 M;  4B95 A;  1P7E A;  4M00 A;  1FCL A;  4B9K A;  4DDI D;  3VQI A;  2QCZ A;  2L8J A;  3UQB A;  2KTF A;  3L4P A;  2ZW0 A;  2FCN A;  4RF0 A;  4R3D A;  4TQ0 A;  2HDE A;  4C4V A;  2I1K A;  2WLB A;  4S0R A;  2NBU A;  3KYC D;  4AUQ C;  3R7R A;  3BVM A;  1WMH B;  4G0N B;  4ANX A;  4ARI A;  5HFY A;  1S3S G;  2LEK A;  4MAC A;  3H6N A;  2KJR A;  4KDL B;  3SEB A;  3VH4 B;  1RM6 C;  2BWE S;  3PRZ A;  1TKE A;  3CIR B;  4DK5 A;  4DHJ B;  3N9Y C;  2DAJ A;  3ZTC A;  2MWS B;  4NQL B;  2MBQ A;  4FXC A;  3NS8 A;  4I6N B;  3PLU A;  4XGA B;  2LZ6 A;  3ZKJ C;  2MRP A;  1TIF A;  2YVC A;  1FXI A;  5L95 C;  1I35 A;  4JX1 C;  3GE8 C;  2WXG A;  1LO5 D;  2L52 A;  2N9P C;  1WXM A;  4CYE A;  2NPT A;  2G45 B;  1YNT E;  3AMZ A;  2C5L C;  2KKC A;  3R8B A;  4HK2 A;  2KK8 A;  2LGX A;  1J7B A;  3QHT A;  1NEK B;  3GP7 A;  4RM8 A;  4BKT A;  3LYY A;  2N9K A;  3MC9 A;  2JYE A;  2D3A A;  3IAM 1;  4M8N A;  3AED B;  2IJ0 A;  2B76 B;  4PYU A;  4EZL A;  2FCS A;  2KX3 A;  3DHH C;  3RUI B;  2PJH A;  2K9X A;  3TEX A;  3VR9 B;  2HJ8 A;  1AWD A;  2WXQ A;  4HKZ E;  3NOB A;  2KAC A;  4GU2 A;  1EWY C;  2XBB C;  4EOY A;  3I5J C;  1WGY A;  3BII D;  3BK1 A;  3X23 A;  4DHZ B;  2CHZ A;  1SE3 A;  3ZW3 A;  4I6L B;  4WJP A;  2KDE B;  3H8H A;  2DYO A;  4MEM A;  3KWV A;  2N7E A;  1ZP0 B;  1L2N A;  5BMI A;  2MBO A;  2AQ2 B;  2REX A;  2EKE C;  4A8X C;  1E10 A;  1C76 A;  2JX5 A;  3TBL D;  4FN2 A;  3TEW A;  1E8X A;  3WAM A;  1WJN A;  3H7P A;  4M0W B;  1D3Z A;  4BKG A;  3A4S C;  3IXS A;  1ZE3 D;  4HCP B;  3ZNH B;  4AS1 A;  3P4Q B;  4PS7 A;  2GLS A;  3DOW A;  2KQ7 A;  3L13 A;  3N20 C;  4DHJ D;  4JE3 B;  4DQO C;  1VZ8 A;  1VD2 A;  4KZ0 A;  4ARC A;  2L0F A;  2GBR A;  2L00 B;  1SF0 A;  4W9H A;  1UNS A;  4C7Y A;  1E90 A;  1QF6 A;  3DBR I;  3X0W A;  2KMC A;  2V3P A;  1PUT A;  1S1Q B;  3DQV A;  2KQ4 X;  1WR1 A;  5EDS A;  1EF5 A;  4DXF A;  3I63 C;  3SFE B;  1H4R A;  4C4V B;  3APD A;  3Q3J A;  3KLS X;  1WXQ A;  2FNJ B;  2DHZ A;  2XN9 C;  3HM6 X;  2BTE A;  4K3B A;  1XLO A;  4ANU A;  4F1S A;  2HD5 B;  4YTM B;  5G5G A;  2AQ3 B;  5C1Z A;  1U4A A;  4EEW A;  4YSZ B;  5IOI A;  1R4M I;  2LHE A;  4ZRJ A;  2PE9 A;  2CJO A;  2CR5 A;  4M8M A;  1T6B X;  3P4S B;  5DPW A;  2I2Y A;  2DWQ A;  2MJD A;  3W1S A;  4XE0 A;  2NPT B;  2IPK D;  3ZJV A;  2XEW A;  2N7J A;  4A20 A;  3BY4 B;  3EUB 2;  2IY0 B;  2DAF A;  2TSS A;  2LXA A;  3K9O B;  5IKC M;  1EF1 A;  2XK5 A;  2BB6 A;  1TS4 A;  4RMA A;  1WWT A;  4WAA A;  2CJN A;  2BS3 B;  1WJU A;  2NBW B;  1UH6 A;  2Y5C A;  1TYG B;  4B6W A;  3AE9 B;  2IZV B;  1T3Q A;  1CMX B;  5LXH A;  3Q2A C;  3AEE B;  3UGB B;  3U30 A;  3DVG Y;  3ABV B;  3P1M A;  1GG3 A;  3AE6 B;  3BK2 A;  4GN1 A;  3IVF A;  3KUZ A;  4BBN C;  3AN1 A;  2YLM A;  2KMM A;  3RT3 B;  3PV1 A;  1TS3 A;  1VLB A;  2JZP A;  4AP4 C;  4NQK E;  4IG7 B;  4A9A A;  1FNU A;  2MQJ A;  1WI0 A;  3RN9 C;  1ZGU B;  4IW0 A;  5C3J B;  3ECI A;  1E0Z A;  3O65 B;  3B08 A;  3HIZ A;  3DBR B;  2BYT A;  1FFU A;  3V05 A;  2WXN A;  4YSX B;  1L5P A;  2QDF A;  1L0X B;  3WIM A;  4XWW A;  1GPX A;  4DDG D;  4BKS D;  3O13 A;  1QKZ A;  4ZOH C;  4YTP B;  3AEB B;  1LM8 B;  3PVL A;  1NDD A;  4DHZ E;  5BYQ A;  1UD7 A;  5E6J A;  3QWZ B;  2I1J A;  3ONS A;  3SD5 A;  4KGR A;  2ZCC A;  1LQB A;  3DVN U;  1ET6 A;  3OJ4 B;  1HXY D;  4YSY B;  3L17 A;  3ZQ4 A;  1F2R C;  4HKQ A;  1F52 A;  2K6D B;  1BUI C;  1ZUD 2;  2KNB A;  2C60 A;  4LNK A;  5J17 A;  1PGA A;  3VTV A;  1GB4 A;  1PQS A;  1QZE A;  2FUH B;  3NG0 A;  5EE0 A;  2B3A A;  3AE1 B;  1IP9 A;  1YD8 U;  4HVB A;  4LCD E;  4W9J A;  5CX3 A;  1IPG A;  3RNE C;  1VR9 A;  2JT4 B;  3AE8 B;  3RNA C;  3DBH I;  5HG2 A;  2CS4 A;  3MJ5 A;  2EKI A;  4GDK B;  2OED A;  1WIA A;  4L2Y A;  4LTU A;  3UIO B;  3JSV A;  2LFI A;  2LVO A;  3A33 B;  2YEP B;  4RM9 A;  3UIP B;  3SR6 A;  2I38 A;  3ZJT A;  4DWF A;  4LNN A;  4P1B C;  2X8X X;  4ZRI A;  2ZW1 A;  3Q3N C;  1FFV A;  1YX6 B;  2XK5 B;  2J7Q B;  2O2V A;  4URK A;  4N9F 4;  3H7S A;  2JY6 A;  3Q6B A;  2L83 A;  4GSW A;  3VVW B;  2LWP A;  2MSE D;  3OAW A;  1DGJ A;  3GZN I;  4AJW A;  1C78 A;  5T8I A;  1KLG D;  4NJC A;  3M3J A;  4W9C A;  3CST A;  2KN4 A;  1JW9 D;  1V97 A;  4GDL B;  1V2Y A;  1E8Z A;  2L05 A;  1YN5 A;  2L32 A;  2MLB A;  1WMH A;  2BBC A;  3A1Q B;  3U52 E;  2LVP A;  2WGS A;  4C00 A;  1N5W A;  2KC1 A;  4IKG A;  3R2I A;  4LNI A;  2ZNV B;  2LJ5 A;  2WU5 B;  4MH0 E;  4P16 A;  3FIL B;  5FK9 C;  2KJ6 A;  1WZ0 A;  4NZL B;  2WDV B;  2JRI B;  1SBB B;  1WX7 A;  1RFK A;  3LJ3 A;  3VR8 B;  3CSF A;  2KC2 A;  2LXC A;  1MG4 A;  3QCA A;  4XYC A;  1JWM D;  1WM2 A;  4UDU C;  1K50 A;  2IYD B;  1UWX A;  1J7A A;  2ASQ A;  2Y5P A;  1V1P A;  3ZTD A;  4W9F A;  3RI7 C;  2WWZ A;  2GBN A;  1R7S A;  2VZK B;  2WX1 A;  2CU3 A;  3SFD B;  2HE7 A;  2D3B A;  3E56 A;  5FR3 A;  2GI9 A;  1E9M A;  2K0P A;  2MJ3 A;  3DBH B;  2KQS A;  3URY A;  1I4X A;  3WAP A;  2NVU I;  2RDH A;  4MGK E;  4WWN A;  3BYT B;  5D2M B;  2ONQ A;  3GE3 C;  3N32 A;  3LDZ E;  4GMV A;  3RNG C;  2BS2 B;  2GOW A;  3H1U A;  2DBY A;  2IND C;  2C7M B;  1F9J A;  4FHK A;  4IM3 A;  2LUE A;  3KUD B;  3IG3 A;  1MHH E;  3DWM A;  4OZA A;  2CU1 A;  3WAN A;  4KGS A;  2Z59 B;  2LUM A;  3MHZ A;  2C7H A;  2RDG A;  3RCZ A;  1XXG A;  4J6I A;  2M17 A;  2YEP F;  3WA0 A;  1E7U A;  1YJJ A;  1N63 A;  2ACZ B;  4OZC A;  3AE3 B;  1Q5W B;  2WDT B;  3GZN B;  2IBI B;  4KKI A;  3TUO A;  1BXT A;  3JSV B;  1TJE A;  2WQY B;  4WWM A;  2M1M A;  2DZI A;  1MJD A;  2PVO D;  1UUP A;  4RFB A;  4MEL A;  3JW0 X;  4MSM B;  3AE2 B;  1OQY A;  1JAL A;  4EKU A;  4OVU A;  5G55 A;  3TL5 A;  3QIJ A;  4JWS C;  3EC8 A;  1Q10 A;  3IT4 B;  2J0K A;  1OFF A;  1YN3 A;  2V3N A;  3V3X A;  4FLH A;  2LGI A;  1T0R C;  5G5H A;  3I9V 1;  3VUX A;  3ZRC A;  1T5X D;  5LLI A;  2K25 A;  4M02 A;  4KV2 A;  2BW2 A;  4CHK A;  1D5X C;  1OEY A;  1I4G A;  3BWU D;  4FJZ A;  1V6E A;  4AWJ A;  1WM3 A;  2R61 A;  2K8H A;  3Q8E A;  5BMG A;  4BKS A;  1C4P A;  5GXG B;  1WRI A;  1XT9 B;  3NZ3 A;  3EFU A;  2VZK D;  3NVW A;  5J2R A;  2JU6 X;  4XZ4 A;  4WJN A;  3BZD B;  4A90 A;  2IGG A;  1E7V A;  2PTL A;  1NI3 A;  2J42 A;  1AAR A;  3OLM D;  2Z8L A;  2WNM A;  1JQ4 A;  2WU2 B;  3QC8 B;  3PHX B;  4TMA B;  2KFJ A;  4WJQ A;  2UYZ B;  1Q0W B;  4O1N A;  3AM9 A;  1Z5S B;  4K3C A;  2JZZ A;  2LGY A;  5DPT A;  3TIX A;  2DZJ A;  1YOV B;  3L08 A;  3FC4 A;  4OVZ A;  4LNO A;  2DYB A;  2N1W A;  3EGR A;  1C3T A;  2K8C A;  4IM2 A;  1V1P B;  2DZM A;  3Q69 A;  4RGT A;  3VUW A;  1L6U A;  2KAN A;  1FCC C;  4IWP A;  4GGQ A;  1ENF A;  2GRI A;  3APC A;  2JUO A;  3J9C A;  1SIF A;  2WS3 B;  3PHW B;  2LRU A;  1WX9 A;  2XNA C;  2BQQ A;  4JPS A;  2QIE B;  2BWF A;  3SU8 X;  4GIV A;  1L6V A;  3PSE B;  1X1M A;  3QX1 A;  5EE1 A;  2N4F A;  3KWL A;  1SSN A;  2LVQ A;  5D3I B;  5DCN A;  4TV3 A;  3QAQ A;  4MJS B;  2D2Q A;  2AX5 A;  2V9H A;  2NBV B;  2EMS A;  4WQM A;  5AZF A;  5EE9 A;  1BML C;  4LDT B;  3JVZ X;  3C0R B;  3TSS A;  1SJE D;  3ZUN A;  3QA8 A;  4MDK E;  2WYQ A;  2QSD A;  2WXJ A;  2DZK A;  2PMV A;  2IGD A;  1T0Q C;  1FNV A;  5L83 A;  4KSL C;  2D07 B;  3ZLZ A;  2BPS A;  1HA5 A;  2QHO A;  2M0X A;  3VRB B;  3K9P B;  3NY5 A;  2GBK A;  1FRR A;  1EO6 A;  1XO3 A;  4JGH B;  2MBH A;  2NTT A;  3W1Y A;  4EUT A;  3PZ8 A;  1QOA A;  2ICI A;  1F2R I;  3WAO A;  2IO2 B;  3KVF B;  3WCQ A;  4FJY A;  4MH8 A;  1WJ6 A;  2INN E;  3T8M A;  2FCM A;  2DNF A;  4K7W A;  1ZKH A;  3ZYY X;  4FAD A;  4HDO A;  3VDZ A;  2L76 A;  2MJE A;  2W55 A;  3QQ8 B;  4ZYS A;  5BYS A;  2R2Q A;  2DYM A;  3N1Y C;  4TSS A;  3APF A;  4F7Z A;  1ZDX A;  1FD6 A;  3DWG C;  1SE2 A;  4GDK A;  2QMT A;  4B0E A;  3IFW B;  1WXS A;  4G50 A;  2IO1 B;  1WE7 A;  1LFD A;  1FXT B;  2IGH A;  3MJW A;  1RFA A;  4WAF A;  4US9 A;  2IY1 B;  4YL8 A;  3NVZ A;  4ZHP A;  2WXH A;  2BYF A;  3KYD D;  1QT9 A;  2LAS A;  4WH4 A;  1MHX A;  3MP9 A;  4A55 A;  3P4P B;  2LGD A;  2INP E;  3LXF A;  3DPD A;  4REZ A;  4EZJ A;  2QC8 A;  2ON8 A;  1WX8 A;  1XD3 B;  3B9J A;  4LDT D;  4MM3 B;  1B9R A;  4W9G A;  3NRZ A;  2KDI A;  3DBS A;  2RR9 A;  2DEN B;  2NR2 A;  2INC C;  4GDL A;  2N7D A;  2O6V B;  3ZNZ B;  3ML8 A;  2BT6 A;  3TJP A;  4JQW C;  3DVG X;  3A1Q A;  4HRO A;  1CQV A;  4FA6 A;  3PZ7 A;  1P9D U;  2A5U A;  1MVK A;  1UGJ A;  1FXA A;  2M0A A;  2W54 A;  1PFD A;  3TMP B;  2M56 B;  2W9N A;  3L54 A;  1WXA A;  1UEL A;  2N9L A;  3FIL A;  2AQ1 B;  3ETR A;  2KVZ A;  4JWU C;  2K22 A;  2ZPY A;  4HPM B;  4AOF A;  4L1B A;  3L16 A;  3NVV A;  4G3X B;  1JCK B;  1T0S C;  2MCN B;  3T3N A;  3D32 A;  2DX5 B;  1WYG A;  2QEJ C;  4KVG B;  3ZJU A;  1FEH A;  3ENE A;  3AU4 A;  5HKH A;  3Q8C A;  4C80 A;  4ZDV A;  2K8B A;  1YX5 B;  1N62 A;  1C79 A;  5AZH A;  3VAW A;  1PGX A;  1V86 A;  3AEF B;  1V49 A;  3L10 B;  3L0W B;  4IC7 B;  2KAJ A;  4H2A A;  3W5U B;  1E8Y A;  2KDF B;  3TCA A;  1WGD A;  1SGH A;  1HQR D;  3P63 A;  2KTR B;  3R7Q A;  2M19 A;  2WXR A;  1T0Y A;  2H89 B;  3PTF C;  3KH0 A;  1ZW7 A;  1ZOY B;  1V9J A;  3PRM B;  2MX2 A;  5KHO A;  1WSP A;  1C4C A;  5AUI A;  4E3C A;  1KRH A;  1PGB A;  4Q2J A;  1CZP A;  5HHD G;  1AYF A;  4HDQ A;  5CHF A;  2BVC A;  4BBN F;  5D94 A;  1WR6 E;  3PRP B;  3Q14 C;  1TKG A;  1XCQ L;  1TZ1 A;  5GMV A;  2LI5 A;  3TEY A;  2FE8 A;  1C1Y B;  1JRU A;  2O6V D;  4HLE A;  5LNK 1;  2G3Q B;  3MC0 B;  1OGW A;  3W2D A;  2KDM A;  1SEB D;  3AEC B;  5IN7 A;  2GBM A;  3V6E B;  1F0Z A;  2J4X A;  3CMM B;  1TS2 A;  1TY0 A;  1SIJ A;  3C19 A;  1M94 A;  1BT0 A;  2FUG 1;  2C9W B;  3OJ3 A;  1EM7 A;  3SHQ A;  4BAX A;  3RPF C;  5KHQ A;  2D3G A;  1CK1 A;  1L4Z B;  4IM0 A;  1AN8 A;  3VHT C;  1KFY B;  2HJ1 A;  2FCQ A;  4WWP A;  1C77 A;  2HTH A;  3P42 A;  3MHS D;  3AV8 A;  2LGS A;  2KO3 A;  3ZXV A;  2Q5W D;  2J0J A;  3T9L A;  4XDD A;  2AWT A;  1K52 A;  1UGM A;  3HHM A;  2GBJ A;  1EUV B;  5MPO A;  2L3Z A;  1RWS A;  3W1S C;  3IAS 1;  2L7R A;  3NZS A;  2KOX A;  1I4R A;  4HCN B;  1EU3 A;  2J53 A;  2KN5 A;  1C4A A;  4ZYN A;  5C2T B;  5JZE B;  2ZPN A;  5JHB A;  5BMH A;  2KWD A;  2BF8 B;  2OHF A;  4K7S A;  1L7Y A;  1TTN A;  1OQQ A;  4XDC A;  3NJT A;  1JRP A;  4ZRP A;  1P7F A;  2RMM A;  1IGD A;  2JSV X;  4ICU A;  3DBL B;  4USA A;  3W5V B;  1KM7 A;  1OQR A;  1CJE A;  2IDY A;  1WE6 A;  2WXK A;  5TSS A;  3SDL C;  4X57 B;  3RYT A;  4PYZ A;  1VDV A;  4BVU C;  1XLQ A;  3AE7 B;  3MFG A;  1V5O A;  1OEY J;  2V0G A;  1KOT A;  4HXD A;  2MP2 B;  4HRS A;  3ZRF A;  4BOS C;  2ZNV C;  3I3T B;  4PS3 A;  2VH1 A;  2MBE A;  1D6E C;  4KSK C;  2MW5 A;  4LJO B;  4KDI C;  1MFW A;  4MJS A;  3NS1 A;  3U2S C;  1D5M C;  2KVR A;  1YIW A;  3V62 A;  4NNJ B;  1I7H A;  4IWQ A;  4P6V F;  3Q3O C; 
#chains in the Genus database with same CATH homology
 1NEN B;  1VRA B;  1K53 A;  1VJK A;  3AB5 A;  1WWT A;  4N6E B;  1VZ6 A;  5H8Y E;  5H92 C;  3HUI A;  1L6V A;  2BS3 B;  2CJN A;  2PW9 A;  1I4P A;  1QOB A;  4RGM A;  3PO0 A;  5EE1 A;  3KWL A;  1SSN A;  2E6X A;  3E9S A;  5D3I B;  2Y5C A;  5JXV A;  1N61 A;  1TYG B;  3AE9 B;  1T3Q A;  2AX5 A;  3AEE B;  3Q8A A;  3ABV B;  4WQM A;  4YT0 B;  3P1M A;  1L4D B;  3AE6 B;  3BK2 A;  1D4B A;  4HEA 1;  5EE9 A;  1SE4 A;  3AN1 A;  1BML C;  1QQR A;  1YQ3 B;  2KMM A;  1AW7 A;  3B2G A;  3U4E G;  2QIL A;  1ZPS A;  1ZXH A;  1GOZ A;  1SJE D;  1TS3 A;  3TSS A;  1VLB A;  2JZP A;  2QSD A;  1B1Z A;  2WXJ A;  2SEB D;  4EE2 A;  2FBW B;  2PMV A;  2IGD A;  4A9A A;  1PDX A;  1FNU A;  1N60 A;  2E3T A;  1SJH D;  1UWM A;  1FNV A;  1V8C A;  4NAM A;  4N58 A;  4RNA A;  5C3J B;  1E0Z A;  1HA5 A;  1ZXI A;  4YTN B;  2BYT A;  1FFU A;  3VRB B;  3V05 A;  2WXN A;  4YSX B;  1FRR A;  1L5P A;  1ACC A;  3I57 A;  1L0X B;  1V1O A;  1WGK A;  1XO3 A;  4XWW A;  1N5X A;  1GPX A;  2WDR B;  2WXF A;  1E7P B;  1HZ5 A;  3IT6 B;  3O13 A;  1QKZ A;  4ZOH C;  2NTT A;  1KF6 B;  5I4D A;  4J3O D;  4PT5 A;  3TEZ A;  3PZ8 A;  1QOA A;  2ICI A;  1F2R I;  3AE4 B;  1ZDV A;  4YTP B;  3AEB B;  2WXO A;  4ZRQ A;  2BS4 B;  3LB8 C;  3WCQ A;  5BYQ A;  4MH8 A;  4XWT A;  4ZHO A;  1M4V A;  2G9H D;  2INN E;  3BVG A;  5E6J A;  3ZYY X;  1IBX A;  2PVG C;  4KGR A;  2MJE A;  2W55 A;  4A6Q A;  4ZYS A;  1JWU D;  5BYS A;  1NYR A;  1NVI D;  1ET6 A;  1ESF A;  2K3U A;  1HXY D;  2WDQ B;  1XLP A;  4YSY B;  3ZQ4 A;  1F2R C;  4HKQ A;  1QOF A;  4MT5 A;  2DYM A;  3GS2 A;  4TSS A;  1BUI C;  1TS5 A;  1ZUD 2;  1EU4 A;  1PGA A;  2W3S A;  1ZDX A;  1FD6 A;  2JQR B;  1EWC A;  3DWG C;  1SE2 A;  4LLG M;  1GB4 A;  2QMT A;  4B0E A;  1IBX B;  3P4R B;  5EE0 A;  3AE1 B;  4B0M A;  2Y3A A;  3VRA B;  4YWG G;  2IGH A;  3C8Y A;  1KH0 A;  2J52 A;  1J7C A;  4WAF A;  4US9 A;  2JYT A;  3NVZ A;  4ZHP A;  4ITK A;  1VR9 A;  1PYW D;  2RPV A;  3ZGZ A;  2WXH A;  1HZ6 A;  2NTS A;  1TKY A;  3AE8 B;  1STE A;  1QT9 A;  4KKJ A;  3HVZ A;  2NMQ A;  2MEK A;  4WH4 A;  1MHX A;  3MP9 A;  2LHD A;  5HG2 A;  3GB1 A;  3MJ5 A;  4A55 A;  1IUE A;  2EKI A;  4GDK B;  3BYY B;  1GAQ B;  2OED A;  4L2Y A;  4N59 A;  3P4P B;  1XLN A;  2HTM E;  3Q8B A;  4LTU A;  5D7G A;  2INP E;  4KX6 B;  2PKO A;  1KLU D;  3LXF A;  2LFI A;  4HJG E;  1JWB D;  4RH6 A;  1FMA D;  4TQ1 A;  2YEP B;  3RFZ B;  4WUR A;  2L1A A;  2PLP A;  4REZ A;  2X38 A;  2JXT A;  3UI3 A;  2ON8 A;  3B9J A;  3HVD A;  4KGT A;  3SR6 A;  2I38 A;  1ET9 A;  3ZJT A;  4MM3 B;  3U7Z A;  3Q8F A;  1B9R A;  2ZW1 A;  1YN4 A;  3NRZ A;  3AEA B;  3NVY A;  1FFV A;  1JWS D;  4WIP A;  4DXG A;  2L83 A;  5FKA C;  1DOY A;  1YMH E;  2BT6 A;  2V4I B;  4M0W A;  4HRO A;  1CQV A;  1DGJ A;  1ROE A;  3R2T A;  1C78 A;  5T8I A;  3PZ7 A;  2WXP A;  4NAW B;  1KLG D;  4NJC A;  4C7Z A;  1MVK A;  1RYJ A;  1FXA A;  1UGJ A;  2M0A A;  4IDI A;  2W54 A;  1I4Q A;  2KN4 A;  1JW9 D;  1PFD A;  1V97 A;  2PIA A;  1D5Z C;  4GDL B;  2M56 B;  1YN5 A;  2EEL A;  2L32 A;  2N9L A;  3FIL A;  2AQ1 B;  3ETR A;  4JWU C;  2K22 A;  2BBC A;  4LK0 M;  1QLB B;  2BB5 A;  4L1B A;  3U52 E;  1P7E A;  3NVV A;  1JCK B;  1FRD A;  5BYR A;  3T3N A;  1FCL A;  2K5P A;  3VQI A;  2W3R A;  1NYQ A;  1WYG A;  2QEJ C;  1N5W A;  3ZJU A;  3L4P A;  1FEH A;  4IKG A;  2JWU A;  3R2I A;  2WXL A;  1K51 A;  2G1E A;  2ZW0 A;  4TQ0 A;  4RF0 A;  4R3D A;  2HDE A;  3Q8C A;  2WLB A;  2WU5 B;  4C80 A;  4P16 A;  3FIL B;  4RF1 A;  5FK9 C;  1SB3 C;  1QOG A;  3BVM A;  4NZL B;  1JML A;  2WDV B;  1N62 A;  1SBB B;  1C79 A;  4ARI A;  5HFY A;  2LEK A;  1RFK A;  4MAC A;  1PGX A;  3VR8 B;  3AEF B;  3SEB A;  1RM6 C;  1TKE A;  3CIR B;  3N9Y C;  1JWM D;  2KAJ A;  4H2A A;  3W5U B;  1JWA D;  4UDU C;  1K50 A;  4FXC A;  1UWX A;  1HQR D;  1IGC A;  3P63 A;  1J7A A;  4C56 C;  2Y5P A;  1V1P A;  1FM0 D;  5AUK A;  1FXI A;  2M19 A;  4AQ7 A;  1R7S A;  2VZK B;  2WXR A;  2CU3 A;  1QIL A;  3SFD B;  2H89 B;  3E56 A;  4GLS C;  5FR3 A;  1E6E B;  2GI9 A;  1E9M A;  2K0P A;  1ZOY B;  4JX1 C;  2MJ3 A;  3URY A;  1A70 A;  1DOI A;  1WSP A;  1C4C A;  5AUI A;  1I4X A;  1FO4 A;  2WXG A;  1KRH A;  2RDH A;  1LO5 D;  2L52 A;  1PGB A;  3BYT B;  2ONQ A;  4Q2J A;  1CZP A;  2BS2 B;  5HHD G;  1YNT E;  3AMZ A;  3R8B A;  2DBY A;  1AYF A;  2QJL A;  2LMC A;  1J7B A;  2N0S B;  3FAH A;  1TKG A;  1XCQ L;  1NEK B;  3GP7 A;  2LJI A;  1MHH E;  3LYY A;  1YQ4 B;  3DWM A;  2N9K A;  2WXI A;  4OZA A;  3TEY A;  4IOI E;  2JYE A;  2FE8 A;  3IAM 1;  4KGS A;  3AED B;  2IJ0 A;  2B76 B;  2LUM A;  1MI0 A;  3MHZ A;  2RDG A;  5LNK 1;  4OHJ A;  1XXG A;  3MC0 B;  4YXD B;  4L23 A;  2YEP F;  1L0V B;  1I4H A;  3KQ4 A;  2K9X A;  3TEX A;  3W2D A;  2KDM A;  1SEB D;  3AEC B;  3VR9 B;  1YJJ A;  1N63 A;  2ACZ B;  4OZC A;  5D3D A;  1AWD A;  3AE3 B;  1F0Z A;  2J4X A;  2WXQ A;  4HKZ E;  4KKI A;  3TUO A;  1TS2 A;  2SAK A;  2KAC A;  1EWY C;  1BXT A;  1TY0 A;  1TJE A;  2WQY B;  4WWM A;  3BII D;  3BK1 A;  5EE3 A;  1SIJ A;  1SE3 A;  3AH7 A;  2PVO D;  1UUP A;  4RFB A;  2FUG 1;  3H8H A;  2DYO A;  1EM7 A;  2W82 A;  3KWV A;  3OWE B;  3RPF C;  1ZP0 B;  5BMI A;  3AE2 B;  2AQ2 B;  1CK1 A;  1L4Z B;  1AN8 A;  1JAL A;  4A8X C;  1KFY B;  1E10 A;  1C76 A;  1MPE A;  2JX5 A;  1TY2 A;  3T3O A;  4JWS C;  3AE5 B;  1Q10 A;  1C77 A;  3IT4 B;  3TEW A;  1OFF A;  3P42 A;  3AV8 A;  1YN3 A;  2V3N A;  3IXS A;  1FNW A;  1L0Y B;  3V3X A;  1TZO A;  1ZE3 D;  2LGI A;  2Q5W D;  5G5H A;  3I9V 1;  5HI1 A;  4AS1 A;  3BVZ A;  1HEZ E;  3P4Q B;  3W9C B;  1T5X D;  3B2F A;  2GB1 A;  4XDD A;  2BW2 A;  3EA6 A;  1YJI A;  2MH7 A;  1D5X C;  1DOX A;  1VZ7 A;  1I4G A;  3BWU D;  1SXT A;  4JE3 B;  4DQO C;  1K52 A;  1VZ8 A;  2WP9 B;  5MPO A;  2R61 A;  4ARC A;  4D2K A;  1RWS A;  3Q8E A;  5BMG A;  1GB1 A;  1SF0 A;  1FIQ A;  1C4P A;  1UNS A;  3HRD D;  3IAS 1;  5GXG B;  4C7Y A;  1WRI A;  1I4R A;  1QF6 A;  2H88 B;  3NZ3 A;  1EU3 A;  2J53 A;  2V3P A;  2VZK D;  3NVW A;  1C4A A;  5C2T B;  1PUT A;  2WXM A;  2D5G A;  2JU6 X;  2KQ4 X;  1C9F A;  5BMH A;  2KWD A;  3BZD B;  1Y56 A;  4A90 A;  2IGG A;  4RGN A;  2OHF A;  4DXF A;  3SFE B;  2PTL A;  1NI3 A;  1OQQ A;  4XDC A;  1JRP A;  1XCT L;  2J42 A;  4OW0 A;  3KLS X;  4ZRP A;  1P7F A;  1WXQ A;  4CQN A;  2Z8L A;  2RMM A;  1IGD A;  2JSV X;  2XN9 C;  2WNM A;  1JQ4 A;  2WU2 B;  4USA A;  2DLB A;  4TMA B;  3W5V B;  1OQR A;  2BTE A;  1CJE A;  4O1N A;  3AM9 A;  1XLO A;  2IDY A;  4YTM B;  2WXK A;  2AQ3 B;  5G5G A;  5TSS A;  3FC4 A;  4OVZ A;  1JRO A;  4YSZ B;  3EGR A;  1V1P B;  1VDV A;  3Q69 A;  4RGT A;  2LHE A;  1XLQ A;  1F77 A;  3AE7 B;  1L6U A;  3MFG A;  4RGO S;  1FCC C;  2V0G A;  1DYQ A;  4US8 A;  2CJO A;  4HRS A;  4OZB A;  1T6B X;  1ENF A;  2GRI A;  3P4S B;  1D6E C;  2I2Y A;  2DWQ A;  3CWI A;  2MJD A;  3J9C A;  3AEG B;  1XEE A;  2WS3 B;  3W1S A;  4XE0 A;  3NUH B;  2IPK D;  3ZJV A;  3NS1 A;  3U2S C;  1D5M C;  2N7J A;  2XNA C;  3EUB 2;  2TSS A;  1XF5 L;  1KTK A;  1I7H A;  4RCO A;  4JPS A;  4P6V F;  2QIE B;  1TS4 A;  2BB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...