1C4XA

2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOATE HYDROLASE
publication title Three-Dimensional Structure of Microbial 2-Hydroxyl-6-Oxo-6-Phenylhexa-2,4- Dienoic Acid (Hpda) Hydrolase (Bphd Enzyme) from Rhodococcus Sp. Strain Rha1, in the Pcb Degradation Pathway
pubmed rcsb
source organism Rhodococcus sp.
total genus 92
structure length 281
sequence length 281
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 1999-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c4xA00
4BC1A 4UBJA 3FYUA 4GI1A 5CMLA 4BP9A 3WA6A 1W52X 3EF3A 4U2EA 4FKBA 4PSCA 4UFOA 2WSLA 1E8DA 4CCWA 2ZSIA 4ZXFA 3ZLVA 3I1IA 5ALFA 1SOMA 5FOQA 4BCDA 2XUQA 4ARBA 1HBJA 3QPAA 1P0MA 2WIDA 2J4CA 2WHPA 1Y7HA 3SWWA 3HACA 3A70A 5AM3A 1XROA 1CUCA 4V2IA 1DX4A 5T4FA 1J07A 5ALIA 2XUGA 1EB9A 3STXA 1SCIA 4DMKA 4W1SA 3D7RA 3O9MA 2G4LA 3D59A 3H1AA 1VLQA 4HRYA 2B4KA 1R9MA 4J0DA 1LPAB 1EHYA 4UPDA 5AHXA 5I9IA 3HEAA 3FLBA 4GBGA 1CR6A 3VISA 2HA2A 5JARA 3HI4A 3D3NA 1CUDA 4Y2JA 4E11A 2WU4A 4RGYA 4FBLA 4BDTA 5YASA 3WWOA 5BWCA 5LKRA 1B6GA 2XUAA 5IH7A 3AINA 4GDMA 2VAVA 1EINA 1ZD5A 1YB6A 2ZYIA 1Y7IA 1ODSA 1WM1A 2WLSA 5AI4A 4H18A 2XUIA 3HSSA 5HF6A 4YPVA 1L7QA 5CXUA 1AQLA 4BTVA 2B9VA 1QFMA 5K5EA 3I2FA 1XZLA 3LCRA 3C6XA 1VE6A 5AM4A 1W75A 3D2BA 3AZQA 2PVSA 1CUGA 3V1NA 3GZJA 4AZ0A 2VJCA 3G02A 2WKWA 2PU7A 5DNWA 3O4GA 5BOVA 1BN7A 2BUCA 1TQHA 4UBNA 4OB7A 5JD6A 3IIIA 4WY5A 1Q0ZA 4GWLA 4AMZA 5ISMA 2JGFA 3MUOA 4ZV9A 4Y2VA 3JW8A 1E8MA 4IH4A 2ROQA 3G0CA 4IQ4A 4CFSA 4UBLA 1K63A 2V97A 3I6ZA 3KOOA 3R3VA 3D4LA 5DNVA 4BVLA 5AM2A 1P0QA 5LZ5A 5JAOA 5DLPA 5LIPA 4BATA 2JGJA 5IVHA 3DEAA 4Q3LA 1DINA 4LXGA 5ALRA 4K6KA 4Q1VA 1RYYA 4N5IX 4X6UA 4OUKX 5EHXA 5DWDA 5E4TA 4DNOA 5DTIA 2O2IA 4X94A 1EDEA 5A7GA 1YS2X 4LIPD 1BS9A 1G4HA 1H2ZA 5AOAA 4JUIA 5AI8A 4OD0A 1QO9A 1LNSA 2V9ZA 3S8YA 5ALVA 3FCYA 3OURA 2XQIA 4X93A 4OU4A 2Z3WA 1P0PA 3ED1A 3M83A 3QBJA 4KEAA 4F21A 1R50A 3K9BA 3BJRA 2WU3A 4HVTA 4A16A 2XMBA 1N5MA 1OILA 1R88A 2DCMA 3EIOA 1EXWA 5K3FA 3FWHA 5KREA 4EB0A 1YAJA 3H2KA 4BDSA 1XZCA 2XUDA 4K6GA 5A7FA 5AI5A 2DQZA 5ALMA 3O9VA 4KR0A 4QDOA 5A71A 1AX9A 1P0IA 5AK4A 3WYDA 5ALZA 3I28A 1WHSA 1WCYA 4H7DA 4J7AA 5HFNA 4EY6A 5AO9A 2QKYA 2JBWA 2CEKA 4BAZA 1EVQA 3RARA 2GYVA 2C0PA 5CW2A 3M81A 1HQDA 1HLGA 4MWSA 1MNQA 5AIBA 5JYCA 5CXXA 4HZGA 3AZPA 5C81A 1AMNA 5T4BA 1ZIYA 2V96A 3V1MA 4AN0A 2JIDA 3VKFA 2QR5A 3WKDA 5AOCA 1YCDA 4X3CA 3DLTA 2OQVA 2XE4A 1CEXA 3DD5A 2O7VA 5IVIA 4J0HA 1F0NA 4C6HA 1MX9A 4XWGA 3KDAA 4CG2A 4I4CA 5FRDA 4ZI5A 2PSDA 4OYYA 1CUHA 1YASA 4C89A 3WJ1A 5A6VA 3FLEA 4K2AA 3AIMA 2B20A 4U2FA 1DT3A 1QJ4A 4G8BA 4J0CA 4DNPA 3G9ZA 1EVEA 4HTAA 2IX9A 1XZIA 1XZDA 4WFKA 4TVKA 1ZOIA 5BV7A 2XMSA 1UXOA 4DNFA 2PUJA 4UHDA 1UOQA 4EY7A 1TIBA 5CT8A 3SX4A 2XDWA 2ZJ6A 5AOBA 4U2GA 2IITA 3WJ2A 2XUPA 1R1DA 1X70A 2W22A 1QGED 5J3JA 3IBTA 1Z68A 2GZSA 1QIFA 1XZHA 3FSGD 5IVKA 2VATA 5AKKA 1QIIA 4FTWA 3A2MA 3ANTA 4P08A 1SCKA 4DMHA 4EZIA 3QM1A 4M0FA 1QTRA 4QE3A 4F60A 4BE9A 1WB6A 5ALLA 2LIPA 3VJLA 5JAPA 1XQVA 4OYLA 3MGAA 1VOTA 3L1HA 1T4MA 4AN1A 3BDIA 1LLFA 2XT0A 1XRMA 3Q8WA 4TGLA 2GZRA 2AXEA 1GPNA 1AZWA 3M82A 2J3DA 4UBKA 4B81A 2OAEA 2WG1A 2OCGA 3STUA 7YASA 4H77A 2H7XA 2XMRA 1B41A 5EGNA 2I78A 4BAUA 1XZBA 2WJ3A 4ITVA 3H2IA 4MXDA 3W2TA 2DHDA 3CN9A 4O08A 3I2KA 2WHQA 1QO7A 1DWOA 5K3FB 4EA6A 1GKKA 3G9UA 2O7RA 5LZ8A 1TCBA 3WLAA 1WPRA 3A6ZA 1C7JA 1USWA 2QZPA 1NU6A 1XZAA 3ESBA 4L3WA 1VXRA 3WL6A 3Q0TA 2K2QB 4EHBA 4QWMA 3WK5A 1K4YA 4Y7DA 5K3DA 3H1BA 4QDZA 4L9AA 3DCNA 2Y1KA 4CIAA 2ONCA 1TKRA 3LIPA 4UHCA 3ZPXA 2PKYX 1HDEA 4F0JA 3R40A 4QEKA 2VQ6A 2Y2VA 4X71A 4M0EA 4FFWA 3ILSA 3I2IA 4BC0A 4BBZA 5FLKA 4B83A 3SK0A 2GYWA 3H2GA 4PF1A 3ESCA 5C7YA 1FFAA 1WOMA 2PUHA 2WM2A 3WA7A 1DT5A 4C4XA 4RPCA 4W63A 5FV4A 1N8SA 2XQJA 3ESDA 1ODTC 1RWQA 4U2BA 5K3CA 2OQIA 1XZFA 1UK8A 2RONA 2AJBA 4G4JA 1MU0A 4CI9A 2PL5A 3GROA 1YB7A 3F96A 3BDVA 4AZ3A 3VXKA 2WIGA 4FBMA 4D9JA 4C4YA 3VDXA 5HKBA 4GLBA 3F98A 3W05A 1F0PA 3PF9A 1QIMA 3BL8A 1XQYA 3NOXA 2GBFA 1X2BA 1L7RA 3F9CA 1UKAA 4G1FA 1UK7A 3D2AA 1PJAA 1F6WA 3OPMA 1T2NA 1LGYA 3A2NA 4KAJA 3D0KA 5AI0A 4EUSA 4H7HA 1JKMA 2ZYHA 1XRRA 2Z3ZA 1JJBA 4U2DA 3GFFA 4HXGA 1YSCA 2WFZA 3G9TA 1H22A 4UHEA 2QVBA 4BZZA 1X2EA 2H9YA 2WIFA 1ETHA 3X3HA 5JADA 1CRLA 4DLNA 1UWCA 3F8SA 5T4EA 3C8DA 2BKLA 5IKXA 4B82A 3DL4A 3G9XA 5FUMA 1XZGA 3K6KA 3UUFA 3WWDA 1FFEA 1BU8A 4UHFA 5FP0A 5LYYA 1XLVA 3G0BA 2YASA 4NMWA 2WHRA 5HF5A 3H17A 2H7YA 3GUUA 2ES4A 3FLAA 4FLMA 1U8EA 2HFKA 1WPXA 2D0DA 4WFIA 5AICA 5AKIA 2X76A 3PUHA 4B80A 5IVDA 2O2GA 3R3WA 5KBYA 1HL7A 3R3ZA 3AJAA 2XMDA 3AZOA 4UBIA 3TGLA 1BN6A 4EY8A 2VJDA 4XIIA 2JGLA 1H2XA 3AIKA 4Y2RA 1GPKA 3BIWA 4X92A 1UKBA 5C8ZA 5D6OA 2BGNA 1U2EA 1BROA 4Q3KA 4WFJA 1N5RA 5A2GA 2C0QA 3TRDA 5CH3A 4OB8A 4DSAA 4H7FA 5FKJA 2C7BA 5LZ2A 2HHAA 3QPDA 5ALPA 3D2CA 5E4JA 2CMFA 4ZRDA 4KE9A 4Y2SA 4UUQA 1QIDA 1EA5A 4UBOA 1YAHA 1R4ZA 4MQMA 2WFMA 5A7HA 2OPHA 3EQ7A 1LPPA 4Q05A 3TEJA 1CUJA 1CUSA 4E15A 3QMMA 4KACA 1LPOA 3BF7A 2HIHA 4X95A 1ZICA 1E8NA 4WY8A 3QITA 2CBGA 2DHEA 2OGZA 3LIIA 3NWOA 1K6EA 4WCVA 4J3JA 4HRXA 3WKEA 2DR0A 4DMCA 5ALTA 4I19A 2DHCA 4G9GA 3G0DA 4KJXA 4IHAA 4F5ZA 5JD4A 1LZLA 4OB6A 4LKOA 3WKCA 4QDXA 2QUAA 2XLBA 4JH0A 5CURA 5JZSA 3QVMA 3ZLUA 3IDAA 2QXUA 2VF2A 3WZMA 4RE6A 2Y2UA 3DDUA 3WIBA 4KYVA 4C01A 3E1GA 2WJ4A 2VA9A 1LPBB 5DYWA 1JJIA 3C8HA 4PO3X 3C5WP 5JZBA 4ROTA 1QTIA 3ANSA 3PICA 3F67A 5CT6A 4G5XA 3P2MA 5SYMA 2WG2A 4Z49A 3DNMA 3QPCA 4E14A 3OOSA 2HU7A 5LZ4A 5D3KA 4GXNA 4UFPA 2WILA 2ZJ7A 3RLIA 2WUFA 3WK8A 2JGMA 2HA3A 4FWBA 1EI9A 5CT9A 3WKBA 1VA4A 3CCBA 3O4IA 2OLEA 2XQKA 2CUTA 4B7ZA 4KE6A 5JASA 1XLUA 1UT6A 3C6ZA 4XJVA 1FJ2A 2ZYRA 2YH2A 3HRHA 2X8BA 3ZV7A 4ZWNA 2ORYA 1JJFA 2D5LA 4L0CA 3KWJA 1GKLA 1XFDA 2XB6A 4DMFA 3B12A 3JYHA 5AM0A 2PSJA 4Y2QA 1VE7A 1AGYA 2I3DA 4X6XA 4HAIA 1NX9A 5HQ3B 2R8BA 4W9RA 1XZEA 1H2YA 3LP5A 4IH1A 3LS2A 4QLOA 4EBBA 4W1PA 3WI7A 3FCXA 3G0GA 4GEGA 2RI6A 2Z5GA 3H2HA 4YK7A 2ZJFA 3DQZA 4HXEB 4B85A 4KE7A 2FX5A 2P8SA 4QWWA 1IUPA 1LPMA 5CT4A 5HCUA 3KSRA 1CUVA 5ALJA 1TCCA 2UZ0A 3VVLA 4KAFA 2G5PA 2VAXA 1W4LA 4J0GA 4UBMA 3CN7A 1CQZA 5HK9A 2C58A 1BE0A 1EB8A 4ZV7A 5JALA 4FDMA 3O4JA 1THTA 3IUMA 3R41A 4JEIA 2WIJA 3C6BA 4X97A 4Y9SA 1ZGBA 4M0MA 5ALWA 4X00A 2XLCA 4B6GA 4Y2XA 2X5XA 1DU4A 4FMPA 4I3FA 2EEPA 1L7AA 3R3XA 1WHTA 3V1LA 4QDTA 3H2JA 5KWIA 5JATA 3PFBA 2WTNA 1QOZA 2CJPA 4S0XA 1WB4A 5CBKA 4K5QA 2QJWA 4CIBA 1KU0A 3DKKA 2HFJA 5EHNA 4EY5A 4C87A 3OTQA 4G8CA 1E5TA 1JFRA 1VKHA 3F97A 3WWEA 1ZGCA 1W1IA 3IUQA 5AKZA 5EHZA 3FVRA 1MAHA 4DTCA 4WDQA 2JF0A 1H23A 4MEAA 2QS9A 2DFPA 1GT6A 3DYVA 1CV2A 2FUKA 1CUWA 2VSQA 4AO6A 4PNZA 2QT9A 4CCYB 5AKLA 3HC7A 2XMZA 4BCCA 1UK6A 4FLEA 2Y6VA 5T4HA 1DQYA 4G4IA 5FPPA 1AUOA 4XX1A 4B0OA 2G63A 5D7BA 1CPYA 5ALOA 2BGRA 4J0IA 1EK1A 2BUAA 1ORVA 5ALUA 1VA5A 4AO7A 1XZJA 2QJRA 2WUGA 3W9UA 3QYJA 3PFCA 5CTAA 2AJLI 5ALHA 2XUHA 2I03A 4AX4A 1VZ3A 2JEYA 3FSGA 1BCSA 1CLEA 5HZGA 3KXPA 4Y2UA 5AK6A 5JAUA 3WK4A 1CUXA 1G66A 4WJLA 1Q84A 1ZI6A 1GQRA 1VZ2A 1ZD2P 3ZWQA 1CQWA 2JGKA 1TAHA 4H7KA 2Z8ZA 3KD2A 4KAAA 4N8SA 1GPLA 1CFJA 4FHZA 3GA7A 2AJ8A 2OCKA 1C4XA 4J0JA 1MT3A 5K3BA 4B0PA 5LP1A 1IZ7A 1TCAA 2WUEA 4GW3A 5AI6A 4BP8A 5AP9A 4BB0A 1DWPA 2DQYA 2QRUA 2BJHA 4E46A 3RK4A 1XRNA 5DYYA 3WYNA 3HZOA 3W06A 4JYMA 1QIGA 1IVYA 4P93A 5AM1A 3I1YA 2C5GA 4UHBA 2XUJA 1JMKC 2RHWA 3O4HA 3NGMA 1ZI8A 1K5PA 4B9EA 3BF8A 3WMRA 1AURA 3HABA 4H0CA 4FOLA 4C4ZA 5HKAA 4BVJA 4GECA 3PE6A 1TK3A 5AKHA 3JWEA 5AM5A 1DX6A 1K8QA 2QMQA 5HFAA 5BWBA 4PSUA 2YYSA 2CZQA 1IUOA 4TPKA 2HA5A 3RKSA 2G5TA 1QIHA 3PF8A 1UZAA 5ALSA 3QMWA 3OM8A 4IO0A 3WL7A 5HF9A 2CKMA 3MVEA 5JZ9A 3HLKA 3KWFA 3UMJA 1BRTA 2WFLB 3G0IA 5C8VA 3ESAA 2PSEA 2W6CX 5AK5A 3T4UA 4OSEA 5JIBA 5AKGA 3WK7A 2QM0A 1A8SA 1A7UA 5K3EA 1LBSA 5ALGA 1DTEA 5HQ3A 1PFQA 1O6GA 3NUZA 4ZREA 5C8XA 4K6HA 4KRYA 1FFCA 1LZKA 3V1KA 4UHHA 1R9NA 4QA9A 1XKLA 4HXFB 4MQLA 2R11A 2HU5A 3V48A 2O2HA 4QNNA 3AILA 4QZVA 4IH9A 4P92A 3STVA 4BAGA 2V98A 5EHQA 4X6YA 1ISPA 1J1IA 4BTLA 1QZ3A 2HM7A 4QLAA 2WQZA 1XRPA 1IUNA 1OCEA 5AIAA 1MN6A 2AJDA 3DOIA 5AH0A 4DSZA 1Y37A 3HJUA 3L1JA 4QDUA 2RHTA 5FXMA 2IIVA 3STWA 1ZI9A 2DSNA 4PW0A 1Q0RA 1MJ5A 3A2LA 3WKAA 5ALXA 2XUKA 4DYHA 1JI3A 4G4GA 2BAGA 3G8YA 2J3QA 3QZUA 4INZA 5DTJA 4OPMA 4CG1A 3H18A 1LBTA 2XUFA 3IURA 5CRIA 4RNCA 1RP1A 4GHWA 1D07A 4DNQA 2YXPX 2QUBA 1R3DA 1ZJ5A 4PQEA 1G5FA 5ALYA 5EIHA 2QXTA 5ALNA 3FYUC 4Y2PA 4N5HX 2JGEA 1M33A 2XQGA 2PM8A 1SC9A 1EK2A 5JAHA 1ZD3A 3BJMA 1NU8A 1E66A 1UOOA 4LXHA 1OXMA 1YA8A 4KE8A 2FJ0A 2HL6A 3G7NA 3M3DA 3PUIA 4Q34A 1VXOA 5AJHA 5AKYA 4Y2TA 3IULA 1AKNA 2BFNA 4AQDA 1YS1X 4BRZA 1JU3A 2XUOA 2FJPA 4JNCA 1EX9A 2XMGA 2BCEA 3IUJA 3N0TA 3DYIA 4X7BA 4JYPA 4LXIA 1HKHA 1XQWA 4Q82A 5FPQA 3AIOA 1GZ7A 4B9AA 3B3QA 5JD5A 4W1QA 4H7JA 2PSFA 2RGUA 1S8OA 2OG1A 3OC0A 1Q83A 4Y2YA 4CCYA 1QFSA 1ZD4A 2HRRA 3I2HA 4N8EA 3R3UA 3WL8A 2WIKA 4Q3OA 1E89A 3I6MA 1MPXA 2OXEA 1XZMA 5CH5A 3GBSA 4LYDA 5I7UA 2OGTA 3FYUB 4BYMA 1SFRA 4C88A 1UKCA 1G42A 2HDWA 5LZ7A 5H3HA 5D3ZA 5EFZA 3CXUA 2AJCA 3UUEA 4H7EA 5K3AA 1MO2A 1H2WA 3RM3A 1WB5A 2ACKA 3QH4A 4G9EA 3C43A 1QONA 5E2IA 1MX1A 3S2ZA 1QIJA 2CB9A 3BE8A 2WHPB 1ZJ4A 2VEOA 2ZVDA 3E3AA 1MTZA 1I6WA 3IB3A 2JEZA 2ZSHA 3ICWA 4G8DA 2OCIA 3MUNA 4UFNA 3IUNA 5ALKA 3STTA 1CUEA 4X91A 3W9BA 1GXSA 2BUBA 4CG3A 2EDCA 2HA0A 5AKEA 3K2IA 3SC2A 1ODCA 1J2EA 1YR2A 3H19A 4FFVA 3HYSA 2HA6A 3R0VA 2PX6A 3FVTA 2OCLA 3LLCA 5AKJA 1CUFA 3EQ9A 2OAGA 3AUKA 3GELA 2XMQA 3D5EA 3L1IA 2HU8A 2ACEA 1JMYA 2HADA 5ESRA 4ARAA 2Q0XA 5JANA 1HPLA 2XI4A 4NS4A 1J06A 3CCCA 2WG0A 4YASA 6YASA 1XZKA 3QMVA 3IVMA 1BCRA 4ETWA 1N1MA 3W04A 4U2CA 2GYUA 3TJMA 3WWPA 1LPNA 4AXBA 4AMYA 3FOBA 1EDBA 1LPSA 3STYA 1QLWA 4ZGBA 4OU5A 1KEZA 3I2JA 4J0KA 1FSSA 5CH8A 1ZIXA 2C5FA 1FFDA 3ICVA 2GBIA 4KRXA 3U0VA 1FFBA 3EBLA 1CUUA 4DGQA 4A23A 3OG9A 5AI9A 3ZI7A 2PBLA 3PDCA 3VJKA 3FYTA 4AO8A 3VVMA 3I6YA 3PI6A 5SYNA 2VJBA 4HS9A 2EDAA 3FAKA 2XQFA 1ACLA 3DS8A 2PU5A 1BEZA 2RIPA 2VJAA 1XRQA 1U65A 2RAUA 1PV1A 4OCZA 4DM7A 1CUIA 5HK8A 1XKTA 1A8UA 3C87A 1UOPA 2WJ6A 1JU4A 3WQHA 4L72A 1CUAA 2GBCA 1A88A 2WFLA 1KU6A 2QOEA 1THGA 4BRSA 1F8UA 3WK6A 5F4ZA 5DYTA 1EH5A 1AC5A 3FNBA 4H35A 1DWQA 4J03A 2HRQA 3B5EA 4A5SA 3BXPA 3I2GA 3T52A 1ORWA 4FNGA 5KWJA 5AKXA 4AB1A 1CVLA 2GBGA 4BVKA 3O0DA 1XLWA 1IZ8A 4MYSA 1MNAA 3C70A 4P9NA 4LHEA 5LZ9A 1EDDA 2VT7A 1SCQA 1GGVA 3H04A 2I3ZA 2E3JA 2XMCA 4LYEA 4NZZA 3WIOA 4H7IA 2Y6UA 1MAAA 1C7IA 2Z8XA 2B61A 2VTVA 4RE5A 1A8QA 3AFIA 3C5VA 3BIXA 5LLSA 3WZLA 4X90A 1XRLA 3V9AA 1CUZA 5ALQA 3C45A 2J4FA 5HF8A 2ECFA 5DNUA 1IMJA 1TRHA 1BEEA 5ALEA 3ZLTA 3BWXA 2ZYSA 4EY4A 1UFOA 2WUDA 4B84A 5EIAA 4XVCA 1U4NA 3IA2A 1UK9A 2NW6A 4PSDA 4W1RA 4MJ3A 3FBWA 1W6RA 3WWCA 4WDRA 3R3YA 2H1IA 1MX5A 4X85A 1CUYA 4YX9A 1VJ5A 5E4YA 1JT2A 3EQ8A 1E3QA 2HA4A 5EIEA 3N2ZB 1QIEA 5EI5A 1O6FA 1ACJA 2OGSA 5DJ5A 4PV7A 5CT5A 4BCBA 1CIJA 5FDFA 2WTMA 5I8PA 3VJMA 2JGIA 1GQSA 4DIUA 5ALDA 3DL7A 1XQXA 4BZWA 3DKRA 4BE4A 1W76A 3C6YA 4MEBA 3HXKA 5LKAA 4FNMA 3DJYA 3E0XA 4MYDA 1CUBA 3E4DA 3U1TA 3WL5A 2H7CA 2PSHA 3WK9A 4MWTA 2PPLA 1QIKA 2HA7A 4FLFA 1DQZA 5A62A 2C4HA 5AK3A 1QE3A 4N8DA 3DOHA 2VT6A 1YA4A 3O95A 4NVRA 2QTBA 3YASA 3H0CA
chains in the Genus database with same CATH superfamily
1X7GA 3GW8A 4II2A 1DXYA 1I33A 2BYTA 4WNCA 1PWYE 4UC0A 2WKSA 3BG5A 3OLCX 4GLJA 4I08A 3FSEA 5FUBA 1OY1A 3EF3A 3EVBA 3P97A 2NMVA 2BGTA 3DBOB 5FWDA 3GRAA 2L42A 4FKBA 3N8KA 4UFOA 2K7ZA 3CONA 1IDN1 1YTUA 3JR3A 3URKA 3Q8XB 1KTIA 2COUA 2JBHA 2GT1A 1UZNA 1ECGA 1YXMA 2B4RO 3ZLVA 3OQNA 1DC4A 4P3KA 1WTAA 1C3OA 2ZIUB 5DN6D 1Z07A 2CN1A 2YIJA 1TUIA 2FFRA 4YMTA 5JCOC 5MFPA 3TFWA 3PFWO 4UOZA 5BMOA 1RJ9B 1W0JD 3DBRB 1YHZA 3EXEB 1Y82A 3LT5A 3Q4GA 1UPXA 4OK5A 4W99A 3ZWKA 2ZB4A 2Z4TA 5KNLA 2XUQA 4DCOA 4ARIA 1KJZA 1RKBA 2BGIA 2ZDGA 1R2QA 3ZQUA 4EGFA 3R5FA 4MMXB 4G65A 5KOYA 1YULA 1VIAA 4LBWA 5L7TA 4KGZA 3EYAA 1Z5WA 2XKBA 3FKSA 1Y7HA 2R97A 3HACA 1OXVA 1DC8A 3FFAA 2OAQ1 4PLCA 5F1OA 1KEKA 3UGQA 2B82A 2OBYA 2GZHA 4ESHA 4IDNA 4RQAA 1QGZA 4AM8A 4GZ5A 1B42A 1QF7A 4GVLA 4EI9A 2FR8A 4V2IA 2ZUWA 2FB9A 3W5AA 3HJHA 1EB9A 1DAPA 2J5KA 4DMKA 1ZAKA 1GNPA 2GD1O 3I6QA 5TMPA 2OYRA 2OLJA 3PZRA 4EECA 2JZCA 4L0DA 5EIBD 3LYHA 4OQNA 3A1CA 1NA5A 1DPGA 4FFBA 4HQRA 5DBFA 4J3NA 5KU7A 1CWUA 3OCJA 4HAWA 2B4KA 2V7BA 4H3KB 4L4SA 3HCEA 4EG8A 2PGXA 2RSLA 1R9MA 3BILA 2I6UA 4ANFA 2QN1A 3Q3CA 1LPAB 5JC1A 3JWJA 2VHXA 1OWPA 1TLFA 1WLYA 3BQNB 4GBGA 4MNTA 4E32A 4DT1B 1B4DA 1YS7A 1E1KA 1PR6A 3PXEA 1O58A 3LPNA 4L5IA 4V39A 4AF6A 3MT0A 1Z16A 2B7LA 4J9UE 1ODLA 1RCFA 1UXGA 4MVCA 2W6MA 3KAKA 1CUDA 4W5NA 5C1BA 1J8QA 2CD7A 4LF6B 4W7IA 3UJNA 4E11A 1FDWA 1LJUA 3SP1A 5YASA 3FWKA 1SURA 1TT7A 2I1WA 2FW7A 4DIOA 5BWCA 2RK6A 4UUPA 2VJYA 3UTCA 5ARCA 5IH7A 3AINA 1ZIDA 1Z45A 4ZCSA 1YZTA 4MS3B 3IEMA 3KO8A 3H9CA 4GDMA 4YJKA 1J23A 1YB6A 3DTVD 4IV8A 5FNVB 1KIFA 2PFSA 4C7KA 1ODSA 5JDIA 5F52A 4LG1A 1Q7BA 2H52A 3ZDDA 1XX6A 4EL0A 4MI6A 1YMUA 1LCIA 3A1FA 4M21A 4YDRA 5K6AA 3ZG6A 1X1TA 2Q99A 5JHGB 1EAYA 4Z3OA 3QKTA 4PX3A 4G0OA 2OV6A 5CXUA 3OQJA 3O93A 3QI7A 4YGYA 3SBDA 1WZCA 1SMKA 1XDUA 4YRQA 3ZEAA 2HMUA 4EEXA 1JKXA 4YAIA 2XOEA 2OBBA 3QLEA 5K5EA 2F43B 1E20A 2CY0A 3HDGA 3IUBA 3RF7A 4D02A 5F4BA 1UANA 4MMYB 3OF3A 3C6XA 3DKVA 4PXSA 5J4HA 1A4RA 3V4SA 2DKOA 3OFND 2BL4A 2R6DA 5B5SA 2RHHA 2HV8A 2PSSA 1CUGA 1U1CA 1PT8A 1P3JA 1J9ZA 4EW6A 1QG6A 3D6TB 4PICA 2P9EA 1ABEA 3AKCA 3GZJA 1Q14A 4XLTA 5M2QA 2EFDB 2IKSA 4QUGA 4OH1A 3ZKAA 6ABPA 2HQBA 1AK9A 3OEYA 2PU7A 3HV2A 5DNWA 1FQKA 3LUKA 4Q37A 4C6TA 5JAMA 1UFQA 1XTUA 3WMFA 4WCDA 1M2EA 4L28A 4AKTA 4U5QA 5HSGA 4RADA 1BN7A 1G9TA 2UYYA 2VP9A 3N2LA 1M1YA 3L0PA 1VKJA 5HKKA 3EIHA 3GDGA 2AEMA 1UJ5A 3HKEA 4UBNA 3QU7A 4LMRA 5B1DA 2YR0A 3P2KA 2PNJA 1HOXA 3PBKA 1JSXA 4FI3F 5D51S 2GM3A 2CFRA 2GF9A 4EELA 1VHTA 2VHVA 1Z82A 1HF3A 1OBCA 1Q0ZA 2GFIA 2P8JA 3O83A 2ZVJA 4LMBA 1L4HA 2CWWA 3A6FA 5EPEA 3VVBA 3MUOA 2FPGB 3IV9A 4ND7A 1NGSA 4Y2VA 1KOJA 2JS7A 3IP5A 2WD7B 2ZBEA 4Y0VA 2Z2YA 3OTHA 4YJ2B 1K63A 2RGWA 4UBLA 3RFVA 2QTLA 5B2FA 3GQBB 1E4YA 1LLDA 2YQ4A 4M88A 4A8HA 4MOWA 3HP7A 1G7CA 4BVLA 5AM2A 4GZ3A 5LIPA 3QE9Y 4ZI7A 1NJ2A 4BATA 2ZWVA 5IVHA 2Y3IA 3BXXA 3DEAA 1RPJA 2ANBA 2Q3HA 2QSJA 2XSZA 1NP3A 3BMOA 5KYGA 4PYNA 4K6KA 3EGDB 4GQBA 4Z86A 4BU1A 1GKYA 1JEEA 3LBFA 4AZ3B 4O5AA 3JYPA 3VDMA 4OIMA 4EK9A 1WZ2A 4ALMA 2V4MA 1FJGB 1C8BA 1N2HA 1Q92A 2H07A 1N0VC 3DE6X 4JOSA 3ETLA 3GFTA 5K8IA 2V9PA 5DDIP 1X92A 5K2OA 2AC7A 3RAGA 1CNEA 5CD9A 2OFOA 1FPMA 1M83A 1XTPA 2HBQA 4DLUA 3ROQA 2HO5A 5IFLA 2NXCA 2W2NA 4N4AA 1KQ3A 2NNLD 3W2FA 1U1DA 1LI4A 3ZNQA 3P0FA 3IODA 4IP0A 4QEZA 4BVFA 1GARA 5CFOA 4PIVA 2RKBA 1E6LA 3DXYA 5TR9A 4ZGWA 4XRGA 1V25A 1BS9A 2VK8A 4ND3A 3F46A 2Y9MB 3QW4B 1E99A 1U5CA 3IP8A 3T0GA 5FOTA 1ZRHA 4YIHA 2JLWA 3EVFA 4LYGA 1MC5A 1YZFA 4EENA 5FUWA 1KETA 1NWHA 5T3YA 4QXPA 1Y6ZA 3DMGA 3OURA 2FK8A 4NIMA 3VH4A 1JHRA 3COVA 4X0EA 1V8FA 1HGXA 2QTHA 2X9GA 3N39C 4C1BA 4ZOBA 4HMOA 3KUDA 5K8JB 2I4LA 5JVDB 4ID3A 4Y6SA 3REOA 4YEDA 1P0PA 3H5IA 3RVSA 4L74A 5JSQA 5KVSA 4KXFB 2JD1A 1NIPA 2OT3B 3HYRA 4OM8A 2GAJA 3T9BA 4B4OA 3M83A 2CHQA 4YT5A 3DA8A 4KEAA 2D5BA 1C1DB 4KXWA 5I45A 1JEOA 1TTHA 5IAKA 4I5GA 4PC6A 3IT2A 5B36A 4CU5A 1W87A 2JAPA 1KDRA 4XUCA 2ONKA 1RJGA 3VZRA 4H31A 2QPTA 3O6VA 3PV0A 3X1KA 5HDBB 1ZJZA 4ON9A 4DQ0A 1OILA 1S7GA 4QXQA 4GGPA 5FO1A 5TGDA 2QVLA 3SYTA 3HJAA 3LQ2A 1QG4A 3MG9A 1OD6A 1X1DA 2QP9X 4MKGA 1BHQ1 1UXJA 1V1MA 2OFXA 3KZKA 4KAXA 1NAHA 1GGKA 1T26A 5I47A 2XZTA 2CMHA 2C7PA 1O94D 1F38A 2D3TA 1ZD1A 3MWFA 1RBQA 5EWMA 1A2OA 2QN6A 3SHFA 1JHMA 2LCIA 2DY0A 3ETCA 3W6ZA 1J4AA 3ZU3A 4RKEA 5KREA 3C3CA 3DCIA 4BDSA 1KQOA 3ABSB 1KDZA 2XUDA 5F33A 2PLWA 2Q5FA 1X14A 4R3WA 2ENUA 1QANA 1R9JA 1T4BA 2W6JD 2Q5QA 3BB1A 1ESNA 4JB8A 1YZ3A 2N46A 2O0HA 3K96A 2N1BA 1JYEA 1VE5A 1AX9A 2PGJA 5A3QA 2O3JA 1E4VA 1Y7PA 3MD9A 5JFOA 3AC0A 3KHSA 3H8VA 5CDFA 3AHGA 1VECA 3BJEA 1P72A 2Q3LA 1NIJA 3U4HA 3ZY2A 1TW2A 2OZPA 3MTBA 1HKUA 1O95D 4J7XA 1E5DA 4GX2A 2GDZA 1L8LA 1GPH1 1U31A 1EA7A 2FRDA 3C74A 3DQQA 3EPPA 2EW1A 3GY0A 4G25A 1GFWA 3CZ5A 4R5HA 4CLOB 1JVBA 2FW0A 2HPHA 4RSRA 3OD1A 1SIWA 3NAMA 1G3UA 3IAS1 2VKQA 4MW1A 2CEKA 5FORA 3E7WA 1M6VB 1QPZA 1EVQA 3RVLA 3CWQA 1CC1S 3IFSA 5DHQA 4HB2A 4A7PA 2BE9A 1FYXA 4D4HA 5CW2A 2C5LA 4OHFA 4EHLA 4A36A 2IZOA 3THRA 2MDTA 4E4RA 3HKBA 2OWEA 2XZPA 1CULC 1KK3A 1MNQA 4JOCA 1FFXA 3V8VA 4DLTA 2MSLA 1BXRB 1M74A 3HA2A 1MHTA 3W5HA 1VIVA 2EJVA 4FW9A 2AOVA 1ZIYA 4ZGGA 3SSAA 2HD4A 2ASEA 1JBEA 3IVRA 3V1MA 3HYLA 2YJNA 3N1UA 4GM4A 1SR8A 2P9HA 3NKFA 5SZKB 1VLJA 5AXBA 2C2OA 1CEEA 3OLQA 1G8MA 2X9LA 3VC1A 2ZM5A 3VKFA 1CF9A 1YCDA 2YIMA 2BMAA 1MRSA 2QMUA 2LIVA 1SN7A 2PV0A 2WD8A 3B78A 3DLTA 1T1GA 3OOJA 1JLSA 5J4LA 4KQGA 1ORIA 3RQSA 1LF5A 5HPYB 4GL2A 2AXQA 2OCPA 1IBCA 1QBKC 4NAHA 5A6SB 3HWX1 1W19A 4YXFA 5K09A 1BIFA 3FA2A 3OQ1A 4KDFA 2X40A 3NC0C 2A1TS 1WSWA 1WXQA 4EOGA 4BO2A 5AVTA 4Y6LA 4TYYA 3KDAA 3TNDA 1VJTA 2ORVA 2YIDA 2SKCA 1FRZA 3EIFA 3I12A 5A3SA 1PZXA 4FINA 2FF7A 3KLPX 4OYYA 5BR4A 1AKRA 3NYIA 3O8OB 4D5EA 1HV8A 4C89A 4NABA 4R9SA 5A6VA 3RVNA 3FLEA 4L7QA 1U6KA 1A8PA 1ZONA 3EZNA 4FR5A 1OVGA 1L3IA 3UW1A 1GSIA 1IDOA 3FUWA 2PMWB 2OXCA 1QJ4A 3EXG1 3HKDB 1FP7A 2I34A 3PD1A 2Y8EA 3R3SA 4Q7MB 1GPYA 3CNEA 3KSMA 1ZD8A 5CLLA 4AP9A 1CRPA 4M9ZA 3K8OE 4O63O 4H17A 1QH0A 2HWXA 4IDOA 1XZDA 2PD4A 3BIFA 1UPAA 3LYUA 2J41A 4EQZA 1ZOIA 4GPAA 5BV7A 2PJUA 4HZIA 2XMSA 2G4VA 1UXOA 1XEWX 3W7VA 1UDXA 2PUJA 3CRRA 1QYVA 3GVXA 4XGRA 2A5DA 1NN1A 4UD2A 1F8GA 2OG2A 4U8GA 2IEBA 1MEJA 3R0ZA 1O96B 3E3MA 3FRHA 2ZJ6A 3NKLA 3A0RB 2ZTVA 3WJ2A 1AGRA 1B8UA 3CF6R 3CSUA 3VZBA 1H6AA 2H00A 5JU6A 1QGED 3IBTA 4X1KB 1NI3A 4H27A 3WO1A 3UO8B 2J3MA 1B2LA 4ZI7F 4Z9YA 3D5QA 3GDOA 2LKCA 1ULZA 4ZOLA 4WADA 3KJHA 3OZXA 2ID7A 2M1ZA 1HLDA 4IVNA 4YRDA 4CUZA 1N0UA 5K6AC 2DUUA 4BJ3A 1IQUA 2OKGA 2FEAA 4DR5B 1YVEI 3KDSE 1RJ9A 3VGPA 3SEAA 3DBRA 4LZLA 1JRLA 3I0NA 1WEKA 4DMHA 4HEA6 2DTXA 4PC7A 3TRIA 4B3FX 2HLDD 1TC2A 2CJXA 2QT0A 2VS1A 3QBTA 2ZYDA 4F97A 1GTG1 2G0TA 4M0CA 5JS6A 1T0UA 4DDWA 1JECA 4CF5A 3V3TA 3VJLA 1WULS 1XDBA 1ZU5A 1XQVA 1P1IA 4KQWA 4OYLA 4EG0A 1Q6ZA 4PX9A 1VOTA 3CZ4A 1KZ7B 1XMSA 1P4SA 1UPCA 1L7MA 5AHRA 3FZNA 4EHNA 1KYZA 1Q7GA 2WKPA 1EFLA 2GZRA 1RHJA 2FHSA 3Q8WA 4IIGA 5U9CA 2X8WA 4LSZA 3H65A 2AXEA 2R8PA 3RRBA 4QLBA 4Y18A 1AZWA 1O6ZA 3OU2A 3I5XA 1GUZA 5IARA 2A3RA 3D8SA 3WLIA 2HUPA 4KCGA 3QYPA 1GSHA 2Q0SA 3STUA 3OWXA 1T3TA 2NXNA 3BUSA 4ZXPA 3ABIA 3KT6A 4H77A 1V7QA 4MIOA 4DUYB 4B6FA 5AMXA 5EGNA 4NCIA 5FQOA 3U40A 1MO4A 4DT1A 1IFXA 1XZBA 2H8GA 2WJ3A 4IFIA 2YHSA 1RWPA 1X94A 1XCLA 4AG6A 3Q7EA 3X1MA 1H8EA 2RGCA 4MXDA 2GKSA 2DHDA 3P0RA 1KMCA 3K72B 4MVJD 4HNUA 3GJSA 2DFDA 2VEDA 4D9NA 5K4GA 1N6PA 3NH9A 2A92A 1TM5E 2D62A 4XUEA 5JASA 2XT6A 2WWFA 3FNRA 3GEEA 5I5EA 4IILA 2IDKA 1QO7A 1ZPDA 5BRJA 1DWOA 2ZEJA 5K3FB 2RG7A 2HJ9A 1P75A 2R68A 3TBKA 2CJYA 5JD3A 4EA6A 4ENTA 8GPBA 2IW1A 3G9UA 1VBFA 4MS3A 1TYAE 5CNMA 3PLRA 3MJ4A 5LZ8A 4EG3A 3WLAA 3F6CA 4UVIA 5FNVA 1B8PA 4XLZA 3WLKX 2JFOA 1R16A 1USWA 4LRXA 2WYIA 3B7WA 1BMFD 3D6NB 5JAZA 2YFHA 2FPIB 1PR2A 1SH7A 4L3WA 3DQPA 3WL6A 3BOSA 1VI2A 2GBLA 2K2QB 4BX8A 4Q5IA 3W3ZB 3E4CA 3E05A 1L2TA 5THKA 3W9SA 3KWLA 2VWGA 4HK4A 4QWMA 1HYGA 5JDCC 3UK6A 3UTDA 1TJ5A 3WK5A 1XK7A 3ZHRA 4CLRB 4QDZA 3KXLA 2VNJA 4L9AA 1MT0A 3RAEC 2Y1KA 2C4TA 2F43A 4GKVA 5AW3A 1TKRA 1S2NA 1XCGB 1Z4KA 3PC2A 1NNEA 2QMZA 3W34A 2BRUA 5EVJA 1QHHB 1Z2PX 2OMEA 2Z0MA 1HDEA 3BGVA 4FE4A 4FOOA 4LZAA 5C31A 2GPSA 2PIDA 1RYMA 2BFOA 2QW0X 3EJWA 1OXKB 3B82A 3H84A 3HUUA 3MS4A 1N4AA 4BFWA 1H69A 4F0JA 5IPFA 1P9OA 3QYFA 1OYVA 1MVLA 3CKYA 1I3NA 3TG2A 4X44A 3HN6A 2VQ6A 4CV2A 2Y2VA 3COJA 1IAQA 4LFBB 5EZ5A 4OXNA 4RKYA 3ZCXA 4DEYA 4MRAA 3EQ2A 4PZDA 2VYFA 3WQRA 1UWKA 4ZC1A 2VSFA 2QAIA 4ND2A 4UEWA 3I52A 3AEKB 3E5MA 3HQ4O 3V80A 4BC0A 4HTFA 2EBFX 3NVMB 4B83A 2V0CA 4G4SO 1ZVQA 3R6TA 1R15A 3KJGA 3BGDA 5HUJA 2B69A 2PA3A 3QFCA 5I9MA 1B7GO 5BV0A 1CDZA 1PUJA 1V45E 1M8FA 4IIJF 2RB4A 5EKXA 5FADA 4DAOA 4YMGA 3PVCA 2W5UA 1G5IA 1UJ6A 5HOEA 1IHPA 2Y1EA 1FFAA 1M6HA 2C7QA 3ZQJA 2C2HA 2PUHA 1KH1A 2VHWA 1DT5A 2YZKA 4CR7A 3BD6A 1QP4A 2F4VB 4F06A 3I3SR 1C3LA 5IDYA 2FPGA 2OQIA 4JKOA 3T0FA 2EFYA 1JALA 2WD7A 2RONA 1FQJA 1OOEA 3F6RA 1KDTA 1YZVA 2BE7A 4YJ2A 1GKIA 2I6TA 5T64A 1TKCA 3W1VA 3GQBA 2OV1A 1EVYA 2O3UA 5DTEA 3T8YA 4B4VA 5JCPA 1VRWA 1ISSA 2HCJB 2HGZA 3TPZA 3TLEA 1GKUB 1DBWA 4UXIA 1IWPB 3EGDA 2LCFA 2DPXA 3RSSA 3V7UA 2OEPA 4B76A 1DUIA 4AZ3A 2Z6AA 2JARA 1ZL0A 4L08A 4J1SA 2WIGA 3KKEA 2CL7X 2DWOA 3DUFB 1PHRA 3EUFA 3T12A 3T7KA 3VDXA 4BKOA 5AVOA 3E15A 4GLBA 3G2JA 4MO9A 3L02A 1EX6A 4PO8A 3U61B 2R2AA 1QIMA 1H9CA 1E7WA 1JLMA 5AR1A 3BL8A 2GM9A 2RCYA 4A26A 5MHTA 1KERA 1FJHA 3N5KA 1LSSA 3ZH2A 1XQYA 3H83A 1O89A 1AZTA 2GBFA 1KDYA 3O9ZA 1C4KA 4OOFA 3ZLJA 3PCRB 1L7RA 1BKSB 3F9CA 3U13A 5ES4B 1UKAA 4F6LA 1IM2A 2HB6A 1UK7A 2QTWB 4GYKA 2GXSA 2L17A 1BKYA 5TPZA 4FSXA 4MWBA 3FPSA 4NCAA 1EBUA 2PQ6A 2JZOA 4QUIA 2PX0A 2Q5CA 2RJ3A 2G04A 2ZRBA 2X5OA 3K0CA 2WPNA 4UAVA 1VCIA 1K4MA 9MHTA 2XITA 2I4TA 1HDRA 3SS9X 4EUSA 4EQ6B 4GUAA 2ODPA 5K99A 4O2RA 2VDUE 5H83A 2JFGA 2WDPA 4NF2A 1L4GA 4ETNA 5HM6A 2ZBGA 4C04A 5PGMA 2YWJA 3OM0A 3ZVKA 2XPCA 4U2DA 3I8XA 4TTQA 1FXWA 5JNRA 2QAGB 3QE4A 4JOBA 2NUTA 1C1DA 1PFUA 3UIEA 2WFZA 3HYTA 1HEIA 4ZQBA 1HE3A 1OGJA 2GCOB 4TXJA 4ZOLF 4F1KA 1E79A 2CBZA 1X2EA 3KXKA 2QM8A 3FHCB 3TE6A 3V3KA 3OFSA 4EPXA 1V48A 4DN6A 5JADA 2J07A 4MLPA 2R0QC 1LQTA 4BECA 2J0EA 2H51A 3UY4A 2BGJA 5A0VA 4R54A 2WNSA 4FZRA 1PYDA 2QZSA 4NHOA 2Y1CA 2YXLA 3F8SA 4FWIB 2GA8A 4MYUA 3AH8A 3AR9A 1W36D 3EIXA 2O3TA 2ZJ8A 3ROEA 1GRQA 1RACA 3Q9UA 5E7IA 5GIPE 2NADA 1JDTA 4GNKA 4ZEMA 4XPZA 3PK0A 3BB4A 3HU2A 3NBMA 3ID6C 3Q3VA 1J20A 4RPKA 1KR5A 1YHYA 5GV7A 3TL6A 1ZK1A 3KALA 4H4CA 3K6KA 4ND6A 4TLMB 1JAXA 2WBLC 1LC0A 3IERA 4U7HA 4Z9XA 3VKUA 1CJCA 4N7MA 2P0YA 4CGYA 5DMXA 5F23A 1JBQA 4EHKA 5IAAA 4UHFA 1V6SA 5M29A 5LYYA 1AUPA 3G0BA 1XMVA 1OH8A 1WMAA 1J22A 4NMWA 1IIBA 2AEEA 2ENWA 2I62A 2QRGA 4I1UA 2QX9A 4IGKA 1T5DX 3NV9A 4KO3S 5K8UA 5D01A 2XB9A 3KE9A 1ADCA 3FSJX 5AVWA 1A1SA 2IC5A 1XHFA 2WP8J 2JPDA 4FLMA 3NVKI 7ABPA 2HFKA 4EW3A 1XDZA 2FXVA 4PAGA 3SYRA 2D0DA 4O4HF 3DOUA 4OQPA 2REXB 5AICA 5JMWA 3I01M 4RC9A 4B7UA 4B80A 1P6UA 3K0SA 1JKFA 3L4JA 3R3WA 1E0JA 1ZMOA 2V54A 3RH0A 2INGX 1PE0A 4RZIA 4ZHQB 4MKHA 3ETHA 1MENA 1EQ2A 3AZOA 4KVGA 5EG5A 1KFCB 3BTVA 4UBIA 1YBHA 2FG5A 1O4WA 2QVZX 1VCNA 3MSXA 2F8MA 2MWMA 3HCCA 3WQSB 5LMZA 3BXHA 4E4YA 2JGLA 4NWIA 4M86A 1VL0A 3RU3A 4Y2RA 2ZG6A 4HVCA 4D1YA 3T1TA 1E6MA 2HY7A 3ZGYA 1UKBA 3RYTC 3K15A 4DTIA 5C8ZA 5D6OA 4IM7A 4UHKA 5DU2A 3T1VA 4Q3KA 3EVEA 2D1TA 1IG3A 1WR8A 5FNVF 3LLUA 1N5RA 5TJHA 3CT6A 3UCXA 1QHFA 1VBMA 4C0AC 3G17A 4CT0A 4I1YA 5ICEA 4J4HA 1URPA 4J1TC 4KGDA 1AKEA 4G5SA 4CM4B 1HE8B 1U99A 2OV3A 5EJEA 1E2GA 2ZOSA 2CMDA 5FKJA 2J5XA 4GR4A 5EE0A 1Q20A 6ADHA 5DNEA 1NJGA 1F4VA 3V8QA 5IC4A 4LGVA 4C4PA 2JCGA 4FMDB 3AKDA 4ZRDA 3CO5A 2PT9A 2OHOA 5FOWA 1VTKA 2IK8A 1RP7A 2W4MA 1H85A 5ECDA 3LGAA 3RTEA 3WP1B 3LPCA 4L73A 2A0YA 2Q6TA 3O8OA 2VTDA 4PPQA 5FBWB 1U63A 3LUAA 1T91A 1P2DA 1JR4A 1T34A 2H65A 1TF5A 2LNDA 4QYMA 3V7YA 4TKVB 3FHOA 1EG7A 1UP4A 1EHIA 4MQMA 2GPTA 1XZQA 2PXAA 3RNLA 4BLWA 1PW5A 1A2QA 3HKDA 3I37X 1SCDA 2DWPA 2GN0A 3AFOA 4WOBA 3VBCA 2QTAA 2WWVD 3RC9A 2VUHB 1QCYA 1UZMA 5EP3A 4B5KA 3OOWA 3TEJA 2GN2A 3RVBA 3QLJA 4QUBA 1T3ZA 1AHNA 3H11A 3C39A 4B74A 4BNGA 3QMMA 1W46A 2BEUB 3EDQA 3WLHA 4Z53A 5EP2A 2C8JA 5K45A 1LPOA 4HNRA 1X1CA 4E21A 4E2XA 5H7XA 5C32A 4X95A 1F2UB 2FWRA 4JJ7A 3E70C 3BS4A 3CMCO 3B2QA 3F7TA 3KVRA 5GPBA 4TZKA 1UDAA 3UAGA 5ICFA 3IOBA 3MS7A 4DLVA 4HYEA 2JI4A 3NEAA 1E2NA 4ZEWA 2FOIA 1O96A 2CBGA 4EUKA 4HEQA 2DHEA 3QX7A 4TKUB 5JMPA 1OWNA 3SZRA 3LIIA 5AUNB 4WCVA 1B15A 1Q0HA 4J3JA 4HRXA 3ZXYA 1HQYE 4Q6BA 3T9DA 3U48A 2BEWB 4MICA 3AR7A 4G9GA 4KJXA 1AQYA 3DL0A 4YJ2F 3VKVA 3ZU4A 3IXMA 3BHJA 1LZLA 3AJ9A 3ZZ1A 1YJAA 5C46F 5HDQA 4OB6A 4X1KA 3GRUA 1AQ6A 1SVKA 1T9AA 2ZYAA 1E5XA 3A1TA 4N5NA 4NPAA 2J32A 3IKMB 4P80A 3VC7A 4AD8A 3ULKA 1U8XX 1GPJA 1FRVA 2PZKA 3EH2A 3QVMA 4GAEA 2B34A 4L8LA 2Y67A 4NH4A 4D97A 4NAVA 2QXUA 1F0YA 2HWYA 4HQLA 5CYPA 1DAGA 2C9OA 2FA9A 3PPVA 4RE6A 4Z1MA 3AR2A 3R7DA 4MAFA 3WNQA 1YUNA 2CL5A 4FYHA 4UQLA 1HE2A 1RWKA 3COYA 4UM5A 3SY8A 4Z0HO 2PO7A 1IE3A 1QH1B 4KQMA 3LG2A 4I1VA 2Y93A 1B0UA 5E7QA 1CDEA 1JJIA 1OE0A 2R84A 5G1PA 2IV7A 1B00A 1UJNA 5LQJA 2JK1A 1J9GA 2ZUUA 4NJOA 3RGGA 5JZBA 1W44A 1CZLA 3VYVA 3NDPA 3IQEA 4MUJA 1TCVA 3L9XA 3ANSA 5EXTA 4DZTA 3N2IA 4HJXA 3WMGA 1TFUA 2B5VA 3K53A 4G5XA 1F51E 1UMDB 4C0JA 2R1VB 5FI5A 2ZATA 5DZSA 5SYMA 2ZYTX 3A4YA 2QRJA 1MB2A 3ZK9A 1SHUX 2CFSA 1B73A 1TIKA 4CDRA 5KJFA 5KS2A 4ZICA 4L6AA 4L0QA 2ZP1A 2C61A 5GJCA 5LQSA 4E14A 4BO3A 3H42B 5KTTA 3RAJA 1NVFA 1I2CA 5EMJA 4NCKA 3K32A 4QXRA 3A26A 3V7WA 4XX0B 3DFFA 4UEJA 3UATA 2G06A 2Q6VA 4FT2A 3B38A 2AHOA 2GD0A 4OQDA 5D3QA 1E1MA 3FYSA 4QJ3A 4GOLD 1U0JA 5DMHA 1Y3BE 2PR2A 2IQ5A 2ZJ7A 3DE7X 3RBZA 3U7RA 2VYND 3DWGA 2CLOB 3MC1A 3RHZA 4B46A 1DCKA 1N9KA 4NV3A 3KEFA 2HA3A 4JUCA 1KMMA 4PWYA 4IX9A 4EO7A 4OSPA 3PKZA 1FXWF 1EI9A 2H2FA 3O2NA 1BXKA 4NS1A 2D5IA 3QU2A 2RGYA 4AZSA 5B3JA 5T3UA 3O82A 4AECA 4BFLA 1SA0B 2LP4Y 1OXBB 4TLDA 4YV0A 1AMUA 2WYHA 3KX2A 4ZV4A 3C6ZA 1PZEA 2C2YA 3E23A 1DAKA 1EFPB 2X5KO 1FJ2A 4NY1A 1R6VA 4PLTA 5T6BA 2B0CA 1ZK0A 1NASA 3PHGA 2VZEA 3KL2A 4OHOA 4BFUA 1C0IA 1J1ZA 4YRTA 2ZRCA 3QGMA 3FI9A 4LI3X 2J0SA 1Q7CA 5KNCD 4D4MA 4ZWNA 4ZVVA 2ZIXB 3TLKA 1HRKA 3LQKA 3LRXA 4DLKA 2EG5A 3JVDA 3EVDA 4D26A 4CLXA 3N05A 1PRYA 2FPIA 5LQUA 3NM4A 4PFQA 4IG9A 5K2MA 3QW2A 1ZBQA 5D5QA 4BLSA 1USVA 1HFJA 2LE0A 4HI0E 1KSGA 5HXAA 3U4GA 4OO3A 4BO1A 3V9PA 2BBTA 5AM0A 4XDYA 4BNTA 1JJVA 4CR6A 1M34E 1PAUA 2CCJA 1RAIA 2Q45A 1VE7A 2NO7A 1GG8A 3FPLA 4JSYA 1UBCA 2ST1A 4FN5A 1PGQA 4M49A 5SZHB 3UXYA 3VR2A 1NX9A 1G3IA 3ELYA 2FSSA 4D6XA 1Q22A 1W93A 3PFKA 4M1ZA 3LQFA 5KQMA 2OC4A 5FD8A 2R8BA 1QHHA 1YMQA 3PHIA 1PZNA 5EIXA 3U0BA 5ILOA 3FKJA 3GEGA 1PWHA 2TS1A 5HKOA 3EBPA 2VOEA 1NY6A 2WA1A 3V4PB 2P11A 4EBBA 4ZZIA 1L1QA 2HKIA 1XPUA 2ZTMA 3P5SA 5LA6B 1Y98A 5JY1A 5LOVB 2X15A 5LQNA 3FOEC 1C0KA 1UJBA 3BCRA 3LF1A 2O6LA 3T35A 5KNDH 4RHFA 2PLFA 2AG8A 2SICE 1T8RA 1CEQA 4GE3A 2P5UA 1OFUA 4GEGA 4QYWA 1RYNA 1TA0A 2Z5GA 3H2HA 4Q47A 4E1BA 2PV7A 3L04A 4YK7A 5EZYF 4NBUA 1KZ6A 3DKPA 2AMYA 4QGAA 3VUEA 1JSRA 4F7WA 2P2SA 3RCBA 3GLHE 2VBGA 3K0KA 3PFFA 3PQ5A 4KE7A 2FSHA 2JFNA 3EYWA 5AYVA 4DQLA 2WSSD 4ZK2A 4EJ2A 5LQRA 3L77A 4M46A 1M73E 1AS2A 1OA1A 4QDKA 4CYMA 2VP5A 2Q2WA 1T2CA 1FVOA 2FMTA 3ASYA 4QVIA 3HN2A 2VJOA 3IEUA 2P0AA 5GAJA 2X23A 3PXDA 2O3SA 4NL4H 2BLLA 4MW4A 1J42A 1CUVA 5CT4A 5ITSA 3FGNA 3PGXA 3MAAC 1V26A 4BO6A 5J4YA 1PEDA 4PE5B 1PFGA 3EGWA 1YRBA 2R6HA 3FMPB 3OCXA 2VAXA 5BNTA 4FCVA 4IINA 3R7SA 3PQEA 1L7XA 3FGZA 4EP1A 1ZEJA 2P5SA 2NXEA 1ULHA 1IVNA 2YTZA 3A2KA 5JBNA 2JFQA 4JLAA 1SCJA 1RT9A 2OLKA 4QJBA 4BVAA 2VH1A 1EGVB 4W4TA 4RK1A 3ND7A 2PEYA 6CHYA 4B1FA 3MYYA 5D5HA 2IU0A 3OHSX 1TK9A 2QZZA 3LVQE 3HP4A 4G24A 2UUPA 5JALA 4CEJA 3DUFA 4FDMA 3O4JA 6LDHA 3OZUA 4QU5A 1THTA 2MSDB 3NVAA 4JVOA 3UK2A 5JJIA 1NI5A 1W36C 3F4KA 4B87A 4GC9A 2F3RA 4OJMX 2WIJA 3W6PA 5GINE 1AQIA 1ZBDA 1YV9A 3NHZA 4QXOA 2EL9A 4M0MA 1VI6A 2AR7A 1UINA 1U6IA 4DUPA 2MOKA 2FQQA 3M8KA 3ER9A 1US8B 1O57A 1ZRNA 4PQYA 4Y2XA 4ZEOA 4UCFA 4YGXB 1DU4A 3QNUA 4TMYA 1XVIA 2J5QA 3HDHA 1VB3A 5AXDA 3AUTA 2ZIEA 2X13A 5CPFA 3GRPA 3RASA 5ADHA 1SD2A 4UUAA 1WHTA 4GPBA 1OHHD 4LWOA 5LQDA 1WMFA 4UNIA 2EP5A 1V4VA 1PLKA 2HDOA 4O59O 1J0EA 4P4TA 4PZYA 3KQMA 4Y0AA 4BQQA 1RBYA 2G40A 4OMCA 4PRKA 3R76A 4CKCB 4DV4B 5KWIA 1NUTA 4EQ6A 4ESOA 1RBZA 3PFBA 5KVCA 1ZL2A 2W11A 3A25A 3L3BA 4NCXA 1ONBA 2PMBA 2HQRA 4DG5A 1R37A 4P54A 2QAGA 3IRUA 1KK1A 3DKKA 1TZBA 3K9CA 3OCZA 4JP8A 5I7RA 4IUYA 1KDVA 4AY6A 4ZYYA 4KRGA 3R4CA 5BXYA 1Y3AA 1GVHA 1W5TA 3CPJB 2GCOA 2PEZA 1W34A 3KXIA 4B3BA 2RBKA 1O03A 1PR0A 1KY5A 1QK5A 1XXHE 3AVUA 4KXXA 1U94A 1JFRA 1VKHA 3RKRA 3ZCVA 4LJRA 3F97A 3R7NA 4M6WB 3TTWA 3UAWA 3RFUA 3QK7A 1B6SA 3JYOA 1NHGA 2ADMA 3H4VA 3NS7A 5EHZA 2CVPA 2P2LA 3TX6A 4IY1A 3TO5A 1EBBA 1EFVA 4KOEC 1M7GA 2V6GA 3TIIA 1MAHA 4L75A 4DTCA 3M6MD 4GQIA 1V5EA 3NGXA 3ZE0B 2ZSKA 2X7JA 3QVTA 2GUGA 1HYBA 4YO7A 4ZO7A 1NBHA 1FZQA 1QR2A 4TX1A 4PYQA 5J4KA 3D8UA 3E5NA 3IPCA 3A3OA 3MQ4A 4AAYA 1A9OA 4B40A 2O23A 4IIFA 2KMLA 4KK3A 4MVYA 1SUSA 2PNFA 3TOVA 2GDJA 1EBFA 2IEGA 4BO7A 4I5EA 2VSQA 5LP6C 2ZRKA 5DEIA 1OB5A 2K6GA 3GN1A 4CIXA 1K6IA 1HDXA 3GMTA 2DKNA 3IOYA 2QT9A 5CDTA 4N9QA 1JWLA 4V03A 1Z5OA 3ETDA 1YZGA 4AY3A 2AKEA 1I7QB 1PT5A 4DV3B 4KBYA 2XMZA 4MA0A 3MPOA 1E1YA 3FPGA 4FGLA 3FKQA 4FLEA 1OR8A 5IJZA 3R2JA 4IIVA 4D0RA 5DGXA 1EESA 4O0MA 3V7NA 1DVRA 2LW7A 3BAZA 3DEIA 3D0QA 4M1QA 2R7NA 4YRCA 4XX1A 3KV3O 4B0OA 2G63A 1ARZA 3VX4A 5MGNA 2VPZA 5D7BA 1P77A 4DLAA 2IV2X 1CHNA 4ZHQA 1RHKA 1NLZA 2BGRA 1J5PA 1S1MA 1W6UA 1UC5B 2E6UX 4F85A 3OOHA 1JEYB 1Q1GA 2P90A 5JG7A 3EWNA 4NDAA 1XF9A 4U6QA 5E0OA 1J0CA 4MUNA 3D6FA 3H1GA 1KVTA 5ALUA 1G7TA 2PUVA 4N0PA 1XJ0A 5L6LB 2HC9A 1NQOA 3Q8KA 4YCDA 4RULA 1UKEA 2JKZA 3X1JA 2COKA 4MJXA 2DX7A 2ZSUA 3LXMA 2WUGA 3LXRA 3QYJA 3RREA 2JH9A 3PFCA 2GPJA 3M6LA 2Y0EA 2XUHA 4BWVA 4LVNA 1ESZA 4ZCIA 3EEBA 4CM4A 2ATXA 5KOJB 1PDVA 3E2PA 4Z9AA 4C1NA 1M6NA 4AX4A 2GLXA 1R9GA 3P4YA 4JDPA 5J1TB 3FHJA 1EGQA 3GH3A 4O2AB 2W6NA 3FYHA 2EAUA 1ZMTA 2PZEA 4D8XA 2WRZA 4QJ5A 1D2MA 2Y66A 4ZVLA 2GERA 2IPXA 1ZC3A 2FFAA 1RNLA 1B6TA 2JFXA 2IYWA 4FCWA 5A4JA 5AK6A 3SZMA 4NE7A 3A9UA 4TZ0A 2UZ3A 2I9PA 3G2LA 3V1TC 4R0VA 3IUYA 4NYMR 1V0JA 1GGFA 4MUBA 3WV5A 2ORWA 3UAOA 1MFPA 3J80A 1SKBA 1M8JA 3MBOA 5IBCA 3S40A 4LJ9A 2AXPA 1GQRA 1I1HA 1I7LA 2F00A 1DLJA 4YMUA 5JPDA 4TKVA 2IYAA 2H1VA 3QA9A 3PVSA 2OHGA 2ILVA 2II6A 1YGYA 4H7KA 2QENA 1XWIA 3AY3A 2CCGA 2FRXA 2NWQA 4KAAA 3RAPR 1Y4ZA 2EW8A 3V4VB 2EEZA 2QNIA 1MFZA 2P2CA 2YQZA 1CFJA 4BL5A 5JRJA 2IY7A 2FZKA 1EUCB 1K2VN 1M2KA 1SHLA 2QG4A 4H4EA 3B53X 1XEAA 3KS9A 1C4XA 1U3UA 3CUEF 3KEMA 5HQJA 1T5HX 1T6BY 2BEUA 2JZNA 1XRSB 2D2EA 2NO9A 2PGOA 2VYVD 3OPYI 1VRVA 4E13A 2J9FB 4LYHA 1YC5A 3W5JA 4GBMA 1IZ7A 4DJFC 4ZO8A 1NVKA 2B2CA 1R6UA 4U0JA 5G3ZA 4ES6A 2R751 3BE4A 3PNBA 1T2FA 1DIGA 2GZDA 4GW3A 3RR2A 1RXWA 2G1UA 3RSQA 4YV1A 1FJXA 4E30A 3NIDB 3HYNA 4M89A 4OXIA 3NTUA 1Q0SA 4BP8A 2ZS7A 4QPCA 4PFKA 2CLSA 1NL3A 3OMXA 4TKUA 3CRNA 3EIQA 5AP9A 1TK2A 2Q8QA 4D3ZA 1NG9A 4ARZB 1NPDA 2R00A 2E87A 1C80A 4BB0A 2HHHB 2DQYA 2FZ4A 3PUZA 3TOZA 2QRUA 2BEWA 2VAPA 3TR5A 2QUHA 3RWMB 5F2EA 2NZ2A 1PJ4A 1Q0UA 2H48A 2VXCA 3EGVA 1T9GR 1RQNA 3MD0A 3KE8A 2V3VA 3IHKA 4RUKA 3H9QA 1NUSA 1MJGA 4WLOA 1XTRA 4P93A 2X77A 3M0EA 1JHYA 821PA 1K75A 1BCRB 4TRRA 3I1YA 4XVRA 3DAGA 2Q4DA 2N1MA 4RKWA 5LZ9A 1BGVA 2D2FA 4RY8A 2C5GA 2YZ2A 3BRCA 4FONA 2IF0A 1TXGA 1U3FA 1MA3A 2GHRA 3FKSD 1C9YA 3KVVA 4KJZA 1QH1A 4AJOA 5BWNA 2WWXA 1WW2A 1TQDA 1D6SA 1N6RA 1EE9A 1RDFA 2Q8PA 3SYNA 3VNBA 2CJWA 1OBHA 3RODA 4JLWA 1DEAA 4M9SA 2J3LA 1LVGA 3BQMB 2ODWA 4I1SA 2C2ZA 4DB4A 2Z4SA 1IHXA 4JP2A 2IYLD 3PEWA 1UMDA 2R1VA 2N75A 3CXRA 4E5DA 2HPZA 1JIIA 1FMFA 4WMLA 3BF8A 2OYCA 2P75A 1ZNQO 3ABQB 3F2IA 3ONEA 1PIWA 1GAEO 1Y8CA 4MV6A 1PTKA 5D84A 5JNTA 3QPUA 1W2HA 3SDBA 3TXYA 3EEQA 5U1PA 5GJVC 5HTOA 3EVCA 2DPLA 4H0CA 5JC8A 1FTNA 3ZIAD 2AZXA 1OIXA 4XX0A 5TF4A 2O2CA 3DEJA 1YACA 4BGVA 1VMEA 1QDLB 2FSVC 2PT5A 3A6KA 2W70A 4DV1B 1U5AA 2SKDA 2GHTA 4MLDA 3BWDD 2NN3C 3GI1A 1PJCA 5AM5A 5CB6A 3GJTA 3QLVC 1JDZA 4J07A 5FYDA 1G2QA 5JBQA 4L51A 4H2DA 1W4CA 1SJ9A 3REQB 2OXTA 4NXNB 1AB6A 1HDZA 1IH8A 1XU9A 1KA9H 2ZUBA 3K20A 4C05A 4EB8A 1LY1A 1L7NA 2C3PA 2Q4BA 3EOAI 2F1RA 3OA2A 3EQZA 3E7DA 2BP7B 1SA0A 4WBXC 5DWVA 3MTQA 5GMOA 3RKSA 4V24A 4NJMB 1U8ZA 3MINB 3PF8A 5M34A 2O5CA 2KHZA 2BKXA 3VOTA 4U4AA 2DXIA 2AOXA 3CX7A 2C20A 3GT0A 4G0VA 1UDCA 3QY0A 1SVIA 4IUBS 2J46A 4WGGA 4S1PA 4B2YA 3FHTA 1RM0A 4LISA 5B30A 4RDXA 4JLMA 5JCZA 1D1TA 3KQSA 1SELA 2FMFA 3MVEA 3BWBA 3V7FA 5JZ9A 4PSVA 1EFKA 1UODA 3VGJA 2GN4A 4D45A 2YL2A 5WRFA 3ZE7A 4XAQA 4RS3A 4DBLE 1ML3A 2ZIXA 4IR7A 4PWZA 4A27A 5C7OO 1X87A 3PENA 2BHTA 4F92B 3GN2A 1NVMB 4TTIA 4ZYUA 4LFCB 2POCA 2PSEA 1DUSA 4XXHA 3VSEA 2QP3A 5LN1A 5L4NA 4KOAA 3PYMA 4WSOA 3ZR4B 4CKYA 2ZI7A 1Z7WA 1L9XA 3IVCA 4LE1A 2HNBA 3B6IA 5JIBA 3FWPA 1ZHHA 4AY5A 1JNXX 4H3HB 5AKGA 3WK7A 1NMYA 5KKCA 3TDNA 1LBSA 5FBVB 3O1IC 1POWA 1DTEA 1V2GA 2ZPAA 2B1JA 3QUCA 1P31A 4BKQA 5BSGA 2FK7A 2HLPA 3PKIA 2HWWA 2XA1A 3KYIB 4TLCA 5DSTA 2XD4A 1IK6A 5JLJA 1FNSA 2W9XA 4FCTA 1SG9A 1GU1A 4BUJA 4F84A 3A27A 1FB5A 1JSCA 2CLFB 4K6HA 3DE5X 2ZRPA 3HPQA 5DHTA 4O25A 1LZKA 3FFXA 1JEQB 5BQOA 1P17A 1FA9A 1R9NA 2IU6A 4QA9A 5I9NA 2NSDA 1NR1A 5LA6A 4QOIA 5LOVA 1MEEA 5E4FA 3VO9A 3NW9A 1XEXA 4E1VA 4ZHQF 4AYWA 2EWVA 3H9JA 5HKKD 2R11A 3M6WA 1F48A 1MV8A 2JW5A 3ORQA 4PG6A 5DW3A 3PGLA 5IM5A 3UV6A 3D0RA 5IJ9B 2PL1A 4GDFA 4D98A 4Y1RA 4QZVA 4IH9A 4Q7LA 2YMLA 3UA4A 4YRRA 3SHQA 5JH7F 1UUFA 3VC3A 5HJEA 2XDQB 1PJBA 3T1HB 3MOGA 3RUPA 4Q4JB 3HJTA 3N0RA 1RIIA 5GP1A 2D7JA 4BTLA 1CZKA 3TLZA 5IUJC 2IKQA 2OZLB 4CEHA 1EFHA 2HM7A 4XJTA 1DG9A 1J90A 2IT1A 1BG6A 1Y5MA 2ZZNA 4FHDA 2J0VA 4RKQA 4TWIA 1QZTA 4B45A 2VF8A 3OT5A 3TTUA 4BMCA 4C5AA 1ES9A 2XAAA 4ZHSA 4XB6B 5IWAB 4R41A 4XM2A 4LDPA 2OHVA 1S4MA 2X41A 4DQKA 1GZUA 4E2ZA 4EX6A 4WZ6A 5AH0A 1YDGA 4EUFA 5G41A 1Y37A 5CNKA 2PQMA 3I64A 3OE1A 4FBGA 4RD6A 5C7IO 2DR2A 5LSAA 4FMDF 4IKOA 3ISVA 3TGWA 2DSNA 2LXNA 1TUEA 4EUNA 2JJQA 1XTZA 4QPJC 1KZHA 2ZT5A 3DFMA 1S1CA 3HY3A 4IIEA 3V8RA 4HVAA 4BMXA 1MJ5A 4LY3A 4OGLA 4RLSA 3WKAA 3TOCA 1B93A 3I3OA 4V1CB 4LJKA 4DYHA 1ISMA 1S8AA 2BAGA 3G8YA 1XTSA 2J3QA 3GHHA 2ZTHA 1LSJA 3NONA 4TOIA 2JD2A 3BKWA 1IK4A 1L7OA 1CYDA 1ULBA 4JX8A 1LBTA 1TMGE 3G2NA 2PUCA 1IXZA 2V1XA 2WF9A 5AHWA 2Q1UA 3QY9A 3GFOA 1R0XA 2XR1A 1QM5A 4I9FA 2XNDA 1GU0A 3IPYA 3ITDA 3L7MA 5KO2A 4GE0A 1M34B 1H05A 1PR5A 4LC9A 5D7NA 4UNRA 1YTLA 3P9NA 5JNWA 4DNQA 3N2EA 3RIGA 1E1RA 2QUBA 2Y27A 3IPAA 4UMVA 1US8A 1XELA 3RU9A 2ZBQA 2XE7A 1OTYA 2V9CA 3ECSA 3KDPA 5EN4A 5L8VA 4JXZA 3H9GA 4LZPA 4QO8A 4TVOA 4AJHA 3KEQA 4XUGB 2X8LA 1MOPA 4R8VA 4ACBA 3BXOA 3S7TA 3HVRA 1FSZA 3FYUC 3IJPA 3SHVA 4EMSA 5JXWA 3OT4A 4OJYA 4RTPA 3D7NA 3DSRA 4CKCA 1E2JA 3EA0A 3ZX5A 5FX2A 2UXBB 3AUXA 2HO4A 2I2CA 4RTNA 3FCSB 4CLDA 1NU8A 3UFBA 4G5RA 1KO5A 1OC4A 2XAUA 5L3SB 1F6BA 3GLHB 1OXMA 1C7ZA 1KFBB 4KE8A 4IS3A 2KE5A 1XV5A 1HTWA 1BXGB 2GR9A 4KSBA 2ZRIA 4G1BA 5TMDA 3M3DA 1O4VA 1JZSA 4E88A 2WAOA 5AJHA 2DHRA 1CKEA 1R8XA 2BI7A 2BF7A 2AW3A 2EF1A 2QT1A 2YWHA 2ZJZA 2P9BA 4FSDA 4KH1A 4RCVA 4JOQA 1Z37A 4M6WA 3H13A 3IT1A 4FZVA 5J2UB 3WDKA 2HMWA 2F1KA 1YS1X 4WRRA 4AQDA 3K0FA 2ZAGA 4QG3A 1TNDA 1JU3A 3LDUA 2BM9A 2G08A 4CETA 3K2EA 1Y9ZA 2AFHA 3HP1A 3QFHA 4NZYA 4RZSA 1TZMA 3GLQA 4IZOA 2MMCA 4MULA 1NJ5A 1UOEA 2BCEA 2VUTA 3IUJA 3EG9B 3DYIA 1IN7A 4Q3EA 4DHEA 1O97C 4HQ0A 2B0JA 1SZPA 3IP6A 3ES9A 3H3JA 4NOJA 1RZVA 2A4MA 4YMIA 3DPSA 1UBEA 1L4KA 1XQWA 3RSGA 1I3LA 1LUAA 3MT8A 4Z99A 3AIOA 3O8CA 1GZ7A 4YN3A 4B5LA 5JD5A 4YT8A 3R6WA 2WK1A 5K0NA 3ZGVA 2QLBA 3F9RA 1K98A 1VP3A 2H4HA 8OHMA 1E2BA 3LTEA 5EE3A 1TM7E 4F4CA 3UPDA 4R5MA 5IC5A 3SX2A 3OC0A 1Q83A 1D04A 4Y2YA 1QFSA 2RGDA 1FOEB 1MIHA 4DCJA 1WIWA 1QB8A 3OJEA 4C2BA 2R6AA 4C3OB 2DFTA 5TVKA 1SB8A 2ZJ0A 3A1DA 3DEHA 1CJSA 3I2HA 4MQ4A 4BLTA 3QYAA 1Z0ZA 3E7XA 3OAAA 1GTJ1 2VK1A 3HN7A 1WP4A 4Q3OA 2NU7B 3VPFA 4WKPA 4RPIA 2D59A 5HZMA 1IOVA 2RFLA 4OOEA 1KJIA 2ID8A 4W5TA 1XZMA 4IBOA 4IFBA 5CVEA 1IJEA 2VPIA 3GBSA 4UVEA 4XYBA 4LYDA 3G6WA 1S3IA 1MTOA 4AO8A 1JEYA 2E4WA 4UTNA 1TFRA 1SFRA 4OA8A 4GVXA 3OPQA 1TUBB 1Y6JA 1MO5A 4RTSA 2HDWA 2QY6A 2FXIA 4BFZA 4N76A 2VHJA 4G1UC 4DAEA 4EVQA 5MN4A 3QUSA 3FVQA 2ZB2A 4MHTA 4G56A 1T5OA 3IP3A 3U31A 4AIRA 1V7ZA 3SN6A 1EEXB 4IVRA 2VH2A 2ZRMA 1T3LA 4BNLA 3T7DA 3HR4A 4CCAA 2AJCA 2YWCA 4IDGA 4D9KA 3VO2A 1K27A 4KVFA 5KOJA 1H2WA 1QB7A 1XXHB 2ACKA 3CM0A 1FS5A 2XB8A 2YZNA 4QOHA 1XZNA 3CLRD 4F6CA 2PMFA 5CVVA 1EHCA 1WXDA 4LRQA 4MR8B 4O2AA 1YA6A 3S2ZA 4B4WA 1YNSA 1QIJA 3AG6A 3P0HA 3PI7A 3QLUC 4K9MA 4P84A 3RRMA 1HE4A 1RC0A 1R0LA 1X9HA 3BTUA 1I4DD 2UVQA 4YJFA 2DTEA 3BC1A 5BNWA 3NHFA 2Y1GA 4RL6A 1MTZA 2XNCA 1I6WA 3O03A 4WNIA 3F8WA 3H1PA 1I01A 1Q19A 2BI8A 2HXGA 1M0WA 5IT4A 4WEQA 5KTYA 2GF2A 4CZ2A 3MUNA 4RS4A 4UFNA 2F67A 5LNK6 3ZHUA 1HMPA 3IUNA 5KX5B 5ALKA 3NHBA 1PZHA 3STTA 2V4ZA 3ZYCA 1QP0A 4TUYF 1L5RA 5LA6F 2YV4A 1RHRA 5LOVF 5C4GB 3WDLA 2C9DA 1NF2A 1ADYA 4YCNA 2OHHA 3S5JA 2EDCA 2ODNA 5AKEA 3JYNA 1PHPA 3TYXA 3UB4A 1Z8HA 3IAAA 1EUCA 3SC2A 1E2FA 4YCAA 2B3TA 3LWDA 1POXA 5K0SA 2FI1A 4JODA 2AN1A 3BJIC 4Y0NA 2AE2A 4JD5A 2HA6A 1HYQA 3EBOA 4I4IA 4KZPA 3PJEA 2QLNA 1XQ1A 1L7BA 2VXYA 2Q1YA 2JJ2A 1JB1A 3ZCTA 2WSIA 1SVNA 4I99A 2DB3A 4J43A 3N7UA 5DLDA 2A9PA 3A6EA 3TJZA 5AVRA 3BWMA 4RV9A 5EP4A 4PG5A 4HNTA 2QNBA 2JIMA 1YR9A 3IJ5A 2Q29A 3RS0A 1RXIA 2JA1A 1AF7A 1GUBA 2QM3A 1E6UA 1IJFA 1UBHS 1OFIA 4QU0A 2P2YA 3W2IA 4ARZA 3W1WA 1YRYE 4Z5XA 4MDYA 4PLHA 2OO5A 1Q12A 3D5EA 4NZOA 3ZHSA 4BUZA 5BWLA 1VHQA 2QUKA 3TL2A 3VR5A 5JUWA 5KSOA 1I2MA 4V38A 1YFZA 2ACEA 1CJUC 2HADA 1WCWA 2VF4X 4D6PA 3THYB 5E9WA 3N7AA 5F5XA 2V03A 3C97A 1F8YA 4LBZA 4REQB 4IZHA 2C5HA 3NGLA 3NFRA 3S2IA 1QZUA 4EFMA 2AMVA 3S8MA 2WD9A 1FDSA 3F4BA 1U3DA 1XZKA 3QMVA 5FA6A 3IVMA 4HNSA 4QELA 1BCRA 3ANYB 4FFPA 3WBJA 1N1MA 3HNOA 1E7QA 4KLAA 2XGSA 4M1YA 2AG0A 3W04A 5GZ1A 4U2CA 4P0PB 2IIBA 2GYUA 1NVDA 1LPNA 5A0TA 1P9RA 1L0BA 1PO7A 1U2PA 2YS7A 2YX1A 4OLAA 2CHVA 4URYR 4G1MB 1OFTA 1W0CA 1EDBA 4GX0A 3WBKA 2V8BA 4RGVA 4RH1A 1QLWA 3RIHA 1M5RA 2QVGA 5G40A 1HSOA 4JMLA 4EA9A 3A1VA 1TVMA 4OU5A 4TS3A 1ZCJA 4YMHA 4Z4CA 3I73A 4QOGA 4IJMA 5CJPA 3ZLBA 2CXOA 4PG7A 1VGQA 2P2GA 4Q4DA 3TZEA 4AZ0B 2OK7A 1HTTA 2VFAA 4KHZA 1SIBE 2V0GA 4PBSA 4D8UA 3C2QA 4RTOA 3PIIA 2BWJA 4CMKA 1Z6QA 2CXUA 2GBIA 2GHIA 3AUAA 3R7BA 4AY4A 3QEAZ 1GSAA 1X80B 3ZWYA 4C76A 1Z5UA 1RLJA 2OV8A 1UJCA 3N87A 2IWRA 4CQMB 4M4SA 4R7GA 1WXXA 1CE8B 1DTWB 2IYRA 3CLUC 3L8DA 3LJKA 1Q2XA 3OG9A 2KJQA 3ZI7A 2PJZA 2XWQA 1I80A 4JA2A 2RK4A 3RABA 3VVMA 1FU7A 3T7TA 2X0IA 2ESRA 1FTGA 4MV3A 4UEOA 4ENPA 1H8ED 2B4TO 3REQA 3OZCA 1E1CB 1HLFA 1OXUA 2IUFA 3D0OA 4KVZA 3HUTA 1NW9B 3Q0IA 4Y7CA 2NQ8A 3FAKA 4BLVA 1SCNE 2XQFA 3EEFA 3QJ5A 4J0QA 2Q6LA 1J8MF 4QFCA 1PF7E 3LVRE 4XWAA 4PLVA 3QF7A 1BEZA 4NJMA 1V71A 2VJAA 3MINA 4H6PA 3HDJA 4FYMA 1NR5A 4C3VA 5ADWA 2ZE8A 3JZFA 3PGA1 5C53B 3DLHA 4LK3A 4OCZA 4DM7A 4MV4A 1CUIA 3ZJTA 3LE8A 2QU8A 1XKTA 1MABB 1LV7A 3G2OA 3PQ3A 4N48A 4KMSA 2WIAA 3V4OA 3WRYC 1SK9A 1D4AA 3WQHA 2QRVB 5FUYA 2XB4A 4HLUC 4HFNA 1WE2A 1FYVA 1R10A 1ZN9A 2BONA 4KPUB 1MORA 1QORA 2WT4A 3VNQA 5TIIA 2W2MA 3KSUA 1JPUA 1SUIA 1W7AA 2ZW9A 1K06A 2RI1A 5C3MA 3F6SA 4XQ9A 1ULAA 4EEKA 1I5EA 1SIOA 3J81k 1FUUA 1JYSA 1AC5A 2L2QA 3AVQA 3U3RA 2AUNA 1FNCA 1VMAA 1DWQA 1VB5A 2Q2NA 3CINA 2OK8A 3W5BA 2XJ4A 5K20A 3B5EA 2XVYA 4UATA 3IQZA 3SYKA 2JASA 2CNOA 3IC5A 1OSNA 2I7TA 3CH7A 3DBHB 4MH0R 5U4QA 1S01A 1I5OA 2LTAA 2Y92A 4N0EA 1I7SB 1VJCA 4KGVA 3GUZA 3M9LA 3TN7A 2FGKA 3AGPA 1BHJA 3GPIA 3O0DA 1QK4A 1X6VA 1XLWA 3DLBA 2XDYA 3RW9A 3COSA 2PE5A 4C7OA 4LUCA 2O5VA 1SZCA 1CY6A 1ZN2A 4EI8A 3KBBA 2Q4RA 2GCIA 4FNAA 2B99A 4CN9A 3TSYA 3C70A 3HJBA 3DLAA 3KZNA 4P9NA 3K1TA 5DRTA 1IOWA 1DC7A 1EDDA 2J7KA 3E5RA 5B7NA 1DE0A 4RH3A 3VU9B 2ORED 1Y7TA 2ZR8A 3F7OA 2WMOB 1NXPA 3R7AA 3PQCA 1C0PA 5IBRA 3C1TA 5LJLA 4JV5B 4XQEA 4LYEA 5BQ3A 4QBTA 3CGGA 3H7IA 1MAAA 3H75A 1CY4A 1NATA 4ESEA 1KXZA 2IVFA 3FOAA 4EHJA 5JAQA 2H1CA 2CEAA 4FSHA 4B6PA 3O94A 5CG2A 5B55A 2WABA 2XDQA 1YI8A 3EMDA 1ELOA 2IOFA 4MI1A 2P65A 2YN2A 3RUAA 4AN4A 4F11A 2WHYA 3BIXA 3PNQA 4Q4JA 5ANRB 3IAM1 3V8EA 4D9EA 4F2DA 1XRLA 4J7CA 4HYTA 3HDVA 2QN9A 3C3BA 4JVSB 2OZLA 4M0LA 1CUZA 1RYBA 2I4RA 5CHEA 2YCBA 1YJBA 3O4RA 3R7WB 5JNSA 3ER6A 4P1ZA 4EI7A 4J16A 3LY5A 1GNSA 3AW9A 3GT4A 1LH0A 3QUAA 4IJVA 4JP3A 4O2AF 3WWYA 5B4UA 2QG9A 3LNTA 5HCNA 1NW7A 4FD3A 4OHXA 3TSOA 1IMJA 4KX3A 2PKQP 3ZJVA 1BEEA 2XODA 3C5HA 2COEA 2BGGA 1UT8A 3BBPA 1JPVA 3S1AB 1VHWA 4P0QB 1W29A 3BWXA 4NARA 5A06A 1KBZA 5IZCC 3IE1A 4D5GA 4X24A 1YZQA 7REQB 1U8UA 3ZV4A 3T3PB 1PL8A 5ES3A 4AUKA 4O4JB 4XA8A 4QRIA 4W9NA 1GQQA 2JIQA 3Q2IA 3CX6A 4PX5A 4C0WA 5BQFA 1U4NA 3IA2A 4Q9NA 1P2GA 4ZVKA 3G8DA 2YWBA 2C00A 3JQCA 4HUQA 3MJRA 1YVUA 2CL0X 4UXHA 1UP6A 2P78A 1LJLA 3K6RA 3R1IA 4F4HA 4WPGA 3ZOKA 4C5BA 5LP6B 3WHIA 1BS1A 1WHSB 5IH3A 3DHWC 3FVVA 4MJ3A 2P6MA 3PNYA 1M34A 4CUJA 1PFKA 2ZUVA 1UJMA 1GR1A 1HR0B 1GZSA 1MRZA 4A6XA 3ADDA 4XGNA 4G89A 1S7CA 1SEVA 1IN5A 1V37A 1WEHA 3D1LA 4N6OA 4PNHA 3TB6A 3GOQA 2H1IA 2XKJE 2PZLA 5HE8A 1TAGA 3L0BA 3PUKA 4RK0A 5J4VA 4GUDA 1TYEB 4FGZA 4YYZA 5E4YA 1VMIA 2AG1A 3H16A 1MIOB 3EQ8A 2HSZA 5CFMA 2HA4A 3JD0A 3FDZB 4IHQA 4QTTB 1UWLA 3WGHA 4D96A 1YC2A 2ZIFA 3K9FC 2ZJ4A 3KP1A 5EI5A 3GXBA 5GIOE 1O6FA 1W88B 3EXAA 4MQ5A 3FZGA 4DJEC 3ENNA 2IEAA 4V02A 3H5LA 1E79D 4C4SA 5LDHA 5H81A 3EY9A 4N0MA 5K3OA 1ZQ1A 3DWFA 4HHEA 4KQ6A 5CT5A 5TEWA 3T3OA 3GLHA 3PHBE 1CF4A 2IDJA 5EQTA 1GHTA 4D3XA 5C5DA 3ADPA 1BXGA 1KR2A 2QA5A 4XTRA 3ZN2A 1J09A 4WNAB 4IIXA 3OWOA 4UUOA 1SBCA 1U80A 1II8B 1P7WA 1RQLA 4UKDA 1SVOA 5J2UA 2YFKA 3AJDA 2AMLA 3WNBA 4PU0A 5AK0A 1OXSC 3USZA 2JGIA 4Q9IA 3CISA 3G1WA 4RXUA 4BVBA 4PZ9A 5C1IA 3K4PA 2WI8A 3JD1A 2FLWA 1UBOS 3EG9A 3KR9A 1XQXA 3DEFA 4IMIB 4XTCS 4BZWA 4RDIA 4BE4A 1UADA 4Y3UA 4DKXA 4R81A 4URUR 3PNKA 1NC1A 3RPEA 5KKAA 4HD8A 5HUQA 4BNWA 4DMMA 3EMKA 4HN9A 3DJYA 2D3WA 3PRJA 3H86A 3E8SA 1XGKA 2BTEA 4QVKA 2PSHA 4MWTA 2FHPA