1C4XA

2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOATE HYDROLASE
publication title Three-Dimensional Structure of Microbial 2-Hydroxyl-6-Oxo-6-Phenylhexa-2,4- Dienoic Acid (Hpda) Hydrolase (Bphd Enzyme) from Rhodococcus Sp. Strain Rha1, in the Pcb Degradation Pathway
pubmed rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
total genus 92
structure length 281
sequence length 281
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 1999-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c4xA00
5EHQA 1F6WA 3E0XA 4Y2TA 1TIBA 1XFDA 4PNZA 3R3ZA 3NUZA 5LZ5A 2H9YA 2WQZA 1E8DA 1EX9A 4HRXA 1ZD4A 1DWQA 5ALVA 2ORYA 2PSFA 1BE0A 4GBGA 2WG0A 5K3FA 4BC1A 4INZA 4DSAA 3MUNA 1R9MA 2V96A 3STXA 5ALSA 1ZGBA 4OPMA 2G5TA 4A23A 3DKRA 1UK8A 4MWTA 5ALIA 5CW2A 2XT0A 5FPQA 5AHXA 5J3JA 5AKLA 1EVQA 4MYSA 1BCRA 4CG3A 2QXUA 4Y2SA 3C8HA 5AOBA 1YB6A 4AO8A 3R3XA 3Q0TA 4RE6A 3T4UA 4YASA 1EINA 1MTZA 4BC0A 4UBMA 5BWBA 3DQZA 1DQYA 1N8SA 2CMFA 4WDRA 1U65A 2XQJA 2PPLA 3G9UA 2ACEA 2YYSA 1QO9A 1L7QA 1YA4A 4H35A 2HA7A 4W1RA 1GXSA 1ACLA 2BFNA 2HA0A 4KE7A 2PUHA 1R50A 5LP1A 5JADA 1BS9A 3D7RA 2ZJ6A 4NVRA 5EFZA 1JI3A 1XZEA 3STYA 2WFMA 4QDOA 2WIGA 5HFAA 2PSJA 4FBMA 2QTBA 2W6CX 5KWIA 4L0CA 1MAAA 5AI5A 5AIAA 2C4HA 1R88A 2XUOA 3GA7A 1WCYA 5BWCA 2CEKA 5CXUA 5JIBA 3LS2A 3F98A 3AINA 3L1HA 2HA4A 1ZD2P 3D2AA 3D4LA 3Q8WA 1UOQA 4EBBA 4YPVA 3HYSA 4DNQA 3DKKA 4PQEA 4OD0A 4UHEA 5CTAA 5JAHA 4OB7A 2Z5GA 4Q34A 3QPAA 3FLBA 1WPRA 4K5QA 4DMKA 4EA6A 2EDAA 3DD5A 1MT3A 2GYWA 3VDXA 1TK3A 1JMYA 2J4CA 2ZYRA 4B85A 5AI0A 5F4ZA 1CUJA 1H22A 1ODTC 2PSHA 4UFNA 2UZ0A 2JGJA 1XLVA 2Z8ZA 1GQSA 1R9NA 2BGNA 1Q83A 2JEYA 4BDTA 4XJVA 3PFCA 3WI7A 1YAHA 3U1TA 2ZJFA 3IBTA 4LYDA 3ANTA 1CR6A 3DOIA 2ROQA 4X94A 1CIJA 2C5FA 3CN7A 1MPXA 1LPOA 1EDBA 4QA9A 4I4CA 2DHCA 1BRTA 5ALFA 4BB0A 4U2BA 3KOOA 1DX4A 2BJHA 4DMHA 3I6MA 2GYVA 3MUOA 5C8VA 3B5EA 4PO3X 1XLWA 1P0PA 2I78A 1CRLA 3V9AA 2BAGA 5HK9A 2H1IA 5DNVA 3IULA 3STTA 4HVTA 1IZ7A 5AI8A 3O9VA 2QS9A 2XUPA 3NGMA 2WFLB 4X6UA 1GPNA 4HRYA 4B9AA 4AQDA 1A88A 5ALJA 4Q82A 5AKZA 5ALLA 1LZLA 1CLEA 4EY7A 1Q0RA 4Y2VA 5HF9A 2O2IA 3I2GA 5LZ9A 5ALGA 5JARA 3HC7A 4IH9A 1X2EA 1GKLA 3AZOA 1E3QA 4RNCA 2XUJA 2GBIA 5AM4A 1MX1A 4HAIA 1FFEA 2Y2UA 5ALOA 4JUIA 1CUXA 3O4IA 3QZUA 3T52A 1UWCA 4X91A 1ORWA 2QJWA 3F97A 4LKOA 1UT6A 4UBLA 4W1PA 1E8NA 1D07A 4JNCA 3WQHA 3ESDA 1GGVA 4N5HX 7YASA 3WKBA 4L72A 1SOMA 3WK9A 1FFCA 2QJRA 5AIBA 2QUBA 4BE4A 1CEXA 5D3KA 2B4KA 4BCCA 3K9BA 2VATA 3R0VA 4OYYA 2BCEA 4FKBA 3FWHA 4OYLA 2WIKA 2HL6A 2E3JA 3DYIA 3QMMA 2Y6UA 4JYPA 3H2JA 2HRRA 2D0DA 4J0CA 2PM8A 3AZQA 4PF1A 2ECFA 1QLWA 4P93A 1CUFA 1AGYA 4AN1A 1YR2A 3WL5A 2QMQA 4EHBA 1XZGA 3FCYA 2H7CA 4TPKA 4X95A 3ZI7A 2QM0A 4Q3LA 3D59A 4X3CA 3RLIA 4DNPA 3A2NA 2J3DA 3E3AA 5DNWA 5HZGA 5AK4A 1QIFA 5ALUA 5ALYA 4G8DA 3W05A 5JANA 5T4EA 4EUSA 3BWXA 2VJDA 4M0FA 3OTQA 4X6XA 2VJCA 4BCBA 3F8SA 1WM1A 1YB7A 2PSEA 1SC9A 2R11A 1YAJA 2PKYX 1LGYA 4C4ZA 1EDEA 2XUQA 4TGLA 4B81A 5AI9A 4KEAA 1XZDA 2HA5A 1EDDA 3VJMA 2RIPA 5DTIA 5HQ3B 3D2BA 1ORVA 2K2QB 3FYUC 4B9EA 4QEKA 4DSZA 5DYYA 3KD2A 1EVEA 3C43A 3H2HA 5EIAA 3AJAA 4F60A 3KXPA 4QDUA 4Y9SA 2WJ6A 3CCCA 2C0PA 4Q3KA 4OUKX 1OILA 4MEAA 3V1NA 2Y2VA 3C87A 3WKDA 4GI1A 1N1MA 1XRLA 2WSLA 5FKJA 4CG1A 1QTRA 4W63A 1EHYA 2C58A 2RHTA 3H2GA 3N2ZB 4Q05A 3IVMA 3W06A 1LBSA 4CIBA 2QXTA 3SK0A 6YASA 3TJMA 3O4GA 1J2EA 2WLSA 4L9AA 3ZLVA 5JZ9A 4MWSA 1TKRA 2CJPA 3B3QA 3FAKA 1DTEA 5BV7A 5HF8A 4KJXA 4H7JA 3FNBA 3IUQA 3BE8A 1USWA 5K3FB 3DDUA 1YSCA 2AXEA 5FPPA 3G0IA 5E4JA 1N5MA 1FJ2A 2HADA 4C01A 1EXWA 2IIVA 4LXHA 1HDEA 2EDCA 4IQ4A 3NOXA 3O95A 1HKHA 5D7BA 3WL8A 3BF8A 3QBJA 3WK6A 4K6KA 3HRHA 5FRDA 5EHXA 3KWFA 2DQZA 4BAGA 3PUHA 1VOTA 4LYEA 2WILA 3BDIA 2B61A 1XZJA 4B83A 3ZPXA 1QIKA 4FOLA 1LPMA 1WB4A 1OCEA 3R3VA 4XVCA 1CUSA 4ZREA 1SFRA 1CPYA 2Z3ZA 4L3WA 2GBCA 3JW8A 3ZLTA 1F8UA 3W2TA 4OU5A 2QVBA 4C6HA 1G5FA 3I28A 1QE3A 2QUAA 1DQZA 4KRYA 4DGQA 4G5XA 2OGZA 5AKYA 1XRPA 3PFBA 1QONA 5D6OA 3VVMA 4UBOA 5DLPA 4DMFA 2WUEA 3WZMA 4LIPD 1XRQA 1H2XA 1X2BA 3WMRA 5LLSA 1PJAA 3C70A 2P8SA 2QT9A 1R4ZA 2WIDA 3H0CA 5ALRA 2QR5A 1HL7A 4ZWNA 4H7HA 2D5LA 2XUDA 5IVHA 5KWJA 5ALQA 5I9IA 4C4YA 1CUIA 1AURA 1CUEA 1VXOA 2XE4A 2WU4A 1XZBA 1LPAB 4CCYA 4AN0A 1WB6A 4FDMA 2VJAA 5EIHA 1EA5A 4OSEA 3W04A 5AKJA 1K6EA 1CQZA 3C6ZA 4Y2QA 1MJ5A 3M83A 1O6FA 4J0JA 5HF6A 4W1QA 1NU6A 3A70A 2HDWA 1ZD3A 1LZKA 5CXXA 3OURA 1E8MA 2PX6A 3BXPA 4DMCA 2ACKA 1DU4A 1THTA 4Y7DA 3I2KA 2FUKA 4BYMA 4C88A 5EIEA 1ACJA 4ZXFA 4J0IA 1QIIA 4OU4A 4QWMA 4H18A 3UUEA 4UBKA 4FLFA 4UHCA 3VXKA 2XUHA 3TRDA 1FSSA 2BGRA 4QZVA 3LLCA 2XMDA 4BP9A 2O2GA 1UK9A 1GPLA 5HF5A 4CCWA 1XZKA 2PU7A 3R41A 4UBJA 3RM3A 4Z49A 2WHPA 2VJBA 5AM0A 4B7ZA 2XMSA 2WTMA 2ZYHA 3QPDA 4MQMA 3JWEA 4UHBA 5K3DA 5HCUA 1VA5A 5AKXA 5AM5A 4K6GA 1W1IA 1ODCA 3R3UA 1SCIA 1ZI6A 4EB0A 3D2CA 4JYMA 5ALPA 2VEOA 3KWJA 3ESCA 4J3JA 4FHZA 1GKKA 4G8BA 4IH1A 3WK5A 2OGTA 5CMLA 3JYHA 2GBFA 4W9RA 1U8EA 3ILSA 4HXGA 1LBTA 1O6GA 1LPPA 2QZPA 2XI4A 2HA6A 3QMVA 1HQDA 4LXGA 5H3HA 1RYYA 4X93A 1CUVA 1UKCA 4UFPA 1CV2A 3I6YA 4O08A 1MU0A 3EQ7A 1XKLA 1ETHA 3G0DA 4EY6A 3MVEA 4B6GA 1UK6A 1B6GA 4HXFB 3SX4A 4YX9A 5HFNA 4NMWA 3H2IA 4BAUA 3HEAA 5ALWA 2Z3WA 4X97A 2H7YA 2VT7A 2HIHA 2AJBA 3C5VA 4ZV7A 2WKWA 1W6RA 4HTAA 1W52X 3M3DA 2AJ8A 4PV7A 1G42A 1LNSA 4LHEA 1IMJA 1WHSA 2HM7A 3ICVA 1G66A 4X00A 4E15A 2OXEA 5FP0A 1N5RA 1KU0A 4EY5A 1VXRA 2C0QA 3ANSA 4GW3A 3IDAA 1BCSA 5K3BA 1YASA 4M0EA 4UBIA 3HLKA 3DL7A 1RP1A 1QIJA 3OM8A 2XMRA 1CVLA 2XUAA 2OLEA 2OCLA 2WJ3A 5KREA 4KACA 5AM1A 3QM1A 5C8ZA 3QMWA 4QDXA 4Q3OA 1Y7HA 2BKLA 3NWOA 1QIDA 1ISPA 4RE5A 2HFKA 5ALDA 3VJLA 2RHWA 4GXNA 3BJMA 1U2EA 1FFAA 5IKXA 4U2CA 1H2ZA 4I19A 5EHNA 4H77A 2JGIA 3DS8A 5AP9A 1K4YA 1RWQA 2GYUA 2JBWA 5IVIA 4WFKA 5AK6A 1F0NA 5D3ZA 1JFRA 1MAHA 5JASA 4GWLA 1QIGA 3H2KA 2BUCA 1LLFA 4S0XA 3RK4A 5IVDA 5JAUA 2OG1A 3WYDA 3STVA 4M0MA 3D0KA 1TCBA 3HACA 1QIEA 4PSCA 4EZIA 1CFJA 5DYTA 2WG2A 5C81A 3TEJA 3STWA 2I3ZA 1K63A 3S8YA 1UKAA 5JD5A 1YS1X 2XQFA 1LPSA 2ES4A 4K2AA 2J4FA 3WK8A 3A2MA 1DWOA 1W75A 2LIPA 3W9BA 5DWDA 4BAZA 3P2MA 4GHWA 5JD4A 1DINA 1UXOA 4G8CA 4BZWA 3DLTA 1DWPA 4N8SA 5AK5A 2HA2A 2H7XA 2XMCA 4P9NA 1THGA 2DQYA 4CI9A 3V1LA 2HHAA 5A2GA 2J3QA 3C6BA 4GEGA 2RAUA 4B0OA 3AIKA 1MX5A 4BATA 4H7IA 3IUJA 2B20A 5T4HA 4AO6A 1B41A 4OCZA 1DT5A 4G9EA 1QFSA 1Y7IA 3OOSA 2HA3A 3I2HA 3UMJA 2PVSA 1GQRA 2WJ4A 2ZYSA 3L1JA 1C7IA 3E1GA 2R8BA 3G9TA 4UPDA 1TQHA 4J0HA 3HI4A 2DCMA 3WWCA 1W4LA 3PE6A 5FOQA 2QRUA 5EGNA 2DFPA 3WWDA 1XZIA 4U2EA 1ZI9A 2GBGA 2PL5A 1IUPA 2V97A 3WJ1A 3GROA 5HKAA 3R40A 2Q0XA 4XX1A 5LZ2A 4A5SA 5AJHA 2PU5A 5LIPA 1BN6A 5AKKA 3HJUA 2JGMA 3D3NA 3KDAA 5CH3A 1TRHA 1E66A 5CH5A 5LZ4A 4C89A 2Y6VA 2ZVDA 2HU5A 5AKIA 2X8BA 3K6KA 5ESRA 2VA9A 1R3DA 2JGFA 3AFIA 4QLOA 2WIFA 2IX9A 1QFMA 3WLAA 3X3HA 4EY4A 5AOAA 4J0DA 4J0KA 4OB6A 4TVKA 3E4DA 1VZ2A 4FFVA 4FMPA 5AK3A 3FLEA 4AZ0A 4X71A 3I2JA 5CBKA 1BEEA 1XZFA 3MGAA 2VTVA 3AILA 1M33A 3VISA 1LPBB 3WZLA 2QOEA 4CCYB 4KE8A 4AMZA 3CCBA 5CT5A 5CRIA 1H2YA 2OCGA 2FJPA 1C7JA 1HLGA 3CN9A 3B12A 1IZ8A 4Q1VA 2VAVA 3G0CA 2DHEA 1CUZA 1K8QA 3TGLA 1CUGA 2XQKA 5BOVA 2VAXA 4JH0A 4H7EA 4JEIA 3ZWQA 4EY8A 2OPHA 4E14A 5C7YA 3V1KA 3C45A 1EB8A 1UKBA 1VE7A 3FLAA 5CT4A 4LXIA 5JAPA 3O0DA 4PSDA 4N8DA 4Y2RA 3BJRA 5FXMA 2ZSIA 4DNOA 4FNMA 4KE6A 3V1MA 3VJKA 4PSUA 3H04A 2C7BA 1VE6A 4X90A 1K5PA 1W76A 3SC2A 4FLMA 2HU8A 2W22A 4FWBA 1S8OA 3C6XA 4F21A 4NS4A 3IB3A 5LZ8A 4WFIA 3DCNA 5JZSA 2WHPB 3R3WA 5E4TA 4UFOA 1HBJA 2OAGA 3ESAA 2XMZA 4KAFA 2CKMA 4V2IA 1Q84A 4F0JA 4X92A 5LZ7A 2B9VA 4CIAA 3WL7A 1BEZA 1CUWA 5KBYA 3DJYA 4UHDA 4F5ZA 4XWGA 3WIBA 1IUOA 4A16A 5ALEA 1H23A 5AO9A 1HPLA 3FYUA 5ALMA 4UHHA 4X7BA 4HXEB 5DYWA 4ZV9A 4CG2A 2WUGA 1LPNA 1VA4A 1WHTA 2WUDA 4MYDA 5AOCA 4FNGA 1ZIYA 1KEZA 1MO2A 4KYVA 4DNFA 5CURA 3AIOA 5HKBA 5K3CA 1SCQA 2WTNA 1YS2X 2OCKA 2DSNA 2O7VA 3G9XA 1YA8A 1A8QA 3SWWA 5IVKA 4J03A 1JU3A 1QO7A 1P0IA 4WFJA 4Y2PA 1UZAA 4KE9A 3BIWA 1AQLA 4BTVA 4BZZA 2WIJA 5SYMA 1E89A 1J06A 2ZYIA 5A62A 2AJDA 4RPCA 2HFJA 5ALTA 1WPXA 1QIMA 1AX9A 1ZJ5A 5LKRA 2WHQA 5FDFA 5AKGA 4WY8A 3AZPA 2DHDA 2O7RA 4G9GA 5CT8A 1GZ7A 4XIIA 4G4GA 2XQGA 2XUGA 1IUNA 3LIIA 4MQLA 5AKEA 2PSDA 2CUTA 1ZIXA 3QPCA 1OXMA 3QYJA 1CUUA 3FSGA 3AIMA 5T4FA 4HS9A 5AM3A 4C87A 4AX4A 4X6YA 3WKEA 5SYNA 1MNQA 1AZWA 2JIDA 2WUFA 4IH4A 1CUHA 2OQIA 1C4XA 2RONA 4UUQA 2XMBA 4ARAA 3FYTA 2O2HA 4YK7A 3H1AA 1VZ3A 3PICA 3L1IA 4BDSA 3QITA 4DYHA 1XLUA 1JJIA 3FOBA 3H1BA 2ZSHA 3G7NA 1XZCA 3FCXA 2VT6A 1UOPA 3O4JA 4H7KA 1J07A 3WL6A 4GLBA 2BUBA 3ESBA 1YCDA 2WHRA 4QDTA 3HABA 5HK8A 1QJ4A 1CUDA 3M82A 3I6ZA 2PBLA 1Q0ZA 1VLQA 4U2DA 3F96A 3W9UA 4J7AA 1ZJ4A 1T4MA 3WA7A 1R1DA 4G1FA 1U4NA 4H7DA 4BP8A 4X85A 3IA2A 2G63A 2JGEA 1VJ5A 2YXPX 2I03A 4B84A 4Y2JA 4E11A 2Z8XA 5AM2A 3BDVA 4B0PA 4H0CA 5A6VA 3OG9A 3K2IA 3C5WP 1AMNA 4BTLA 1PFQA 1MN6A 3IUNA 5JYCA 3DOHA 4ARBA 5FUMA 1QOZA 4FLEA 4RGYA 3I1YA 1AUOA 3C8DA 1P0QA 2WM2A 2CBGA 3BL8A 3I2FA 1QIHA 4Y2YA 1FFBA 3RARA 3FVRA 1DT3A 1PV1A 1I6WA 1QGED 3I2IA 4C4XA 4WJLA 3VVLA 1A7UA 3EIOA 4OB8A 5DTJA 3V48A 2JGKA 1NX9A 4P08A 3EQ9A 1JJBA 2X76A 3STUA 3ZLUA 2G4LA 1XZAA 3ICWA 5EHZA 3F67A 3H19A 1WB5A 1ZGCA 4FTWA 3PF9A 4WDQA 1IVYA 4UBNA 3QH4A 5CT6A 4QNNA 1CUYA 2EEPA 3D5EA 2Y1KA 4N8EA 3WK7A 1KU6A 1XROA 1BU8A 3IURA 2FJ0A 2VF2A 5CH8A 3KSRA 4GECA 4AZ3A 3H18A 1JU4A 4DLNA 3G8YA 3C6YA 2AJCA 4BRSA 2HU7A 2VQ6A 1UOOA 3WKCA 5AICA 2NW6A 1BN7A 1X70A 3EF3A 2WG1A 3DNMA 4QDZA 1XQVA 3DYVA 3PUIA 5DJ5A 1XQWA 3BIXA 1UFOA 4GDMA 4MJ3A 5E2IA 5AI4A 2WFZA 4IHAA 2XMQA 5I8PA 1L7AA 5ALZA 3WJ2A 5A7FA 3LP5A 1T2NA 5AI6A 1P0MA 3EBLA 5K5EA 2XUKA 4NZZA 4HZGA 1NU8A 2OCIA 1ZI8A 1JMKC 2BUAA 1Z68A 2CB9A 4DIUA 1CUAA 1DX6A 1Y37A 4ROTA 4KAAA 3DL4A 3N0TA 2IITA 3G0BA 4IO0A 2AJLI 3CXUA 4AO7A 2CZQA 4U2GA 1ZOIA 2C5GA 3OC0A 1E5TA 1MNAA 2RI6A 5IH7A 4ETWA 2I3DA 5EI5A 2XMGA 3LCRA 3WIOA 3RKSA 4FFWA 5ALXA 4G4IA 1FFDA 5E4YA 4ZGBA 1VKHA 4BCDA 1TAHA 3PI6A 2QKYA 3WKAA 5I7UA 4B82A 2YH2A 4J0GA 1XZMA 2ONCA 4KAJA 3WWPA 2XDWA 2XLCA 2XUFA 1TCAA 5K3EA 2FX5A 2WFLA 1ZICA 1BROA 1AKNA 1XZLA 1CQWA 3FSGD 2RGUA 3QVMA 2G5PA 3WK4A 2OGSA 4AXBA 1H2WA 1A8UA 5JAOA 4BBZA 3G9ZA 3IUMA 2PUJA 2X5XA 3FVTA 3HZOA 2GZRA 1XKTA 5JATA 1EH5A 2WU3A 4DTCA 1TCCA 5LKAA 3O9MA 2HRQA 3YASA 1QZ3A 4MEBA 4UHFA 1EB9A 1EK1A 3PF8A 5ALNA 2YASA 3S2ZA 5JZBA 2GZSA 3UUFA 2XB6A 5ALHA 1QTIA 1XZHA 4ZI5A 3H17A 3HXKA 3M81A 5K3AA 1XRNA 2JGLA 4PW0A 4G4JA 1SCKA 3DEAA 4AB1A 3R3YA 2OQVA 4BVJA 4QWWA 1GPKA 2XLBA 3FYUB 5FLKA 5YASA 5A7GA 3OPMA 3ED1A 2XQIA 3HSSA 1XQYA 2DR0A 3A2LA 4U2FA 3ZV7A 2JEZA 4ITVA 1CUCA 1L7RA 3FBWA 5FV4A 4BVLA 4WY5A 4AMYA 4N5IX 5JALA 4Y2UA 3O4HA 3VKFA 5C8XA 1JKMA 4KR0A 5AH0A 4QLAA 5ISMA 1CUBA 3GELA 4MXDA 1WOMA 5LYYA 3GFFA 1ZD5A 1MX9A 3IIIA 1XRRA 4E46A 3WWEA 5AKHA 3F9CA 4H7FA 5ALKA 3GBSA 3AUKA 3LIPA 5A71A 3G0GA 3GZJA 4BVKA 1G4HA 4B80A 1GT6A 4ZRDA 1UK7A 3GUUA 1J1IA 2VSQA 2ZJ7A 3I1IA 3EQ8A 5HQ3A 1A8SA 1AC5A 3G02A 4CFSA 4QE3A 4FBLA 3WWOA 5JD6A 4Y2XA 3WYNA 2JF0A 1JJFA 3U0VA 2OAEA 1EK2A 1ODSA 5DNUA 3BF7A 4WCVA 4K6HA 1JT2A 5A7HA 3WA6A 4P92A 3PDCA 1EI9A 4D9JA 2V98A 3A6ZA 4BE9A 4W1SA 4KRXA 2V9ZA 1XRMA 2XUIA 5T4BA 5CT9A 1F0PA 1XQXA 4BRZA 4I3FA 4DM7A
chains in the Genus database with same CATH superfamily
1F6WA 2IH4A 3GBPA 1AQUA 2NXNA 1B26A 1L5KA 3T35A 3GEDA 4CDGA 3NT4A 4LV5B 4R31A 3Q4GA 4DCGA 3MQ4A 1ISJA 2YV4A 1UQTA 2GXUA 2ZAGA 4QFMA 4L4UA 1JR3E 1YNSA 4G41A 4RY8A 3GB9A 3QLTA 4TVOA 5EMMA 1AJEA 4PZCA 1GSAA 3K6JA 4K81B 5JSUA 2C5AA 1X8LA 2XKJE 2Y0CA 1KZ7B 1UCFA 3FGZA 3K0FA 3PRKE 4V0SA 2CUNA 1DWQA 1R8SA 1DRWA 3A1EA 4LMPA 2VJQA 3DQPA 4GKAA 3Q3GE 4DPLA 3QE0A 3HDVA 2W6NA 3V2GA 1BE0A 3G2KA 4UNSA 4BQEA 2VH1A 3PXBA 4J4HA 5JO0A 2GOYA 1AHPA 2AUMA 4H1HA 2BFWA 4IDNA 2ID8A 3F74A 3VSDA 1J2UA 4OPMA 3NHYA 1A98A 3GQVA 2PX2A 1KL7A 3K9QO 5HM6A 1Q7BA 2Q46A 4X20A 3NYRA 3F2IA 1H8HA 2UUCB 3C39A 4JJEA 1FMLA 3IIKA 1RM3A 2AD5A 3O1JC 2XT0A 3QE3A 5SZJA 5DVZA 3ZE0B 4BFXA 4NZ9A 2QVLA 5CFNA 3U16A 3NHWA 1QBKC 5BW6B 4F1KA 3DWIA 3KZVA 1R0LA 4WX2B 3WOVA 3M6XA 1KJQA 1XJ5A 1D6NA 2AI2A 2VJLA 5M3BA 1I94B 4A2QA 1U5CA 3MMZA 4HYEA 1EVQA 4RY2A 4BUJA 4YTEA 3ZWMA 4DFDA 4Z86A 1UM9A 1E9CA 1G8GA 1ZUNB 3L0YA 4M36A 2C9CA 2P2LA 2QXUA 5AOBA 3N8KA 3MCAA 1TM4E 4Q9HA 3VNAA 4DV3B 2I4OA 1M5UA 3DWEX 1M6NA 1Y1QA 3R3XA 5MN5A 3PQ3A 4CDNA 1RJFA 1QXSA 3HFSA 5AXCA 4BWVA 5C2JB 4G8JA 4MW5A 4YASA 1EINA 2IS2A 5CNIA 1Z08A 3NRCA 4U02A 1JKJB 1QPGA 1XC7A 4A6PA 1P74A 2HQBA 3IHWA 4HWRA 3T1OA 5IJZA 3N53A 1DQYA 3DAPA 3NIBA 1DO2A 1VLVA 3DNPA 1EM6A 2EW2A 2ZUCA 1G7CA 1TYCA 3BXFA 2XVZA 1WW2A 5CEEA 3HI6A 3LNCA 1Q7GA 1PFYA 1SKAA 4O2RA 2ZXUA 4OQNA 5DRYA 3FKJA 2QMOA 1CS0B 4KUEA 4C0LA 1S2IA 2YYSA 2Z5VA 4L2IA 4I8IA 4H35A 4UE2A 4ZQCB 4HEHA 3QVVA 5LU8A 4W1RA 1FNDA 4FZ3A 3W3AA 4TYPA 5F1OA 2HRDA 4YO8A 4URYR 3AF6A 2QJFA 2NSHA 3ZQ6A 3W8FA 3G3EA 2PUHA 2VPXA 2QT1A 1YRQA 3L4BA 2HTEA 3CH4B 3F78A 2NVBA 2C1XA 3MMPA 1KBOA 2XNDD 4G65A 4UAJA 2DG2A 5JADA 1N1GA 1GTRA 2J6CA 1VRVA 2ZJ6A 2VNSA 3D7RA 5EFZA 3UH0A 1JBKA 1LV7A 3EDQA 4BV9A 3STYA 2JAHA 1IZYA 1G4AE 1VI2A 2B8JA 2WIGA 1EXDA 5TQJA 1JEQB 4AP6A 1E1MA 4D9HA 5KVAA 5DNCA 4S2UA 2PSJA 4M4SA 1SKBA 2NTYC 5KCZA 1M10A 2VPQA 4B5KA 2HBQA 3RYHA 4FB4A 5C53B 4R5MA 4D9FA 4PBRA 1DIGA 2PV0A 3L0IB 1R88A 4JYBA 5K8IA 4K05A 2PANA 4UVDA 1XWFA 1NUTA 3BFPA 4ZOLB 2WT4A 2AFIA 3GA7A 4AZ3B 1QHEA 3QU9A 4QBHA 2GGSA 4Z51A 2IC5A 3GWGA 1T3LA 3ND5A 5A5GA 1PR0A 3AINA 3QF4B 3CINA 4GG1A 3T61A 1QX4A 2BT4A 4D0RA 1OHHA 2B1GA 1M2EA 1ZD2P 2HA4A 3AVQA 1VHLA 4JKYA 1E6CA 1JVBA 2Q3FA 3TPCA 3JQ9A 3D2AA 4HDMB 4TRMA 3I9MA 2ZIFA 3QVJA 3S2EA 3GJ6A 5F3RA 4ERXA 4F4FA 2ZXFA 1LRLA 1TLLA 3MJ4A 1G9XA 4DNQA 3QUBA 1GNPA 1L0BA 2WJPA 4OD0A 3IAM6 2PBFA 2WZDA 3KVNA 4M0PA 3WLLA 4K1XA 1T4DA 4FFRA 1B0ZA 1KAMA 1QV7A 2OHXA 1XWWA 3L5OA 3N58A 1RWWA 4HHEA 4Q34A 4BMYA 1P6XA 4PAOA 1H42A 1WPRA 2IS1A 1GPAA 1ECLA 1M2FA 1O9GA 2EDAA 4C7KA 4DMKA 3SXJA 4QVGA 1XAHA 4CF7A 2GYWA 2MSLA 3PKZA 2Q07A 4CWAA 2NP7A 2J3HA 1JMYA 4DWJA 1P4JA 4B85A 1P1BA 1RWPA 5EYPA 2XDAA 4JOSA 5F4ZA 1EQ2A 3RGGA 3T3MB 5A0VA 6ADHA 3D3JA 2NSDA 2ZIGA 1W36C 3A1UA 3UQYS 2UZ0A 3V32A 1PNTA 2WHEA 5A4IS 4RTLA 1XLVA 4I9NA 2Z8ZA 1PBTA 2J0VA 3DMRA 4DB4A 2BGNA 4PC6A 1T34A 2VWQA 3P9IA 4BDTA 3E9YA 2VJYA 1MD9A 1YC5A 4XJVA 1QHXA 2DHRA 2PGNA 2Q0SA 1ZM7A 1T9HA 3U1TA 4RELA 3H1GA 4E08A 4ZAZA 1EDZA 3FDXA 4LYDA 1V5FA 3ANTA 4MGEA 3ZHRA 1S7CA 1WY5A 4IP0A 1EZ1A 1BA2A 2FGKA 3LQFA 1TJNA 1M8JA 4TL9A 1TT7A 4ZTBA 2R2GA 4FQ7A 2AC7A 1BO6A 3IFSA 3WG9A 4IICA 1H94A 2ROQA 5KOJB 4PZYA 1JHYA 1NVVQ 4K9KA 4BFLA 4DNXA 5C32A 5LNK6 1JQ3A 3S1SA 1YCFA 4NNJA 5CYGA 2RHBA 2IT1A 1MPXA 2VK4A 1SPBS 2JS7A 4LYFA 1PYOA 3NHUA 4YAJA 5KOIA 2IHKA 4PC1A 4HX2A 4RMHA 1BRTA 3UBTA 1X7YB 4R8VA 3CE9A 3TJZA 4NE7A 3BEDA 2PCLA 3L7JA 3QKUA 3QOWA 3VNQA 3ETJA 1DADA 1GV1A 3W0LB 4F46A 1MZVA 3HYCA 2XY4A 2BJHA 3ZH9B 1XZQA 1REQB 1MOQA 1PR4A 4CKZA 2FMTA 2XWSA 1SQFA 2GYVA 3TTXA 2UYQA 3FVVA 3MUOA 3GOHA 3RRYA 1G63A 4D9KA 3JATA 1Y82A 1OWPA 5IT5A 1DPFA 2QYTA 1U0LA 3JQBC 3NWPA 3LD9A 3TG8A 2WF9A 1B8NA 4ZZ2A 4DMMA 4V02A 3KSBC 5BT9A 2XIQA 2G7ZA 3V9AA 2C4UA 1NJ6A 2PXCA 2PG3A 2WWTA 3RQIA 2A0FA 2HAEA 1KO8A 3RKUA 2YWRA 3T7SA 1F2UB 3DF7A 4I4TF 1Q1AA 3H84A 4F8JA 5BRJA 1E96A 1P2FA 1P81A 4NAHA 5JLJA 2RC5A 2ZTHA 2V5VA 5FPYA 3ILXA 4D45A 4B74A 2QR2A 3BHNA 3STTA 3A9RA 4X3OA 1OLOA 2SKEA 5B1EA 2NYRA 3DMFA 4X1OA 3TZCA 4DILA 4I1OA 4HN2A 1W4RA 1L1FA 3AF0A 3T12A 5HUJA 5E6SB 3MUEA 3ZWVA 1HNWB 3ZDCA 3ANNA 5C51B 1PGNA 5AI8A 2OZLA 3ZHVA 3IHLA 2WJZB 3PGMA 2GF0A 3E5NA 2HJRA 4LJRA 3VKGA 3O9VA 4WNYA 3GLQA 4MRMB 4UC0A 3LLUA 2P90A 4YUWA 3NGMA 1ATZA 4N4AA 4IFIA 1GPNA 1I2CA 1K75A 3LUCA 1Y3BE 3PFNA 1O6BA 3T4PA 1IQUA 1D2RA 2D5AA 2X5JO 3UH1A 4AQDA 1CD5A 4IV5A 4ND3A 1G291 2ZRIA 4Q82A 2ZE7A 2IRWA 1SD2A 1SVWA 5BV8A 1PKEA 1PFWA 5B64A 2G6TA 4ACAA 4PGGA 5KSOA 1FYWA 2AN3A 2ZR9A 1ZK0A 3C1OA 3QE4A 4L27A 4CU2A 4EY7A 4D8WA 1T6NA 1SU4A 1FRFS 3BREA 4KQWA 4DADA 3LCUA 2O2IA 2V03A 2P1DA 4IQFA 3REGA 5M04A 1L6RA 1W1WA 4HGYA 1KC1A 3L6BA 2VEDA 4V03A 4NJOA 2TECE 2PV7A 5G41A 4KRFA 4F97A 1SU6A 2V7WA 3NVMB 3TAHA 4U00A 4B76A 5EJAA 1T5SA 4Y9RA 3ESRA 4NBRA 1C0KA 1QF9A 3AZOA 3BK7A 4OXRA 3V8VA 5J2UA 5TT1A 2JH8A 2DBVO 1BU5A 2XE6A 1YQ9A 3TNLA 4RNCA 4GYJA 5HGXA 3AL2A 3AVOA 4ZCSA 2L17A 4P32A 1BHQ1 4HAIA 3KFVA 2QV0A 4RHYA 5SICE 1A2KC 1BVUA 2JLQA 5DHRA 2XZTA 1WA5A 1ZK1A 4M21A 1W2GA 4X91A 1JR6A 1ORWA 2QJWA 4Q7JB 1QC5B 5JSYA 4YRSA 1KQOA 4LKOA 1UT6A 3KXDA 3RGWS 4UBLA 4HB3A 3ZS8A 1T35A 4B75A 1DKPA 3CSSA 4CFZA 4PC3A 4H6XA 1SVSA 3LMKA 5DB4A 2BTQA 4D57A 4DXAA 4TM8A 4A5OA 4N5HX 2M32A 4RK0A 3FTEA 1OFVA 1TQ8A 2UYYA 3ZH2A 3ZW8A 3KS9A 1CJKC 2HF9A 4EYKA 2ZSAA 3NBYC 5E4FA 3IMFA 1L1QA 3WGLA 1CYEA 4QTTB 3F5QA 3GLIA 4BE4A 1CEXA 5KU1A 1AA6A 1OZAA 4NBLA 5FBKA 3V80A 4PZ0A 5D3KA 5BSKA 2PTHA 1W0JA 2QTGA 2DBRA 3R0VA 4URHA 2IV2X 2VT2A 3TRHA 3V42A 2BHSA 3RG8A 2EZTA 4ED9A 1RJEA 2VHTA 3ER6A 4AJ4A 3HSYA 1ZR4A 1AV6A 1G8AA 2AL7A 2NO5A 3HNRA 3Q72A 5I48A 1I0ZA 1P2VA 2Y93A 3E7FA 1ZRMA 2ECQA 4L07A 4Y8VA 3DYIA 4LEIA 1CEYA 2P0AA 2XA2A 2Y6UA 3H2JA 4JYPA 1H8HD 2HRRA 2Q7DA 4GF5A 4J0CA 3AZQA 4PF1A 2A57A 1R6VA 4AJLA 3QIAA 4OK3A 1ZN9A 5JMWA 4NXMB 3ZGLA 1KPIA 2FPPA 3O8NA 3RYIA 3FR7A 2J08A 3WISA 2EERA 3ND8A 5G2OA 4JK3A 3DZBA 3HCFA 4ZO6A 3M70A 1D7AA 1XAGA 4LX0A 1HNZB 2H7CA 4RKEA 5DHAA 3R09A 4G0VA 1DDGA 4GMXA 4BX3A 4ZAVA 2RH9B 3ZI7A 1WD7A 4HVLA 1T1RA 3LFTA 4MVJE 2H0QA 3CKMA 4WAUA 2QAGA 1KXZA 2PMKA 3D59A 4X3CA 2ADMA 2P40A 1YVUA 2X23A 3CJQA 1IZZA 4YDRA 3RLIA 4KR2A 3LT2A 4RGQA 4BMCA 3OP4A 1AGXA 3E3AA 3DTTA 4NH0A 1M1NB 2VRBA 3CX3A 2IJGX 3ENZA 3P9KA 2H9IA 1J70A 2PWYA 4O4LA 1P4RA 4UNRA 4F3YA 1DIHA 4WXHA 3U3ZA 3SHTA 4DYDA 5F9MA 2E9SA 5JANA 3LUJA 3UJ7A 1N2CA 2WWWA 1A1SA 4NDAA 2BDEA 3BE6A 3K96A 4O2BF 3A26A 2AFHB 1LKZA 5EKTA 1NF3A 2JI4A 1NQUA 3BD9A 2QX8A 3A6GA 4JEUA 3W90A 1AMOA 3E9DA 3HKDB 1JE0A 3W3AD 4S05A 1RVDA 1IBKB 5M29A 5EJ6A 3FG9A 4MUMA 4LJAA 2D4AA 2CZCA 5CCEA 2XAAA 3OZVA 3O90A 3PT5A 4GH5A 2CNLA 2PKYX 4ZVSA 3U39A 3OQHA 3PR1A 1EDEA 3TTUA 4TGLA 4B81A 2ZPUA 3VZCA 1DBVO 1TF7A 1TJYA 4PE5B 2Z4RA 2X9LA 2DJIA 5FYDA 2INGX 1HYEA 4DLVA 2I80A 4GP6A 3DHWC 2WOOA 3EF0A 5EUQB 1DRUA 3UCEA 4B31A 4EP1A 4WKBA 4UMEA 4H6WA 1EDDA 4A1FA 2RIPA 3U4HA 1FUEA 1ORVA 4ARZB 2Q2QA 5BVGA 2VRWA 4QEKA 3CRQA 4A7PA 4ARCA 1SD1A 1FFYA 2QF7A 1L1RA 2OV2A 3VMFA 5LXTA 1ZA1A 4MQFA 5CJPA 2WTBA 3M1IA 3RC3A 3ANLA 1L7XA 1U3TA 4GXQA 2OE2A 3HBJA 4QYIA 1AK9A 4XW2A 3JQGB 1BQ4A 3NXSA 4J3NA 3RKRA 2LKDA 2QM3A 5J47A 3O38A 1VTKA 1RABA 3FZGA 1OHHD 2WD9A 2PQ6A 2A5GA 2JLRA 3KXPA 1CVIA 3EVBA 2HRCA 3H3JA 3EGOA 4YQFA 2P3LA 3RIGA 3RW9A 1KFEB 2R6ZA 2O57A 4OUKX 1ULBA 2YUTA 1D8TA 1OILA 4R4JA 3BX1A 4LI0A 4RDIA 4F2HA 3K1AB 1CF9A 1EE1A 1ZHFA 4R7ZA 3RC1A 3IMKA 2M9MA 4EABA 3U19A 2RI1A 1FZQA 4CYMA 1N1MA 1NV9A 1Z2AA 3B3GA 4JNKA 5FBRB 5FKJA 4CG1A 4Q66C 4AJKA 2JCYA 3B7WA 2GSWA 4QJIA 4EECA 5AHKA 4JUFA 1QG2A 4HWTA 4KXUA 3HCOA 2XTNA 4QQ8A 4LFCB 1E7WA 3K8YA 3W5AA 3N2ZB 1L3BA 3LPNA 3ZDEA 1VGQA 3KYDA 4Q05A 4UZSA 1GV0A 3BOSA 4YJ2B 3AVYA 1U8YA 3BB4A 3EVEA 3WIUA 3QVLA 4N47A 3IPYA 1E1LA 4NJEB 1EQUA 3DKPA 5C34B 1ZISA 3K0BA 2QXTA 3VR4H 4ZGGA 1Z3CA 1IJKA 3TKLA 3TZEA 5JWRA 2EVWX 4TKVB 2NXWA 1MOZA 2I6UA 2YJGA 5GPBA 3HUFA 1CR1A 1DHTA 4NENA 3ZLVA 2WP8J 2WSMA 4N7BA 4I7EA 4PYMA 3RG2A 3G9QA 3FAKA 2OUKA 2C3UA 1I9CA 1OI2A 3GFSA 1RCUA 3H16A 1D4AA 4DR1B 3IP6A 3GLGB 4X1KA 3F6EX 4JFAA 4G36A 3IUQA 3BE8A 4TV9B 2O3RA 1YONA 2BSXA 2KBEA 2RGEA 2YWEA 2XZOA 1RPAA 1MH9A 1P91A 2Z2JA 2YN0A 3DMDA 3G2HA 5DOVA 4YRZA 3PFFA 1NPTO 1XD8A 2VF5X 3AWIA 5FPPA 1JHZA 2ODQA 1ZBQA 3ZIUA 1E3LA 121PA 3G0IA 3F0TA 3OJLA 5I9TA 3K16A 2GB4A 3VH3A 1OXKB 3E03A 1B3BA 2I6XA 5K01A 1QSGA 1VCMA 2IYXA 3TRIA 4EG4A 2J5XA 3QFFA 1QYRA 2VNHA 4M1KA 2J46A 2BGKA 4FFSA 1JECA 2YXLA 4RZ2A 4LXTA 6NULA 5KTPA 1P19A 1UMCA 2AC4A 4EYSA 1XN4A 2IKSA 1SUCA 4FYYA 1Y4AE 1CY0A 1S8AA 3ZHXA 1KS2A 1AXGA 4DIEA 4WUTA 1J8MF 1ZJWA 2C57A 4R16A 5KPJA 5FRDA 1BXZA 2HXSA 3HRHA 2GCOB 4JXZA 1F2VA 2DQZA 4R05A 4BAGA 1MABA 2XDYA 3ETCA 3PUHA 4PTYA 1WD5A 1P61B 5JH7A 1T24A 5BXQC 2QJTA 1A7AA 3DVSX 3IBYA 2WU1A 2OKGA 2WABA 2Z8YA 2UZ1B 3CG0A 5CG1A 2GN8A 4BMSA 2Z6QA 4GXRA 3RODA 2EEZA 3RUIA 4ZYLA 2JB9A 5GOZA 5TGTA 2B2CA 4YAKA 6REQB 3U1BA 1QIKA 4MUKA 5AW9A 2FZEA 3IA7A 3OOHA 3PQ6A 2QG6A 1OCEA 2G09A 1Z5PA 3SS7X 2HRZA 4NSNA 3WYGA 4E7OA 3H11A 3R0ZA 5KC9A 1CUSA 1M34A 3DT6A 1TZKA 2C8LA 1PFUA 1SFRA 2DMRA 2I1VB 3JALA 3E9CA 4HWKA 4GM4A 4AG5A 4B4KA 5COBA 3ONWA 3EPRA 1KJ8A 2AQKA 2G1PA 4N48A 1PVOA 4IUCS 4IIHA 2WM8A 4C0KA 1NASA 2IPOA 2QQ0A 2W2LA 3HKCA 1OAOC 4RA6A 2H07A 3HXMA 4DC9A 1QE3A 2C98A 1HQYE 1PG5A 4TT3A 1BDIA 2EHDA 5BWNA 1K2WA 1WR8A 4I1YA 2F59A 2H0RA 3E18A 4KRYA 5G3YA 2PX3A 3BC1A 4G5XA 4B3GA 4YMLA 3ZJVA 2R87A 4UTNA 1GWNA 1CCWA 3PG5A 2FOLA 5G4KB 5TQ0A 1F3OA 1IPHA 4I6EA 2Q5FA 3K05A 4ZQHA 5DLPA 2GF2A 2VDWA 3EPJA 3WRVA 3A9CA 4CV1A 4KUGA 1G64A 4UPVA 2WUEA 1SM4A 4UU0A 1E61A 4O6VA 3WZMA 1CKEA 4YRAA 5F7OA 3EWSA 4LIPD 4DHEA 4CMHA 4OQLA 4IOLA 4AZWA 1OASA 2FEXA 1UC5B 3FCEA 3K70D 4KWHA 4NCNA 4EB6A 4IHJB 1MJNA 1N9KA 1H2XA 1QORA 3JQDA 3OOWA 4MUNA 3H8JA 3TQHA 2UVQA 4A8JA 2JG3A 5BN4A 1V26A 2X1MA 3WLNA 1W1UA 4ZVUA 1WSAA 2GQ0A 3SQXA 3ZWOA 4ITUA 2PH1A 1R4ZA 2WIDA 2ZT7A 3QOXA 1CY6A 5DTEA 5HGJA 1A8HA 4AMUA 1CJUC 1RYBA 4U7JA 1RXIA 2R2AA 2CFRA 3HBAA 1ZG3A 3S81A 4DANA 4DT1A 5CNMA 1O5OA 1QKJA 2BN4A 3BJIC 3F9IA 3KXIA 4K7JA 3MWDA 4DLYA 2FXIA 2R5NA 4J76A 4GOKA 1JZQA 3MXOA 1UEXC 2B8TA 3KKNA 3WC4A 4C04A 3W7BA 2W6IA 3IS3A 4PHFA 1M72A 3FGPA 4GGOA 3L7KA 5IJ9B 3EVNA 4B33A 3E7WA 1E59A 1KMHA 2I76A 1N2IA 4O4IA 3LVFO 5BT8A 5FF9A 5I9IA 1JR3A 2HZBA 4MP3A 1Z7EA 3ZV5A 4PIVA 2BDTA 4ER3A 2VYNA 1K4MA 5JQGF 3ABOB 3TFOA 3GLGE 4FZVA 3H5IA 3BXEA 3GZNA 3FSJX 1I4DD 2VI5A 3GI1A 3EGWA 4HNHA 1JB1A 1XN1A 5JI2E 1YOVB 4H4EA 4R1NA 1W0JD 2JAUA 1JAZA 3QJGA 4QG7A 1UBJS 3TH5A 1OH5A 5E9QA 2FW6A 2OBFA 3QLUC 2J3KA 5G0VA 2NXJA 3I6BA 4FDMA 4FFDA 2JHFA 1IBSA 2I54A 5F9FA 1XI2A 1JHMA 1DC4A 2FI1A 1BNCA 4UVIA 3T7AA 3ELWA 3EASA 3E0QA 4L3OA 2CHGA 1KAEA 3ITNA 3Q1LA 1U7OA 4XSGA 1C4OA 5FBVB 1YK0A 4D0LB 1U99A 1MJ5A 2OG2A 3M83A 4NFYA 1JG7A 3A1SA 1CJCA 3Q8XB 4HQLA 5FWDA 4MYTA 2FW9A 3GW8A 5C8DA 3UXMA 1YQEA 3KEOA 2Y9PB 2R7AA 5IC4A 3FTQA 2XZLA 2ILVA 4WN9B 1TPZA 4WASA 2HDWA 3AW8A 1RVV1 3EFBA 3IUSA 2G36A 1LZKA 4WKOA 3GRYA 1MCZA 2PX6A 1F8YA 2PT5A 1Z6GA 1NZJA 1JKIA 1FYXA 3CF0A 4IEFB 4YCJA 3N2EA 3Q40A 3DPIA 3KV3O 2JATA 4DEXA 4I3HA 3JX9A 1DU4A 1LCIA 2ETVA 5E7MA 4DVGA 1UBKS 4N0MA 4KDEA 3BORA 1M7BA 2V7VA 3PD7A 2FUKA 1GNQA 3KTAA 5KNDH 1YZTA 3VPDA 1QAOA 2I66A 4KDCA 4C88A 3BILA 2CC2A 2I5PO 3IE2A 4DKJA 4L8YA 3DAOA 3PUWA 4FSXA 3RF7A 1CULC 4P38A 2C9ZA 1QIIA 1ZD9A 3OT5A 4OU4A 4QWMA 3RVBA 1YL6A 4RH0A 3DV0A 4DV2B 2YDYA 2HWWA 3K5IA 2JRCA 3R4CA 4UHCA 3VXKA 3EWIA 1E77A 5IFLA 2X9VA 1FSSA 2RKBA 2XXAB 2JFUA 4KLCA 2ZJ4A 3QOFA 4Q01A 1ISRA 2IOYA 4CKWB 2MSDB 2XMDA 4PM4A 2BHTA 3H7IA 1OFTA 2EBWA 2GX6A 5FHRA 2JLYA 1XZKA 4Q7EA 1FXWF 1ZNXA 1IG0A 3HWX1 2WTAA 2AHOA 1LD3A 3IP8A 1U2GC 4Z0NA 3L07A 3SD7A 1QRUA 1QHNA 2FP4A 1BMTA 3E2PA 3HA2A 3QUTA 5CJJA 3RM3A 4S1NA 4DV7B 5IKEA 1UJMA 4IIFA 2C9OA 1FMJA 4YP1A 3ZXYA 3WZ2A 1KNXA 2HF2A 4WA8A 4B7ZA 4F38A 3KT3A 3IAFA 4QXMA 2FX3A 3A3YA 4JVOA 1VL1A 1ZA2A 2R8RA 4HEJA 4TOIA 5GV8A 4BFUA 3JWEA 1T4CB 4MI1A 4UHBA 2ZYAA 3C3BA 3TZKA 1C8KA 1PR2A 2C0CA 1LXCA 3NHMA 4D3XA 4D3YA 4ESVA 1Q74A 3AJ8A 1V3TA 3TLMA 1IOWA 1WOYA 2GZ1A 1BE6A 4YEDA 4CRWB 1K3TA 5DCWA 2VUUA 2OFWA 4H1UA 1PS8A 1ZI6A 1O3YA 4F4CA 2TYSB 3CY6A 2HHHB 1Y1KE 3BA1A 3MINA 1KBZA 3DZ8A 3T9BA 4X64B 2BHRA 2IYAA 2JFYA 3MPUA 2E6KA 2C7OA 1SULA 2OQ2A 4EO4A 2UVPA 4YMIA 1K0FA 5DCLA 2VEOA 3D3WB 5BV2P 3RD5A 4YN3A 3ZC3A 4E1AA 5DBEX 2XAUA 3NNDA 5TJHA 1VDZA 4RD4A 4WKNA 5CMLA 3ZIAA 2HUPA 2YUIA 4MMZB 2PEYA 3RRXA 1J21A 1DZIA 2JCVA 3GQBA 3V8EA 4IDAA 3OD1A 1BJRE 4Q7QA 1XSEA 4UCXA 1JWLA 1KMCA 4K1LA 4KO2S 4WKCA 3B36A 3I9OA 3O1IC 1FUYB 4Z0TA 5KNLA 4HQRA 4HXGA 1LI5A 1G2QA 1N9ZA 2GERA 2R1TB 4GLJA 4IXMA 4MS3B 1SK9A 4H3HB 1O97D 2P4HX 3LVBA 1JHAA 4AJHA 4BLRA 5LLDA 1LPPA 4D26A 1K9VF 2QZPA 3MJSA 5EE0A 3EDYA 2D5CA 3U7QB 1WSDA 2OB1A 1LJUA 2IU6A 5FTMA 1YI0A 2IUSA 3QMVA 4I1RA 1E4OA 2J9RA 3IUYA 1E0DA 4LXGA 5FWXB 3OEED 3UK0A 4AWAA 3NQ41 4LGYA 3OPQA 4BLQA 5B6PA 1EK0A 1J22A 5D85A 3GWZA 2JARA 1RHQA 3ZV6A 2YOHA 3B89A 2IHNA 4NQZA 2BTEA 4L15A 4XDZA 3WGVA 3JD3A 3N2GA 1C7ZA 3IEUA 4MMYB 4BP3A 3W2FA 3EQ7A 2ZE6A 2MWMA 4F4IA 1XKLA 4M1YA 3G0DA 1P5RA 4ACBA 5L3SA 3R77A 1TJ3A 4MW0A 4B4WA 2N0SA 3EZXA 3MVEA 4JQYA 5AT1A 2NIPA 2HBZA 4YJ3B 4IY1A 4YECA 4MVCA 5JXWA 4HXFB 2A88A 1Q7EA 1P1IA 1YB1A 1YS6A 2E1RA 5H0IA 5CAEB 4PTZA 3RTEA 5IBCA 1B1AA 1LTQA 1RAHA 3H2IA 1H9CA 5AR1A 2NNWB 4X7MA 3AM1A 4QOJA 3UW1A 2GPNA 1LK5A 1WZIA 1E60A 2OM2A 4BL5A 2BGUA 1TAUA 1JPNA 1KI1A 2C5SA 1QRAA 2FPGA 1YWGO 1O0CA 5BSFA 4DJTA 4JDUA 4M0LA 1GRVA 2IHTA 2W00A 2DQ4A 3SF0A 4D5EA 4EI7A 1W52X 4M7WA 3NV7A 1ZW1A 1OH7A 1GZUA 2XDQA 2R6GA 4MVWA 1JV2B 2AJ8A 3A3OA 2JHPA 4O59O 3LUFA 3ZX5A 1JEJA 4XQGA 3EPLA 4PZLA 2HUNA 5LOVF 3NT5A 4COKA 4IGIA 2I71A 5E8JA 5F23A 3C74A 4GOND 4BU1A 2HLDA 3TM5A 4YNBA 3VOSA 3A11A 3VBEA 3LYHA 1NFRA 3C3KA 3W4IA 4WECA 5TRTA 3OFVA 2J6HA 5FP0A 2AN1A 2BFDB 2C7RA 2I2WA 1KRWA 2HKIA 1P7YA 3PQ7A 1Z25A 5AJWA 2AG8A 2Z9CA 2G9UA 3LH5A 3ANSA 4JBLA 3NBAA 4M0DA 4TWRA 5A6SB 5C1PA 1BVRA 4IL5A 1R8XA 2JRLA 5JS8A 3QE9Y 3THOA 1TA0A 2GRUA 2F3PA 2VAMA 2IFTA 1YZHA 4UBIA 3DPUA 4RD1A 1L5WA 1VPEA 4NYJQ 1ZC3A 1CP3A 4B7XA 1IC6A 1QIJA 2BISA 1RP1A 2GAIA 1LF5A 4UXIA 1AKMA 4Z9FA 5FNZA 4TL6A 2QD5A 3NTOA 4OHUA 1XZNA 3VU9A 5IZCA 2OCLA 2VRCA 2WJ3A 5KYWB 3U7IA 3QIVA 3IB6A 3RRMA 1ORTA 1YGPA 2BEKA 3QM1A 3FOAA 5C8ZA 3ZV3A 5C7IO 3PX2A 3PXAA 4H15A 2QSZA 3AIIA 3KFXA 1NT4A 2VN8A 2W2LD 4Y1FA 3LLSA 1Y7HA 3IEPA 1PGQA 5KQGA 1MAVA 1WUTA 1QIDA 4TT3D 4CN9A 2R1UA 5J2UF 2NXCA 4E30A 4URUR 3MK31 1RC1A 3HCDA 3HO8A 3NTXA 4FCTA 3N86A 3P4XA 2F7SA 4P5DA 1QCYA 3VJLA 3CUSA 5ESWA 3GBVA 4QELA 1U2EA 3X1MA 1T1EA 3L4JA 3QK7A 3P9XA 3VHXA 5IKXA 3ZK8A 5DKFA 5HMMA 3UG6A 5H16A 5LQJA 2AEJA 3OI7A 4Z4IA 2GAOA 3JWIA 4Q6WA 3DS8A 1JAYA 1K4YA 1A97A 1M2VB 1MQ8B 1JEOA 3GA5A 5F2NA 1NR1A 4HCJA 4KPUB 3QPVA 3F3MA 4YRMA 4G0UA 2O6LA 3UT5B 2GD0A 5FLXA 2KLBA 3HZHA 4KXQA 3PEFA 5BRAA 2W42A 5HP4A 3VYVA 1G6OA 1GZHB 3LU1A 1QR6A 4B3SB 1G20B 1Z4MA 2GAAA 3H86A 4QXRA 3DE0X 5JASA 2LRHA 5F5XA 2QW0X 1DBQA 2OKCA 4ZALA 4UJ5A 3ZJUA 2HDNB 3EOAI 3R76A 2F55A 1QIGA 1U9IC 3LRPA 4MAMA 3WB1A 1J39A 1E2HA 1YZYA 4YXWA 3MN1A 2W5UA 2BUCA 3BQ9A 5IYZA 4DAEA 1Y6GA 2RK4A 5FIUA 4UM8B 1JIXA 1Z0KA 2GBLC 2IDKA 4HNGA 4NP6A 4KQKA 2FSHA 5KOHB 3STVA 3VPHA 1SQ6A 1XB2A 2EGGA 4OMDA 2IYFA 3O6VA 3HVJA 4M0MA 3D0KA 1NY5A 4FZRA 3O2JA 2B4TO 1PK8A 1QIEA 2O8BA 5TJ9A 1SUBA 3EC1A 2HK6A 4DWOA 4ZYWA 4BJ1A 2I2AA 1B0UA 2O2ZA 4LRWA 1VIYA 4U6NA 2XEXA 4JZKA 4EZIA 1G3QA 2PMCA 1ND5A 4F91B 3Q12A 2ECKA 2CXXA 4UUOA 3TEJA 1K27A 2HJWA 2QTWB 1D2MA 4G5HA 5C37A 4MHOA 5FEUA 1KDYA 1JBQA 1NRJB 3JQ6A 1J2TA 3TEFA 5JD5A 1YS1X 3W5DA 2VL7A 4CV3A 4K2AA 1N1DA 1Y9AA 5EINA 2PLFA 1X8KA 3FBTA 4EIWA 5IDQA 1EJ6A 4D9GA 3K0AA 5IS2A 2LIPA 3DE5X 1UWKA 1QH8B 3I1JA 1XCPA 2Q2VA 3OM0A 3MIIA 4K26A 4LSMA 4M38A 1L5NA 1FE8A 4EAQA 2P9TA 4BAZA 3O8RA 3X44A 4DDTA 2GM3A 3DBVO 4N0DA 1J00A 2Q7OE 4GHWA 3TE7A 5BYAA 2FW0A 1DINA 1H1LB 1RI2A 4G8CA 3R7AA 4O4LF 1I7PA 1GT91 2ZREA 5CB8A 1EG7A 1HRKA 4ENPA 1J25A 5EN4A 4GKJB 2UZIR 4UNIA 1URPA 1Y6JA 4QYSA 5AK5A 1NAHA 1QJCA 2DE0X 3AVPA 1BFDA 4ZPXA 4CT5A 1JA0A 3R5JA 1IIRA 4WCFA 3WP1B 2OB2A 4LY9A 1AQNA 4I6JA 1FDRA 3KOWA 4MVJA 4KN5A 3E27A 3VKHA 3R24A 4CI9A 5A4KA 4WLUA 3V1LA 4OXXA 4KVZA 4MZDA 3GIWA 1IM8A 1P75A 4DCSA 2GEKA 1QHYA 2CMDA 4E03A 1D5WA 2PGXA 3O3OB 3B70A 3CNEA 4LPKA 2C9MA 4OGKA 3B51X 4Y9DA 2LW7A 4H7IA 2C5BA 2XH8A 2XNJA 1KEEB 4BNUA 2BL4A 3H42B 1NIJA 3BWBA 2DWQA 2B20A 4Z7JA 2HDOA 2IY9A 4NNPA 2KQUA 2BFFB 1IN5A 1B41A 1QFYA 2XHEA 3GARA 3OQJA 4P54A 2C84A 4R83A 2A3RA 4HEQA 2D4HA 5EWJB 4BKMA 1J5XA 4CTJA 2Z8YM 1U0JA 1L8LA 4LNUA 1IN1A 2X41A 4G9EA 2DQKA 4ZU1X 4ZD6A 1ZIOA 4WOBA 3LC0A 5C8YB 5B2ZA 3KHUA 4RD3A 2ZIUB 2BGJA 3T0IA 4B2LA 5LXTF 3UMJA 1PUJA 2FYTA 3SQLA 4CKCA 4L9WA 1GGHA 2WJ4A 4JS0A 3OH8A 4U6SA 1SKUA 2ZYSA 3L93A 3L1JA 1C7IA 1KORA 4G24A 5EKSA 1T25A 1X86B 4OJQA 4I5GA 4EI9A 3KHKA 2DCMA 3BICA 3VDQA 3WWCA 5MF6A 1QVAA 4PSAA 4U8HA 2E4ZA 3K9CA 1R74A 1ISGA 1T1GA 2VSYA 5EGNA 2DFPA 3R0XA 3WWDA 4BQPA 2ZM6B 1FS5A 3R9XA 3EZNA 1V45E 1EFKA 3UJCA 3VDMA 3WDMA 4EPXA 4B46A 3PNOA 3QFTA 2BM8A 3TAUA 1IUPA 2V97A 3EDRA 3RAFC 4CEHB 3DZKA 4IZ6A 1WQ3A 3OZ7A 5EXDA 3NBQA 1NQ5A 4C22A 1KMMA 1Y8AA 3I1FA 4TLAA 3VAZA 2JAOA 4BQIA 5KVCA 2QY9A 4IO1A 1C3LA 1HL3A 1OBOA 1JR2A 2JD1A 1Y6RA 3JASB 4KHPB 3HJUA 1Y1PA 4IKPA 4CFYA 1K88A 1KFBB 2W58A 3M6FA 1FNSA 2BH9A 1NXSA 5D3MB 3AXSA 5IW8A 2MSNA 2C2XA 1GQOA 2FUNB 2X3UA 3U26A 3UAYA 4ZHSA 1DKQA 2ZB8A 4I08A 2DKNA 5CH5A 1ECBA 1V5IA 1R16A 1X9HA 4ZODA 1XDBA 3OX3A 2BR4A 2PBZA 4N0EA 2F43A 3GNTA 4AW9A 5JS6A 1UODA 2FRXA 2HU5A 2ZVDA 4AULA 2GJ4A 2ZSFA 5AKIA 5ESRA 4D3DA 4DZRA 4ZCMA 2VA9A 4RD6A 2CDAA 4XR9A 2XXBA 1X0XA 4TTPA 1IJEA 2J8ZA 1HK7A 2IEIA 2ZVPX 1IE3A 2WIFA 3SG0A 4I4IA 1CG6A 5FPHA 3LPLA 2IYNA 4UTRA 4JI2B 2D1SA 1U11A 4YHBA 4WOKA 3VDNB 4DIDA 3HJBA 2GR9A 4KIUA 5GV7A 3X3HA 1JQKA 2VQDA 4JBHA 4EUHA 4EY4A 5AOAA 4W5RA 3U56A 1OBFO 1TK9A 4JEHA 4X5OA 4C7BA 4J0DA 2HLNA 4MA5A 1V47A 4P4LA 1MC1A 2B92A 2ZB2A 4TVKA 3TX6A 1VZ2A 2FQ1A 4Q4CA 5K0BA 3ELUA 1W5SA 5CVTA 5J2TB 2H2HA 4HBGA 5KWVA 3GF4A 5KS2A 4FFNA 3GJSA 2B7LA 4JITA 2J7PA 1BEEA 1FFWA 1XZFA 2QXYA 1MB0A 5BN3B 4GDFA 4ZHQA 2VTVA 3JWJA 3AILA 1ONPA 4I5DA 1P44A 3QUCA 5SY4A 4HUTA 2Y1DA 3QA9A 1N6LA 2FRDC 4IQ8A 1QGYA 2P4EA 3KT0A 4G1VA 5JJLA 1FU8A 3BZUA 4PLPA 2GHTA 3NTVA 4KLRA 4XIGS 1C1YA 3EG9B 1II8B 1QGAA 2CL6X 3L18A 4IWYA 1NW5A 2IPXA 2Y1OA 1H2YA 2Z1MA 3IMEA 2PKXA 3ILYA 3O75A 3MGCA 4YRKA 4J9VA 1VMEA 4J3FA 3LAWA 3UF0A 2COKA 2BEUB 2MINA 2BY4A 5TB5A 5DT2A 1Z6PA 1BH6A 3B12A 1L4YA 1Y8QB 1I6LA 3G8CA 3MTJA 4ON9A 3HJCA 1PK9A 2WB2A 3THXB 2DHEA 1P9OA 2BI4A 1L5YA 1I80A 1K8QA 2IXFA 1I36A 2JLAA 2XQKA 4G56A 4LJLA 4MV8A 3DZFA 1YU6A 3GJ0A 4J16A 1Q2XA 4JP3A 3TCKA 2QN9A 3DHVA 1TOAA 4EY8A 3CKLA 2A14A 3DZHA 1KTVA 4JQZA 2OPHA 2EF0A 3NAZA 4E14A 1NBAA 2OXIA 3EGDB 3KALA 4UAGA 1P6UA 1CJMA 1P80A 2MYTA 2ZCJA 4ZCTA 1G5QA 5U1PA 4LXIA 4CU5A 4EGQA 1N75A 1TZJA 2RGNA 1GPMA 4ZO9A 3RVDA 2HLDD 1N78A 3RQSA 5EMLA 3RUAA 4NMLA 3HO1A 3MBOA 2FMIA 1HDRA 1EP1B 3MOIA 3R6TA 4E5NA 1V1JA 1ZAKA 1X3SA 5A03A 5HOQA 1AH2A 2ZSIA 4H4CA 2C4VA 3IRVA 4DNOA 2FEMA 1Z2NX 4KNVA 4OFBA 3ONDA 4JHLA 5BN5B 2C61A 4P4SA 4RO0A 5CBPA 5L4SA 1WB9A 3MRTA 3IR7A 3T9AA 2JHAA 3P0IA 1SY7A 3VJKA 4JIMA 1OVMA 1M1YE 4L5CA 5EVCA 1OYYA 3D6AA 2J41A 1YUNA 4X90A 1K5PA 1TU4A 2RG1A 2NVOA 3AOEC 4G5GA 4W99A 4DRXB 4EHKA 1YVPA 4AYWA 5KQMA 3U7EB 2VRCD 4AKHA 1VJRA 1X7DA 3VX4A 3KE8A 5CK4A 4FWBA 4DM3A 4YB8A 2HCJB 4F21A 4PG5A 1U2ZA 2FWNA 1G5IA 5JNTA 3WLPA 3LOPA 1EVZA 3TDMA 2Z08A 1EVIA 2E48A 4PX2A 1HZZA 3DCNA 1OXSC 4XVQA 1V6CA 1RQ2A 4F4UA 2CXQA 3KQOA 4RTNA 4KMSA 3R3WA 4CQLB 3FZQA 2J87A 4X66B 4MS4A 2PZBA 5HDBB 2IV3A 4DR3B 5ITZB 3UATA 3ESAA 4I50B 3CSUA 3M2PA 2AMFA 1SC3A 2A5LA 3Q7PA 2CKMA 4V2IA 5B3JC 4DCVA 4C06A 3JRXA 2B9VA 4CL3A 3LOUA 4CIAA 5JVDA 1FFHA 4GUDA 2EX4A 4Y1GA 3WL7A 2VP9A 2ZB7A 5ER6A 1SBTA 3RS4A 4F5ZA 1G21B 1Q77A 2LDXA 4XD2A 2ZR0A 4XWGA 3B3JA 3WIBA 1EVYA 2V3VA 1Y5MA 3KQUA 3EDOA 2GSDA 2PBRA 3DB1A 3SR3A 3ZV4A 1SVKA 4YV0A 3ZHSA 1QP7A 1AO0A 1V8BA 2A9VA 2P3OA 3G2QA 1ULAA 1Z5OA 5TPWB 4AUNA 1X80B 5ADVA 1XTVA 5ALEA 2P9QA 4O4IF 1H23A 5BMVF 2AMVA 4G25A 3FF1A 1W59A 3DVRX 3FYUA 4A1OA 1EXNA 4R69A 5ALMA 1SWVA 4UHHA 1WQ4A 3Q85A 4X7BA 3BCRA 1MRSA 1A95A 5DNAA 4FVTA 2MIIA 4O63O 3EPHA 2OOSA 3C5EA 1NFQA 4Q4JA 4YXWD 2WUDA 1M2OB 3I52A 3RYCA 1BKSB 2QVXX 1O57A 4XGQA 5I51A 1DEKA 3SF8B 1ZIYA 3QI7A 4C6SA 2IOFK 3PB3A 3PCRB 4AS2A 3HXOA 4ABTA 1GTZA 3WQQA 2FN7A 4KYVA 1YACA 1JHDA 1WF3A 1BTOA 2FK7A 2J4DA 3AIOA 4MJXA 4WERA 5HKBA 5JJCA 1EQAA 4PPYA 4ZU3A 2FSFA 1SCQA 1B3RA 4MR7A 3CZAA 2WTNA 4E12A 5ERYA 1RWBA 3B53X 1JBEA 4A36A 4B6OA 2O7VA 4IFEA 4I6GA 4I55F 2JVJA 3WLTA 1BW9A 3U44A 1XA0A 5A5DA 3GLHB 3D64A 1JU3A 5C3UA 3UXHA 1SAYA 3LJKA 1F5NA 5GONF 3O74A 4PX5A 1XCLA 1V4BA 2L0XA 4B87A 4L5IA 4BTVA 4N7MA 3MT7A 4PQYA 1BMDA 4RV4A 4BO7A 4C4PA 5LMCA 1T2DA 5SYMA 1RI5A 4LWPA 1FZTA 1TM1E 1RDFA 1J06A 3TLGA 3WJ7A 2GM4A 5T3YA 2CYBA 4LVOA 4I1PA 1VJGA 2P77A 4QDJA 1AKQA 2B1QA 1YS4A 2ZLBA 2AJDA 3T06B 3UAWA 2FPUA 2HFJA 2ZEJA 4R2LA 1TFUA 5JDCA 3TINA 2HQ1A 2XODA 2FFHA 1AX9A 4BJ5A 1RCTE 4ZGWA 1SBYA 3LW8A 4JJZA 2C5HA 3X0DA 4BOYA 5JXGA 3C97A 4RY9A 4WY8A 2AXQA 1FP1D 1KQ3A 2QW8A 1G3IA 4MVJD 4NEHB 5CT8A 3NHAA 4ZEVA 1GZ7A 3FWYA 3PC3A 3MOSA 1BKDR 1JEYA 2YDXA 1V3UA 2YJTD 4H6PA 2XQGA 3ASUA 5LCXA 3LIIA 1IUNA 5AKEA 1G6HA 2WF6A 1W94A 1WHSB 1BE1A 1RFGE 3LXRA 2CUTA 1W25A 1ZIXA 2R6CA 4NBUA 4WKPA 1C3OB 3LXXA 3ZKWA 2C7PA 1Z7WA 1OWNA 1SIWA 3CLUC 5HA5A 1ES9A 5BOSB 1UL1X 4NRDA 1RAAA 2HR1A 1OI4A 3M89A 4A73A 5T4FA 4R2MA 1C30A 4HS9A 2ZIAA 5AM3A 5JFGA 3I9V6 4KJZA 4TWAA 4GMFA 4EJSA 3H8WA 4AX4A 1TEZA 2QVYX 3CLRD 1GRCA 1USIA 1FX0B 3DBRB 4IZIA 3N59A 3DAGA 2JIDA 2JJMA 3GJ5A 4O4JB 1A77A 4WXYB 4DV4B 3FE2A 5DK4A 2BEVA 4YBZA 2A84A 1S3IA 5E38A 4B4UA 2XMBA 2O6HA 1AK1A 2WP0A 1XFAA 5BMOA 1GUDA 3SIRA 2EP8A 5KOYA 5HOEA 1UADA 2TMKA 4LZJA 2QD4A 3OFNA 4TQGA 3DXYA 3A1FA 4ERNA 2N42A 4ZOAA 5JJKA 3GHHA 4WK0B 4OYHA 1QFXA 3QBTA 1JJIA 3IDFA 5HS6A 5I8ZA 1KEPA 5K7SA 1R4NB 5ADWA 2ZSHA 3OECA 3G7NA 3TR5A 1XZCA 4LOIA 4F11A 2C5LA 3HVHA 2VDVE 2WC1A 1UF9A 1UOPA 4H7KA 5ENZA 1YS7A 3W34A 4BFYA 3IAM1 3FUVA 4IUDS 4NAUA 1H69A 3OC6A 1Q3TA 1V95A 1XP5A 2GXSA 1GZ4A 1WU8A 3IDOA 1Z6TA 1S0UA 4GLBA 1P7VA 5LQMA 1XAIA 2C1ZA 1X1TA 1NJ5A 2WHRA 4ZEOA 4AZVA 3HABA 3O7WA 2GF9A 1DMSA 4QBFA 1JQDA 2C2KA 1DVRA 1ZJYA 3PQCA 5D00A 2D13A 1CUDA 2XGGA 1X1BA 1YKSA 3C4JA 4KQFA 4X7RA 2REBA 4BMOB 1Y4DE 2IYVA 3E6AA 3OZEA 4R2KA 4U2DA 1NXOA 4W82A 2ZB4A 2Z6VA 1NN5A 5EA2A 2ANBA 1S2LA 4BLVA 4Z54A 9ATCA 1F0KA 2DR3A 2PJRA 3RV3A 1KYYA 2ZUWA 4G1FA 3Q1KA 4OQFA 3A9VA 4MZXA 5DM1A 3RC9A 3FKSA 3GD5A 1BE8A 1KP9A 1LRKA 3D3EA 5B58C 1WW3A 5I3ZA 1YFJA 2BF7A 2PH7A 3AYXB 3MWGA 4X85A 1W19A 4PG7A 3IA2A 3V7FA 3R7DA 1ID1A 1Y1RA 1VGVA 2VYFA 2WWRA 2ZPTX 821PA 2YXPX 3T5AA 1VHWA 1JFLA 3NM6B 2I03A 3B7GA 3F46A 4GAEA 3L7NA 4WY2A 2Q0QA 1Z5GA 4Y2JA 5DM0A 3U3XA 1YE8A 1HRDA 3OJCA 3VR3A 3BDVA 4MR9B 5AM2A 3ZDRA 1Z7GA 3AL0C 4HVCA 4H0CA 5A6VA 2G17A 2B4YA 1Z63A 2PUTA 2DHQA 3ROKA 4CEJA 3F5DA 3G49A 3G8BA 1Y4ZA 2VYVA 3E3OA 3RUFA 4B3BA 4KO4S 4BTLA 1OA1A 1PFQA 2QVCA 3NZEA 4RA9A 5LNK1 2P5UA 1NLUA 3DOHA 3G1TA 2J7PD 4GP9A 1Z4JA 3NB0A 1EHIA 4JSTA 1B14A 4QXOA 2AKEA 4I3GA 4JB3A 4IQ0A 5K0NA 4LJSA 3WBJA 4BO1A 3ZVKA 3CVJA 3FBGA 3E2IA 5EE9A 3DSRA 3PGKA 1QH1B 4XCXA 4QXAA 1QIHA 1PJBA 2FEWB 2CMKA 4LYAA 1E94E 2QD1A 4WQMA 2NUBA 3NEJA 4GGMX 5LB4A 3W8DA 3D4BA 3WL3A 4X45A 1U7ZA 1DT3A 4JI5B 4NU6A 1ZN2A 3QKSA 2FFQA 4HAYA 5ED0A 3AHFA 1HDZA 1I6WA 4NBWA 1JQJC 1ICEA 3COJA 1AGRA 3K0CA 3LC1O 4B2YA 2XVMA 2LD4A 3OBBA 4TZKA 2BLNA 4Q9NA 5ICEA 5IULC 5BRNA 5B7QA 1NXWA 1R4MA 1IJFA 4IWNA 2G0NA 2R1VB 3QXSA 1ANKA 1V6SA 4C20A 1FYEA 3Q7QA 1VBNA 1JSRA 2HCTA 1C2TA 5K3OA 3VPBA 4JJ6A 1NG1A 5B5SA 5K6AC 1MA3A 4RSGA 3EQ9A 1JJBA 4TMZA 3STUA 2FF7A 4ZJYA 3IX7A 3CT6A 4YRPA 4Z3KA 1W5FA 1XMIA 4NMMA 4MVJM 4Y9UA 4G2NA 4RF3A 5AVKA 1LV8A 3WX0A 5LSAA 1OF1A 1Z2OX 2P7IA 5CT6A 1FQOA 1U31A 5TF4A 2GETA 4G5YA 3BL5A 4EAAA 2QE7D 3RVPA 2Y1KA 2YR0A 2ZRKA 5F7XA 4HXYA 1HE2A 1PZFA 2ECOA 1ORRA 2R6AA 5IMBA 4ZK2A 1PG0A 5GIOE 3L7LA 4ZO7A 3MTGA 3CF6R 3MWEA 1BXGB 2ESRA 3H18A 4BNMA 3K2EA 3IVRA 1Q92A 3WAGA 1HSOA 3G8YA 3L4KA 2GLTA 2QENA 3TNFA 3D54D 3K8OE 3HQ4O 1KS9A 2HC9A 2AFVA 2H2GA 3NYIA 3KYCB 1RLIA 2BF4A 2FZVA 4P5EA 5DM60 3U60B 1CDZA 3UHPA 4AL4A 3I5UA 3O4FA 2WINI 4MEJA 1QLJA 4N3NA 3ZCTA 1K7FB 2BJWA 2VTDA 1Q16A 3FNRA 1XQVA 1Z0AA 1R8QA 1HNNA 4LAFA 5FNVA 3ICPA 3RHTA 1KJIA 2HTFA 3ZGYA 1HXHA 4FR5A 3DAHA 2OOKA 5TMBA 4HADA 4L4XA 2VT3A 3AFHA 5DJ5A 2GVNA 3RVOA 1GTJ1 1I01A 5LQUA 5IHXA 2CUKA 4AJOA 3MTBA 5JXJA 1GITA 3RSCA 4P31A 4C6RA 1QHSA 1O08A 1UFOA 4HRAA 4Q9JA 4U3JB 3ST7A 3MLBA 4BJ6A 1P1CA 4MNTA 3TZHA 4EA8A 3NO4A 4WI1A 5E2IA 1F6DA 5HXAA 1H2BA 3G5LA 1C41A 4L74A 4F6LA 2IE8A 2XMQA 3AUUA 3G2JA 5AVJA 5AFSA 4OV6B 1U0FA 2B2XA 2A8YA 5AW5A 4NMXB 1VSBA 1T9KA 3EMKA 5HVNA 3GLFE 5HTKA 4FGJA 2DECA 2Y0EA 1XPOA 3L8YA 5DM2A 6CHYA 1GY8A 5HDQA 3QVXA 2AB0A 3MELA 1NYLA 1ZIDA 4TS9A 1U8TA 2L82A 1NGSA 5AI6A 3BCHA 1P0MA 3I83A 4PSVA 2IV7A 3UEOA 2DFNA 2GI4A 1DELA 2B3DA 4KQEA 4MUYA 2A1IA 1JHXA 4NZZA 4HZGA 1B7GO 4Z8XA 1NU8A 2OCIA 3CUYA 3PXCX 4K9LA 2MSWA 4L22A 1ZI8A 1KQPA 2IZZA 2QAJA 2YZGA 5H68A 4UOEA 4KITB 1FVXA 3V8NA 2V3CC 4ZN6A 4U7WA 1L4HA 1VKJA 2BUAA 3CLSC 5J4VA 2CXRA 1NNEA 3ABSB 1EWTA 3JV7A 5IJ0A 4OXKA 4OLJA 5AHWA 1CUAA 2RGDA 1UPFA 4LFBB 4JLSA 1DX6A 4DCCA 3RAPR 3TTYA 1Y37A 4EUFA 3BXOA 5ADHA 5JY6A 2NU7A 3R6LA 1N5IA 3VRHA 3OTWA 1LK7A 3SJBA 3GCZA 4KAAA 3W6ZA 3EMBA 3DL4A 3N0TA 4BO2A 2IITA 1NW7A 1AXEA 3G0BA 2A9RA 2RH8A 2AJLI 1HY3A 1ENZA 2NZYA 3HR7A 1N3IA 2F00A 3OBIA 4CLDA 2J0QA 2H5LA 2CZQA 1ZX1A 5EC8A 2OC9A 1V71A 1YQQA 5JZOA 2ZK7A 3FGOA 4ZT7A 4C0BA 4IR7A 4ZKDA 1KIFA 5G1PA 3OC0A 3FCCA 1XJCA 4MYHA 3JRNA 4LQDA 4IJVA 1D2GA 4XUEA 1OUMA 1LU9A 3V4OA 2E85A 4BNKA 1JXAA 5HIIA 2UAGA 4AZ0B 2VHCA 2VPIA 3UPTA 5ELXA 3I4CA 4CZ2A 5EI5A 1A4UA 1JR4A 3P52A 1TC1A 4OHRA 4M0CA 1M1UA 2F9LA 3D43A 3GMIA 4NECA 1RI1A 4QTXA 3UJ3X 7GPBA 4EG8A 2HQOA 2W8BA 5HIAA 5NULA 3SYMA 3V7NA 3P8ZA 4ZGBA 1CQPA 3RAGA 2X8AA 1K3FA 3ZDYB 4D42A 2OUIA 1L5OA 2JLCA 1VIAA 2JJ8A 2QKYA 3CUUA 3EC2A 4B82A 3KR2A 5IEJA 4BVHA 3OQMA 2JLZA 4XQ9A 1M3SA 3MJVA 4QL3A 3EQZA 1VRCA 3NHPA 1WBJB 1YMVA 3B6EA 4MVJP 4CXMA 4C2BA 2ONCA 1CDDA 1VMIA 3LSYA 4KAJA 4RHCA 3ZWCA 2I7VA 4UNPA 1I4OA 4WL0A 4YP9A 4F2DA 3ACDA 5HPYB 1AMUA 1QTNA 2ZIVB 3ZZNA 3H3XA 2FPOA 3BMCB 3P2EA 4ZQFA 3I0MA 3SFZA 3UAXA 3C1AA 3L41A 2R751 2IXDA 2VK2A 1TCAA 4MRAA 5LJLA 4N65A 1TX4B 3D2LA 1I2DA 4QUDA 1FP2A 3IOCA 1SELA 2ZW9A 4XTRA 2FX5A 3KETA 4II7A 3FWKA 4OAPA 1CLUA 3PPWA 1BROA 3WGGA 3ESXA 4PZPA 2X8LA 5JR3A 2X6TA 2C04A 3OM1A 2X6RA 2XJ9A 1F2TB 2XPCA 5IU6A 3UCXA 1XZLA 1PHPA 1E1NA 1E9RA 2WD7B 3AK4A 4MCAA 3QVMA 4CM8A 1E1CB 2D5BA 1GFSA 5FPKA 3OT1B 2BZSA 3OFJA 3R4VA 3GVPA 1ORHA 1GDDA 1TEVA 1YIAA 2AN5A 3BSFA 4JA0A 3OM9A 1U63A 1H2WA 3OIWA 1NPYA 5FI0B 3M2TA 1O96A 3OQBA 1CDOA 2XITA 4HWGA 1SXHA 1Z7YA 3F3KA 3IEKA 3RH0A 1X7XA 4AJ2A 5JAOA 4QUBA 3FIUA 3G9ZA 3IUMA 2XVXA 4HDRB 4BFVA 2E21A 3M6VA 1N2HA 2P78A 2JJQA 1G19A 4R7TA 1DQPA 1NQOA 4PXSA 3IIMA 4XSHA 5JATA 3GEBA 2B99A 2G1KA 4RFVA 2FW8A 1O03A 2HNKA 4JBXA 5BORA 1OT5A 3OLXA 5CB0A 4DTCA 4LISA 4EL5A 1SVNA 2ZJ0A 1YFKA 3KG2A 4RVFA 3WRYA 5L4LA 1DFIA 2FH5B 3TKAA 2X14A 3VO8A 1BFUA 4CMIB 1E2UA 3FMOB 3OFND 4KWTA 5JAHA 5KYUB 5LPNA 1PR6A 3WR5A 2YWFA 4H2DA 4JMPA 1DQSA 4JX8A 4QATA 5ELLA 5A9SA 4UHFA 2R60A 3O21A 4OHMA 2OWEA 4HDNB 1SVOA 4JQSA 5JZBA 1UXKA 2YFKA 1BSVA 2BHLA 3A1DA 4YALA 3CF4A 2J48A 3VZDA 4DJEC 3N7UA 5JG7A 3V7WA 5E6UA 2GTHA 2ZANA 3I64A 2O05A 4A92A 4WACA 1QE0A 3COPA 3G2MA 2YWHA 4GMGA 1TKCA 1US8B 4EARA 1ZM3A 2I4TA 4ZQBA 1VIMA 3HXKA 1ONNA 4DBZA 5K3AA 1S1CA 4BFZA 3ISTA 4MDFA 1QGUB 3FDIA 5KDLA 1WU7A 1NZFA 3WGYA 1AT1A 1SCJA 2AK3A 2JFQA 3IO3A 2ZQ5A 5GGYA 2GJ9A 5J4HA 1U28C 4RIIA 1NP6A 3HGQA 3A6EA 1XOIA 2AFRA 1Z83A 3DEAA 2W4QA 4C03A 3HL4A 4PHCA 4RYDA 4UTVA 2J9XB 2DC1A 2ZR7A 1XDGA 1YJXA 1S2NA 2C96A 2D06A 4QD3A 4DA9A 5L3QB 4ECEA 4GFDA 4QWWA 2JHGA 1MW9X 5FI1B 2H1WA 4L02A 4PQGA 5EJMA 1N25A 4D82A 5FLKA 4E32A 4E5YA 2ZM5A 4PX9A 5JSKA 1LVHA 2W2NA 1B42A 2FZCA 4DPMA 4BUCA 5HFJA 4BQOA 2R6HA 1JP7A 3LHIA 1N2JA 2J59A 4MI6A 1X6VA 3KKPA 2PFGA 3NPAA 3TQQA 2X7HA 3VR3D 1PNRA 2QA5A 2I2XB 2DVMA 2Y05A 3AF2A 2GFQA 3MS2A 2CLMB 3A2LA 3D6TB 4LJ8A 1V1RB 4C14A 2J0UA 2O8FA 4U2FA 3ZV7A 1ZL2A 2OCAA 4C4RA 3HADA 2ZBQA 2NUTB 3FPAA 2NQ8A 3FUWA 4XX0A 5A04A 3VC2A 3BKWA 4WLEA 1L7RA 2VYVD 3PLRA 4BVBA 1T0UA 2J9FA 3B1WA 3TD9A 1NXQA 1HFEL 3OE5A 4BVLA 4HDQB 2VUIB 2YWCA 2IEZA 3JCZA 4DCTA 4KU4A 2NZ8A 1NX6A 4J7CA 4JOCA 5DYNA 4C07A 1N2XA 4QPPA 3NHRA 5EEHA 1D2EA 4RVCA 3WFZA 1NJFA 2CLLB 4BEBA 1E3MA 3D7NA 1NVEA 2IZ5A 3GR6A 1PBNA 4LRUA 3VKFA 4FYKA 2H2DA 3RTAA 3V1YA 4OGFA 2BIFA 1ZIPA 3OOEA 1ZOLA 3JQPA 4LC9A 5P21A 2FDCA 1Z6XA 3LYUA 3USZA 1JU9A 2Q6KA 4A10A 4MXDA 1UDBA 1WOMA 1ZU4A 4XPIB 3GFFA 5LYYA 2D0OB 4UU1A 2Y66A 2MYNA 4E5PA 4EGJA 2QLNA 1JYSA 3RE1A 3TL3A 4EEZA 1AB6A 4ZCLA 1SKQA 4YCDA 1WCXA 1YF3A 4EYOA 3K30A 4NBVA 1S3SA 1XTRA 3IIIA 2BFEB 4MDHA 1DIAA 2I6FA 2NYAA 3W7VA 4WZBB 2PK3A 3F9CA 1VLLA 3AEQB 1GZDA 3D8SA 5ALKA 1K66A 3AUKA 4MWGA 4BLOA 5LQNA 5EIBC 3HJNA 3W5BA 1Y8ZA 4C7OB 2A9QA 4D9MA 3FETA 3OMWA 1WWKA 3EAQA 4CLOA 1BX3A 1NXVA 5HKOA 4XGRA 1E0KA 4OBBA 1Z3IX 1QHHA 1N36B 5FTLA 2HWUA 2FQYA 2FUEA 1KTIA 1L7NA 5CB6A 5H1YA 2EKBA 4DL9A 4HLCA 3KJFA 3I6IA 4EPVA 2O3TA 1GAEO 1E3SA 1DKUA 1UDAA 2WVAA 3A6DA 3CZ5A 4G81A 4QREA 3C4VA 4MIYA 5EQTA 3SHWA 3ZY3A 4DYVA 1GUZA 2DR2A 3GUUA 2HQRA 3KSZO 1PLLA 4H08A 1AC5A 2QN6A 1M2WA 1RBQA 3G02A 4UMDA 1HTWA 3TLJA 1SN7A 2ZRDA 1EUCA 4OVKA 3WDSA 4QULA 4FBLA 5IX8A 4IFBA 1ZWKA 2B6HA 2C2HA 4PBTA 1U0SY 1GSIA 4QPNA 3UM9A 3VPGA 4IRMA 1O8CA 3ZS9A 1ZMRA 3GVXA 4IOMA 5EZYF 4Y0VA 1J8QA 5J4KA 3DOOA 3TRJA 5KTTA 1K9SA 2IU0A 2G08A 4LGVA 2OAEA 3O82A 2R62A 4XQEA 1Q7TA 3VR2D 3VU3A 5F64A 3BRCA 3DO6A 2ZB3A 3JQAA 2JBAA 3BF7A 4P53A 2YW9A 1G8HA 3IQFA 3WY9A 2VDOB 1USUA 1V1MA 4FS8A 1VHJA 4CM6A 4D96A