1C4XA

2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOATE HYDROLASE
publication title Three-Dimensional Structure of Microbial 2-Hydroxyl-6-Oxo-6-Phenylhexa-2,4- Dienoic Acid (Hpda) Hydrolase (Bphd Enzyme) from Rhodococcus Sp. Strain Rha1, in the Pcb Degradation Pathway
pubmed rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
total genus 92
structure length 281
sequence length 281
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 1999-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c4xA00
1LPPA 1ZI9A 5SYMA 1MJ5A 4H7JA 4FNMA 5JALA 2I3ZA 5ALEA 2VA9A 3RLIA 3R3VA 1C7JA 1UOPA 3EQ8A 5FP0A 5DYYA 5FPQA 5IVHA 2QUBA 2WIGA 4DMHA 3BL8A 2Z5GA 4YX9A 4U2FA 1B6GA 2XLBA 3HC7A 2WILA 1P0IA 2OCGA 2QTBA 1SCQA 1XZDA 2JBWA 4Y2VA 1WHTA 2WJ3A 3TEJA 3IA2A 2XUQA 5JZ9A 4FNGA 2WHRA 4DYHA 3H2GA 4Y2UA 1NX9A 2C58A 4KAFA 3HSSA 1X2EA 4EA6A 5LKRA 1JMYA 2RAUA 4Y2QA 1H2YA 4W1QA 3HEAA 3G0BA 4B7ZA 1MPXA 3SWWA 1UK6A 1MO2A 4AO7A 1H2ZA 1ZIXA 5CT6A 1W4LA 5LZ7A 3RARA 1UK7A 4UBOA 5HK9A 2Z3ZA 5CURA 2B9VA 5KWJA 4DNFA 5FRDA 2WUGA 4CG2A 2QR5A 2WFLB 2FUKA 4C87A 5HKBA 1IUPA 2FJPA 3B3QA 4OYLA 4C88A 2J4CA 1CFJA 1XRNA 4BTVA 3R3XA 4MEBA 4J3JA 1LPMA 1CLEA 4L0CA 5YASA 5ALNA 4Y2RA 4Q3OA 4CCWA 1WPRA 4G9GA 1QTIA 3ICVA 5AKEA 4B85A 2XQFA 1P0PA 3FYUC 1EB9A 4AMYA 1XQWA 3WIOA 5A71A 4UBIA 5K3CA 5ALJA 3SC2A 1EINA 1CUIA 4GWLA 4X7BA 1DTEA 3C8DA 2JGLA 5JD6A 1N5RA 3G9UA 3G8YA 1ACLA 3NOXA 3B12A 1XZKA 1XRQA 2O2IA 4QDXA 4FLMA 1ZIYA 1E8DA 1L7QA 2CMFA 1G5FA 5EGNA 4UHFA 3R41A 4P93A 3STYA 2XE4A 4Q3LA 4L3WA 5LIPA 2OAGA 2C0QA 2HDWA 4QDZA 1WOMA 4K6HA 4MXDA 3IBTA 2VEOA 3WA6A 4LXHA 4JEIA 2JGMA 3ED1A 1TQHA 4QWWA 1BROA 5K3DA 1DQZA 4BB0A 4FBLA 4OD0A 1UWCA 2PU7A 3G0CA 1TCAA 3N2ZB 2CEKA 4A16A 2XQKA 4QLOA 4BTLA 4DSAA 3QPDA 2ZJ6A 4X95A 4G8DA 5CXUA 2RHTA 5E4JA 1E8NA 1DX4A 3C6XA 4EUSA 2CJPA 1OXMA 5ALTA 3B5EA 4OPMA 1RWQA 4F0JA 3E4DA 4UPDA 5ALXA 2YYSA 1QE3A 3UUEA 5C8ZA 5AKJA 4J0CA 2CBGA 3PI6A 3CXUA 4DNOA 6YASA 1PFQA 1QJ4A 2OCKA 1MTZA 5K3FA 3V1MA 3BF8A 3I2KA 4UHDA 2CUTA 4W1SA 1JT2A 5A6VA 3WKBA 3WKAA 4J0HA 4Q1VA 4H7DA 3OTQA 4YASA 1UKCA 4ROTA 4H0CA 1VE7A 4QE3A 4HXGA 1XQYA 2W22A 3ZLTA 3FWHA 1JU3A 1MAHA 4IH4A 2EDCA 3V1LA 4GHWA 3MVEA 5H3HA 1IVYA 4C01A 3ILSA 1U65A 4I19A 2OG1A 4H35A 1R9NA 1CUAA 2Q0XA 1BE0A 1YASA 4UHHA 1QO7A 1QIDA 4OB8A 2IIVA 5T4FA 3EQ9A 4QDUA 3FYUA 3L1IA 5IKXA 1MX9A 1MN6A 4ZV9A 3AIMA 1DU4A 1YS2X 4UUQA 3H19A 1THGA 4FMPA 3I6ZA 5ALRA 4LXGA 5I7UA 4BAUA 2XQGA 2WHQA 2C0PA 4H77A 5AK6A 5BOVA 3HI4A 4X92A 5DNUA 5D3ZA 4EHBA 3DL7A 3F97A 4L72A 3G9ZA 5EHNA 2JF0A 3KXPA 1Y7IA 1E66A 4AMZA 3WJ2A 4EB0A 2OPHA 3T52A 3WLAA 5ALMA 2HRRA 4DMCA 2D5LA 3O4JA 1J2EA 2XMSA 1LPBB 4ZREA 2B20A 1SC9A 3QM1A 1DWOA 4FKBA 4BAZA 2HL6A 5FV4A 1P0MA 1LZLA 2WSLA 4LYEA 3WA7A 1CV2A 4FLFA 2J3QA 3HXKA 1EHYA 1CUCA 3MGAA 1CUZA 4XX1A 4EY4A 1MNAA 2PL5A 3ZLUA 1EDEA 1LPAB 2O2GA 3R40A 4Y2JA 4N5IX 4XIIA 4F60A 4RE6A 3QYJA 5AH0A 4KACA 1JJBA 1O6GA 1UFOA 1HPLA 1K5PA 5IVIA 4E14A 4QEKA 2H9YA 5IVDA 4AB1A 2O7RA 4BBZA 3I1IA 4OB6A 5CH5A 5CT9A 2PSHA 1IZ7A 4WFIA 5HQ3B 3BDVA 1Q83A 3QPCA 1H2WA 3OM8A 4CCYB 3BE8A 4DMKA 4GLBA 2AXEA 2WG0A 2QM0A 1N1MA 3STUA 1Y7HA 2QJWA 5EFZA 4KAJA 3G0DA 3QZUA 5CH8A 1GPKA 3DD5A 1EA5A 1Q84A 3ZV7A 3AFIA 3C6ZA 3KDAA 1QIMA 4X3CA 2ACEA 1HKHA 3HLKA 1CEXA 2VF2A 3H2JA 5ALVA 4PQEA 4RNCA 1XQXA 4OSEA 2O2HA 1VZ2A 1KU0A 1U2EA 4EY6A 2HA0A 2E3JA 3DDUA 3WK6A 3D5EA 5AKGA 3BJMA 4WFKA 2OXEA 3CCCA 5AKHA 4G5XA 2WUFA 3W05A 2EDAA 3T4UA 5AOCA 3C43A 2VJAA 3ESBA 3VVMA 4N8EA 3DL4A 4KJXA 3VDXA 5KBYA 1DQYA 2WG1A 2XUKA 2PSDA 4Q05A 3IUMA 5K3EA 1UXOA 2Y1KA 1FFCA 1XZCA 5I8PA 3PFCA 4BZZA 4UHBA 5IH7A 5ALHA 4MQLA 2WUEA 1WB6A 5T4EA 3JYHA 4P9NA 3Q8WA 3RK4A 1QTRA 1XZLA 4IH9A 4YK7A 5T4HA 3I2IA 4IH1A 1E5TA 1NU8A 2GZRA 3QMVA 3STVA 3LCRA 5D6OA 5JANA 1Q0ZA 3F98A 3H0CA 1GPNA 2B4KA 5EHQA 3DJYA 4BATA 3N0TA 3CN9A 4W9RA 2AJCA 2DFPA 1CUVA 3FOBA 5LZ4A 3O4HA 2PX6A 2AJDA 4G9EA 3M82A 1W75A 1GXSA 1ODTC 4JYPA 1XKLA 1CIJA 3FBWA 3LS2A 1JFRA 2H7CA 2BJHA 2ORYA 1VKHA 1R9MA 2ZSHA 1BN6A 3D2AA 3V1KA 1KEZA 4KE8A 3E0XA 4E46A 2G5PA 4B9EA 5LYYA 5JARA 4DLNA 1R88A 4Q3KA 4J0JA 5BWBA 2XUDA 1NU6A 1YAJA 5CT4A 1VZ3A 3IIIA 5HF8A 1Y37A 2XI4A 3PF8A 5CMLA 4UHEA 3M3DA 2PM8A 2WHPA 4B0PA 1EH5A 1WB5A 4X6XA 1VA4A 2V96A 3VJMA 5D7BA 3DNMA 2DHEA 3LP5A 2J3DA 3OOSA 3WWCA 1I6WA 4BC1A 5AK5A 4ZGBA 5CTAA 2O7VA 4KR0A 1TIBA 5HZGA 5T4BA 1W76A 3P2MA 4A5SA 2GBIA 4H7KA 2WFLA 3WIBA 4F5ZA 4U2BA 3OC0A 2WHPB 3FYTA 5CRIA 5FOQA 1EDDA 3WKCA 4HXEB 1XZFA 2V97A 4CFSA 3W06A 2GYVA 1ZJ5A 5K3AA 5DLPA 1HQDA 3WK8A 5HKAA 3WL5A 2QS9A 4BP9A 2GBFA 4DNPA 2GYUA 1AZWA 1XFDA 3R0VA 4K2AA 5JAOA 4P92A 2BGNA 3C45A 5AK3A 4I4CA 3KD2A 2JGIA 2PSJA 4MYSA 5FKJA 4INZA 4H7HA 1EB8A 4KE6A 1FJ2A 5ISMA 5AICA 1XZGA 1MT3A 4CG1A 1CUFA 5ALDA 5HF9A 4HXFB 5AIBA 2BGRA 3HJUA 4KRXA 3C5WP 2PUHA 1EX9A 4B80A 3IUJA 4U2EA 4X85A 2WFMA 4D9JA 2HHAA 3ZPXA 2V9ZA 4V2IA 3YASA 2VAVA 3K6KA 1CRLA 4BCDA 5ALZA 1TKRA 4KYVA 4TGLA 4H7IA 3VXKA 5AHXA 1QIFA 2XDWA 5JYCA 4MWTA 2DHCA 1Q0RA 1BCSA 4AO6A 1UKAA 3HYSA 3GROA 1J07A 2XUHA 1O6FA 2PPLA 4HVTA 2YXPX 3F9CA 1ZICA 2XT0A 5I9IA 1QIJA 5IVKA 2BFNA 4WY5A 5FLKA 4IO0A 1J1IA 2C5GA 3DEAA 1JJFA 3BIWA 3SX4A 1TAHA 4E15A 1C7IA 2WJ4A 1XZAA 5A7HA 3QH4A 1XZEA 5JD5A 4J7AA 3WWPA 1X2BA 5FPPA 5AM4A 1MNQA 4W63A 1AMNA 3L1JA 3QBJA 3KWFA 5C8XA 4PSDA 4O08A 4AZ0A 3D0KA 1WPXA 2DHDA 3WJ1A 2CB9A 3FLEA 1GQSA 5AKIA 1AKNA 7YASA 1EK2A 5EHZA 2WUDA 4FFVA 5AI8A 1AURA 1DX6A 1HL7A 3RM3A 3TGLA 2VATA 1ZI8A 4GI1A 5AI6A 4UBMA 3V1NA 5FXMA 1H2XA 3IURA 2Y6UA 2PVSA 4RE5A 2FJ0A 5ALIA 3W9BA 1QIKA 1DWPA 1E3QA 4XVCA 3O0DA 4G8BA 3QITA 1XROA 4FTWA 4PO3X 1U8EA 3R3YA 2JEYA 1CUYA 2VAXA 2Y2VA 1LBTA 3I2JA 1N5MA 1BEEA 4Y2YA 4YPVA 4PSCA 2WKWA 4WJLA 3BF7A 2PBLA 2XB6A 4KAAA 3WYDA 1XZBA 5C7YA 4PSUA 1QOZA 3A2NA 4WFJA 2VT6A 1AC5A 1R4ZA 2ES4A 5AI4A 2JIDA 2HIHA 5ESRA 5EIAA 1LPNA 1VXRA 2ZJFA 4QWMA 4Y9SA 2HA6A 5DYTA 1ZGCA 1UKBA 3ZLVA 3V9AA 4WCVA 2OGTA 5AKYA 3GELA 4BE4A 3R3ZA 3E3AA 1QONA 4Q34A 3AUKA 3GFFA 4KE9A 2OLEA 2HFJA 2C4HA 3FVRA 4B83A 4PV7A 4PF1A 5AKKA 1QIHA 5JASA 2XMBA 5DNWA 1VOTA 3C6BA 3DQZA 2WTNA 2WIJA 3G9XA 3FNBA 2XUGA 4RPCA 1S8OA 4ZI5A 4NMWA 2DQZA 2XMZA 3NGMA 2QOEA 1JU4A 4ARBA 4G4JA 2JEZA 4FBMA 5E4TA 1L7AA 1QZ3A 2GYWA 4G1FA 1FSSA 5AOBA 5JIBA 3WK5A 1EDBA 5AO9A 2H7YA 3KOOA 2AJLI 2XUAA 5LLSA 2BUAA 4KEAA 1HBJA 1E89A 3GUUA 1YR2A 2QRUA 4A23A 5HQ3A 4MJ3A 4AX4A 4U2GA 3LIIA 4HAIA 4G4GA 1A88A 3KWJA 4CCYA 1LLFA 1WCYA 4ITVA 3WK7A 5CXXA 1VLQA 1FFAA 4DGQA 1AGYA 4GBGA 4JYMA 4QA9A 3H2KA 3PF9A 1DT5A 4BAGA 3AIOA 3WMRA 3ESAA 5JZBA 4K5QA 4ZXFA 4F21A 2WIFA 4HZGA 1FFEA 3TJMA 5C81A 4BZWA 2ZYIA 2XMDA 1TK3A 1JJIA 3AJAA 2Z8XA 3QMWA 4M0EA 3NUZA 4X6YA 3H1AA 1SFRA 4ZRDA 4AZ3A 1FFDA 4H7FA 3WYNA 4LYDA 4WDQA 3FCXA 5AKXA 3WI7A 1QIEA 3WL7A 2PSFA 2VQ6A 3DOHA 3S2ZA 5ALUA 4OU5A 3OPMA 4IQ4A 4X93A 5CT5A 1T2NA 5AI0A 2UZ0A 4DSZA 1BN7A 3GBSA 4I3FA 1UZAA 3F96A 5ALLA 4PNZA 2V98A 4FLEA 4BVJA 3DOIA 1HLGA 2HA7A 1ZI6A 3O9MA 1THTA 2OQIA 4BDTA 2ZSIA 2BAGA 2ZYRA 3WZLA 3WK4A 1M33A 5J3JA 3X3HA 2ONCA 3A2LA 1CUJA 4EY8A 1EI9A 2XMCA 3DLTA 3DKRA 5CH3A 1GKKA 2IX9A 2Y2UA 1MAAA 3EQ7A 4WY8A 2OGZA 5AJHA 3BIXA 1A7UA 3ESDA 3AILA 3VJKA 3GZJA 1ODCA 5K3BA 1LZKA 2R11A 1QO9A 2WU4A 4TVKA 4BRZA 3HRHA 5K5EA 1OILA 1PV1A 3D2CA 5D3KA 4MYDA 5HF6A 2J4FA 2RGUA 5AM0A 4X94A 5ALQA 3WWEA 3UMJA 1LPOA 2RI6A 1OCEA 1VE6A 3L1HA 5CW2A 1K63A 5EHXA 3U0VA 2VJBA 1CUWA 3IVMA 1C4XA 3DYVA 4FOLA 3D7RA 4J0KA 2WIKA 3WQHA 5LZ2A 4OYYA 1A8UA 3VISA 1G42A 2JGEA 3EBLA 2YASA 2ZVDA 2W6CX 2DR0A 3G7NA 3IULA 1VJ5A 1W52X 4HRYA 1JKMA 1TCCA 1LNSA 1DINA 2CKMA 4AN1A 1H23A 1G4HA 3ZWQA 2BUBA 2HA4A 5AI9A 2WLSA 2VJCA 4UFPA 4TPKA 4DMFA 4DM7A 4AXBA 1TCBA 3DS8A 5ALWA 4UBLA 1CR6A 3WWDA 4BC0A 3W04A 2VJDA 1UOOA 2K2QB 2Y6VA 3FSGA 3VJLA 5BV7A 4B9AA 2ROQA 2VTVA 3OURA 4BP8A 5EIEA 2ZJ7A 2EEPA 2XQIA 4FHZA 4S0XA 4B84A 5HFNA 2XUIA 5EIHA 3TRDA 4LIPD 1QIGA 5AKZA 1XLVA 1ORVA 4KRYA 5DYWA 2R8BA 3HABA 1CVLA 5DWDA 3F8SA 1ETHA 4Y2XA 3I6MA 4J0GA 5ALGA 4GXNA 4FFWA 3EF3A 5C8VA 4XWGA 4DIUA 5LZ9A 3DKKA 2QMQA 4UBKA 3H18A 5DNVA 5LKAA 4ZWNA 1UK9A 2XMGA 3AZQA 4UBJA 5LZ8A 2XMRA 4X71A 3WL8A 1AQLA 3BWXA 3R3UA 3C6YA 3HZOA 5A7GA 2GBCA 4FWBA 4C4YA 4RGYA 2QJRA 1IUNA 3BJRA 2WFZA 3D4LA 2HM7A 2C7BA 3FVTA 1BS9A 5DJ5A 1F8UA 1QGED 3IDAA 4B6GA 3ZI7A 4BCCA 2HA2A 4BYMA 3C70A 3CN7A 4K6KA 2XMQA 1CUDA 2JGFA 1WM1A 3KSRA 2XUFA 5A2GA 5JZSA 3K2IA 4Y2PA 1DWQA 1XRRA 4BVLA 1E8MA 2GZSA 1MX5A 4J0IA 3G0IA 2LIPA 1JI3A 2X8BA 1YA8A 3RKSA 5AM3A 2DCMA 1GPLA 2OQVA 1IUOA 1GKLA 1XKTA 2QXTA 1CUHA 3D3NA 5ALSA 1ORWA 3O9VA 3AINA 2WG2A 4M0MA 1XQVA 4UFOA 4HS9A 3QVMA 3WKEA 4ZV7A 3HACA 1EVQA 3I28A 2IITA 1X70A 2ACKA 3PUHA 3R3WA 1ZD2P 4N5HX 3D59A 1XZIA 2RONA 3MUOA 1ZOIA 3DCNA 1GT6A 1YS1X 1CUXA 3I2FA 4AO8A 1LPSA 4LHEA 1GQRA 4WDRA 3BXPA 5E4YA 3PFBA 2RHWA 3W2TA 2PKYX 4QNNA 1F0PA 4UBNA 3QMMA 3FAKA 4XJVA 3STXA 1H22A 1BRTA 3EIOA 5E2IA 4EY5A 1R1DA 2I78A 3PE6A 2GBGA 4QDOA 3D2BA 3M83A 3G9TA 3AIKA 4HTAA 1RYYA 5DTIA 2G63A 4GDMA 3U1TA 3FLAA 3G0GA 1L7RA 4C4ZA 4P08A 1UOQA 3C8HA 3H1BA 3PICA 4BRSA 2ZYHA 3W9UA 1XZJA 3ESCA 5ALYA 5AM5A 1BU8A 3H04A 4MEAA 5AP9A 5AOAA 2QXUA 1XLUA 2YH2A 4UFNA 3GA7A 4Y2SA 4X6UA 3A70A 3IB3A 5JAUA 5LZ5A 4C4XA 3O4IA 2OGSA 3QPAA 5A7FA 3Q0TA 5JAPA 5ALKA 1EK1A 2FX5A 4E11A 2I3DA 2PUJA 2XUJA 1CUEA 4CG3A 4BVKA 4J03A 4LKOA 1YB6A 1AUOA 5K3FB 1QFMA 1ZD3A 1QIIA 3PDCA 3OG9A 5HF5A 3ANSA 2WQZA 5HFAA 4C89A 3VVLA 5EI5A 2JGKA 2XQJA 4G8CA 4OUKX 1W1IA 1CQWA 3FLBA 1YCDA 2WIDA 1ISPA 1R50A 4BE9A 4AN0A 4LXIA 4M0FA 3I1YA 5ALPA 5BWCA 5JATA 2RIPA 3WK9A 1YB7A 1SCIA 5AKLA 4B0OA 2VT7A 1UK8A 3O4GA 3IUQA 1EXWA 3WZMA 5HK8A 1GZ7A 1VA5A 5CT8A 4OU4A 1ZGBA 3FYUB 4NVRA 5ALOA 4K6GA 2C5FA 5JD4A 4HRXA 5JADA 4EY7A 1DT3A 1RP1A 4NZZA 3G02A 4DNQA 1JMKC 1BEZA 1F6WA 2WM2A 5JAHA 4N8SA 4JH0A 4N8DA 1XRMA 4BCBA 4QLAA 1ZJ4A 1VXOA 1LGYA 1HDEA 1K6EA 3H17A 3I2HA 4C6HA 4ETWA 4EBBA 2WTMA 5A62A 1XLWA 1CQZA 5AM1A 4X97A 4U2CA 4PW0A 2QVBA 1XZMA 2H7XA 2HADA 2NW6A 1IMJA 4GW3A 1MU0A 4KE7A 2HFKA 2Z3WA 4EZIA 2ECFA 3MUNA 3NWOA 2HA3A 1SOMA 3JW8A 2OAEA 3IUNA 4CIAA 2BCEA 4U2DA 3I6YA 1LBSA 1Z68A 2B61A 2JGJA 4L9AA 4B81A 1A8SA 4OB7A 3E1GA 1D07A 2XUPA 5DTJA 3SK0A 3V48A 5HCUA 1T4MA 2HU8A 4MQMA 2QUAA 2XLCA 1ODSA 2HU7A 1QLWA 2OCLA 3ICWA 3H2IA 4J0DA 3AZOA 3F67A 4W1PA 3WKDA 3K9BA 1UT6A 2WJ6A 2CZQA 4Z49A 1FFBA 1XRLA 1MX1A 2X76A 1EVEA 3A2MA 4FDMA 1GGVA 1AX9A 4MWSA 2PU5A 3FCYA 1CUBA 3M81A 4NS4A 1CUGA 4W1RA 1U4NA 3C87A 4G4IA 1KU6A 2AJ8A 4GEGA 2PSEA 1WHSA 2BUCA 2P8SA 5AIAA 2QKYA 1R3DA 4IHAA 1PJAA 2XUOA 1N8SA 4Q82A 2HU5A 1P0QA 4JUIA 1IZ8A 1B41A 2WU3A 1W6RA 4BDSA 4DTCA 5F4ZA 3LLCA 4CI9A 1XRPA 3C5VA 3AZPA 2D0DA 2H1IA 4GECA 3FSGD 3LIPA 2DSNA 4JNCA 1CUUA 3PUIA 4H7EA 5FDFA 4CIBA 4QZVA 1WB4A 5FUMA 3BDIA 4UHCA 2DQYA 1CPYA 1ZD4A 3WL6A 1F0NA 4Y2TA 5AI5A 3UUFA 1J06A 2G4LA 1ACJA 5AM2A 5SYNA 2HA5A 3ANTA 3STWA 2ZYSA 1K4YA 1YSCA 5LP1A 4Y7DA 3A6ZA 3I2GA 2VSQA 1G66A 1USWA 3STTA 3DYIA 4QDTA 4H18A 2BKLA 3CCBA 4ARAA 1YAHA 1SCKA 4OCZA 4B82A 1ZD5A 3S8YA 2X5XA 4X90A 1A8QA 4X91A 4AQDA 4X00A 5ALFA 5CBKA 5KWIA 1YA4A 2HRQA 5KREA 1QFSA 1BCRA 2I03A 2AJBA 3WWOA 3JWEA 3O95A 1XZHA 3H2HA 5AK4A 1TRHA 2G5TA 2OCIA 2QT9A 2QZPA 1K8QA 1CUSA 3VKFA 2Z8ZA
chains in the Genus database with same CATH superfamily
2HJSA 3U16A 1CEYA 1MA3A 4WA8A 5FTJA 1UBRS 4G9BA 1NW9B 3CEPB 4OYHA 4JA0A 5E6RA 2VT3A 2CF5A 2YOHA 1M2NA 2B4YA 1RABA 2A5FA 4LY6A 3WLFA 4BBAA 2X4GA 2FJUA 2PZKA 5ALEA 4DQLA 3L8EA 1M2EA 1DE0A 1WO8A 1B4DA 2DM6A 3RRNA 2XE7A 1JR3A 1GXSB 3OMWA 5E6UB 2NU7B 3R3VA 4QXQA 5I7VA 3VO2A 5IEJA 3CH5A 4F93B 5FOTA 5CFQA 5ICEA 1FFYA 1E1QA 3KEQA 4G1EB 1V6SA 3PX2A 1EHCA 1TVKB 1ZESA 3P2JA 1PGPA 1EG2A 4YRKA 5JEEA 3ZV3A 4JELA 2R1ZA 1AM4D 3IELA 4ABTA 4AJHA 2B5WA 1MV5A 3FTCA 5C18A 4MW2A 1KS2A 1Y6GA 4C07A 2WIGA 5I5EA 4G5RA 3T6KA 2QNBA 3QBEA 2DULA 4HNQA 3USCS 4YX9A 3MJCA 3FPAA 2WSSA 8ABPA 2IH5A 1PL6A 1B6GA 3NHUA 3P9QA 2VHUA 4GQIA 5DULA 4YV2A 2NUBA 2FK7A 2GAFA 2ZRJA 3E81A 3AF6A 2WILA 1U02A 3TTWA 1CJBA 3WP0A 1QQ7A 3PRKE 1A5TA 2QTBA 3TIGA 5C8YF 5F9HA 2WF8A 1GRVA 1NFRA 2BFBB 3AKYA 4WXMA 3FMIA 4P22A 2P3QA 4Y2VA 3DF9A 4Q4JA 3SFTA 4BECA 5K8JB 4EKYA 4TKZA 3HBAA 1E3JA 1NQ5A 1WEHA 3PJGA 5JZ9A 1D0VA 3WHLA 4OQDA 1W36D 1QHGA 3HCWA 4XDZA 1WZEA 3VU9A 1NX9A 3EA0A 3LPMA 4D6YA 1XBTA 4IPTA 5EZQA 3BH6A 3HDYA 2QDXA 3KQOA 4JIMA 4OJYA 4YFYA 1IZZA 3ET4A 1L5MA 4J9UE 4IGAA 3RS7A 3FGOA 3IP7A 4DZZA 1DIAA 1EXMA 4E07A 3V4PB 4CTMA 1TF5A 2ZE6A 3G0BA 1K0UA 3NXSA 1UPUA 3CUTA 3ZYCA 4E2XA 4NARA 2QQ5A 2FR8A 5AJTA 1MPXA 3SWWA 1H2FA 1NMXA 4ENRA 5CB4A 5K20A 1KAEA 1W34A 3PHIA 1QGDA 1H2ZA 2WZQA 3B1JA 1E2MA 5EMJA 1I3KA 4LK2A 2P3LA 1HDXA 5CT6A 2XCUA 5LZ7A 5JAIA 1L5FA 5D1NA 3F1LA 1H2BA 2IODA 5TQ0B 1FFSA 1W96A 1I33A 2Z3ZA 4DNFA 1Z2AA 2CZGA 2NVWA 2JAQA 3HP1A 4KLCA 1F9EA 4L8LA 4M60A 4QVGA 2V7WA 5FRDA 3L8FA 1HNZB 3JQFA 2QR5A 2E7ZA 4DCTA 2JJYA 4POOA 2WWWA 2QN3A 4Z9YA 5YASA 3SEAA 2W71A 4BL5A 5CX1B 2R86A 3FHTA 2MSEB 3NNNA 4JU8A 4XB2A 4FILA 1FDSA 2PLAA 5KVQA 1UXGA 4BEBA 4XJXA 4QXMA 5LWQA 5AUNB 2CW5A 3GJ7A 2J4CA 5THQA 3R75A 1Y6RA 4M76B 4YBZA 3VO1A 1LRKA 2CL7X 4BTVA 4UTVA 4J3JA 4V0SA 4E1AA 1LPMA 1CLEA 2VCEA 2YYZA 2ZR7A 3OE7A 1K8ZB 1OAKA 3Q85A 4QPZA 1G60A 1JHRA 5ALNA 3UMFA 4MVJG 4BNTA 3CUWA 2ACWA 2NGRA 4ACAA 3EBPA 4GLLA 2QJFA 4QQNA 4G9GA 2A9PA 3S8EA 5BSVA 3PPXA 2YY5A 1TADA 3SDSA 3HZRA 3HA7A 5L6LB 1NRWA 3D4BA 5AKEA 3EMDA 1P45A 1ZLXA 3UWSA 1QTNA 5CBPB 1I0IA 5J1SB 4AY6A 1KETA 2YXNA 4QECA 2CN1A 3FYUC 4AMYA 2GB4A 1RCTE 2R68A 3EVEA 3P7MA 1M34B 4GQAA 3NIWA 3W2FA 3CX3A 3WIOA 1PJCA 1T6BY 4OBWA 1TGVA 3U4CA 4UBIA 3NBKA 1VL0A 2VRNA 2NPFA 3LQ1A 2D1RA 1YA6A 2VP5A 1OH5A 1J23A 2I62A 2VBGA 3BFXA 4BWYA 4GWLA 1X15A 3GAFA 2LUOA 1NXPA 2FZVA 2JGLA 5B1IA 1VCMA 4R41A 3RU9A 4IUCS 4L4ZA 1E3TA 4TXMA 2VPPA 4UDNA 4BNWA 3EPJA 1B6SA 3W7BA 3M2TA 4GYWA 1TW3A 1QAQA 1ZYUA 2DKFA 3JQ9C 4IJQA 1XZKA 3BAZA 5IZCC 2O2IA 3X1MA 3L7KA 1YC2A 3HU1A 2NV6A 3WLIA 3IOBA 1F4PA 3BQMB 3IAFA 3RUFA 3WSVA 2IHJA 4ARCA 5BUSA 2CMFA 2DOKA 4FT2A 4JXJA 4ESVA 3KQKA 5J58A 2P9GA 2IFTA 5DP1A 1KFBB 2J5XA 3KV1A 3LVQE 4DC0A 3QVVA 3R41A 3VC3A 2JLUA 3KRTA 4EFDA 3DBVO 4MLPA 4MV7A 4L3WA 2X2EA 5LIPA 4UMDA 4B4UA 4CKBB 3Q7SA 2C0QA 1TNDA 1MB4A 1C1DA 2BFDB 2HDWA 3B51X 2EG9A 4TTIA 3RVNA 4K6HA 3FJ1A 3IBTA 3VKVA 1P33A 1JYFA 2W8BA 1XTRA 1P29A 3WA6A 2O2CA 5E2AA 1JN0A 2OV4A 3UT5B 4JEIA 5TIIA 1V6CA 4JD5A 2BFAA 2NYVA 4NFYA 3C4JA 2A35A 2HK7A 2AYZA 2XYVA 2H1CA 4RGQA 2HLDA 5DMHA 5ETJA 1UAYA 1PIWA 5EZYB 4ZYLA 2RAVA 5K3DA 2I67A 1DQZA 1AGRA 3GUHA 4DJDC 1KZYC 1N6NA 4DCUA 4MB6A 1SHLA 2JCSA 1V1RB 4I1VA 2CDCA 4EYQA 1BCSB 3MT8A 2BZ0A 3UB2A 4OD0A 4DAEA 3BG5A 3G0CA 4P4GA 4ZPJA 4BO3A 1UCFA 1QH1A 2EFGA 1DKNA 2GLTA 4L8VA 4QUBA 5TRTA 4A8JC 1N34B 1DC6A 2CEKA 4A16A 4QLOA 4BTLA 2A1TR 3KYCA 2ZJ6A 3GZ4A 2EOAA 2REXB 3NAZA 2G67A 2ZRCA 2AT1A 4X95A 5H82A 1JU9A 4RZ2A 3DDHA 2RGWA 2RHTA 3MMXA 4C7VA 2YQ4A 4YXWA 1X1BA 2EZ4A 3PUVA 1F2DA 4IGEA 3WGTA 4H6XA 4RZ3A 2G5GX 1W94A 3WYBA 5IBCA 3JR3A 4XUCA 5FNZA 4YR7A 5ALTA 1PSZA 3PGJA 3MPUA 2FFBA 5KTNA 2JFGA 3NWBA 3QWBA 4R3UC 4E3WA 1VRWA 3BERA 3PCTA 1U3DA 3DC7A 2ZB7A 1EFPA 2J41A 4KXMA 4UPDA 4ZAZA 3UANA 3RADC 1ZR4A 2YYSA 5EY5B 2QRMA 2DERA 5CVDA 1PZXA 1QRRA 2XR1A 3IPAA 4K9RA 3GYBA 2HEGA 3L05A 1E4VA 4MWEA 5LQKA 1RACA 2GK4A 2QRVA 3DUFA 1SBZA 1E2PA 4NCHA 1AS2A 3PI6A 2KYRA 4DNOA 4Q1BA 1DADA 1RZ3A 1KTVA 2D2IA 3I3SR 2FOLA 4PLGA 1PJ2A 3EZGA 1PFQA 3P0IA 4QDJA 5M29A 2B1GA 5DI3A 4IRMA 3SEFA 3WLRA 3K2BA 3VNUA 3BTOA 2BKVA 3QHPA 2AX3A 1P73A 4UHDA 4OKIA 4UW9A 4UZEA 2CUTA 5FBZA 4Q1EA 5IBQA 1JT2A 4D9FA 3PD0A 4ZOLA 4ZN6A 3I5YA 4GUAA 2OQ2A 3WFJA 4TS4A 4YTEA 4ZYYA 3DDCA 2IZ6A 1Y5IA 4Z0HO 1YTUA 4JFRA 1HM5A 1KZ7B 1QLHA 3HKCA 2YWHA 1IATA 3OO0A 4IKOA 5CVVA 1W9MA 3T35A 4YASA 3PB3A 3KQTA 1ZL0A 4G24A 1SA0A 2DBQA 2QWXA 1QOPB 3P2KA 4GZ3A 4WPGA 5IULC 5H0IA 5C51B 3A9CA 2VXCA 2BEWA 4J1NA 3WHPA 5CFNA 5JSHA 1NY6A 1WUYA 2GD1O 5MFZA 4BVHA 5BOSB 1CY8A 2FWMX 3ZLTA 2YFHA 1FFWA 2JH8A 4MV8A 1ZJ6A 2OO5C 3ECSA 4IH4A 2ERCA 4NI5A 2XTMA 3HYNA 3PFKA 5H3HA 3MMZA 4C01A 3GRUA 3TW4A 1NI5A 2PMCA 3TGWA 1ZCFA 4I9HA 2Z5FA 1N3LA 5BMVB 2JJ1A 2RGRA 1WABA 4H60A 3ZBUA 3OC6A 4I19A 3W1VA 1QH9A 2TECE 3E8MA 4DG9A 1T1SA 4I5GA 2PT6A 3HJTA 4N39A 4A8HA 2Q2WA 2W58A 4V3BA 3CR7A 1A4IA 3PGKA 5LU8A 1GSIA 2Q0XA 4HDCA 3ZE8A 1YASA 4Z2YA 1QO7A 2X0DA 4F96A 5K8VA 1ZKMA 5J2UF 2IIVA 3PJDA 1YHNA 3R7FA 3ROKA 3PBKA 2QZ4A 5T4FA 2GCPA 3EQ9A 1T91A 2QW1A 3S99A 4YWHA 1DQNA 4I1UA 1RJGA 1WMDA 2VDQB 1MN6A 1NRJB 1P39A 4GH5A 4ER5A 4ETIA 2JCYA 1SG9A 2ZVJA 2C5BA 3AIMA 2CVPA 3CURA 1DU4A 1CR2A 2JHCA 2VJPA 3BMOA 5A3RA 1NUPA 1YS2X 3EGEA 3HEMA 2Q7XA 4NMLA 2OOSA 4O4IF 2PCJA 1J8QA 1JVSA 3D3JA 3JQ7A 1ISSA 3IQHX 2FMHA 3BD9A 3I6ZA 1HXHA 4FMPA 2PX2A 4AK9A 4EGFA 1DIRA 1XTJA 4FJ2A 2PZFA 1JBQA 4BKQA 4UCWA 3DDWA 3BWDD 1H5UA 4OIMA 2MSWA 4LXGA 5I7UA 5KNCH 1ESZA 4X20A 1E32A 1YBMA 5G4KB 2I6QA 4W5WA 3VAYA 2JJQA 3WRYC 4FBGA 4PAOA 4R9VA 3PJRA 4XLLA 5G41A 4B33A 1LSSA 2IGBA 4P3KA 4M0LA 4N0PA 3HN7A 1J1UA 4AUKA 2FP4B 4H77A 1I6MA 4KVZA 3ZWVA 3S1AB 3AB7A 2UZ4A 1WDMA 1NC3A 1UWVA 3M6MD 5K3OA 1MJHA 4LTMA 3GN1A 2E9SA 1C3OB 2WYVA 3C98A 5JPIA 3F97A 2V6GA 3VUEA 2QZJA 5BN4A 4L72A 1JG1A 5KCMA 1WVIA 3EXEA 1KIAA 1KZ6A 3KXPA 1YO6A 5A4MS 1PG0A 2G1KA 3T1VA 3TSOA 1SXJB 2HKIA 2B98A 4ZODA 4FGJA 1SCUA 1GR1A 1Y82A 1EGMB 3AG6A 3O8DA 4JQYA 4RA9A 1I7SB 2BFEB 1HWYA 1IHYA 4R8RA 2PEZA 2D06A 2GTIA 4YRMA 1U9JA 2HV9A 1A76A 3AMVA 2WIAA 3MZ0A 4PQRA 2COKA 3VAAA 4DSOA 3TRKA 1NE7A 3ILHA 3PYLA 3QA3E 4QQKA 1X1SA 2WZBA 4J43A 5REQB 3ZZTA 1D4OA 2CD9A 4OJNA 3GX1A 4Y2GA 2QM8A 4C29A 3AC0A 4NBKA 4XVQA 2UVPB 1Q3HA 4MVJD 3O8NA 2H1RA 1ZRHA 2ZRAA 4I50F 1SC4A 1U5BA 3HN2A 1V39A 4CV0A 1BG6A 1Q50A 4HDAA 4WNAA 2BWJA 4BAZA 4Z4IA 3WV4A 2GERA 3EXHC 2UAGA 3EEFA 5KDLA 1KPHA 3U4DA 3IA7A 3OJ0A 5KVCA 5KYYB 2XB2A 1LZLA 4P4NA 4YT5A 4BUZA 3JAKB 3DEYX 1FNNA 2B7BA 2H1HA 2J3QA 2D59A 3HXKA 1W87A 2PN1A 3MGAA 4XX1A 1I0ZA 1N6OA 2CMHA 2PL5A 1RZVA 2Z09A 3B6EA 1HDYA 3E7FA 2C4MA 3T7CA 5HE8A 3CE6A 2YFQA 3TTTA 1EBFA 1RLUA 5DLQC 3IKVA 3VOAA 2BBWA 1T8UA 3EVCA 3RFTA 2BH9A 1QAOA 5KYUA 1GL6A 1W0KA 3VI4B 4GOKA 1OIVA 3M5CA 3IT3A 4JUFA 4O2AA 1NV8A 1R5JA 1WR8A 1GY8A 1QZUA 2OGWA 1KP3A 3I9V6 2K7FA 4GKKB 4CDNA 3DLHA 1NVTA 3A4MA 5DK4A 1HZJA 1QRTA 3PTLA 4IQ8A 1O6GA 5AK0A 1UFOA 3T7RA 1KSGA 4HDNA 3AF1A 1ULAA 2BRUA 5EKTA 2IU6A 4L9RA 5JAMA 1U5AA 5LD2B 3C1TA 3HVIA 4F7DA 3LYHA 4BS9A 3BWCA 2AHRA 3LV8A 4E14A 3OF3A 1O9BA 5IVDA 4DWJA 1RLOA 4MI9A 4ZCPA 2W4IA 3O0TA 3B9RA 2HJWA 3KV3O 2OBYA 4PNEA 2YXDA 1IY1A 2G4CA 4MS1B 5DM2A 3ZCPA 1JBKA 3U3JA 3CLSC 2ZI4A 4PZUA 5EXSA 2UYHA 2B34A 3PIIA 2Q1YA 2O9JA 1Q83A 5CP8A 3M4YA 3GUZA 1PRYA 1P19A 1QGOA 3LCVB 2CXXA 1PLJA 3JWPA 5JFTA 3DMPA 4JBLA 3GLHB 3S7ZA 4CCYB 4ZMRA 4ZZIA 3IAAA 3ICCA 3KTDA 1YJBA 3UQZA 5CEJA 3BXXA 3NDPA 4XVRA 1LTQA 3COPA 4L5CA 3TNDA 1B15A 4HGZA 4E32A 3DBRB 1NURA 3LLVA 4BO8A 4DMKA 1OZ0A 3T3NA 1IXRC 1G7RA 1N1MA 2NO6A 1H66A 2DHQA 4I1OA 4JP8A 2IYUA 3BCRA 4IICA 4YREA 3UYLA 4MQEA 5KWSA 2D4AA 1FXSA 4EH1A 5J5VA 3ZBTA 1GTJ1 3R3JA 3I4CA 4YH1A 1ZP6A 5DTRA 4FQ5A 2EFYA 1H6CA 1QVWA 5CH8A 4AECA 3Q3JB 1GPKA 2VPYA 2EJWA 4K6CA 4ASUA 4DLPA 3OQMA 2QHXA 2ZIEA 3O2JA 1EWQA 3NTQA 3AFIA 2L69A 2PIDA 1HT2E 4KI0A 1ZD9A 1H6AA 4PO8A 5F77A 3P19A 1T3SA 2R65A 3BTUA 4IYRA 3ETGA 1C7FA 1J8VA 2ACEA 2FW6A 1HKHA 3KFVA 3UKJA 3QLVA 3U9SA 4JVMA 1A9PA 4LDZA 5K0ZA 3HLKA 3MYRA 1B23P 2GLUA 3T0FA 2ZUTA 1P3JA 3I34X 1Y3DE 3L7AA 1L3IA 1CEXA 3NIGB 3CE9A 1KNQA 1OIWA 3O8RA 2FAXA 1BJTA 5JSKA 3IPRA 2CV1A 5B55A 2F8MA 3NRCA 4CV3A 3ROFA 4NAVA 1BHQ1 3VTKA 2P2NA 3MWFA 4KXNA 2UZAA 2R00C 2G82A 4L07A 2HZ7A 5LMNB 1VKNA 2BI4A 1VBFA 1IU9A 2EZ8A 2GNOA 2ZZKA 1KDRA 3CX6A 3DMTC 2ZUSA 5GZ3A 2GSDA 2UUAB 2J5QA 4JLVA 1WKVA 4JL8A 1PJRA 3TNJA 3DDUA 1GT91 3CLSD 3D5EA 3Q7PA 4M98A 1DO0A 3BJMA 1CD5A 4QEDA 2NSHA 2ZTUA 4X61A 4G5QA 4RDHA 5AW1A 3SZ3A 3O73A 1KQ3A 4JGBA 2A78A 4G5XA 4JHXA 2WUFA 5THXA 3W05A 2XBMA 3MCZA 3T4UA 2XUZA 4YJFA 1PBNA 2ONZA 5K6AA 4AKHA 2YQ5A 5AOCA 4DG5A 4TKVA 3LPLA 4NYMR 3A6PC 5JY1A 4O02B 1V7CA 4KJXA 4YRLA 2PAFA 1OREA 4GXTA 2LZ0A 2GK7A 5CEEA 2YZGA 2NZVG 1NW8A 1ZY2A 3G1WA 2ETXA 2D3WA 3PQ2A 2WJGA 2NX2A 3HA2A 4Z1MA 2IWHA 2XDAA 4YAJA 5DIFA 5K3EA 2F8LA 3D3EA 1EQ2A 1VE5A 2EFCB 2UYCA 2G4VA 1S5PA 4XYGA 4KCGA 2AOTB 4RLQA 3M89A 2NUAA 1BE8A 3DNFA 4KGDA 3AIIA 4NABA 4U7TB 2Y1KA 5GOTA 2GEKA 4D4JA 4QDKA 2Q27A 3G7SA 1XZCA 4DXDA 2XTNA 4B48A 4JJ6A 3PFCA 2HQBA 2IEYA 3A9WA 1JAXA 3FZNA 4EKNB 3FFWA 2EVWX 4WCFC 4F9EA 1B0AA 2OFOA 2VYVD 1D1SA 5A2QA 3USES 5FAKA 5JPDA 1EFCA 4RVSA 2O8FA 4MQLA 3MRXA 3DQPA 1QHHB 5JLJA 2LWIA 4D9EA 1VL1A 2Q6LA 2ATEA 3DE2X 3HBFA 3R2JA 4BKUA 3EC2A 5DBIA 4AI6A 2WF7A 1RQRA 1ECBA 4E7OA 5F5NA 4MS3A 4P9NA 4LBYA 2WY2D 1UPBA 3RK4A 4D82A 1QU2A 2C2OA 1XZLA 1X7XA 3ZNQA 2M6SA 2QAGB 3C8UA 1CZUA 4DRYA 2OCYC 3UTCA 1R8XA 3SR0A 5A5FA 4HQKA 3JU3A 5LYJF 3GG9A 4TQ9A 5E0KB 1T4DA 3N8IA 9LDTA 4W5HA 1FU4A 2JDIA 1BXRA 2MSNA 4GMXA 1NU8A 2QVYX 2X2PA 4DIOA 5D6OA 5I9LA 4DEVA 1Q0ZA 3L41A 5C35A 5FJJA 1YZ3A 2Q28A 2P5UA 5BN1A 3H2SA 2OCXA 2BFCB 1W73A 1GPNA 4IZ6A 4WQMA 1ZA2A 3RK0A 3KHTA 3QLUA 1RMQA 3M6FA 4LRSB 2ZE5A 1EP3B 2Y92A 5GM1A 3WRWA 4KMSA 1YUMA 1T35A 5BN5B 4G56A 3VC1A 2JLBA 5C5CA 5C8YB 1GAQA 3V7UA 1U2DA 3DBOB 2I8CA 1R0BA 3GCXA 5L7TA 3M6IA 4TWZA 4YQFA 2X0JA 1W75A 1PE0A 3V4VB 1EFRA 1V95A 1XKLA 3SYMA 1G8KA 2LDBA 3FBWA 3T3OA 3B2EA 3L8CA 1JFRA 1SOAA 1PX0A 1DG1G 1Q91A 2F1IA 4XD7D 3RIEA 1GTRA 1SK8A 1C80A 4NYMQ 3G8AA 3MIZA 3VFDA 3AVTA 4K87A 1JIIA 2KQUA 4CEIB 1D6NA 1R9MA 3G2OA 4HDRA 3V1KA 3OIFA 1KEZA 2P40A 3EQ2A 4G81A 3CXRA 4ID3A 1DC7A 3F46A 3ND7A 2FMIA 2QNRA 1N8TA 4E46A 2VHYA 3L2OB 3BCUA 1BX3A 1L4MA 2RK4A 2QD4A 2PUFA 2ZI9A 3PQ6A 3QQ5A 4QUEA 1UDRA 4AF6A 1POWA 4CL3A 3IHWA 4GNKA 2V9PA 4DJEC 1PP4A 3QUBA 1FRVA 1OIXA 1HTWA 1NJ6A 1QM5A 1M6YA 1U2ZA 1WVGA 1ZCBA 3BQNB 3FIJA 1E6UA 4FHCA 4AICA 3TFOA 2A9KA 1CZHA 1ZRMA 2A1IA 2JANA 2OK8A 5LR6A 3DYBA 5F7ZA 2XZPA 2WF6A 4ERNA 3ORYA 1P1KA 3ZWWA 1NU6A 4JBXA 4FJ1A 3TRFA 3IAS1 1IBCA 2PX0A 5GVSA 4G1CA 1VI6A 4RS3A 2HMTA 2AFHA 3U37A 1J7JA 3DZIA 4CMAA 1D1PA 1C9MA 1VB3A 1D4ZA 3PC6A 4U7WA 5LN1A 1E59A 1XE3A 1LWOA 1KO1A 2GXQA 2CF6A 2JVKA 4C4TA 4QVIA 1MQAA 1G17A 1JQEA 1L6IA 4LHSA 4UHEA 1W0JD 1JVNA 1EH5A 1WB5A 3MEQA 4JODA 2WZCA 2PFGA 3VJMA 1Q11A 1S9HA 5ULLA 1TD9A 2YIVX 3AP3A 3RSZA 3PXCX 4I4TA 3OOSA 4JP3A 5BW6B 3OFNA 2Z6AA 1WEKA 2H54A 1C7QA 2FPKA 4I66A 2ARKA 4ZRNA 2NVUB 4BC1A 5AK5A 3RR2A 4ER0A 4ZGBA 1NUSA 1BKSB 2OG2A 1QCZA 5AVXA 1PGQA 4RCYA 1GU0A 2H3HA 1Z4NA 4KR0A 1CYDA 2CLCX 1WZIA 1VYUA 4DCOA 2OESA 4Q4CA 1W76A 4YCAA 4RSHA 3WFIA 1Z28A 3FXAA 3ELUA 3QE4A 4KPGA 3RC9A 3ZDEA 1AZTA 2YQZA 4KQ6A 1MEJA 2WFLA 3VMMA 4UARA 1M0EA 4WLUA 2AN9A 3IEXA 3QUSA 1UJBA 1VJ0A 4G5YA 4W82A 2ISSD 4D4KA 1H42A 3PFGA 1S8FA 3U44B 3H4MA 4LMRA 3KUCA 5EWJA 5K51A 3HDHA 1XDSA 3X1WA 5LUAA 2VTBB 2HLPA 1HQYE 4QFMA 3GZTB 1GD1O 4ML3A 1L8AA 1RZRD 1JFSA 1N0UA 3MCWA 3CEAA 4X54A 1G21A 2YZ7A 1ZJ5A 2REQA 3JATB 3CLTC 3AEYA 1HGXA 4MH0R 3HCAA 4RF5A 5CM9C 1G18A 5DLPA 5JWOA 2QS9A 3AM5A 2AOWA 4Q3AA 1RHMA 1OKKA 1TJ5A 2DMRA 4IGIA 4OHOA 2JFZA 1AZWA 3A32A 1NPDA 1JFVA 3MIIA 3R6WA 5JAOA 4HQLA 3HZHA 1DTWB 3K96A 4WN9A 5FWAA 3UJ8A 4FQ8A 4KDFA 4GYKA 5JAZA 5LB2A 3IJRA 1WVMA 1X7YA 2OGUA 5KDOA 1D6SA 1QMGA 4B2LA 4A1FA 5L3QB 1FYEA 1U8XX 5I7HA 4F9TA 1JS1X 1NYQA 3QELB 1V16B 4J3NA 2O19A 4AY3A 1O0CA 1RI4A 1G8SA 2W42A 2OB2A 3QX7A 1TU4A 5G3ZA 4AUNA 1ADYA 1SEVA 4J29A 3KQQA 5AICA 1YVPA 4LZJA 2HSWA 3ORRA 5C7OO 4YONB 5ALDA 2BJWA 1YS4A 2R44A 1CJUC 3CQ9A 3FDIA 1WUHS 3I23A 4IP0A 1WCIB 3QY9A 4X1YB 3U17A 3EVAA 1P7PA 3I5AA 3HJUA 3PVSA 1K98A 1RFGE 4KRXA 4EJMA 1RPZA 2FK8A 3E7WA 3J7TA 5IKMA 1B0PA 3SJBA 3VZBA 2RI1A 1T0JB 3PU6A 1ES9A 3GDFA 3CWCA 4Q9JA 1SM4A 2D0IA 1XNGA 1YZNA 2Q5JA 1DJPA 4MV6A 5DH9A 4Z54A 2Q99A 4OGWA 1NVMB 3BFKA 1U6IA 2IUYA 1TUGA 1EVZA 2A94A 3RVLA 1SWWA 5F9FA 3TDMA 1NBEA 2HF9A 4E09A 1OROA 3TW8B 1XD8A 3QTTA 3ZZ1A 1R6BX 2XA9A 4B34A 1MPTA 1T0IA 3KU4A 1SIBE 1SXJC 4BASA 4EJ6A 5GJCA 3I6QA 2VAVA 4ZVTA 2AZXA 1U3VA 2PT7A 2BGKA 4RC9A 4RPJA 1H85A 4JB2A 2PMWB 1M1YB 2GN2A 1F2TA 4B73A 1ZGGA 5ALZA 4DR1B 3CLTD 2DB3A 1K06A 2V4UA 4TGLA 1AA6A 4H7IA 3VXKA 1IULA 4LXTA 1YDGA 1IAQA 4TWRA 5KTTA 4AUMA 2VF4X 2BGLA 3CPJB 3A6DA 1UKAA 3AO0B 2XH8A 3BMCB 5EWMB 1CJSA 1KVTA 3GROA 4YN3A 4BU0A 3GUVA 3WIUA 3FPJA 2V74B 1NPTO 3VQTA 4OLBA 5BUQA 1YS7A 2GEVA 4AROA 2QTNA 2XHEA 2YXPX 1QCYA 3GQBB 4HVTA 4KR2A 2J85A 4YPFA 3IVXA 1P2VA 3CZMA 3HCFA 1RC0A 1YZTA 4QBFA 1QP8A 5I9IA 1ZUWA 2XE8A 4CQLA 2C7RA 2JLYA 1IEWA 5B3JA 4ZANA 1JG7A 4RVCA 5H8WA 3R9XA 5I9TA 1Y1SA 3JAWA 2EGUA 2QYTA 3QKSB 3N8NA 5LLDA 2BFNA 3H8JA 3AM4A 2FKNA 5KYTA 5LJLA 3MAJA 3DEAA 3WDMA 2CNWA 5IC6A 3MOGA 3WDKA 2B1JA 2H1SA 3NX4A 5I7WA 1U31A 4JQZA 5BRNA 2JFWA 4CF3A 5EXXA 2NUTA 5JD5A 4YRJA 1SD1A 5IWCA 3D8NA 4J7AA 1KMQA 1Z18A 1W8DA 2WJWA 3FUXA 2CNNA 5AM4A 3F7MA 3LPAA 1FDOA 1B8VA 2VRWA 3ED5A 5KHOC 1OB5A 3F4BA 3PL1A 3L1JA 1LBEA 3QBJA 2YN2A 4URHA 3MJFA 4EYEA 4JUCA 2WNHA 4AY5A 3KWFA 1TAUA 3K35A 3ZQUA 1J09A 4PSDA 3JARA 3CU5A 4JB3A 2FNAA 2OXIA 4P2GA 4RGBA 5HE9A 4UQLA 5LD2C 1QRDA 3IXQA 4EBFA 2IS6A 3D0KA 4BIMA 2DHDA 3P20A 1K8RA 1CQXA 3JSXA 3WJ1A 1P2UA 3TSYA 2O52A 2P5TB 2OCDA 2WSYB 4FDLA 4OGLA 5FLEX 2ZWPA 5AKIA 1GQSA 1YGPA 3ACCA 4O1MA 5GV7A 2M32A 4RSRA 4RK0A 2N47A 5J2UB 1B14A 3U4GA 5EHZA 4RKFA 1CF4A 2LVBA 2X22A 3NLLA 1Z5OA 4J91A 2XYGA 4L4YA 5JTTA 1DRJA 1AURA 1ONPA 4Q3NA 4CM5A 3C3EA 1JEQB 5ECDA 4L8GA 1ZCJA 5B6JA 3EXG2 1BNCA 3KKMA 2PXHA 3H97A 2C9BA 4LRYA 2Z83A 4CLOB 3FZGA 4QNMA 3V1NA 5FXMA 4G23A 4D45A 5FA6A 5KOHA 2HD4A 1PJLA 5I4BA 1NTRA 1V7QA 4O4IB 4NH4A 4RSMA 1EVKA 2FN4A 3O92A 3R7WB 3VPAA 2H31A 4JLJA 2O07A 3ZY3A 2P9FA 4NIMA 4RE5A 2FJ0A 4A91A 4B8ZA 1O0SA 2MJLA 3FYHA 3L0CA 3L7OA 4C08A 2E0IA 3GEPA 5DNAA 3QI2A 1HORA 3ZWCA 1V6AA 3O82A 1VG0B 1DWPA 4IEIA 1E3QA 1TMKA 2HCRA 4JLUA 4ND4A 4RKYA 3RIGA 4DSNA 1AGXA 4U4AA 4EMSA 1QYWA 2N1BA 1DBQA 5H70A 1XRSB 4IQFA 1UMCB 3I45A 3QJGA 4K9QA 2NV0A 1N4DA 4KITB 1UDXA 2GPJA 1OBFO 3R3YA 3U3DA 5AUQA 1K5HA 4Y67A 5D00A 1A9XB 2H7VA 3I2JA 5EG5A 1RKVA 4Y2YA 2BE7A 4YPVA 3SOPA 3QX8A 4QPCA 3L4BA 2ODQA 2PNFA 3RNOA 3S2YA 3AJ8A 2M6KA 2I3GA 3GU3A 4C5AA 2C07A 4URXR 4L57A 2BSAA 1PWEA 2VHCA 3KYJB 1T29A 4XWTA 2DUWA 3M70A 2IDJA 2O20A 4KAAA 5C7YA 1XZBA 4PSUA 3ETJA 3SIXA 1QOZA 2NU9B 4DCMA 2XE6A 1DKUA 3A2NA 3NFRA 1OWOA 2C7PA 5BNWA 2BMWA 2C88A 2VP0A 4DV7B 3BIFA 3OLWA 5BWLA 4KTVE 2QPAA 3E9DA 5B57C 3DKIA 4UE6A 2X4DA 3FTEA 5DIZA 3SLKA 3ZQKA 5F2EA 1NJGA 5BRJA 2BGUA 3G6KA 1BXGB 5EIAA 4O4HF 3I01A 2P4UA 4FSHA 1ADCA 3DFMA 3E22B 3H11A 1E60A 2ADFA 3OT1A 4MIYA 1QRUA 2Z9BA 1NLZA 4FN4A 4UVIA 4ZQCB 1SG6A 1F2UA 1H4VB 3E7PA 1VKZA 4XIGS 5FTNA 4GEKA 5DYTA 4EHFA 1ZGCA 1IPHA 2H9IA 2BKUA 4HZUB 3SZGA 3ZLVA 3AY3A 2AZDA 1W4RA 1Z4JA 4DPKA 1MAUA 2D00A 5FL7A 4WCVA 3BCHA 1QK3A 4GP6A 1BRMA 1PGNA 4I6JA 4N1AA 4GNRA 4E5MA 3DMDA 3ZJ5A 2CK3D 4F3NA 1E1YA 4KXVA 4EFMA 1E1DA 3UXHA 3Q7EA 1EWKA 2PKRA 3GJSA 3HB9A 1D2GA 4JI3B 4G0MA 4Q34A 4R84A 5FOSA 3AUKA 2FETA 6ADHA 1Q7TA 2DETA 1DI0A 4YBRA 1VP9A 1H8HD 3A6FA 4PYNA 2HFJA 2I2AA 5K0FA 4WUTA 2FSHA 4JP5A 2ZS9A 4JLNA 2VTEA 3AVQA 5AKKA 3PRYA 3WE7A 1V5IA 1BVYF 3MTJA 3ZXUB 4LSGA 1KRXA 5LOVB 1GFSA 1J8FA 4N3BA 1BZYA 4RULA 1YR6A 1MO3A 3IBSA 1ZRNA 3A04A 5TS2A 5DI9A 2EP8A 1F1BA 5F3WB 3G9XA 2V3VA 3FNBA 4Q00A 4CIYA 1V25A 3GP5A 1YMQA 2OZLA 2VBIA 4EARA 3AWDA 1S8OA 1YJCA 2QAGC 3VKGA 1LI7A 3RS0A 4CM9A 5BXYA 4ZI5A 4RTKA 1Z7YA 3LSTA 2DQZA 2L17A 4R68A 1JNYA 4F86A 2XMZA 3NGMA 1U7UA 3U7QB 2GZHA 1E5DA 1VC2A 4KXXA 3B3AA 3B2QA 3C14C 1FP4A 3PHGA 1JU4A 3M6LA 4YMLA 3CLKA 2II6A 2WAYA 4LZOA 1W36B 2P7IA 1LV7A 1GGNA 2B9EA 2BISA 1M5RA 1QV7A 4WZBA 3FHLA 5KC8A 1ZXBA 1F51E 4YUWA 4QXAA 3LKBA 1L7AA 3E1KA 3H3XA 4GKJB 1Y5MA 3RYIA 2J0EA 2D7JA 1WF6A 4KQMA 1OLOA 1S4MA 2GYWA 1XEXA 3DBIA 3OQBA 5AOBA 3OIUA 2WEKA 5IM4A 2GBLC 4EG7A 1T26A 1F0KA 1LTHR 5I51A 3OAAA 3VR2A 1XSEA 2J6BA 3K2QA 3KOOA 3CYFA 3M4ZA 5F2NA 5JDIC 3EIFA 3L0ZA 3O2NA 3KZOA 2EARA 1N6PA 4QKQA 2DBYA 1EDOA 4PHFA 3QE3A 4QOHA 3HKBA 4GZLA 3H7IA 4LC0A 1JDJA 3GDHA 4FKMA 4TRJA 3CRMA 3NBZC 5E8RA 4BMVA 3BTVA 3VPSA 4J2HA 4QGAA 1SQSA 2QRJA 1N2BA 2QRUA 2ZT7A 2ZSFA 1MORA 1D2RA 1T10A 1FVOA 2P3SA 2PGXA 3C3BA 1JR3E 3HE3A 3HNPA 3O9ZA 2FHPA 2H85A 4MUGA 2WUWE 4BQEA 1NXWA 5HRAA 2YJ4A 5IYZB 1ZH6A 2HXYA 3K15A 1BWSA 4N47A 3ZXYA 1FFAA 2I8AA 5TPWB 3K9QO 3F0TA 4CKEA 4G2NA 3LRXA 4I5IA 4DCVA 2C0CA 1LU9A 1MAWA 1DT5A 1FJHA 1HEUA 1GILA 4IOLA 5CCEA 2CLFB 1EBBA 3KOZA 2ALJA 1Z4MA 4NZPA 2XRZA 3G13A 5DX0A 5JNWA 2GCOB 5JZBA 1VPDA 1D8AA 1I24A 3BXZA 2ZPAA 4ZXFA 2Y27A 3AEQA 3OJWA 4JT9A 4D02A 1IQRA 3DTVA 3KKEA 5DK6A 5IANA 4ZGWA 5C4IA 1MW8X 1KOGA 2ZRHA 2X4IA 2OKCA 3JYPA 4H4CA 4TROA 4R51A 4ESOA 2ZYIA 1PUXA 2XMDA 2JJ2D 1N3YA 2FH5B 3BMNA 3N70A 4XDYA 5KTKA 5LNK1 3HGMA 3AJAA 5UKDA 5HHTA 4DB2A 4RIEA 3QMWA 4TTTS 5LCXA 5KAPA 1O0BA 3NUZA 2VK8A 3PKZA 4X1KB 1DJLA 2CCGA 1NM5C 5HDBB 5IF9A 4PC3A 4DUZB 4B75A 5DB4A 1ENOA 5IBRA 4ZRDA 3R23A 1HLPA 2W2VA 2C1ZA 4M1TA 3CJQA 1Z22A 4AZ3A 4XTRA 4PBSA 2OSVA 3VA7A 1NNEA 1HQCA 1PVVA 2Q4TA 4DXAA 3AY0A 3FVVA 1E64A 3QU5A 1FUYB 3DXZA 3UMYA 5DGDA 3WI7A 4Q93A 3SS9X 3WL7A 3WLSA 3CV3A 3E9YA 4NNOA 4YCJA 4PRZA 1CZNA 1HDCA 3LCCA 5MN4A 2W2NA 1HNNA 5D87A 5ALUA 4OU5A 3ZCVA 3PLRA 3H6GA 4IQ4A 3IKMB 2PV7A 3LQ4A 1OX4B 1IYZA 1GA1A 1VE9A 2B83A 2J3MA 3ECAA 3EWAA 3K16A 4RQAA 5T64A 4A0QA 1Z25A 2UZ0A 3HA3A 4AZWA 9LDBA 3OQIA 3N2NA 4OA5A 2AN3A 1BN7A 3ELYA 1NW5A 1TAQA 4QOSA 2IDMA 3R5JA 3GF4A 2DECA 1PGOA 1MJGM 2PZGA 2YHIB 4KXWA 4C14A 2R85A 1IBLB 4G65A 1X0VA 4FDVA 5FO1A 3WQQA 5LYJB 4D41A 2W0MA 2NTNA 4M1OA 4CPDA 4CETA 2F59A 2EX0A 5GOZA 1I6LA 2HLNA 3N8KA 4EKDA 4LJKA 5ECWA 4JSRA 2X58A 1ZL2A 3BPSA 2AYYA 3B3JA 5F7XA 1YFLA 1VE3A 4E13A 2QD5A 2C00A 1CU1A 3DMRA 2HNBA 5H68A 1ONSA 1G59A 2OQIA 2LP4Y 4NICA 4XUEA 2ZSIA 1MXFA 2FZ5A 3WZLA 3D8SA 4BLWA 2BHSA 1O5TA 2FG7C 5CTJA 3WK4A 3NYRA 2JFFA 1M33A 3I72A 3MHTA 3OZXA 4R5HA 1U7OA 1Q1EA 1F4VA 3T4XA 4JDUA 4RZHA 2PZJA 5J3JA 2DVMA 1GCIA 3K9GA 3UOGA 4B1FA 2R6GA 3LH5A 4HTFA 3AEZA 4Q1AA 2FG5A 2ZYDA 2PZMA 2IOYA 3NS7A 3W77A 1ONBA 3CHYA 1ABEA 1I01A 5JCXA 4R8LA 1JL3A 3KYDB 3O4VA 1O95A 3BHIA 1GTZA 2JLQA 1LXCA 3GGCA 3K1JA 4WZAA 1E98A 5CH3A 4UTOA 4PGFA 4ENSA 1YI1A 3B6ZA 4MDHA 1GUZA 4S1TA 5IN4A 4G85A 4TS1A 4CDGA 1NVDA 4NE2A 3LE8A 4NV1A 1QHIA 1MAAA 3OJOA 4PZCA 5I5GA 4ZZ3A 3F7TA 1HZZC 1N9KA 2POQX 3ETCA 3IE0A 2HHCA 2ZUVA 2OGZA 1F48A 1U3TA 3PA6A 1A7UA 5A04A 3FY4A 5EE9A 3GFTA 2C2BA 2C4NA 1E1CA 5H7XA 3ZK8A 4EMUA 4IZIA 1P60A 4MGKR 3C15C 4N7RA 2Y1WA 3SNHA 5C37A 4ZT4A 2X9GA 4MUKA 3PFNA 3QYPA 2YUIA 3U7FB 5K5EA 4LSMA 2JLZA 2PTHA 4YMSA 2PGDA 2IS1A 2QD1A 2QE7D 3IODA 3DZDA 3V6MA 2P9TA 1K4KA 2ZQYA 4CR8A 1O77A 5HWSA 1ZEJA 2O8EB 1GNRA 1OV6A 4H3SA 3AJDA 1G8GA 2WM3A 2HSGA 3D2CA 3LOQA 4R8MA 4G86A 2ZR9A 5BVGB 3K32A 1AJEA 1SOWA 5D3KA 1S8NA 1UXHA 4U7HA 2PWYA 4ZT6A 3TR5A 3FTNA 5KSWB 3SG0A 2J4FA 3TZKA 4JB0A 1CYEA 4QGBA 1B2LA 2W6ZA 1DMSA 1PL7A 3H9JA 4D4MA 4QYWA 1BX1A 2H11A 2YXEA 4EJSA 4RAQA 4RMHA 1QV9A 3IUBA 4DREA 3UYKA 4RYLA 1OCEA 3W5HA 1I7DA 1RE1A 4EZBA 1K63A 2X0IA 3SOZA 3HUUA 3SYRA 2I1QA 3TH5A 2IRWA 4GG1A 1OTXA 2JFNA 4R05A 3TYXA 2EL7A 3QE2A 1DPFA 5AHWA 5CU7A 2HEIA 3VZPA 3DYVA 4F5WA 2JFUA 3S55A 1E5XA 3D7RA 3DD1A 1HOTA 1ZONA 4HNUA 4PYIA 1ADJA 3BMXA 3BD8A 1QPZA 4YMIA 3WQHA 4BZXA 5M04A 2Y1GA 1F3LA 2FSIA 2W90A 1U8TA 1YBHA 4GGOA 5I8WA 2EBWA 3GLQA 2VYQA 1Y4SA 2WW8A 2NO0A 2PX5A 1KQPA 2GVZC 4G0ZA 2HIAA 1P2SA 1MQ9A 3VDQA 2A4KA 2CNBA 1TVEA 1UEJA 2QTWB 1MVOA 4I46A 1MO6A 1IZYA 3JCZA 1B0UA 2I2CA 3BEOA 2SICE 3GLVA 3I9OA 4R2XA 5C1BA 3PNPA 2HPVA 4HRYA 1WP9A 2JCGA 5ELLA 3ANLA 1TCCA 1UF9A 1JQJC 1LNSA 3O21A 4D8TA 3D7LA 4DT1A 3GP8A 3K8OE 4M1QA 2CKMA 3FOWA 4IR7A 3IR6A 2R8ZA 4M6WA 3KSBC 4V0RA 1U6JA 4GLFA 1KI6B 3OZFA 1A3CA 2BUBA 1MG0A 1U4SA 2HA4A 2YVLA 3URMA 1KF0A 1IOZA 2H9AA 1BW9A 1XTKA 3UJPA 4QUJA 4WGGA 1XYGA 5AHOA 3U4QB 4CFYA 4EX6A 2ZPUA 2E48A 4DMFA 4HGYA 3QFHA 4H0NA 1TCBA 4CHGA 5BN3A 3QVLA 4UBLA 1ONNA 3L0OA 1ISMA 2B4QA 3QVXA 2SCUB 1OD6A 1TLLA 1NSFA 1BXKA 4YDHB 2FEPA 4DBZA 2ZIXA 2XDQB 4PG4A 1UOOA 1PJTA 2D2EA 4MOWA 2FN3A 3NR2A 3WGKA 4FWTA 1BCRB 4PZAA 1IMOA 3RRJA 4RACA 2Y0BA 2O0KA 4BP8A 2CNDA 1ZD1A 4JI2B 3KR0A 2RAPA 3AF0A 4LYYA 4NCJA 1OASA 6ABPA 4Y9DA 2J32A 1XNRB 2CUKA 2XNKA 3MJTA 2ZM5A 2EJCA 1Y3CE 3KEGA 4GM1A 1OAOA 4ZHQF 4FHZA 4P83A 3EDYA 3DZJA 4ZXPA 5HFNA 1SVWA 1GARA 2RHOA 1YJ5A 2L42A 1YR8A 2IUTA 3CGGA 1ZH2A 2V6FA 3K0CC 3UTDA 3E3LA 1U3GA 3GAMA 4XPIB 5EP1A 1R8SA 3M1LA 1RM4A 3LA6A 2G9VA 2JKYA 5KNCA 3NNDA 1PO7A 3AVUA 521PA 1E92A 1E5QA 1ORVA 3MGKA 5J5AA 4BQPA 4G09A 1SB8A 3O8OB 4LZPA 2XVMA 3Q7IA 1QGUB 1ZEMA 1Q6ZA 1ZFNA 2X40A 4B4KA 1UM9A 1R5NA 4RL4A 1QCDA 4IXWA 2JNWA 5HIMA 5T6MA 3MWDA 4G1BA 2BSXA 4J0GA 3T61A 5HTKA 1OBVA 2ZRKA 4GXNA 4JXKA 3UIEA 3C7KA 4C7XA 3D7NA 4XWGA 3KT6A 3JASB 4PFSA 4DIUA 4UE2A 2QNIA 2NAFA 3GVPA 3WDLA 5IUNC 3GG2A 3WLKX 2HK9A 3KVVA 3ENZA 3GJ8A 1AH2A 2AS0A 1JUDA 4KQCA 5B7GA 3WR5A 4IDEA 4Q18A 3RC3A 3VDRA 4DIEA 4PYJA 3P9NA 2Y68A 1PJSA 4FYPA 1H9BA 4ZFNA 4X71A 3WL8A 1AQLA 1DX9A 4QOIA 5JMOA 4YHHB 3WG9A 2B0CA 3L0YA 1JIJA 3IKTA 4ATNA 4Q9NA 2I7TA 3RUDA 3HJCA 3HZOA 4P98A 1KQOA 2DH5A 1XDUA 1P77A 4PEVA 4G25A 4Z4EA 3BJRA 5INTA 3QXJA 1NDUA 2HM7A 1ZX1A 2GUWA 2JD2A 2YRFA 1G64A 3BZUA 2CHFA 4ITUA 3FVTA 3MM4A 2FWBA 4L27A 5D7NA 4B4DA 4HNGA 4DT1B 3Q8MA 2WHEA 4CXMA 4IHJB 3ESZA 3HRKA 4DLYA 1ORIA 4U7FA 3O6VA 4QO7A 1EFVB 1UADA 5DCYA 2YUTA 3A11A 3IDAA 1NF3A 4I8XA 1QG2A 2APJA 1HRKA 4XLZA 3V1UA 3V2IA 4B6GA 1DZ3A 2G0TA 3UO8B 2NU8A 1UBEA 4K6KA 1JDTA 3OEHD 2C5AA 2XMQA 5EINA 3T5MA 3E2IA 3WGOA 3U4IA 1WM1A 3KSRA 4OQXA 4AWBA 2QLLA 3PD1A 3MRTA 1A4XA 3OOJA 1DWQA 1T8RA 5A4KA 1RT9A 1LTKA 2GZSA 5E0OA 1RYFA 1ATIA 4PZPA 1MX5A 3RVBA 4BVLA 2ZW9A 4UDXX 4ZU6X 3G0IA 4MVJI 3KYIB 3RJMA 3JZAA 3EBOA 3T7TA 2R4TA 4V0OA 3VZRA 1DKOA 1YA8A 2H06A 3PWZA 3I4FA 4K9SA 3FWPA 1PNTA 5FULA 2J30A 4Z0PA 3KXKA 1WAMA 3F3SA 3KVOA 2H48A 4BLOA 1BSVA 2A5LA 2X15A 2PX3A 1E2UA 1AUXA 2A9JA 3DE4X 3CKYA 1CZOA 2A5JA 5ELMA 2X8AA 3SBXA 3TLCA 1A7KA 4LPKA 4OXXA 4ZO6A 3U3MA 5HSGA 5JFOA 4W5JA 2GRAA 2G6BA 4MVJH 2ZUEA 2EAUA 3ZW8A 4WNIA 4MB2A 1NW7A 2JGNA 1EVJA 3Q8KA 3KE9A 4CT5A 3MF4A 3K31A 2J3IA 2VP2A 3IAM1 1Z06A 2P2LA 3PKJA 3FMPB 2QXTA 4R1TA 1CUHA 3WLHA 1EJ0A 3BA1A 2OBFA 3GJ4A 3LOUA 3T5TA 2HAEA 2UUBB 2QM7A 1TO2E 2ZAYA 3JD2A 2TMYA 4OTZA 5HW0A 2GPYA 3AINA 4DTIA 3ZZNA 2ZIGA 4NDNE 4MWOA 4GPZA 3OZSA 2XXJA 7MHTA 4AKGA 2CDAA 4EX7A 4PM4A 3HWWA 1KHHA 4HS9A 4HFNA 5KJEA 3QVMA 3GLFE 1E4EB 3IJ5A 3U19A 5CDTA 2V65A 4G5GA 4HUQA 1M83A 5AJVB 3UATA 2PQMA 2Q9CA 1RLMA 2Z58A 2J08A 2BV3A 1L7VC 3FDZA 3T9AA 1EVQA 3W6UA 2V0GA 3WGLA 2IITA 1O7JA 2X5JO 2X5NA 4QXRA 3R3WA 1RRVA 1XEWY 2ACKA 5IU6A 3T1HB 1ZD2P 1VL5A 3KIPA 1EDZA 5F9MA 4ER3A 1A04A 1YB2A 1YRAA 3BE5A 1VP3A 2C95A 3T8YA 3D59A 3MXTA 5E3IA 4LYJA 2VDKB 5T8KA 1F06A 2G9UA 2G0AA 2Q4OA 3MUOA 4AJOA 4EL0A 4QJ4A 5K05A 5B53A 1FOEB 4ND1A 4E2ZA 1DL5A 3QLJA 2EJUA 4EGAA 1YS1X 2PJZA 5CB4F 2ODAA 2ABWA 1T5BA 4UUPA 1OXTA 4KQHA 1M2VB 4IAOA 4WLOA 4P7BA 1BVHA 4M54A 1QWSA 1MC5A 1LPSA 2V7UA 2FW1A 3C16C 3DDZX 3CMMA 4JZKA 4PX2A 2JFBA 4WDRA 1OFUA 4MDFA 2RK6A 1T9DA 2Q2OA 2Z2ZA 3PFBA 2BMFA 2RHWA 3MBKA 5E4YA 2PKYX 5ESDA 2O8BB 1IL0A 2Y0PA 5CK4A 5EQJB 1EHIA 3ZZUA 1F0PA 1OTYA 3UKOA 3FVQA 4D3SA 3W78A 2PUGA 5DHPA 1M9NA 1CRQA 1HYEA 4J75A 3STXA 3W90A 4DBVO 2E49A 4C2TA 4XX0B 2BMEA 3EIOA 1FXUA 3LFUA 4U9HS 2JIPA 3BFVA 4K9KA 4YB8A 1E3DA 4F9GA 4JMPA 3SHWA 3P9KA 3GNTA 1IJFA 2ZRFA 4O4HB 2QGFA 4KQ9A 3HL4A 4NNPA 5J2TA 3PNMA 3B9PA 3EHDA 3M83A 2BKEA 4Z99A 3RJ9A 4ZICA 5IG2A 1C1YA 2O8DB 4JUDX 1LRJA 4A7PA 1PR1A 1LB1B 1HK7A 5AXAA 5DTIA 1T2EA 3H0KA 3DE6X 3U4HA 4PONA 4FB5A 4RHXA 4U7DA 4JI7B 1J4AA 3IP5A 1XJ0A 3ZEIA 2Q21A 1BHSA 2YJNA 2JLRA 4HN2A 2D3TA 4D7AA 1UMDA 2FEKA 3AR5A 4XM0A 3OECA 1XA4A 4UTPA 1AIPA 3AFGA 4QIHA 4Z9FA 2XSZA 5G02A 3RU7A 1V37A 3TQHA 4GR5A 1LW7A 1M75A 3LKVA 1ZN2A 3LRPA 3W9UA 1RXSA 1XZJA 3J7AC 2CXTA 4FW9A 3UK0A 2ZCUA 5AM5A 4CM8B 4PLWA 3KQMA 3UAOA 5IVKA 3RVRA 3E48A 1FDRA 2FU5C 1QS0A 2YYAA 2ZTSA 2ZJAA 1BU8A 1YKSA 5ENVA 2V45A 3TQRA 1QFYA 2D2VA 3H04A 3I76A 1H5NA 3DTYA 2R8OA 3N87A 4IWXA 1GWNA 1EFKA 5AOAA 4AC9A 2QXUA 2JHFA 1CQJB 1NT2A 2YH2A 3X1XA 3CY6A 3HFSA 5BUZA 5CG1A 2X6TA 4YRRA 3B70A 3SFZA 1SPXA 1VJDA 5G0SA 3ZGOA 1Z29A 4A2PA 4QPDA 4R1LA 4I6GA 4EG4A 5E6SA 2X6RA 3D3KA 4URYR 5TQ0A 2QTTA 3PHHA 3NHLA 1TRKA 3RYHB 2BP7A 1NN1A 5IJZA 2KE5A 3SQXA 3OZTA 2IYXA 3QPAA 4DBLE 3Q0TA 1X86B 5JAPA 4Z4GA 4JOCA 2GZMA 4DRXA 5IX8A 1P4JA 3G23A 2BPOA 3PEUA 2XGGA 4UCQA 3L5KA 3BIOA 2OYRA 3LDFA 2FZKA 2PUJA 4E11A 4EDFA 4P0QB 1XQ6A 1C1XB 1SCBA 3IAS6 3SBDA 4PANA 1EE9A 4D5GA 2ZBDA 1CUEA 3HP7A 3O93A 4BVKA 2A1UA 2J3EA 1NULA 1X14A 3RSLA 4RXTA 1OZAA 1AUOA 2CHUA 5BSRA 1Y80A 3U7JA 1Z7EA 4DIDA 1XCMA 1TCUA 4P5DA 2VCHA 1JTFA 3X43A 1ZD8A 4XARA 5FWXB 1C7RA 3GEBA 4DUGD 4WBNA 2OHFA 1A4UA 1J25A 1DELA 4FW8A 3S2EA 5LFAA 1QFJA 3GXBA 2MMGA 1VCNA 3LO8A 3AFHA 2B3DA 3B38A 4C89A 3VVLA 2Q8QA 5EI5A 4AZVA 4DLLA 4HNRA 4ZI3A 2YNMC 2C5EA 3Q88A 1Q2UA 2QJOA 1FTSA 2WYUA 3PJEA 4N82A 1BMDA 2R6HA 4BNDA 2ZUCA 4XR4A 4BMCA 4HD8A 4G8CA 5KNBD 1C3LA 1W1IA 1I4DD 2N9UA 2EF0A 3A1DA 3E2MA 1WXEA 2Z2IA 3EQ6A 4CYMA 5COBA 3ICPA 1RWMA 1H93A 4GOMD 4JK3A 4RM2A 4QYXA 4B6EA 4OKSA 4QAQA 4C6TA 4LXIA 3TG2A 2P6NA 4C0BA 5IZ4A 1P7WA 5EJ7A 3QV1A 2BHNA 1ZGZA 3QXHA 1O54A 3ZNNA 2VVTA 3D3WA 2YBDA 1L5YA 3HJGA 2HJRA 1LDEA 1NNSA 1E79A 4I8IA 4HDSB 4JJGA 3EUEA 4MAFA 1LF5A 1TUBB 3C3KA 2E18A 1Y63A 2P0EA 2VT7A 4KYTA 4V24A 2W2QA 4FYWA 5FB3A 1EXWA 4TN1A 2LGJA 2Q3BA 3I39X 2ZRBA 4A10A 3IFSA 2CCKA 2V4ZA 4BO2A 4EECA 2XXAB 3R74A 1B6TA 4C05A 3KQHA 4XM1A 5FBQB 1CHNA 3NEYA 5AVJA 2O8CB 4HPWA 2Z1DA 4FCVA 4XQCA 2G1PA 1Q0PA 1CRZA 4MPDA 1E1RD 2VCYA 1GZ4A 4J07A 3IS3A 2FFHA 4N3GA 5IBPA 1MABB 1KYYA 2ZDGA 3KT0A 4O1HA 3TLEA 4K6GA 2JAXA 1DT3A 2QTCA 4EY7A 1RP1A 4NZZA 3S29A 5HIKA 1IXKA 1JMKC 1BEZA 1F6WA 1YACA 2DPMA 2WM2A 3QUQA 4BUCA 1G16A 4YYZA 5SYAA 4MGYR 3F6SA 2GNAA 4N03A 4N8SA 3DAOA 3Q41A 4JH0A 4RD3A 1IB0A 4I55A 3WL3A 5FA8A 5A3JA 4MLCA 3LO5A 4ZOLF 1U90A 1BKYA 3MILA 3GLRA 3WRXA 3SMQA 2AN4A 3PIRA 4Q6WA 1B3RA 4RK6A 4RY9A 1Q0LA 4QLAA 1MOSA 2G9NA 3HMKA 1ZO8A 4RESA 4MYUA 5KYGA 3AKZA 1A69A 1VJCA 2R2GA 1DG9A 3ID6C 3SZRA 4BLSA 4GX2A 2FE4A 2RHHA 5EJIA 3LWNA 1BD3A 1LGYA 2UYQA 4Q4HA 3TF5A 2DBZA 3LK6A 3FKJA 2WT8A 4CMIA 3V4SA 5FBHA 1VHJA 3T9EA 2OYSA 4HFMA 1QQ6A 4KB5A 4RMGA 5FOUA 5CXQA 2FY8A 3FAZA 3FPHA 4AF8A 1XLWA 4ZQFA 3LF1A 4QNRA 4IXTA 5LBIA 2WJVA 1W2HA 4M87A 4X97A 4EA9A 5KOYA 2V7GA 3MQFA 4RH0A 5DWVA 3OKFA 3TECE 4Z53A 3M1AA 1GDHA 2QVBA 4OJMX 1VMAA 3QEMB 2F3SA 5JXWA 5K8IA 4C0AC 2VDMB 4IM7A 3GJYA 2HADA 4TT3A 5FBRB 5EHIA 1YDWA 2AFHE 1P7VA 3AHCA 4PTYA 3RTBA 4EFNA 3NVAA 2CDRA 4XQ0A 4R98A 4JL6A 2XVYA 1PT9A 4GPTA 4CN8A 4KE7A 4F1WA 2H4JA 2HFKA 1EM6A 1OU0A 1N2XA 1RRKA 1ZS9A 2ZIVB 3MN1A 1J9ZA 2PR2A 3HB7A 4KK3A 1H8ED 4AZTA 3CVVA 1VHWA 3TO5A 4MKGA 1RAFA 1V3VA 3CR8A 2N42A 3N28A 4S24A 4RF3A 2HA3A 3JD4A 2X0RA 3WLLA 5HMMA 2VWPA 4DA7A 3OE1A 4KQ1A 3HYRA 1KJ9A 2CJXA 1N5KA 1ZG3A 2BCEA 4FOOA 2P90A 3PC8C 2Q8PA 3TCXB 1I10A 3E9CA 2MMCA 3I6YA 4IQGA 3ZHRA 3I73A 1LFDB 1PYDA 3KCQA 1E3MA 2JGJA 4B81A 4I81A 4L28A 1A8SA 5F1PA 4OB7A 3R6TA 4MW9A 4N6NA 3TNYA 1J1ZA 1E2QA 4KUGA 4NU6A 5J9FA 4GLOA 2OBLA 3QX3A 3OEED 1JWAB 3KP1A 4IFTA 2QMEA 1UBFA 3GBPA 1GLVA 3V48A 1JDZA 5EPUA 1URPA 4B43A 2F4VB 2A0WA 3T1TA 4LDRA 4MP3A 1JT9A 1BMTA 1N1DA 4MQMA 3A31A 2I9KA 4MI6A 2XLCA 4LDPA 1UXJA 3VHLB 4YAKA 3HHPA 1UIMA 1PAUA 1YQXA 3JX9A 3LD9A 4GKBA 4J0DA 4II2A 2OV8A 2ATIA 1S02A 4PYOA 5ED0A 4DM3A 3VKHA 1THZA 4W1PA 4RZQA 3VZCA 3G8BA 2HDOA 2B25A 1M2HA 2GD2A 4NCKA 3WYGA 1TZKA 1FP2A 3DOCA 4QARA 4Q9DA 7ADHA 3ZLBA 4LHXA 3RSHA 3ZXIA 1NFQA 3R20A 1AOXA 2BTQA 1G21E 2CZQA 1W44A 1Z0ZA 2PWPA 3MGBA 4K6OA 4GP9A 2CXOA 1E6MA 4BVBA 4F72A 1VCIA 3TSWA 2Z9CA 5C2JB 1NSTA 3A9VA 3GRKA 2X76A 2E6KA 5LMZA 1EVEA 1VIDA 1RADA 4XOUA 3NP7A 1JKFA 1XKXA 3C74A 3H9GA 1SVUA 1OF1A 3Q5EA 4HRAA 5D84A 1YR9A 3A2MA 3WAGA 3T5BA 3KZNA 3QWAA 3LC1O 3KR9A 4E30A 3KB1A 4J49A 4MWSA 4EFKA 3E5MA 4R8KA 5JNSA 1C3JA 3FNQA 3SQMA 1EESA 1JH8A 1GPJA 4HLUC 4R2KA 2XHZA 2CYCA 4RF2A 1SO8A 2BCJQ 3D6MA 3MWEB 3QF7A 1J8DA 3ZHBA 5KTYA 2QG9A 5EJ9A 3PZBA 2AJ8A 1L9KA 1YIOA 1Y3HA 1SOUA 2GASA 1QHYA 3D64A 2NP7A 3CUUA 2PSEA 3IUEA 4R2MA 1NZJA 1OX5A 1FSFA 1PZGA 2QRHA 2V5VA 3CW2A 3LCJA 1PTJC 3CO5A 4KDRA 4QYTA 3T1NA 5ADHA 2P8SA 4X8OA 5DN9A 1M0SA 1FLDA 3R6DA 1XVIA 1NKSA 1CY2A 5KJFA 1J5XA 2IIPA 1UDBA 2QQEA 1LDNA 3WSWA 2YJ6A 3R6GA 3ORHA 3WLEA 4BNKA 3FFBA 1AB5A 3EPKA 4EW1A 4L5IA 1W1WA 1IZ8A 3MQ2A 4CM1A 3GJTA 1FUUA 1M7BA 5TF0A 4R1SA 1DLJA 2WU3A 4IGFA 1R0XA 5KWEA 1RWPA 4QU9A 1PWZA 3JTEA 1Q7BA 1W6RA 4BDSA 1PQWA 1ABFA 4WKNA 3TAUA 3TE6A 4BXOB 1V8DA 2J1LA 4JJEA 1K66A 3GR6A 2VZ9A 2FUEA 4GGPA 5IASA 1O5OA 3IUYA 2H1IA 3GV0A 4RLHA 2F9LA 1SVNA 1Y34E 1RI3A 3FSGD 1HDOA 3L7IA 2ILTA 3LIPA 3S28A 4BQFA 1TJ3A 2DSNA 3OD1A 3IR5A 4RD0A 4H7EA 1KYQA 4LXYA 3TR0A 1DBPA 5FFMA 3H1EA 5FUMA 4FFBB 4NEQA 1XXLA 4R2WA 4NLLA 3BDIA 1CS0A 4U1RA 4WX2B 4ZAXA 3HH8A 3BIJA 1CPYA 2G40A 3WL6A 1CETA 1Q3KA 1C8KA 1IHXA 4DLSA 1SQ6A 2QBYB 2Y77A 4MNTA 1PL0A 1EUYA 3HJFA 4Q7KA 3EYAA 4V39A 4UEOA 3HCOA 3UUFA 1VG8A 2ID7A 2VDWA 3SE0A 1V3TA 3L8ZA 1ACJA 3AOEC 3LL4A 5JXIA 1CE8B 1FTNA 3P32A 1N1EA 4O4JA 2HA5A 5AM2A 4AMVA 1M2OB 1YR3A 4D9IA 4ZDIA 4DQXA 1GGKA 2A58A 3ANTA 5CYPA 3VSBA 5EP3A 5IAAA 2ZYSA 3VAZA 3PNYA