1C4XA

2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structure of Microbial 2-Hydroxyl-6-Oxo-6-Phenylhexa-2,4- Dienoic Acid (Hpda) Hydrolase (Bphd Enzyme) from Rhodococcus Sp. Strain Rha1, in the Pcb Degradation Pathway
pubmed rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOATE HYDROLASE
total genus 92
structure length 281
sequence length 281
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 1999-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c4xA00
3EBLA 4C4YA 1IMJA 3H04A 5T4FA 4DLNA 1K8QA 1QE3A 4N5IX 2CZQA 5A71A 4EZIA 1CUIA 4JEIA 1ETHA 1UWCA 1UT6A 2J4CA 5AKLA 1KU6A 5FLKA 2HDWA 4B83A 5DYWA 3HLKA 2XLCA 3GFFA 5IVHA 3D5EA 4UFPA 4XWGA 2V97A 3AIMA 4H18A 5FDFA 1LGYA 3DS8A 1H2ZA 1GGVA 4HVTA 5IVIA 1YS2X 4FMPA 4ZXFA 5BOVA 3LCRA 4KR0A 1U8EA 1MT3A 5DNUA 4HXEB 2XQJA 1JMYA 1XZHA 1SCIA 3WKEA 3WL7A 4J0KA 4U2CA 5A7FA 1QGED 3H2GA 1F8UA 4FNGA 1SCQA 2VTVA 3BIWA 4MWTA 3ILSA 2Y2UA 3L1HA 4FBMA 1Q84A 3V1LA 3EQ7A 3R3UA 2BUCA 3STWA 3F9CA 1JJBA 2DFPA 2I3ZA 4ZREA 4QLOA 3V1MA 2BFNA 3HACA 5FV4A 1EB8A 1FSSA 4Y9SA 4YX9A 1G66A 2XMCA 5DJ5A 3PE6A 3W2TA 1AQLA 2Y2VA 2QS9A 1TK3A 1AUOA 4C4ZA 2GBIA 2ZJ7A 2JGFA 2JEZA 3IUQA 3D2AA 2IITA 5AK5A 2CJPA 1UK7A 3FYUA 2QXUA 4WDRA 3HRHA 1GQRA 3F67A 4DNPA 1UOPA 4C6HA 1VE7A 5AM5A 4J0IA 3R40A 2WJ4A 2BGNA 1U65A 3C87A 3ESDA 2FJ0A 3FOBA 4EY4A 4F60A 4ARBA 1AC5A 2VF2A 4I4CA 4AN1A 4J0HA 2HA6A 1NX9A 2H1IA 4E14A 4LXIA 1DQZA 1DWQA 5JIBA 1LPAB 2Z5GA 4CIBA 3F98A 5AI4A 4Y2XA 1XRMA 3V48A 4BVLA 5EHZA 4CCYB 5FRDA 3DDUA 1A8QA 2HFKA 4PSUA 2C58A 4F0JA 4PV7A 5AI5A 3C70A 4XIIA 5ALGA 4QLAA 1RWQA 3KSRA 2XMZA 3RKSA 1GXSA 2PVSA 3WK9A 1XQYA 3MUOA 3SX4A 3M83A 5AKHA 5I8PA 2XMGA 5AH0A 3VISA 2QUBA 2ZSHA 4Q34A 2VJDA 1W1IA 3H0CA 3ESAA 5IVKA 1XZGA 2HHAA 5ALFA 4KYVA 2XMDA 4AX4A 2WIKA 5ALZA 4B6GA 1LPMA 5ALEA 5JARA 1R50A 5SYMA 3STXA 3H19A 2D5LA 2XI4A 4J3JA 1CUUA 1Z68A 3PF8A 1XQXA 3R3YA 4H0CA 1TCCA 5JZSA 3KD2A 3R3VA 4H7HA 4FFVA 5LIPA 5ALQA 2ROQA 2OG1A 3YASA 1ZOIA 4C87A 1BN7A 2RONA 4TPKA 4LKOA 4X90A 4Q1VA 4L72A 1SCKA 4YK7A 4N8SA 1CQWA 2WIJA 1EHYA 1KEZA 5ALNA 4D9JA 1E66A 5CT5A 1MTZA 1XRRA 1H22A 3BE8A 4EY7A 5DTIA 4WY5A 4LHEA 1VXOA 3E4DA 4KAFA 4EBBA 2P8SA 2XUJA 3KOOA 1N1MA 4EY5A 2DHDA 2ECFA 5C7YA 4BCCA 2WUGA 2PM8A 1MN6A 3RARA 1IZ8A 5AOCA 4B7ZA 4BCBA 1O6GA 4G5XA 2WKWA 1XZAA 3UUEA 5I7UA 3VJLA 3ESCA 2WUEA 5ALUA 4U2FA 3C5WP 3HC7A 2X8BA 2HU8A 1BCRA 3TEJA 3DNMA 5YASA 5JAOA 1P0MA 5CRIA 4XX1A 3QMWA 5KREA 3I2KA 4DTCA 1GPNA 3LS2A 2XLBA 1OXMA 2H9YA 5BWCA 5ALTA 2C0PA 1GT6A 3W9UA 4H7FA 1HDEA 1G42A 3IB3A 1DU4A 2QJRA 2XUPA 4FHZA 2QUAA 1QJ4A 1SC9A 1XZJA 1FFAA 2O7RA 3VKFA 3PUHA 2WHRA 3CCBA 1UK9A 1GKKA 2FJPA 2HA7A 2QM0A 1UZAA 4BCDA 1LPOA 4UBKA 1Q83A 2XMRA 1TCAA 1WM1A 2HU7A 4PNZA 2OAGA 3SC2A 3R41A 4KE8A 5JALA 3A2NA 4UHCA 5K3FA 2ZJFA 4JH0A 2JIDA 5JAHA 3ICWA 1UKAA 3ZV7A 3MGAA 2EEPA 1VA4A 1MNQA 1VLQA 2RAUA 3DOIA 5AM4A 1FFDA 5ALKA 5AK4A 4J0CA 1C7JA 3AFIA 3IDAA 4Y2RA 4AZ0A 3HJUA 4FLMA 4BRSA 3WJ2A 2PU7A 5A2GA 2WFLB 3OPMA 1JU4A 5AI8A 3O4HA 3NGMA 4H35A 4Y2UA 3K2IA 4PSDA 5AI0A 4GHWA 4Y2VA 2XQGA 1MU0A 4AZ3A 3OC0A 1K5PA 4G8BA 1AZWA 1RP1A 4X92A 3I6MA 4TGLA 3L1IA 2EDCA 2C5GA 4G9GA 4X6UA 4HXFB 1XZIA 4X00A 4X94A 3BJRA 5LZ5A 3U1TA 1XZLA 1WPXA 3WL6A 1IUNA 5FPQA 1LZLA 1DT3A 5JZ9A 2OAEA 4ZGBA 2FUKA 4X91A 2E3JA 4Y2PA 1YB6A 1BROA 1MAAA 2ZYRA 1ZI8A 4BATA 3ZWQA 5HK8A 4BE4A 4UUQA 3BL8A 1QO7A 1H2WA 3HZOA 4EA6A 3O4JA 5ALSA 1T2NA 4U2EA 4WCVA 5LP1A 2XUOA 4XJVA 2XT0A 4GXNA 3F8SA 4BVJA 2V98A 4PF1A 4G4GA 1ODCA 1PFQA 1MJ5A 2XQIA 3IULA 4DGQA 1JJIA 3BDIA 1H2YA 3WI7A 4KJXA 4H7JA 2QTBA 3VXKA 4BVKA 2PL5A 2AJBA 4HAIA 3BF8A 4QA9A 5LZ2A 2XB6A 4FDMA 1OILA 2HA2A 2NW6A 1J2EA 1UKBA 2PSJA 5HFAA 1ZGBA 5CURA 4H7KA 2Z3ZA 2W22A 1P0IA 3D3NA 1XKTA 4W1QA 1HBJA 2J3DA 1ACLA 1L7QA 3C6XA 1N5MA 4X3CA 3A2LA 5JAUA 1H23A 4ZI5A 5K3EA 2XUAA 5CBKA 1SFRA 3I2IA 4KE9A 4BBZA 4B0OA 3G9UA 2QVBA 1ISPA 1ORWA 2ACEA 2XQKA 3DL4A 3M82A 4B9EA 2XQFA 4X6YA 4ZWNA 1MPXA 1BN6A 5AIAA 4TVKA 1O6FA 1PV1A 1ZIYA 2J4FA 3FVTA 2XUGA 3EF3A 2IIVA 1AGYA 4HRXA 1UK8A 4UBNA 1WB4A 3WYNA 4X7BA 4OB7A 4BZZA 2ZSIA 3M3DA 1JKMA 4E46A 1W4LA 4JYMA 3G0CA 1YAJA 3CN9A 2V96A 1PJAA 5E2IA 2WG0A 2HADA 3QPDA 5KWJA 5A6VA 1MX1A 4OUKX 2JF0A 3TGLA 4LYEA 1MX9A 2OCGA 5LZ7A 1DWOA 2OGTA 3IUJA 4G4IA 3GBSA 2VATA 5HFNA 1CPYA 5IH7A 1QIKA 2WILA 3I6ZA 2HA3A 3G0IA 3GZJA 3BDVA 4N8EA 4PO3X 2GYUA 4G8DA 1F6WA 2G5PA 2FX5A 2YH2A 5EFZA 1GPLA 3E0XA 5IVDA 4MEBA 4UBLA 2WM2A 5CH3A 1QFMA 2WU4A 4GECA 3DCNA 2OCKA 4P92A 3R0VA 2B20A 3WL5A 3WKDA 2OPHA 3ZLTA 2VT6A 4W1PA 3N0TA 2ZJ6A 1LPNA 5FKJA 3WYDA 4ETWA 5E4TA 4K6HA 3X3HA 1CQZA 1J07A 3A2MA 4XVCA 2HA0A 4MJ3A 2J3QA 1X2BA 4FNMA 3S2ZA 4CFSA 4QDXA 4QDZA 4BTLA 3HSSA 3HYSA 4AO8A 2G4LA 2OQVA 3VVMA 5T4HA 3G9TA 4OCZA 3B5EA 1HQDA 4B85A 3C8DA 1MNAA 3O95A 1VE6A 3QH4A 5AI9A 3WKBA 4G4JA 1ODTC 1ZGCA 3FAKA 2CBGA 2BJHA 2QZPA 4J0GA 2AJ8A 4QWWA 1CIJA 1A8UA 2XUHA 3E3AA 2RGUA 4ROTA 2AJLI 1WHTA 5ALPA 1CV2A 3W05A 2RHWA 4DNFA 1FJ2A 2WG1A 4C4XA 2ZYHA 1WOMA 4AN0A 4Y2SA 2O2IA 1F0PA 4C88A 2GBGA 4X6XA 2DHEA 5CH8A 3D0KA 5CH5A 1G4HA 4P9NA 3I2JA 2LIPA 1JU3A 2DQYA 1QIGA 1VZ2A 5CMLA 2GBCA 5AKXA 2HM7A 2W6CX 4UHHA 4IH4A 4OPMA 5LZ4A 7YASA 4B0PA 4BDTA 1JJFA 3D2CA 1ZD5A 3STUA 1KU0A 1W75A 3STTA 1ORVA 3WK4A 1L7AA 3D7RA 1G5FA 1BRTA 4GW3A 4N8DA 2WLSA 4EUSA 1ACJA 5EIAA 5D7BA 5ISMA 2XMQA 5AKIA 1QTRA 5LZ8A 5H3HA 3WZMA 2IX9A 2VJCA 1HKHA 1LPPA 3FBWA 3I1YA 2VT7A 3FVRA 3PDCA 4BC1A 1FFBA 2GBFA 2EDAA 3TJMA 1CUVA 1CUDA 3DYIA 3M81A 4UBJA 4EB0A 1LLFA 1XLVA 5FPPA 1TCBA 3FSGA 3KDAA 2HRRA 2QT9A 4QEKA 4UHFA 3E1GA 3WZLA 2QOEA 3T4UA 3GUUA 5ALWA 1EK2A 5ALVA 3QYJA 5ALOA 3H17A 2PUHA 1YAHA 1YA4A 2XUDA 3NUZA 4M0FA 4UFOA 3WWOA 3EQ9A 3C6BA 5D3KA 3O4GA 1E89A 3WK5A 4DMFA 5AHXA 1XRPA 1DX4A 2WFLA 3PI6A 1CFJA 2WJ3A 3DQZA 4CCYA 2B61A 4B81A 2WG2A 5ALLA 1LPBB 3WKAA 1ZI6A 5K3AA 2OQIA 3D2BA 1AURA 5DLPA 5AKGA 1QFSA 2PSDA 3QBJA 4MQMA 5FXMA 3OURA 4BAUA 5K3FB 4UHDA 3W04A 4X95A 3SK0A 1IUPA 3BF7A 5AIBA 3SWWA 3IIIA 4E15A 3TRDA 1YA8A 4I19A 2WTMA 3H1AA 4KEAA 2QMQA 3STVA 4YPVA 5HQ3A 3FYUB 1FFEA 4J0DA 3G0DA 4UPDA 1UKCA 3DYVA 1X70A 4HZGA 5HF6A 1CUXA 1QONA 3WK7A 3GROA 3HXKA 4Y2YA 3FCYA 2ZVDA 4GWLA 3NWOA 3QMVA 3WIOA 3I28A 1CUCA 1JMKC 1EX9A 2PSHA 5A7HA 3KWJA 5DTJA 3AZOA 3A6ZA 1CUZA 4FTWA 2PKYX 4KAAA 1DQYA 4B9AA 1XLWA 3G8YA 1A7UA 3FYUC 5FP0A 4DM7A 4BE9A 4G9EA 1HL7A 1XFDA 2DHCA 3LLCA 3PFBA 5DWDA 4W63A 1A88A 5CT9A 2WSLA 3ZPXA 2CB9A 1ZJ5A 1W6RA 3BJMA 2QKYA 2JGMA 4QZVA 5K5EA 5ALXA 1TIBA 4FLEA 1JI3A 1NU8A 4LXHA 5D6OA 2QRUA 2UZ0A 4FBLA 5HF8A 2AJCA 4WJLA 3G0GA 3B3QA 4Y2QA 1BEEA 3ZLVA 1ZICA 1LBSA 5AK3A 5HKBA 4DMHA 5ALDA 3OTQA 4L9AA 3DJYA 2VAVA 1USWA 5AM2A 5IKXA 2RI6A 3I2FA 1WB5A 1EDEA 3DOHA 1QIDA 4K2AA 4N5HX 5ESRA 1BE0A 1XZCA 3QM1A 2GZSA 3IUNA 4QE3A 1YS1X 1CRLA 1VA5A 3FWHA 4L0CA 3AINA 1XZFA 2YYSA 1I6WA 3O0DA 1R3DA 3ICVA 1BU8A 4KE7A 3AJAA 1UOOA 3AZQA 4DMCA 4V2IA 1GKLA 3F97A 4AO7A 5LLSA 4A23A 4Y2JA 1N5RA 2VQ6A 3C45A 5CT4A 1J1IA 1VZ3A 3G9XA 1QIHA 1X2EA 2JBWA 1IVYA 4GDMA 4DSAA 3VJKA 1HPLA 2VAXA 3BXPA 3R3ZA 3ANSA 4OB8A 3PUIA 1T4MA 1EK1A 3ZI7A 3S8YA 1YASA 3H2KA 3NOXA 1R9MA 4MWSA 1Q0ZA 3QPCA 4UBIA 2JGEA 4DSZA 4NMWA 3WMRA 1S8OA 1XRNA 1EB9A 3WWEA 1DX6A 4KE6A 4OSEA 5A62A 3V1KA 1FFCA 1UXOA 1XKLA 5LZ9A 3FLAA 4BC0A 3F96A 1VKHA 4S0XA 4Q3KA 2QJWA 1XQVA 2JGJA 4MXDA 4UBMA 1NU6A 1MO2A 4MQLA 4MYDA 3DLTA 3ED1A 1RYYA 1XRQA 2DQZA 3D4LA 3O9VA 1C4XA 2BGRA 5E4JA 3WWDA 4BYMA 5EI5A 4H7DA 3Q0TA 4RGYA 2CKMA 2V9ZA 5D3ZA 5AM0A 2I78A 5DNWA 3RLIA 2C5FA 1VJ5A 4QDUA 3KWFA 4BAZA 3H2JA 4DMKA 3ESBA 3W06A 2H7CA 2ES4A 4PW0A 1IUOA 1M33A 2YXPX 3QZUA 2DSNA 3EIOA 4HTAA 5DNVA 1AX9A 2WIFA 4H77A 4C01A 3WQHA 3O9MA 3QVMA 4PSCA 5DYTA 1B41A 4BB0A 3W9BA 3LIPA 1MX5A 4CCWA 3CCCA 3G0BA 3O4IA 5JAPA 2O7VA 5AKEA 1LBTA 5ALIA 3FCXA 2WHPB 1CUFA 4ZV9A 4MYSA 3PFCA 5FOQA 5LKAA 4BAGA 4WY8A 3FLBA 5JD4A 4BRZA 4CI9A 1EXWA 5AP9A 5HF9A 5CXXA 4IH1A 3T52A 4P93A 5AJHA 2VJBA 3IVMA 1BCSA 3FLEA 5AOBA 4IH9A 3I2GA 1QZ3A 3V1NA 4M0EA 2WHPA 4GBGA 2QR5A 2WUFA 3AIKA 1EVQA 2PBLA 4BP8A 3VDXA 1LZKA 1Y37A 1XZBA 4ARAA 5AKYA 2Y1KA 2Z3WA 2R8BA 1VXRA 4EHBA 1K4YA 4FKBA 1JFRA 3C8HA 4CIAA 4OYLA 1D07A 2H7XA 3DKKA 4QDOA 4ZV7A 4OYYA 2XUFA 2HU5A 1QIJA 4IQ4A 1CVLA 2ZYIA 2JGKA 4GI1A 1TQHA 4K5QA 1CUEA 5C8XA 5EHNA 3UUFA 1U4NA 3V9AA 2PSFA 3DL7A 4C89A 4KAJA 5JASA 4RPCA 1IZ7A 4FWBA 1EA5A 1WPRA 5J3JA 4KRYA 1SOMA 4W1SA 4RE6A 1CLEA 5ALMA 1UK6A 1THGA 2WFZA 4JUIA 4U2GA 5C8VA 2G63A 1CUAA 1EINA 1R88A 2C0QA 3IA2A 1EDBA 4CG2A 5JATA 1QO9A 3CXUA 4F21A 4M0MA 5JD5A 1ZD2P 1R4ZA 1THTA 4Q3OA 4GEGA 4Q05A 4J03A 4U2DA 4FLFA 2CEKA 4WDQA 2PPLA 4X85A 4F5ZA 4DNQA 2XUKA 5F4ZA 2YASA 4DYHA 5FUMA 4FOLA 1CUJA 1UOQA 3WKCA 3GA7A 3A70A 1DT5A 2DCMA 2PSEA 3WA7A 2WIDA 3HABA 5AI6A 4HS9A 2OGZA 4A16A 5K3DA 4OU5A 4G8CA 2O2GA 5AICA 3WA6A 3K6KA 2ZYSA 5EHQA 3OG9A 3I1IA 2ACKA 1OCEA 3ANTA 4GLBA 5K3CA 3R3WA 1ODSA 1R9NA 1E8NA 3AILA 1BS9A 3MVEA 3WLAA 3ZLUA 4AQDA 3C6ZA 1TAHA 1WB6A 3AZPA 4NVRA 4WFKA 5E4YA 1H2XA 2AXEA 5CW2A 2RHTA 5JYCA 1CUHA 1Y7IA 3WK8A 3K9BA 4WFJA 3R3XA 1GPKA 1XZKA 4UBOA 1C7IA 1EI9A 1EVEA 4IHAA 1E8MA 4QNNA 5EHXA 4EY8A 4CG1A 2OLEA 4PQEA 2XUQA 5C81A 2D0DA 3AUKA 5AO9A 5DYYA 5HKAA 1ZJ4A 4YASA 4U2BA 4P08A 2R11A 2I03A 3EQ8A 5EGNA 5LYYA 3FYTA 3MUNA 2K2QB 4A5SA 1JT2A 3G02A 1W76A 1MAHA 4J7AA 2XMSA 4Y2TA 3VJMA 2WQZA 4OU4A 1A8SA 4HRYA 3G9ZA 4IO0A 5AM3A 3RM3A 3WK6A 2OXEA 3IUMA 3HEAA 1LPSA 1XRLA 1QIIA 1CUSA 1P0PA 1B6GA 5JZBA 5EIEA 4B82A 4QWMA 4BDSA 2VJAA 4KACA 5ALRA 4BP9A 5CT6A 3H18A 2O2HA 4LYDA 4BZWA 2HFJA 3OOSA 3JW8A 4X97A 2VSQA 2XDWA 5HQ3B 2OCLA 4B80A 2I3DA 3G7NA 1BEZA 1CR6A 3N2ZB 1QTIA 4AB1A 3H2HA 4WFIA 3I6YA 1L7RA 2Q0XA 2ONCA 1CUGA 1XZMA 1AMNA 2BCEA 4Y7DA 1QIFA 2AJDA 1YCDA 1HLGA 5A7GA 2C7BA 5HK9A 4W1RA 5KWIA 3FSGD 3C6YA 1GZ7A 3U0VA 3I2HA 5CTAA 1CUWA 3C43A 2GYVA 2VEOA 3HI4A 4DNOA 2GZRA 3OM8A 2WIGA 2XMBA 4AXBA 3LIIA 5JANA 1XLUA 5HF5A 2B4KA 3BWXA 1WHSA 1AKNA 2B9VA 3B12A 3H1BA 2JGIA 3P2MA 4OB6A 2WFMA 4AMZA 1QIEA 3DD5A 1GQSA 5LKRA 4Q3LA 4X93A 1QIMA 1CUBA 1EDDA 4AO6A 4AMYA 5ALYA 3JWEA 3JYHA 3AIOA 4LIPD 2Z8XA 4JNCA 3DEAA 5AKJA 5CXUA 3IBTA 4K6GA 6YASA 4X71A 5BWBA 5AM1A 2PU5A 1DWPA 2RIPA 5AKKA 3WJ1A 4B84A 4EY6A 2BAGA 1XZDA 4NS4A 4JYPA 1DINA 4HXGA 3LP5A 1N8SA 5AK6A 2CUTA 4L3WA 4Z49A 2PUJA 2WJ6A 5ALHA 3Q8WA 5EIHA 1ZIXA 2X5XA 5AOAA 3WWCA 1QOZA 4H7IA 1ZD4A 3BIXA 4Q82A 5I9IA 2OCIA 3RK4A 2OGSA 2WU3A 3WIBA 3CN7A 1WCYA 4J0JA 2ORYA 1XQWA 2G5TA 2GYWA 3WWPA 1E8DA 5AKZA 3PF9A 2HL6A 2Y6UA 3WL8A 1CUYA 4RNCA 2XE4A 5BV7A 1W52X 5C8ZA 5JADA 2DR0A 1P0QA 4UHBA 4FFWA 4O08A 1DTEA 2JGLA 5CT8A 2C4HA 5ALJA 4RE5A 4NZZA 4E11A 2HA4A 5K3BA 1EH5A 4MEAA 1XZEA 1Y7HA 2X76A 1E3QA 2HIHA 3QITA 1K63A 1CEXA 4H7EA 3FNBA 2BUBA 5HCUA 1E5TA 5T4EA 4UFNA 3STYA 1TKRA 3IURA 1ZI9A 2XUIA 3QMMA 1VOTA 2BKLA 4OD0A 1K6EA 2BUAA 2WHQA 5T4BA 3UMJA 2CMFA 3VVLA 1R1DA 5HZGA 4QDTA 1QLWA 1XROA 5KBYA 3QPAA 4INZA 2HRQA 3GELA 4DIUA 3DKRA 4UHEA 4ZRDA 1Q0RA 1YB7A 1J06A 1YSCA 1U2EA 3C5VA 2WTNA 2JEYA 2H7YA 1ZD3A 5JD6A 1YR2A 4CG3A 2HA5A 2Y6VA 2WUDA 3KXPA 1LNSA 5SYNA 4ITVA 1UFOA 4I3FA 4W9RA 1F0NA 4KRXA 3H2IA 2Z8ZA 4G1FA 4K6KA 2PX6A 4BTVA 3D59A 1TRHA 3L1JA 3PICA 2QXTA 2VA9A 4LXGA
chains in the Genus database with same CATH superfamily
2EAUA 2PKQP 4A0FA 3TZLA 3LECA 1H0HA 1OFUA 3HB4X 4REQB 4V2UA 2ZATA 4RELA 2QVLA 4Z0TA 3OQIA 1P2UA 4G09A 4BU1A 2VJMA 2EIHA 3TCNA 4IV5A 5I3ZA 1QE3A 4H08A 3Q0EA 2D4AA 2LR0A 4GMFA 2XNSA 4OI0A 5JCZA 3SDSA 5A71A 1CUIA 5EXPA 1OLXA 3IAFA 4C78A 4JEIA 3ZNPA 3C3MA 3OPQA 4E5DA 1UT6A 4V24A 1IN6A 3DBOB 2RFLA 1ZVQA 1W5BA 3ENZA 2R79A 3BTOA 1GSOA 3QF4A 4LGMA 1Q50A 3IEKA 4LDQA 2WKSA 2I66A 1KU6A 4S1PA 4UVGA 2HRDA 4KVZA 2HDWA 5FLKA 4IIBA 1N4AA 4HNRA 1KY4A 1JE0A 3H2BA 3HKDA 2GX6A 3JRWA 2DTEA 2P9ZA 5CIWA 2HLPA 2JFHA 5BWOA 1LLDA 5DYWA 4KHZA 1G7RA 2XLCA 4YDRA 1H5UA 5I9TA 2C95A 1F5SA 5DRTA 3WDMA 4PYQA 1FF9A 1XWWA 1OI2A 2ZU0C 1N6OA 4JYAB 2WV9A 1UR5A 3CBQA 1R8QA 2JCXA 5CA0A 2ZM6B 3DS8A 4BJHB 4HVTA 3T1YB 4B46A 1DEOA 1QKIA 4FMPA 5F5XA 5JNRA 1ZGJA 1V4BA 2VCEA 1YL7A 1ZGZA 1U3UA 3EDMA 4TMFA 4KR0A 5DT2A 4WCFB 1MT3A 4RLSA 3W4JA 4FB5A 2BI4A 4OH1A 4WL0A 1ILWA 1XZHA 1K7FB 1SCIA 1JG6A 3M4JA 1BNCA 1CRZA 3L0DA 3CLHA 3PDJA 4G0ZA 3WKEA 1T2CA 1A0OA 2BZ0A 2MYNA 3CEPB 4U2CA 5JNLA 4LF6B 2DWCA 2FK8A 1QGED 3H2GA 4G4SP 1ZY2A 5FNVA 5ABPA 1F8UA 1XDUA 3NXSA 1SCQA 3D1JA 1XA4A 5IT9A 3OQHA 1EFVB 2WTAA 2HXSA 5FNVF 3AF5A 5IRCD 4MWTA 1TPYA 1NBME 4DOMA 1DO2A 2AFHA 1NQWA 2FETA 1Q84A 1W9MA 4H60A 1NVGA 3N7AA 4N5NA 4P2BA 3V1LA 2C8LA 3EQ7A 4G4SO 2P2CA 4I1RA 4NPCA 4S1OA 1P3Y1 4WZAA 5FJJA 1L3IA 1G21E 3W6OA 3GFQA 1OAOC 2CMKA 1Z6QA 2QV0A 3ZWOA 3MGKA 5E3IA 5KTSA 2NO4A 3E2IA 5DBGA 1M67A 4DDUA 4UE6A 3BB3A 4L95C 1IY8A 5FH9A 2DKFA 4B3HA 3KALA 4GXTA 3BTSA 3BZWA 3I9NA 3DDNA 1HFJA 4WUVA 4E09A 5FV4A 1EB8A 4RKFA 2RGBA 3L8ZA 1WZUA 2QRZA 4LISA 4M76B 3N3AC 4Y9SA 2ECKA 2AEJA 5HIMA 1GNVA 3ACBA 5LYJB 1Z6PA 5K9ZA 4WOPA 2NNLD 2Q5IA 5CM2Z 2HF9A 2I6FA 4IDOA 1ADGA 1VMIA 1N2EA 2CB0A 3LJKA 3TQHA 2ILTA 3U48A 2XXAA 2NP6A 2G7ZA 3BCHA 1TU4A 1U1CA 5BY2A 4KOAA 2Y1WA 2PNJA 1MPTA 4EF5A 2ZWPA 1PWYE 1N1GA 2Y2VA 3TMAA 2EU8A 2Q5LA 2PQ6A 1T6BY 3M1AA 3RSQA 3F4KA 2PX5A 4OQQA 3BMNA 3SNKA 3UWDA 4NCJA 4C4ZA 3PCTA 5TEVA 3NAZA 2QN8A 3ZNQA 3IEVA 1MA0A 1NLUA 2CNLA 3HUFA 1NNSA 4GZ5A 1RXVA 3FNEA 2SKCA 1EK6A 4HGRA 1QZXA 1YCGA 2JRCA 4A92A 1PDWA 5C1IA 3REGA 3NVAA 1V1RA 4FGSA 3UMYA 5BMOA 2PMDA 5FTMA 2QXUA 4AQ7A 3U44B 3CYFA 1DG3A 4WDRA 1I14A 1S4QA 2QK4A 5CFOA 4YUAA 3VNUA 1GQRA 1WUYA 4EUFA 4G07A 3Q3EA 1NKSA 4AQYB 2D7DA 5EP4A 1APBA 2Q6LA 2H9AA 4P58A 3LKBA 4XYBA 5AM5A 5C8YB 3WGMA 4G63A 2WT8A 2XEXA 3E84A 3K0FB 3MBKA 5TJHA 1H6BA 1CZKA 3FDZB 4CKCA 4B6FA 2FWJA 3BXEA 3I5AA 3C87A 4IXMA 3DLPX 5KDLA 1BYIA 4F92B 2P4QA 1E0AA 3SEFA 4M7WA 4DREA 3UXHA 2IWRA 2WOOA 4Y1RA 2EW1A 5FPHA 3H11B 2Q1TA 3LBNA 4QSMA 4KXWA 4AN1A 1RPZA 1OXXK 1SU8A 2HA6A 3DFZA 3H8SA 3D8HA 2GF9A 4L07A 4ND7A 4I55A 1E6EA 2FKAA 4Q66C 5EJ2A 1KBOA 3HJTA 4BMOB 4EPWA 2XQVA 4BQIA 3UH0A 4LXIA 3X1DA 1E98A 1CDDA 1RJEA 3O03A 5K4AA 4AFNA 4YCSA 4CIDA 3U09A 2UYHA 1J7KA 1IHYA 5LD2B 1X7HA 2R3SA 2IF2A 3L6CA 3I64A 4Y2XA 4NICA 2W6MA 4ZO6A 3FZQA 3S55A 4LJ5A 4Q1FA 5DISB 5AQ1A 2PD3A 2C07A 5E6UB 3KB1A 4MNTA 4F3CA 1DRVA 1IG3A 1XOIA 4IHQA 4FZRA 4RMJA 4WLNA 1JHDA 5FLXA 3U17A 2ZJZA 2WY2D 4DV2B 5TRTA 1G8SA 2CHFA 3E3LA 2FG6C 3CLRC 1E2HA 1IM5A 4H27A 4RZIA 4A8TA 3PC2A 5LD2C 1Z0AA 2P3SA 1KJ8A 5JFGA 4F71A 4PV7A 3G8BA 4XIIA 2C4VA 3IJ5A 3OA0A 4C03A 3EGXB 4IG4A 4CVNA 1Q7RA 3DDWA 2B8TA 3ABOB 3RUFA 2DYKA 3EEFA 2PVSA 4JGGA 3WK9A 2UUOA 3HDQA 3NBFA 1F38A 2WA1A 4G85A 3SX4A 5HRUA 3LK6A 4C9BA 3M83A 4W5TA 1VE3A 4EYOA 3IQEA 1VYHA 1YRAA 4BLQA 3K8ZA 1ZS9A 4B4KA 1WF3A 4O2BF 3IOEA 3OX4A 2NPOA 5CM8B 4HB2A 3HXPA 2ZWMA 5BSGA 5CYPA 4MUNA 4RIIA 1DADA 4YYZA 5A9SB 2A5GA 1KO5A 2VJDA 2ZSHA 3AM4A 3C3AA 4KN9S 3NV9A 3DVQX 3DPIA 1NVVR 3H0CA 4ZQBA 1C0KA 3ESAA 4C0BA 4UTVA 3GRCA 4N3GA 3G2QA 3ZY6A 1M0WA 1KSHA 4KYVA 1H1LA 3SM9A 5B30A 3T7SA 4OV6B 4EJMA 1XDZA 4MIEA 3AP2A 5JXJA 1F3LA 2GXQA 5TPWB 3VKGA 3AONB 1POXA 3FDIA 3QSGA 1T3TA 1UDAA 2C2BA 3HWX1 4E6PA 8ADHA 5L6LB 3LDAA 4L2IB 4YTEA 1ZM9A 5ALEA 4ER7A 5AJUA 2QV7A 1WP9A 4HLQB 1UBCA 2EJUA 1ECFA 1R50A 3VSBA 3OUZA 3RGGA 3DEYX 3WHPA 1KO8A 4CF3A 3JVDA 3GUYA 3BERA 2HDHA 1CS0B 3CTPA 3KYBA 4PLCA 1VKZA 2JFXA 4L4RA 3Q8XB 5IP5A 2JFQA 2QX7A 3HEMA 4E21A 2MSNA 2YVQA 4LXXA 3KT3A 2RGNC 4R1TA 3WMGA 2V7XA 3PF8A 1KE1A 1P60A 5L6MB 2F43A 4QQFA 1NPDA 4YACA 3NR2A 1HLDA 1QRRA 4H0CA 3UB4A 4MGIR 5JZSA 1COZA 1Y9JA 5I7SA 4YB8A 2RAFA 2BH2A 1EVLA 4O2AF 1ZOOA 1ZN8A 4JYCA 3MCZA 4YR7A 3RRFA 1EIZA 2YMQA 1C8KA 4HD8A 221PA 1U81A 1V8DA 2J0VA 2QT0A 1E1DA 2L82A 3GEPA 5DGIA 2I76A 3GGOA 4ZC8A 1J9ZA 3HK2A 3W5SA 4Z4GA 4C3OB 5LIPA 2ZB7A 4EHNA 2IS4A 5ALQA 4RIGA 1E79A 1QRAA 1SBTA 3BSFA 3CISA 1Y7LA 3LDHA 4ZQGA 4NLLA 5JAIA 3LGAA 4H17A 4NCKA 1N5OX 1OFUX 1ZCAA 3AHIA 4EJSA 1RRCA 4B87A 1FLVA 1TYZA 2DZDA 4HT3B 1CF9A 3EARA 5DO9A 3W4KA 1K8ZB 3LHIA 1QYDA 4V1CI 3EAQA 5GJWC 9LDTA 2BEWA 2X4GA 1V5GA 3UGTA 2B5WA 4X90A 5CDFE 4Q1VA 1E3EA 2AKAB 4FFRA 1NNI1 3ZWXA 4TTRA 3R77A 4YALA 4P81A 3EYWA 3V8BA 5F35A 4ZEWA 3AQ4A 1RMQA 1Q22A 2R6ZA 2DM6A 3C1TA 1CQWA 3EXFB 1WXEA 5U1PA 2LCQA 5JS2A 3WZ2A 4WSOA 2I2DA 4MS1B 1QH1A 2RGNA 5AD1A 2D7JA 4ZANA 1MO5A 3K9GA 3AMVA 1IN4A 4B5KA 5DTRA 1MTZA 4N41A 5K8LA 2EG5A 2QP3A 4B3SB 2RHJA 4Z2YA 3Q1KA 5JMPA 4BN0A 4O4HB 4BVEA 1H22A 4HH0A 2IYUA 4XQCA 1DIOB 1JKJA 1H5NA 2IGTA 2ZETA 3CF0A 2AOUA 4FK8A 1VXOA 1T24A 3N8NA 5AJTA 3S1AB 2GERA 1CR1A 4KAFA 1QG4A 1WP4A 4EBBA 2P8SA 2XRFA 3L5KA 1ZUNA 4FDLA 2ZYTX 2QLMA 2BH9A 4PLGA 4PG5A 3TMKA 1WCIB 1N1MA 2AE1A 2ZWIA 3ZWCA 4BKQA 1CQXA 3DEJA 1VSBA 2VPTA 3CW9A 4Y6RA 2XZTA 3QPWA 2GCGA 2DHDA 3K9QO 2ST1A 3GX1A 4BCCA 1OXSC 5DM1A 3ZE9A 2PKQO 3U4DA 3JAKB 4KSCA 2PM8A 2CL5A 3HCWA 4LNUA 3DE2X 4PXSA 5MF6A 1E7QA 3NEYA 5AOCA 3NHWA 3S2YA 1MXHA 2WKWA 2W70A 5BW5A 3EUWA 2X42A 4HQRA 3QFCA 2HJWA 3VU3A 1NVAA 5I7UA 1L4HA 2VEDA 1YDWA 4DDVA 2E49A 1OGIA 2NTYC 2Q6TA 4OTZA 5ALUA 2V45A 2OXIA 4D3ZA 1UXHA 1I13A 5B1SA 3OZEA 5CEEA 1X7DA 2X8BA 1DIHA 3TTSA 4D5GA 4FNAA 3R7WB 3T9AA 3NV7A 4D6YA 1Z3IX 4RTJA 2PS9A 2B5VA 5JAOA 3A9UA 2R1VA 4K6OA 3FYSA 5FTJA 5CRIA 1UAGA 4BOYA 3Q3IA 5KREA 3S7TA 4M0LA 1ESNA 5KIAA 3QV2A 3UG6A 1X1BA 1GPNA 2Q4EA 2FRDA 1TUBA 2PN1A 1GA1A 2ZWVA 3LS2A 1UAYA 3NEAA 4IIDA 4LJAA 4BWGA 4URZR 1OXMA 1K68A 1CU1A 1HT1E 3C3PA 5BWCA 3GEDA 3WDKA 1YVPA 4Y1GA 3JARA 5ECWA 3S7ZA 2OBYA 1Z2NX 2C78A 4JITA 2M6SA 3A7EA 4IZHA 4GT1A 1OROA 1PT5A 2HW8A 3PE3A 1IN1A 1T6YA 1FMLA 1V9CA 3HPRA 1N7IA 3LYAA 4X1YB 3LVFO 3RS5A 2W6ID 3WO1A 4U6QA 4YCMA 3KYDA 2QD4A 2AR0A 3EMBA 2XUPA 3X1WA 1RP7A 1KR5A 1UBHS 1T8TA 1EE9A 2AMYA 1J2JA 1IOZA 1XF9A 2A88A 3IPAA 4RLFA 5JBNA 3BULA 1P9WA 4ZQCB 2XCTB 4KXQA 2GF2A 2P9JA 1UXIA 4BMSA 1K98A 1MJGM 2PZEA 4IICA 2XGJA 1VL5A 1PGJA 1XTJA 3VKFA 1W2GA 1L5HB 1ZL2A 4S1NA 4X20A 4KITB 621PA 4FYIA 2GZMA 2JAHA 1QXSA 4KIUA 2FJPA 2QM0A 1YXMA 1CS4C 2Y1LA 4I81A 4AROA 2JAUA 2NAFA 1TYCA 2HRZA 1L9XA 3QW4B 3QGMA 3LX8A 3Q7EA 4Q1EA 4RA6A 3PFKA 3RQIA 2GEUA 1Y8ZA 4CLEA 3FNGA 3RYHB 1H3NA 3GCDA 1T6NA 1Z0FA 3OHMA 4ENWA 1X1DA 2ZUUA 3L4EA 4HDCA 3HI6A 4P7KA 3SIPA 4UE2A 3GLHE 3N0VA 4JVOA 1P61B 3CCFA 4Q4HB 4HATA 2VPIA 3QOWA 5KJEA 3TPZA 1TF7A 4TLBA 4C5BA 1JKFA 3I52A 2XOEA 2P79A 3KQOA 4C08A 1GDHA 2OAGA 1E4VA 1G1AA 2ZS7A 3EIEA 1EE2A 1DZIA 3KZCA 3A2NA 4KE8A 4UHCA 5FCDA 1M6HA 4R2IA 1G1MA 3TINA 1X15A 2NXWA 3PNQA 1CF2O 2XDQB 3AUUA 1EX7A 2ZJFA 4JL5A 4KWHA 4CV3A 3NX4A 1KEKA 1WD7A 5BP7A 5JAHA 4KPGA 3ICWA 3ZKWB 4AZTA 2C0CA 5B6IA 1PSZA 1QTNA 4PVDA 3RREA 1PVDA 4AXXA 4D0LB 3T7JA 1OU0A 5BUCA 3DD1A 4JT4A 1OXKB 4LC1A 4MWDA 4HWRA 3LRTA 5KUTA 2Q8NA 3OBBA 4ZU1X 3AGQA 1E1KA 1WTAA 2CK3D 3P2KA 3DOIA 2ET6A 4ZZIA 5AM4A 3I62A 1YUBA 3KHTA 3WGGA 1UKZA 3I04A 3N70A 3JQFC 4HEA1 1XD2B 1P5HA 1RWOA 4NBLA 5ALKA 3WGYA 4AKEA 2XBMA 3X2SA 2E4AA 2ZFUA 1PKEA 1QOQB 4FLMA 3T3IA 3AI3A 2B92A 4B2PA 4BRSA 5A2GA 3UJ3X 2WFLB 4N0DA 3DBLA 3OPMA 4RH0A 1HE8B 5M34A 3ADBA 1E1RA 5JS8A 5ERYA 2B2XA 4YXWA 1YVUA 2MSDB 4Y2UA 3K2IA 2XWJI 1EK0A 1KFKB 5AVXA 1I4WA 2P9HA 4YY3B 2DULA 2WKPA 3MUFA 5F9MA 5FBHA 1DXHA 3JXEA 3JALA 3VHLB 4BYGA 1SXIA 2YYAA 1IB0A 3I23A 3K0BA 2QLBA 2HEGA 1JFLA 4M60A 3UHAA 1H2EA 4PYNA 4LF8B 4O6VA 1GQFA 2H3HA 5DHRA 3ITNA 4G8BA 1AZWA 2OA0A 1I7QB 4JB8A 3W1VA 3TQSA 2ZLBA 3EUAA 3L1IA 4WESA 1NXPA 4BFZA 5IBCA 4WE3A 2R1UA 3WIVA 4C7VA 4HXFB 3JVVA 2XAAA 1VBNA 4X00A 4B6PA 3AHCA 4X94A 4OX9B 1NVKA 1VMAA 3BWMA 4ZGWA 1IOLA 1H6CA 2UVDA 1BHO1 1XZLA 3BZBA 3KYIB 3SFVA 4DIKA 2AEMA 2CHUA 2ODAA 2P65A 2YZMA 5H02A 1KORA 3SFTA 2RCYA 1EHCA 5GGXA 5KX5F 2AXPA 1NF9A 1DMSA 2LNDA 2R1TA 2DETA 3A37A 5B37A 1LZLA 1H9AA 1B8PA 2EFEB 2Q5HA 2IVZA 1KVRA 1GV1A 2RHBA 5K6AA 3MWEA 4O4IB 4C07A 4X7PA 4PC6A 4OGKA 5IHPA 4JQZA 2X7XA 1B7GO 4ZCSA 1KQNA 1MAAA 1Q0SA 1R0ZA 1SIBE 3P20A 3H5LA 5CK4A 2ID8A 4BATA 2R4UA 3HV2A 3WISA 2QTRA 1TLFA 5HK8A 3QPVA 1VJ1A 3IX7A 3FTPA 2PE5A 1I2ZA 1OBCA 2Z9BA 3OP1A 2OZLA 2PD4A 4I1UA 4QPNA 2IHVA 4LF4B 2I4MA 1HUQA 1O2DA 1H2WA 2O23A 2B8NA 2A35A 1GCOA 3H42B 3MAAC 4EO4A 1NIPA 3FG9A 3O4JA 1OBHA 4UM9B 2QVYX 2YJ3A 4YVFA 1V3VA 3NWBA 1PV4A 3EIFA 1S2NA 1G6KA 13PKA 4AZVA 1X8JA 1YJ8A 3RH0A 4ZJPA 5HTOA 1MV5A 3E9EA 4I5GA 4P98A 1YQQA 1YA6A 1YMVA 2NYAA 1OF1A 1T43A 3EYAA 5I4BA 3K31A 3ZU5A 3QPUA 3WYFA 5KSPA 1FFWA 2E9SA 5IN5A 1RQNA 1YGYA 5DTMA 3FCEA 2BMVA 4JI1B 1P33A 2VNSA 3M9XA 3VR4H 1YHNA 2W37A 3N2NA 4BVJA 4NE9A 2VZEA 1PDOA 2QE7A 1U7TA 1I30A 3M5CA 3NDIA 2NYUA 3EZFA 4LYAA 3SJUA 3MGGA 4UNNA 1SH7A 4Q15A 1MJ5A 2FU5C 4TSKA 4G41A 1QDLB 3RYIA 1BTOA 2O2DA 3R5SA 2E37A 2J5QA 5K20A 2FSVA 3L7DA 1DUSA 1Q5PA 4DSOA 3B1VA 4H7JA 2GB4A 2QTBA 3ELUA 4BNNA 2PL5A 3BYZA 3MN1A 2AJBA 4HAIA 5ENDA 1NW3A 4QA9A 4QPJC 5TF4A 1WJGA 4HDNA 1AB5A 3UATA 2BMDA 3EZYA 1INLA 2I80A 4KB5A 4L16A 4LOJA 3MMNA 4B4VA 2RK6A 5CM9C 4DCMA 3WLKX 4DRZA 1KQPA 1NG9A 1FUYB 1ZGBA 2CW5A 1DKQA 3KFXA 4MVJD 5CURA 4CMKA 5A9RA 1AKRA 5KQSA 1A1SA 2IV2X 1V43A 3JAMA 2VHWA 2Y66A 1P0IA 3GGSA 1ISHA 1JLMA 1WMDA 3O73A 3ZWWA 5T41A 3RIMA 4K46A 2X1HA 3IR6A 4QEZA 4U4AA 2IRWA 1OVGA 1L7QA 2IUSA 1RLIA 4Q6WA 1VGQA 5JAUA 3SGLA 1H23A 2HNKA 1I3MA 4C7OA 4WVLA 2MINB 2A9OA 4F04A 4N01A 3RT7A 3CF6R 1EGQA 1TQ6A 1FP1D 1V4NA 2AGVA 1U3VA 1SFRA 2W8BB 4H6WA 4MHSA 5AT1A 4CMEA 5LFAA 2PL1A 1RKBA 5JYDA 4HPJB 2V74B 2G1JA 5JNVA 2WZCA 1XMQB 2P77A 1VC2A 1ISPA 4N1AA 2ORWA 2VT2A 4UDOA 1ZUWA 1OX6A 3P9ZA 2XVXA 1C7QA 4K40A 2IZ0A 5TS2A 5KTTA 3A58B 2CT8A 3VKUA 1ML3A 1XPJA 3II6X 1VBKA 4WIAA 3NHFA 3QG1A 3ROGA 1MPXA 4BQPA 3ODGA 4KUHA 2DWPA 1W4AA 4IMIB 4KFTA 3ID6C 2OSVA 1JTFA 1IIBA 3HBFA 1R8JA 2J4FA 5DX1A 2QX4A 5BQFA 3OY2A 1J5PA 4N18A 4MGKR 1DC5A 3IQDB 4XVQA 2OYCA 3RS4A 3H6HA 3PFHA 3ZUGA 5JAZA 2JH9A 2IIBA 5EMLA 4BFLA 4HZUB 3EY4A 1B74A 3KE9A 2YHAA 4FOTA 4ND5A 3W7AA 5DMHA 4QO7A 2VG8A 2VP4A 5IHXA 4EIWA 2X4DA 3DBLB 1JQAA 2CFSA 1O54A 1O97C 3FR8A 5TR9A 2ARKA 3T9EA 5HIKA 3M3DA 1JKMA 4X8MA 1GNPA 4XB6B 1W4LA 3VR6D 1YAJA 2JANA 3D4OA 1DDOA 3FGPA 3O21A 4RD4A 2X15A 1CJVC 2ZJ4A 3OLVA 1JZQA 1PJAA 1N6LA 1CKEA 3F6PA 4MWEA 3V7WA 4C6TA 3QLJA 2WG0A 4KUEA 5L4NA 1Z4MA 3ONDA 2R6CA 2HADA 5KWJA 4IS2A 2HV8A 1T5IA 3L82B 1I4DD 4NHOA 5KOHA 2ZIAA 3FYHA 4JMLA 4NEQA 1LCIA 3ES9A 3TGLA 3COZA 3HR4A 4LYEA 5J2UB 4QOGA 5F1YA 4WNYA 5K2OA 1RLUA 3IUJA 4LYFA 2VRNA 2B7LA 3R6WA 3RIXA 3OH8A 4DR5B 4S04A 3E35A 1KFBB 3GBSA 3X1YA 4BLTA 1CPYA 1W36D 2J6BA 1VHDA 3WMXA 4CHTA 4OJNA 3ZC3A 5LMZA 1H9BA 2FSIA 1DFGA 3H9EO 1KETA 5CA1F 1X86B 4LBWA 3SJBA 3QWHA 5KMGA 5K0TA 5KEIA 3QI7A 4JU9A 4UOEA 3DHYA 5BRJA 5KNBH 1KQ3A 1XMVA 4OBBA 4JJFA 4RPIA 4HN2A 4WW0A 2HA3A 3GAAA 2IP1A 5ETJA 3D6JA 1XYYA 1YB5A 4X64B 1LI5A 4KWTA 4DSUA 5HS4A 4OM7A 1KZHA 3IOMA 1JX6A 2GYUA 4C06A 4YRRA 3MT9A 4FBGA 3HB9A 3P5SA 3UTDA 2QW8A 3C5HA 5K0FA 5IVDA 1VB5A 2PLFA 1HTBA 2JAPA 5FL7A 3DV0B 4UBLA 1A9ZA 5F76A 3TYXA 4UTPA 4PGGA 3QHPA 2ZRPA 4FZ5A 1QFMA 2WU4A 1U9JA 2VHVA 3HKCB 2CSXA 2XD4A 3OZBA 3C3EA 3NNDA 4DYVA 5FOWA 4NYJQ 2ZRGA 4P92A 5B3LA 3GJRA 2OECA 4JJKA 2RGDA 1GLGA 1H2BA 2ZSJA 1Z0SA 2OCYC 3FHCB 4X1YA 4BX8A 3VU8A 4OHYA 1IN7A 2Q49A 4TTTS 3TH5A 3PPXA 4IHKA 4IJMA 3C2QA 4LVOA 1UEJA 4PCLA 2EQAA 1E61A 2WJVA 5CG1A 5JCJA 1FDRA 2VT6A 5F1KA 3HS3A 3N0TA 2ZJ6A 3O91A 4W1PA 5A3RA 5FAKA 3CUKA 4MVJH 1L4LA 5BR7A 3CUSA 4NKRA 1VFPA 2GESA 4UEKA 5F1PA 2Y1OA 1CQZA 3RF6A 3RUEA 4CUKA 1KAQA 3MM4A 3ENVA 4QUKA 2ZQZA 2QQGA 2A5YB 3PEVA 3PT5A 4QT4A 1Q1BA 4CM6A 1IB6A 4DCNA 1SM4A 1PR2A 2OWEA 2WP0A 2YXNA 3K30A 3NASA 3BD7A 4B7CA 2N42A 4CFSA 1ZQ1A 3DNFA 5JNWA 1VI5A 4F5DA 4BO4A 4QDXA 5IBQA 1QZUA 2BGLA 3HO6A 3DR3A 3UT5A 4OX9Y 4JLJA 4UNQA 1KFEB 2VNJA 2W2QA 1BD3A 1IDN1 3G2MA 4DCVA 4ALLA 5DXFA 4KPFC 3OHPA 5IT4A 1JDBB 1W581 1QPBA 3NNSA 3U7FB 1HDYA 1Q7TA 2FN3A 1GV0A 1HM5A 3AB7A 1BKDR 4YUYA 2UYQA 1HQDA 1B15A 1XPOA 2HH9A 3VAAA 4DLXA 3KZOA 1UC5B 3C8DA 1BMTA 3HV0A 5EXDA 1GJRA 2H29A 2LBPA 1MNAA 1VE6A 2GKGA 2QDKA 1YRBA 4YC7A 1I4TD 3KU4A 5AI9A 5E0KB 3WKBA 4BFXA 1ODTC 2E55A 2QTMA 4CXMA 4FYXA 4C2UA 1GAEO 1QCCA 4NAVA 3A4MA 4KOEC 5C1BA 3UW3A 1EFKA 3FAKA 3OJEA 4U7TB 2I71A 4TVSA 2ZRCA 1P77A 1NQAO 4IJ6A 3WO0A 3WP0A 1C3EA 4BNIA 1W35A 5AFSA 5BV2P 2DLNA 1OBFO 4QWWA 1ZUNB 3TD2A 2C8JA 1EJ0A 4Q93A 3KQQA 5K99A 1CIJA 5DEOA 2WSBA 1ORHA 2RE8A 1YQXA 2XBLA 2FE4A 4CR6A 3TKAA 2FSSA 4P4UA 1QGUA 3SBEA 2CVHA 4G65A 3PGA1 1V9LA 2FOIA 1UT8A 2FFAA 1SU4A 3ZKAA 2CVQA 2J5BA 4RQTA 2RHWA 1SC6A 1KOLA 3GFRA 3VHXB 3M3HA 4LDZA 4PLHA 4RVUA 1Z17A 4UUAA 1C7FA 2WG1A 1G8GA 4V0QA 3L01A 3KKMA 3TJZA 4L0MA 1NE7A 4WLUA 5F5NA 4BS9A 2O1SA 1ZIOA 2Y9MB 3U7EB 5FOXA 2XCLA 2HIMA 4GAEA 3GG9A 1WOMA 4HNHA 3E05A 1X80B 3MIZA 1LW7A 5FLEX 1N2ZA 4N0EA 2GBLA 4Y2SA 1CZUA 2GJKA 1U3FA 2PGLA 3JVEA 3OLCX 1COWA 3VYWA 1SZCA 5BNIA 3WOVA 4ZZ1A 2ZE6A 2RJOA 3EG5A 2DHEA 4MVYA 1SC3A 2PJZA 3OZXA 4MCAA 3D0KA 3IUSA 4RK1A 1DVRA 4IDPA 4OKSA 2OORA 4NMXB 5DK6A 5AVRA 4BX2A 4O2AB 1IONA 4NNJA 1HDRA 3BAZA 4EHFA 1WSBA 2GK6A 4FD2A 3V8MA 2LIPA 1GQOA 2P9CA 2CFTA 3A9CA 5DLYA 1TEHA 3ZQ4A 1G7SA 1Y8CA 1YQ9A 2A0WA 3T5DA 3U4QA 2AOVA 2E89A 2HM7A 2Y77A 4QU8A 1G5IA 2GJ9A 4QUIA 4UDNA 1KZ4A 2O0LA 3U40A 4AJHA 4TYWA 4ECAA 1FS5A 4J76A 2C3MA 5B1EA 1V11B 4UM9D 4JY7A 4ZKEA 5FI1B 5CA0F 1ULSA 3N3BC 1Z26A 1TCVA 1ZD5A 2YS6A 3W6UA 3WOHA 3TQOA 3EZLA 3R3JA 2XZOA 1KU0A 4PXYA 4RZUA 5EVJA 3ZE2B 1SBHA 4MV9A 3ZX5A 3IQHX 3BE4A 1A9RA 3VDQA 2VNAA 4JD5A 1BVYF 3STTA 4C1BA 3M6XA 3S1LA 4DUGA 1LTQA 5IT5A 5DIFA 3WYBA 1DMRA 5H3CA 2BD0A 1CS0A 1G3QA 1HDCA 1VE9A 3HGTA 3HN6A 4MLDA 2BT4A 2RGGA 2WA2A 1ZH8A 1ECJA 1NONA 3OQ6A 3RG2A 2I2XB 2EOAA 1L7AA 2NPFA 3CJRA 2I54A 4TV8F 4IQ0A 4TLEA 1WXIA 2F62A 2VDWB 1BRTA 4ZI2A 3H2SA 4EUSA 1G0OA 3AB3A 3VR2D 4LYHA 2PLRA 1ZMOA 1JHOA 1ZVVA 1A72A 5AKIA 4EW6A 1EFPB 1L8OA 2GPAA 3I92A 2VJCA 1RXIA 2WJPA 3DJFA 3EOBI 3JWGA 4FWIB 1VLZA 4R7TA 3IAHA 3HG7A 3LY7A 2ACVA 2ZRKA 1YQTA 4WNAB 3FBWA 3S81A 4MR9B 1A7KA 2WF8A 2O5CA 2FW1A 2GBFA 2CJXA 2EDAA 1ZM2A 4NR0A 2KB0A 2R7MA 5SY9A 1L1FA 2JLRA 4ZP1A 3P4XA 1CULC 4K3VA 2BJVA 3ECAA 2X23A 1R66A 1FRVA 2INGX 2HGZA 5SY6A 2QRHA 3KUDA 1TO2E 1E92A 3ORFA 2GNPA 3RHFA 3G2KA 3QVJA 2R65A 1FW8A 1PX0A 4OFZA 1I01A 1V5EA 3AEUB 1G8JA 3MCWA 1PI3A 4B2YA 3ZIAD 3R7BA 5C4GB 5ALVA 2AXQA 2P30A 4BUCA 2Q6VA 1ABFA 4KG7A 1BYUA 2H08A 2C7QA 3DMYA 4L5AA 3U80A 1YA4A 2XUDA 3NUZA 4UFOA 4GP6A 4HSEA 1NNEA 2H8GA 3EQ9A 5I9SA 3HJCA 4X63A 4MW2A 3C6BA 3U2QA 5FEUA 2WP8J 2EKZA 3WK5A 4DMFA 2ZIUB 3H5OA 4K05A 4UTZA 1BDBA 2Y1EA 2C61A 4NTZA 4W8HA 2JFYA 3S5UA 1SCUB 2VWGA 3PKJA 1E2NA 3BWCA 3M1IA 3BA6A 2PMWB 3JQ9A 4EM6A 1JXOA 3GU3A 1SIOA 2X8LA 3KL2A 3TSZA 3UJ6A 3W6ZA 2QU8A 4WNAA 2PH7A 4CCYA 2B61A 5EE9A 1ENZA 4KXYA 4HPXB 3ENKA 1SKBA 2ADMA 1AXEA 4B81A 2AKEA 1C0IA 3COVA 1T5SA 2WICA 3VOTA 1RBZA 3FNFA 1O9GA 4G8JA 3LK7A 3RUDA 2OQIA 2Q3FA 3D2BA 4NJEA 1I3NA 1ZEJA 1LI4A 1AURA 4QFBA 2IOHA 2FCAA 2P0EA 3JV7A 5AKGA 1U94A 1QFSA 4HNQA 1JWBB 1W5AA 3FJ1A 1OJLA 4KQFA 4MUGA 5CLLA 3V55A 5BVHA 4F4IA 2QX6A 2RAPA 3S8MA 4MQMA 5BQPA 4FW9A 1S3IA 3DT9A 2H1HA 2C04A 1KGSA 4QTTB 4R2WA 3WLTA 3AP3A 5IU6A 1QORA 1A27A 3O8LA 1KIMA 3K05A 5IJZA 1H3EA 3X0DA 4UHDA 1MRZA 3REQA 3EMDA 2ICAA 3SC2B 3W04A 1OBVA 1E4OA 3ESYA 3HDYA 3H3JA 1IUPA 3NTRA 3BF7A 4M0DA 3CE6A 5JVDA 3MLAA 1ZJYA 1KMHB 2BGGA 3R75A 1TMYA 1Q1QA 3RUIA 1LDBA 3TRDA 1ZLXA 4Q4JA 4YO7A 4BWVA 1YA8A 3RAFC 3IEMA 3N59A 1N7JA 3AU9A 2I6XA 1V45E 2WTMA 3NKVA 4GZ3A 5AW5A 3FYUB 2ENWA 2C2MA 3CWCA 4E2FA 1TZKA 4F2PA 3FFXA 3N2KA 4DLKA 2BBSA 3U4QB 3PWKA 5CGZA 4UPDA 4CV2A 1X87A 1Q0TA 4DXHA 2O3TA 1CJCA 1D6JA 4B7UA 2IS6A 3CZ4A 1U5CA 1FTSA 2Q46A 4HZGA 5BUQA 1IG0A 1WDMA 1GWNA 2FLVA 3WK7A 2IEYA 1NVMB 3GROA 3JQCA 1ZSVA 5K0GA 1L5NA 4Y2YA 3IH5A 3IJPA 4YXFA 3PXEA 3UPTA 3WNQA 1JV2B 3G88A 4YMSA 5C1PA 5DHTA 4TMYA 4C4PA 4YT4A 4M8SA 5HIIA 1MC8A 3VGPA 5KAPA 1K4KA 3I28A 3TLYA 2GLUA 4WOCA 2OQRA 1CUCA 4YGXB 3D6FA 1JMKC 4GI2A 4JYZA 1KAEA 3JQPA 5AVSA 1CY4A 3IAEA 1JJAA 1ZMRA 2XD9A 3TJRA 5IUKC 1O94A 2O6HA 4DUGD 3ZDCA 3CZRA 1YMQA 4PYRA 3BQ9A 4FTWA 3RVJA 1FP7A 1VIYA 3BWBA 2BHRA 4B9AA 3T0GA 1XDWA 3G8YA 1A7UA 1ZNYA 1N57A 3AW8A 4K6CA 5FP0A 4UULA 3NIBA 2JH3A 1FU8A 3PWTA 1HL7A 3T3NA 3ZD8A 4WOBA 2ZVQX 3PFBA 2A2ZA 2VPYA 3OU6A 1M1UA 4W63A 1U2TA 3DT6A 4RHFA 4W8GA 1JLLB 5BN3B 5CT9A 2IV7A 4EPTA 1LDNA 4BXOA 4IDGA 4PPGA 2A4KA 1ZJ5A 5HIJA 2ZBRA 1SEPA 3WQRA 3BJMA 1GR1A 2QKYA 3L0BA 3GOHA 3ZVKA 4QZVA 1R8YA 4YAOA 2C29D 2V3VA 1P3DA 3ND8A 1YUMA 4UPEA 4FQ8A 3HDGA 5ALXA 1NLFA 1ILEA 4FI3F 1TIBA 2C4KA 1YR7A 3ILXA 3WQSB 5J23A 2BGTA 1G4AE 3ANYB 3I8XA 2WU8A 4Q6BA 1YZHA 2QRUA 3HBLA 1N8NA 1F17A 1NYTA 2WHYA 3ESQA 3OC6A 3F6YA 1E79D 1JHUA 3GNQA 4FQ5A 3G0GA 4PE5B 1Z6ZA 2VOJA 3CLUD 4Y2QA 5JG7A 3BKWA 4X6LA 3WMWA 3PV0A 1KK0A 1ZICA 2IYWA 2O7SA 3BJEA 3HB1A 4NF2A 1J9EA 1W44A 4R31A 3X1MA 3PXDA 5HDQA 2WWXA 5DM0A 3PX7A 1USWA 2FZ5A 3NVDA 1GGKA 4YONB 1UXKA 5IKXA 4CEHA 2A9QA 3KDSE 3T5PA 3NDBB 2W4MA 3N2GB 4YBZA 3C3DA 2VBGA 5DLEA 4BQNA 4JXZA 5FUXA 1WB5A 3TNJA 4IMJB 2WKRA 2O8DA 1YOBA 2Z1DA 4I9UA 1BE0A 3IAM6 2RKWA 3GQBB 2OXTA 1CLUA 3TX6A 1NUPA 4QE3A 1KZ1A 3I04M 5F52A 3HP1A 4W6ZA 3VOSA 2OCDA 4KAXA 5CFZA 1QQTA 2B4RO 3AINA 4OFXA 1WO8A 1UIMA 4C5AA 4WPGA 4KVFA 2F4VB 1I6WA 5KDOA 2DU8A 1R3DA 3ICVA 2FYTA 3PEUA 3WYAA 3BQMB 1LLUA 4K2HA 5JDCA 1QB7A 2XGMA 2VJMB 1QS0A 3NBZC 2PGJA 4J7CA 4IJQA 3AZQA 3JWHA 1A8IA 3B6MA 4IFIA 4QUGA 3A06A 1XMXA 3B1JA 3EF1A 3P9NA 1BFUA 1SD1A 3E6AA 3A4NA 3ELBA 3UK7A 2IK8A 1OYWA 3DCJA 4PLZA 4ZI7F 3N6VA 1GKLA 1KYYA 4JWKA 5JZOA 3L05A 1GTRA 4YR9A 3RC1A 5HPYB 5LLSA 3ZZTA 3TE6A 4WKGA 4MV0A 4F72A 4PPQA 5TLSA 3NP7A 3R09A 1TM4E 4IVPA 3ZWPA 4F12A 2WQ6A 3G9XA 2P3OA 1XJ0A 1ML4A 1NI3A 2D00A 3S4YA 3VUFA 2FEAA 4XWYA 2JRLA 3L6RA 4ZN6A 5A4JA 4WK2B 3TQRA 1CRWG 1IVYA 2J33A 5EXSA 3UBTA 2IZOA 2O2YA 4JEMA 3KHKA 3FX2A 3ZGXA 5CAEB 1T3SA 5EKUA 3Q10A 3JQGA 5K51A 2G7MC 4TRMA 5LNK1 1FJXA 2ORED 4JT9A 1Z4LA 3AGPA 4O2LA 3PCRB 3AR8A 3I76A 1ENYA 1IEWA 3P9SA 4PTZA 3EXEA 3TSWA 3ZI7A 4DLVA 3FMOB 3H65A 4A9AA 3DL0A 3SJ7A 3EAGA 5DNYB 3SZ3A 1YKSA 2PH5A 2ZYVX 1P7VA 3GGGA 3FCSB 3OZWA 4F11A 1R9MA 5KOHB 1Q91A 2VUIB 3BWEA 4HH1A 4XDZA 2E21A 4RD0A 2OV4A 3SLRA 3I12A 1KYVA 2CL0X 2EYQA 4MDHA 4MVJP 3UAZA 1EFLA 2JGEA 4DSZA 5HJEA 2WJAA 1X6VA 3WWEA 2DPGA 1DAMA 3QLVC 4GICA 1YHZA 3DZDA 3S2GA 1EGMB 5EJ4A 3ZCRA 1ENOA 1XKLA 3LLVA 2ZR0A 3OD5A 4NHEA 1ZEMA 5DW3A 3SXJA 3FLAA 1AB6A 3LY8A 4UVHA 3BIOA 4BC0A 2ATXA 2QRVA 3FFWA 4RSMA 4S0XA 1X14A 4JP3A 1F0YA 5FAXA 4Y6LA 1NXQA 4ZAFA 2ZTUA 2ALJA 5FUYA 4ZVQA 2ZULA 3ZBUA 3RFFA 2W2KB 1JDJA 1KDRA 4K03A 2W8ZA 5IMSA 1L7EA 1BHJA 2PRSA 3FSEA 5IX8A 5LQMA 1MO2A 4P86A 1V35A 4MR7A 1YVDA 3BH0A 2Z9CA 2WD8A 4MQLA 1NQVA 3RJTA 3CNHA 4MYDA 1C14A 5BT9A 2X3YA 4DR2B 1RYYA 3OJXA 5TSDA 2VXCA 3CPEA 3O9VA 5F2OA 4Z3DA 4P0PB 3DH0A 2P67A 3OQVA 4RV4A 1C4XA 3L02A 2IZ5A 3KKQA 5E4JA 1HDOA 3EB9A 3WWDA 4BYMA 4D8XA 1R4NB 2P6RA 2OORC 3Q0TA 1WDTA 4RGYA 6REQB 5D3ZA 2ESRA 5C5EA 4QQKA 2N1MA 2QN9A 2R60A 2BBOA 3D0QA 3BVPA 4WY2A 2QVZX 3FWPA 3RLIA 4F3RA 3ZYZA 3BPSA 4GGMX 3BD8A 2JI4A 3FHTA 4EOGA 4QQRA 3DL2A 3KWFA 3SEZA 1GZ5A 3BFKA 1RQRA 1K2WA 5FF9A 3WNBA 1XL1A 1PZFA 3H8WA 5KNLA 2QZSA 2VH2A 3H3XA 3ZDEA 4TT8A 4FFBA 4FUQA 4PW0A 2MIIA 4PYMA 3W9YA 3T5AA 2A0UA 4LYGA 1DTWB 1M33A 3SLGA 1Z2EA 4I1OA 1L8XA 1HQKA 2AR7A 4KZPA 1MTOA 2X9LA 4RKWA 2ID4A 4HB4A 4KWEA 4YJHA 2GZ2A 3VM6A 4HTAA 1KYTA 5JDIA 5C31A 4X84A 4ARSA 5CIYA 1NY6A 1XJCA 2QLTA 2IPOA 1YS7A 4K9PA 1HNWB 4ND8B 1V8BA 5JTTA 4MGZR 4LSWA 2ERCA 1KOGA 4D1YA 4RADA 1KL7A 3QTTA 3ABZA 1AX9A 1U4SA 2EVWX 4FMDF 2GPYA 3AFOA 4C01A 1E6CA 1SELA 3RAPR 4JHLA 3GNSA 5B7NA 4LDAA 4I46A 3DDHA 1UKYA 2Q3HA 1U7HA 4U63A 1U2DA 3IMGA 3WADA 1IE3A 2DC1A 3MRXA 4OHBA 1Y6ZA 1FYFA 4MK4A 2XYGA 3LIPA 1JGTA 1WCXA 3B9PA 4PHGA 4G1UC 4CCWA 5BUZA 3KEGA 4D0GA 4L7QA 3RWBA 2W58A 4TRJA 3ZVMA 1YH3A 2OESA 3VPDA 4LVCA 3PDWA 2WHPB 4Y7CA 1ISGA 2D06A 4MLCA 5FOQA 5LKAA 4YRIA 4MZDA 3DUWA 5IUNC 1V47A 3MTBA 4YRPA 2DQKA 3UTCA 5TQ0A 3N8IA 3I5YA 1T2FA 1H6DA 4Q9NA 5CITA 1RJDA 2GEVA 2OHJA 1ZD8A 3D6UA 3N07A 3NIWA 1OA1A 3ORQA 2I2FA 3D8NA 1GGFA 4RESA 4Y18A 1MW8X 1QYCA 3DMNA 3B82A 1THMA 2BEVA 1UP7A 3ZGVA 3LFUA 5BWMA 5DP1A 4J16A 2ZBQA 3T52A 2JIQA 2JW5A 2DAPA 4P93A 3R7DA 3TDMA 2QG6A 5AJHA 3W5CA 2VJBA 1J23A 5JE8A 3TQFA 1A5TA 4II3A 3FLEA 1O6CA 2YW2A 1U9YA 1I7LA 1GG5A 2J0SA 3I2GA 3KBBA 1TO6A 4GQBA 4GLJA 3HO1A 2HSWA 1QH8A 2HQOA 2JHFA 3JS5A 4PRYA 3V1NA 1W49A 4ER6A 4QYIB 3E9ZA 5EESA 1Q3TA 2PSSA 3AEZA 4LFCB 3RASA 3RSHA 4XVRA 5L3SB 4AVYA 5BMVA 2JKZA 1M6VA 3HCNA 4G0PA 4M9SA 4ZO7A 1U63A 3J7AC 4QXPA 1EVQA 2WJYA 3HCFA 1EMDA 3EXG1 4IIJA 1JLHA 4BP8A 1T1RA 1KVUA 3FSRA 3LL7A 3UFXA 2YQ5A 3VPSA 5AVWA 5EJ6A 3R2JA 5FWAA 4NBUA 2JIMA 1SKUA 4GL4A 2Z3WA 3MFYA 3PNOA 1ZFNA 3ND7A 1ZA2A 3AH8A 4U7GA 3OZSA 4QTUB 1M1XB 4FX5A 2VI5A 3GLGA 4N4AA 2ZYAA 2HXYA 3WDLA 3NW9A 4CIAA 4IV8A 3G85A 5IJ0B 1OWLA 1RRMA 3NDRA 3ECCA 5KC8A 3EA4A 4ILEA 2JG3A 1H93A 1K92A 2H4XA 2H7XA 2C9ZA 4MUJA 1KZYC 4QDOA 6PFKA 4WH0A 1E6WA 2OD9A 2OCPA 1SR8A 2V6GA 4UUOA 4RFLA 4TXLA 2CF6A 4RETA 4LS3A 2M1XA 1TZ2A 1IU9A 1BXRB 4PLWA 3TNFA 2IBSA 1JEQB 3N87A 2EJTA 2BI8A 1B14A 2WLTA 1CVLA 3ZBPA 3TRIA 2QGNA 3PD7A 5LCXA 4BGVA 4BGDA 2WPDD 4BNTA 4GI1A 4UQPA 3AR2A 4UDYX 1P9OA 1UM9A 1PFUA 4EPYA 1P0CA 3QUBA 2H59A 1CUEA 4OAOA 1CQJB 2FMFA 3HH8A 3KKEA 4AZ0B 5F4BA 3ZHZA 3MTIA 5DBEX 3F2VA 2V7PA 3OZGA 5COAA 4GX5A 4XUEA 3QBEA 5KINB 1HYGA 1G19A 4LI3X 3FPEA 4RPCA 4KV7A 1QQ5A 1EA5A 4FWBA 1WPRA 1U8UA 2COUA 1O8CA 1USVA 4HV4A 3B8EA 4LXTA 1VCHA 3DONA 1YBFA 5BRNA 1WDWB 4PPFA 1JECA 1CLEA 4TMKA 4W7SA 4BL5A 1N2SA 3T3HA 4D45A 1FNCA 4DG5A 1THGA 1HLPA 3OFJA 1KO1A 4BLWA 4QJ5A 4JLSA 4O8ZA 2B2NA 3PFWO 4DG9A 1Z4OA 3KOWA 5JC1A 2JIRA 3LF1A 1CWUA 3VPBA 5C8VA 1DIBA 3AOEA 1S3GA 1EINA 4K6MA 4QUBA 4IJUA 3C3KA 1EDBA 1EG7A 3QK7A 5CCEA 5M29A 1MP0A 1U0GA 1P7YA 3TR5A 1A77A 3I61A 2UZ1A 4W9NC 5A0FA 3S2UA 4M0MA 3KJFA 3EJWA 4AUKA 2IP2A 3SX0A 1LV7A 1SXGA 4FCWA 4DV4B 4X3PA 5CLGA 5FFNA 5LXTF 3SQMA 3N5CA 1THTA 5HM6A 1RJWA 2XE8A 3EEBA 3DA8A 4MH0R 3RU2A 2YVLA 4MYUA 4C7JA 3IXQA 4RCZA 5BNFA 4BNMA 1SOVA 4TTAA 4YYEA 4A0HA 2ODNA 2XZLA 4WDQA 3EASA 4YCJA 2DPMA 5L40A 4LWZA 4DR4B 2VJOA 4R2XA 1ECBA 1JFTA 4YRMA 4JQYA 2JI6A 4DNQA 1B3BA 3KYDB 2O07A 4X1KA 4A36A 2XUKA 4NZPA 5H81A 2WZQA 3ETCA 1YBAA 4K7JA 3T3EA 1IY9A 2NO0A 2OFFA 1QHXA 3U0BA 3LYUA 3PNBA 3KEFA 3GF4A 3GZNA 2I8LA 4WEOA 4EA8A 1CUJA 1XI2A 3A6GA 4AUNA 3IPLA 2PXXA 3GA7A 3DLCA 2CWDA 1XDBA 5J9FA 3A70A 2R8PA 8AT1A 4FCTA 4HQ0A 1MDFA 5HTKA 1RU3A 1TUBB 4CKBB 4Z7NB 4MHTA 4JI8B 4KC0A 5CVCA 3EXIA 2GA9A 1DLJA 1XTVA 2PSEA 3B6EA 3EDYA 2BKXA 1I3CA 2WIDA 5LU8A 4Q9JA 1U1GA 1Q0UA 2H2DA 5J5AA 2YNMD 1OW3B 2NUTB 3HU3A 3IOBA 3PITA 4KXLA 4L0QA 2OGZA 4BP3A 3GD5A 4HFMA 1RQPA 1RPAA 2WC1A 4S0ZA 1Z36A 5HOEA 3C7AA 3HCCA 3MMPA 2O2GA 4G8CA 4JL6A 1NI4A 2PX4A 4OXYA 3GP3A 3OQBA 2GILA 2EFDB 3F78A 2HHHB 1MB4A 2FPPB 1KIFA 1PNQA 5KNCH 1CZRA 4YFVA 1NUSA 3JASA 4ZC1A 4Z3KA 3IBGA 1NP3A 4Q19A 1JQBA 2WWWA 3R3WA 1ODSA 2Z0MA 3SIXA 1R9NA 2NU7B 4BO0A 2DFVA 2OY0A 1DEAA 1K8RA 1M2OB 1M73E 1NJ1A 2RGEA 2QB5A 2Y4NA 3AILA 3CB4A 3FPHA 3KT6A 1B43A 4LNUB 4CJXA 5FBZA 1HO3A 3AW9A 3COYA 4L8YA 4RTLA 2F1KA 3H0KA 3NBAA 3OEEA 1DBVO 3TNDA 1GTJ1 3ZQUA 4US0R 1TVKA 1SUSA 4HYYA 1PNVA 7MHTA 4LJYA 4EKNB 1EQUA 2C92A 4NVRA 4LHSA 1UJCA 4D80A 4LFAB 3CHYA 1GGJA 3G1WA 2DEUA 3X1KA 1IAQA 2FMIA 4YS6A 3C6QA 1L8LA 4MKRA 4EYEA 1DS6A 4H6XA 3R3XA 4I8IA 4EAAA 4BNXA 1XVAA 1XZKA 3RRYA 1AO0A 1M8FA 1L4BA 1JKJB 3M4YA 1C7IA 3QVSA 4ZT2A 2A0YA 1LKZA 3B6IA 2O0HA 1TA9A 4IUBS 3VR6H 1GCGA 2W42A 4QBIA 5EWJB 1OHHD 1PT8A 1T9CA 3ISTA 1WG8A 2NUPA 4LV8B 2D62A 1ZIDA 4QNNA 5EHXA 2GNOA 4ZXPA 1MLDA 4YRNA 2YC2C 3C6MA 1RQLA 2G3YA 2WAOA 3ODPA 5DW0A 1E9BA 3DDZX 3PNYA 2A58A 1U0BB 1DELA 2XUQA 4TQGA 4B6RA 4X9XA 1P75A 2D0DA 3VZBA 4NE2A 1OU4A 3WLEA 4HSGA 1GNLA 3E8XA 4M86A 4NECA 2I2BA 5GWXA 5IYZF 2QMZA 2FZ4A 2CLOB 1PHPA 1IMOA 1R64A 1U28C 2OV8A 2BEWB 4L4SA 4QOIA 1RYNA 2J09A 4XR4A 3ZTTA 4U3JB 1P8AA 1RC1A 4HUTA 4BRUA 5BQOA 1VL6A 4U7JA 3EQ8A 5EGNA 2ZUWA 2R84A 2GXSA 1XYGA 3FYTA 1BWSA 1I32A 2K2QB 3BN3A 3ZXXA 2FH5B 3G02A 3HMKA 4J9VA 4Y9TA 4EENA 3AJEA 1ZBQA 4TL7A 4A8JA 4DIEA 1NTOA 2O1EA 2ZOSA 1I5RA 3EUEA 4JI7B 1HX7A 1W30A 5HJ7A 2YINC 4M87A 4MROA 1Q7GA 4KYTA 4KREA 3G9ZA 4IO0A 4Q4DA 5LQUA 3WK6A 1R5OA 2QPAA 1TM7E 1YWGO 2OXEA 3KO8A 3HZHA 4AKHA 8LDHA 1M83A 2VC2B 1UXGA 1IATA 3HEAA 3TBKA 4EHKA 5B58T 1QIIA 1CUSA 5BVGB 3E3NA 1M34A 3OPYA 4XX0B 5G40A 1I7SB 2CFIA 3UC9A 4BDSA 2D1QA 2ZQYA 3RANA 1OXTA 4FGWA 4LPKA 1E6LA 3CZMA 3RJ9A 3H75A 4N0MA 1N8TA 1XSEA 4RFSA 1Z4JA 1T8PA 4KACA 1AXRA 1JZSA 2EJVA 5DX0A 1GILA 3G17A 4EG4A 1PQWA 4PX9A 5KSOA 3PZRA 2O2HA 3HQ4O 1OGJA 3KELA 5FIUA 2BMJA 1ZK3A 2Y99A 3TWOA 4BZWA 5EEGA 4D42A 2J45A 1M66A 4UVEA 5LOVA 1F6BA 3O8OA 1CR4A 4NPHA 3V3KA 2CJFA 4TOIA 1QTQA 1TJ4A 3D43A 1LQ2A 2MSLA 1FYDA 2OCLA 2X8JA 2WDZA 1C3VA 3LLUA 1W0KA 3VTFA 1X1RA 4UVDA 3UMFA 3V33A 1L7PA 2W43A 5CB4F 5D87A 2YHIB 4LSMA 3H5WA 1Y6JA 4PZDA 1CR6A 3ZWNA 4IAOA 1P4HA 1Z22A 1SUCA 4D2IA 5KKCA 5FPKA 1BW9B 4QG3A 5DRYA 4TSRA 1AK9A 1C7ZA 2JHPA 1HT0A 1NNLA 3MWDA 3GY0A 1A4UA 5EC8A 2AFVA 2R1ZA 3J81k 1FRQA 2BFCA 1XZMA 2AYYA 2NSDA 4CMCA 2AJDA 3WB9A 2PJRA 5AUQA 3PL5A 4HEQA 2G0NA 3P71T 5DF1A 3AY0A 4QDJA 2Q2VA 4YQFA 4AJLA 4BPBA 1WUTA 2OBLA 1TQDA 3DTYA 3W5IA 4YLYA 5HK9A 5KWIA 1STOA 2XEDA 3N39C 4R81A 2VK2A 2FMKA 4DWJA 1EDZA 1MOZA 5I9BA 2F6RA 1ZD1A 3I2HA 3LV8A 3U0VA 4F38A 2V3CC 5CTAA 5F2KA 1CUWA 3L41A 1EBUA 3E9RA 4K9OA 4HMPA 2BM0A 2YFQA 2OGWA 2Z8YM 3QW2A 4KQ1A 3WV5A 5LN1A 1XCOA 4LWPA 4RBNA 5BSTA 4R68A 3FSJX 4K9QA 4DNOA 2R2AA 4WERA 3AR7A 3OM8A 3PC4A 4OLJA 4IG9A 1PFYA 2HI0A 2WIGA 3LHKA 3B3AA 2W2OA 3L8YA 3LKDA 2CJWB 5JANA 4O8CA 3IT0A 1F8YA 3OIYA 2GN0A 4XFDA 1YZQA 3OO1A 1F7UA 3B1KA 2M2IA 4F1JA 4ND2A 2EHJA 2V5UA 4FDUA 4M53A 1AKNA 4O0MA 5LQRA 2B9VA 1G4UR 3KZKA 3HJRA 1L4MA 2OM6A 4HX5A 1CDEA 4S12A 1FYWA 3ZCUA 4CKYA 4EGSA 4ZJUA 4D9GA 1PL0A 2BE7A 2II6A 3CM0A 4I4TA 4ISBA 1F06A 2VYCA 3LUBA 4MW1A 3H4IA 3T12A 3SG0A 4MDFA 4Y3UA 1UPCA 3N05A 3U3RA 1GDTA 1ZH0A 3RAEC 4JVLA 3FBGA 1P1RA 2ZRIA 3C0KA 3OEHA 4G81A 1ESEA 3P9QA 4AMZA 1GAQA 5IFLA 2J59A 1R8XA 1G5TA 4LJ7A 3TW6A 3DD5A 3U6BA 4ZAVA 1T8RA 2J4DA 2JGDB 1GQSA 4FYYA 1PLJA 1JP7A 1E77A 2JK1A 3GK3A 3IO5A 4RKQA 4HWOA 4TS4A 4D8YA 5LKRA 2OK7A 4EFLA 3CEJA 1CCWA 1WZCA 3GJ0A 2FW7A 4FR2A 1GLVA 4EEXA 3H16A 2D1FA 1C81A 3JWEA 2VSFA 5ALYA 3GPLA 1AF7A 1DIRA 2QL5A 1AA9A 1F2TA 1TC2A 2COEA 2GHIA 2Z8XA 1T0IA 4QFMA 2AMJA 4R40A 3T5GA 4DQXA 3OTOB 2H2HA 3IP6A 3NH9A 4E88A 2QA5A 4K6GA 2X5NA 1HT2E 3CA8A 4E12A 2NSJA 6YASA 1M0TA 3GH3A 3GUCA 3ZEIA 3SE7A 1UWKA 2OBNA 3DMGA 3GJTA 4HHEA 5AM1A 3GP5A 3CQ9A 3IAS6 2G9UA 4B3GA 1NBIA 3IR7A 4OLAA 3ITDA 1U0LA 3NALA 1VDMA 2ZBEA 3ZOZA 1G18A 4B84A 3AI7A 2OUKA 1GUFA 4KYIB 4RORA 2XR1A 5AR1A 1QP4A 1JDPA 5B7QA 1MF7A 3O1HB 3Q1LA 4QUDA 4WKNA 4O5AA 3MOIA 1PQYA 1NW4A 4D02A 4HXGA 4KDRA 2ZZNA 4MKZA 5HMMA 4IVRA 4L9SA 3T9DA 2BV3A 2OYSA 3LP5A 3A4YA 1J2UA 2FSPA 3KUKA 3HA7A 3K1AA 4BV9A 4LA4A 1HYQA 2NTJA 2NU9A 4MWGA 1GL7A 3GFTA 4L3WA 3STHA 2PUJA 3RR2A 2GBLC 2WJ6A 3JAWA 1T0HB 2Z1NA 3NEJA 3T4EA 1WZNA 3H83A 2YCBA 1ZIXA 3URKA 1H8ED 3JD3A 5F7ZA 5BR8B 5BNTA 1A5AB 1SUFA 1LSOA 1Y7TA 2OO7A 2V0GA 4BFWA 3KJNA 3OZCA 1Z62A 2X5XA 3WWCA 1EVKA 5LYJA 3SHFA 1AU9A 3BHIA 5IWAB 1G8AA 4KGZA 1J22A 1M8GA 4YCLA 4RZ2A 4D25A 3DZ8A 4Q82A 1NXOA 1BXZA 3PS9A 1UJ4A 2OCIA 2YWFA 3GAFA 2WU3A 3OVMA 3R1IA 4G3XA 1AF4A 3WIBA 2Q1YA 2EP7A 3MJEA 4DT1A 2PT6A 2P1ZA 3BRCA 3ZV4A 1CW2B 1Y5LA 1U8FO 4MQFB 3KP1A 2ZBUA 5IW8A 4PZ9A 2B6HA 2FSHA 3LQYA 5IJXA 3RCBA 4CFZA 1OH8A 4QVKA 4MV8A 721PA 2MU1A 3TCXB 3VPXA 3R5TA 2F7SA 5AKZA 3JQ7B 1YR9A 3P94A 4UD6A 5CK5A 3W78A 1VDZA 2JLAA 1AKQA 3BL6A 1C9KA 3DW1X 3QTBA 4FYKA 1NVVQ 4D79A 5KNBA 2JJ8A 1AHPA 2AN1A 3Q3VA 3U6KA 1HOXA 1KK3A 2NVWA 2QQ0A 2XE4A 3EH1A 4KK3A 1QZTA 5UKDA 1GAWA 2O6LA 4ZYXA 1OB2A 4P83A 5EPUA 2R751 1SULA 1E1QD 4X41A 2DR0A 5C8ZA 2BKAA 1JA9A 2X2OA 4FFWA 4MA0A 4Y9RA 3RI3A 1M34E 2JJ2D 2NXNA 4MLZA 5JRJA 3PQ3A 2QN7A 5EJEA 5JO0A 3UENA 5G02A 1Y81A 1T26A 1XR3A 4J4BA 2C4HA 4ON9A 4Z51A 3OQPA 4DQLA 5KTOA 2FXIA 1KWGA 4RE5A 3E81A 2YWJA 3KYJB 2OAP1 2FEMA 1CJSA 1Z8NA 1RJ9A 2O48X 1AE1A 3R7AA 3WGNA 1T1GA 4Y6SA 2CNWA 3TAUA 5CA0B 1Z39A 1ZCBA 3PA8A 2X76A 2IEAA 1A5BB 3I58A 1YUNA 2G08A 1YZLA 3D7KA 3A1CA 3KR2A 4EMSA 1KVQA 3DV9A 1DC3A 3HVKA 3DE6X 3LLSA 2PZBA 1E5TA 1KH2A 3LUAA 4MUIA 1Y34E 1D1SA 1UQRA 1TKRA 3HKDB 2SKEA 3IURA 3QJ5A 3OX3A 1DQRA 4RY8A 3RJMA 1AKMA 1ABBA 2AD5A 4R8VA 3L7YA 2O2SA 5J43A 4JJ4A 1P44A 1ZH6A 3FFTA 4DA8A 4GOLD 3DOEA 2HR1A 4V0RA 2IFTA 1TKBA 3HNPA 2JS7A 1UFKA 4P53A 3TCKA 4NIMA 1R0CA 5T4BA 2DMRA 2PT7A 1DC8A 4DANA 4YRJA 3DMDA 1D9XA 1N7HA 1F2DA 4K9DA 1X94A 2QN6A 4E31A 4EY3A 5KOJA 3T5MA 1A4IA 1CNFA 1L4FA 3OLYA 5AUNB 2ZIXA 4TWZA 4RYLA 3V80A 2J6IA 5JECA 1E2PA 1QLWA 2GK4A 4DJJA 1SUIA 2I2CA 2Z2JA 1L5VA 3I6IA 5KBYA 1W2HA 5KTYA 4ETMA 4HO1X 4JGBA 2WT9A 4DPKA 1DQPA 1HNNA 3MWKA 1WETA 2YWDA 1BX0A 3KOYA 2CFOA 2PS1A 2ZPAA 4URFA 2XE7A 3FJOA 3GRYA 4KQKA 2FRXA 2I2AA 2MHCA 3DKRA 3LSYA 3OY7A 4HDAA 4OI2A 5DMXA 2NG1A 2IU0A 3KVOA 1E2QA 5EZYB 1CP2A 1MV8A 2PUCA 4ZRDA 2R7NA 4DW8A 2W93A 3Q98A 4ESHA 3A4VA 4HTFA 1UMDB 1YB7A 3Q85A 4DHWA 4PU0A 4ZT5A 2XTNA 3FW1A 3F5MA 2JJ2A 1IHPA 3C5VA 1EFRA 4WADA 4DLPA 1T9KA 4JDPA 5BPFA 3O4RA 5AJVB 1Y8QA 1YOVA 4ZA2A 3SM3A 4C2TA 3PX3A 4BFSA 3IKLA 3R7NA 2PAAA 1DAGA 2N3ZA 4D92A 4QGAA 5KU1A 2CZGA 2Y1CA 3C7CB 3AF2A 1QCDA 4M22A 1D1TA 1QX3A 2Q0QA 3A1SA 3HBNA