1C4XA

2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
b'TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOATE HYDROLASE
molecule tags Hydrolase
source organism Rhodococcus sp.
publication title Three-Dimensional Structure of Microbial 2-Hydroxyl-6-Oxo-6-Phenylhexa-2,4- Dienoic Acid (Hpda) Hydrolase (Bphd Enzyme) from Rhodococcus Sp. Strain Rha1, in the Pcb Degradation Pathway
pubmed rcsb
total genus 92
structure length 281
sequence length 281
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 1999-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c4xA00
4J0KA 1E8DA 2HIHA 1QZ3A 3D2BA 4WY8A 2ONCA 1FFDA 1MN6A 4K5QA 4C4ZA 4NS4A 1LLFA 1OXMA 5AM0A 2DHEA 4ZWNA 4IHAA 1CUBA 2HA4A 3M81A 1HKHA 3ESCA 5JATA 5ALEA 4U2BA 3WQHA 2GZSA 3BL8A 3W2TA 4GLBA 3CCCA 2AJCA 3QH4A 1WM1A 4BVKA 1ZGCA 4RE5A 3BWXA 5AM2A 2WJ6A 2AJBA 5IVKA 2X5XA 4X7BA 1P0PA 2OQVA 5E4YA 1Y7HA 2WM2A 4I4CA 4DMCA 3C5WP 4H35A 3ZI7A 3B3QA 2QJWA 4W9RA 4IH9A 5ALNA 1E3QA 3WA6A 1Q84A 2VT7A 3HI4A 3WWOA 2CUTA 1CIJA 4FFWA 5CT9A 4B81A 2QUAA 1XRMA 1CUHA 3GUUA 4INZA 1XROA 1LZLA 4JEIA 4L72A 1EK2A 3R3UA 1YA4A 4ARAA 5AIBA 4OSEA 5D7BA 2ZSIA 5LIPA 4MEAA 4UBJA 4BC0A 3FVTA 3I2KA 4BYMA 2DHDA 1MX5A 1XLWA 2C0QA 2I03A 4KRXA 4Q1VA 3G9TA 1YR2A 5DTIA 4J03A 2AJDA 3NGMA 2WJ3A 1DU4A 2OAEA 3PE6A 4QEKA 4QWWA 1QIHA 4MWSA 3FSGD 1ZIXA 5EI5A 1J2EA 3DL4A 1QIDA 5DNUA 1CUEA 5FLKA 1XRLA 1JI3A 1YB6A 5AK3A 1EK1A 4FLFA 4QLAA 5IVHA 2HFKA 5T4BA 1O6FA 1SCIA 3C87A 4OPMA 5JZBA 1IZ8A 4DNQA 3W9BA 1XZJA 3EQ8A 4PNZA 1HPLA 4E14A 1FJ2A 4G9GA 3E4DA 5AI9A 3KXPA 5JD5A 3QZUA 3G0CA 4FBMA 2HU8A 4YASA 3W06A 1JJIA 4G8CA 2Y2UA 4ZV7A 2O2IA 3MUOA 4N8DA 4UHCA 1UWCA 1GGVA 1CLEA 3I1YA 3C8DA 2BUCA 4H18A 4HRXA 2YASA 2Z8XA 4B85A 4CFSA 5AKLA 1O6GA 1LGYA 2PSDA 5SYMA 3BJMA 1IUNA 2J4CA 1QIMA 4L9AA 1CR6A 1SCKA 3WKBA 4WCVA 4LYEA 1FFAA 4BDTA 4JUIA 1ACLA 1CUJA 3QPAA 2NW6A 3R40A 5I9IA 5DLPA 4J0CA 3BF8A 1XQVA 3OURA 1UT6A 3STXA 1K4YA 5K3FA 5FPQA 6YASA 4KE6A 5ALOA 4QA9A 5BWCA 1QO9A 1DX4A 4TPKA 4MYDA 1CVLA 2PU5A 2GYUA 3L1JA 2B9VA 1HDEA 4B7ZA 2EDAA 3HXKA 2OXEA 2QKYA 1AURA 1ZIYA 2OAGA 1C7JA 1EB9A 3BDVA 3OM8A 1H2XA 1XRRA 4FNMA 3H19A 2BCEA 5AI8A 5ALDA 2D0DA 5AKEA 2QXTA 3ED1A 1J06A 2DCMA 1FFEA 1R9NA 4AO7A 2X76A 3WKDA 3WL5A 2JIDA 2VTVA 1WHTA 1QIKA 4AN1A 2OLEA 4P9NA 1XZGA 4MYSA 2BJHA 4DNPA 4X94A 3GROA 1L7AA 2HA5A 3R3XA 3YASA 1HL7A 3O95A 4C6HA 2HU5A 4RE6A 5CMLA 1CUVA 5AK5A 5K3CA 1WHSA 4Y2RA 3GBSA 1JU4A 5HF8A 1LBTA 5A71A 3DQZA 2XUHA 1ISPA 1BU8A 1NU6A 5JANA 4FKBA 2XMDA 4Y2VA 4BRSA 4BRZA 1XLVA 1W4LA 1WPXA 3STTA 2QMQA 4DYHA 1QFMA 2GYWA 5AKGA 4E15A 1XQWA 5EHNA 3SK0A 1VXRA 4ZXFA 4AB1A 1QIFA 2XT0A 4Y7DA 1QE3A 1CQWA 1HBJA 4X85A 1L7RA 4NVRA 1XKTA 4HRYA 1XKLA 1ZI9A 3BF7A 4JYMA 1C4XA 3IUJA 5C8XA 1WPRA 3LCRA 3ESAA 2XDWA 4U2GA 3KWJA 3RARA 1PJAA 1YASA 4UBLA 4JH0A 2R8BA 4ZGBA 4AN0A 1EX9A 2VAVA 4J0GA 3HSSA 3B12A 4CCYA 4AMZA 4O08A 1CQZA 4FMPA 3BXPA 1LPOA 5AH0A 3DDUA 2DHCA 1XZCA 4UHDA 1YS1X 5FDFA 1W75A 3TGLA 3C45A 1MO2A 1NU8A 3O4GA 3V1KA 4BZWA 3G8YA 3MUNA 4KAAA 4F21A 5A7FA 2ES4A 3M3DA 2ACEA 2XQIA 1RWQA 2WHRA 2PUJA 5D3KA 1GKLA 2O2HA 2H7XA 1MNQA 4KE8A 1A8UA 4C01A 5ISMA 2JBWA 3I28A 5HZGA 4OD0A 4N5IX 4FNGA 3QPCA 3FCXA 1QFSA 4PF1A 3SX4A 1W76A 2WU3A 5ESRA 3TJMA 1M33A 2OCKA 1QJ4A 5JD6A 4L3WA 1SCQA 1J07A 4EBBA 3ICVA 2CBGA 3DCNA 5K3AA 1QIIA 4QWMA 1EDEA 3QYJA 4GW3A 4PQEA 3R3YA 2VA9A 4X71A 5CTAA 1A7UA 1MTZA 4KE7A 1DWQA 2YYSA 2XUFA 2I78A 3FWHA 1MAAA 5JD4A 5DYTA 5H3HA 4WFKA 3U1TA 1LPAB 5DJ5A 3V9AA 1CUFA 5CXUA 2WU4A 5K3EA 3DOIA 5EFZA 1F8UA 2W22A 4H77A 3WMRA 2PUHA 2UZ0A 1CUUA 3PICA 1J1IA 2JGEA 1ODCA 1AQLA 3IVMA 1ZD2P 2JF0A 3DYVA 2XI4A 3OOSA 1QLWA 4KAJA 4QNNA 4X3CA 4H7FA 2WIGA 3BJRA 1BEEA 5AKXA 4G8DA 3F97A 4H7EA 1N5MA 4MXDA 1LZKA 4G4JA 4C4YA 3NWOA 1EB8A 1ORVA 1B41A 3D7RA 2CB9A 1W1IA 2JGLA 1H23A 3LLCA 4P93A 1Y37A 4GBGA 2XQFA 2WIKA 1USWA 3UUFA 3H2IA 1QIGA 1GXSA 2WFLB 5FRDA 2OG1A 1R50A 3A2NA 4KRYA 1CUXA 1XRNA 4AZ3A 1F0PA 4YPVA 4EY8A 2XUJA 3STYA 1FSSA 4LKOA 1N8SA 2RHTA 3G0DA 2XQKA 2Y1KA 1QGED 5AOCA 3G0GA 4DM7A 4NZZA 3VDXA 2Z8ZA 5AI6A 4W1PA 4BAZA 1VLQA 2I3DA 2HM7A 2QOEA 3NUZA 3VKFA 3HEAA 5I8PA 2VAXA 3D2CA 4U2FA 2I3ZA 1JFRA 4KACA 1XFDA 1TQHA 2JGKA 1JMYA 1IVYA 3DLTA 5CURA 4X6XA 4Y2TA 3QBJA 3V48A 2VJAA 1DTEA 4BAUA 1F6WA 1ZGBA 3D3NA 5AI0A 1T4MA 2BFNA 5HCUA 5ALVA 2XMRA 1JU3A 4N5HX 4BB0A 1VKHA 3I2FA 4FFVA 5ALRA 3GA7A 4U2CA 1H2WA 3AJAA 5AOBA 3FYUB 3EF3A 4UHFA 2VF2A 4C4XA 4DTCA 4H0CA 3WIBA 5AI4A 5HQ3A 1UKBA 1IZ7A 4RGYA 5A62A 5DYWA 2CEKA 2B4KA 1VE6A 4K6HA 3GFFA 4PSDA 3V1NA 1MJ5A 2J3QA 5AIAA 2YXPX 4BCCA 3KD2A 4WDRA 3WK7A 5DNWA 5FXMA 4Q3LA 3R3WA 4B9EA 1DQZA 3ZLUA 3FSGA 4C87A 4G4IA 5CT4A 4RNCA 4UBMA 1G66A 1LNSA 2XMGA 1BEZA 5C8ZA 1CPYA 3GZJA 3LIPA 4YK7A 3I6YA 1PV1A 1MU0A 4B0OA 3NOXA 4BZZA 2V97A 1WB5A 3FBWA 1PFQA 2VEOA 3DS8A 5HKBA 1K5PA 2H7YA 1GT6A 1UOQA 2H1IA 3W04A 2HDWA 3LP5A 1P0IA 5AM1A 1UKAA 1GQRA 3FOBA 5LYYA 3WA7A 5LZ8A 3N0TA 3O0DA 1CUIA 1GZ7A 3BE8A 5CBKA 5AM3A 4QE3A 2OCGA 3D59A 2ZVDA 2HHAA 4H7KA 3LS2A 3OTQA 2V98A 5HFAA 1XZLA 3F98A 5AKHA 4LIPD 5KWIA 1DWOA 4OU5A 4BP8A 3V1MA 3FYUC 5IKXA 1G4HA 4ITVA 4Q3OA 4TVKA 4GHWA 2HA2A 5AICA 4MWTA 4UFPA 3Q8WA 4EUSA 2OGZA 2QT9A 3F67A 3IIIA 3OG9A 4OB8A 3JWEA 4DNOA 1SC9A 4IO0A 1CV2A 3WWCA 2VT6A 3SC2A 2WLSA 5BV7A 5JARA 2PSFA 4BAGA 1UK8A 1T2NA 1CUYA 1WB6A 2XQJA 2QVBA 3TRDA 3WJ1A 3WYDA 5CT6A 2WHPB 1IUOA 3ILSA 2XMZA 3VJKA 2ORYA 4Q3KA 4MJ3A 2BGNA 1YB7A 3OC0A 3FLAA 4BDSA 2CJPA 1VXOA 4GI1A 3C6YA 2RHWA 3EBLA 5KBYA 5HF6A 5LZ5A 2X8BA 2HRQA 3IUMA 3PI6A 4FLMA 3N2ZB 2C58A 1WB4A 2JGFA 4X90A 1R88A 3LIIA 3DYIA 5CH5A 4IH4A 5EGNA 4ETWA 1EA5A 5HF5A 1MT3A 3CXUA 4BTVA 1ZJ5A 5FKJA 1R4ZA 5E4JA 2Y2VA 2JEZA 1CUCA 4DLNA 1DX6A 3I2JA 1JJBA 4KAFA 4QDTA 1XRQA 1Z68A 3M83A 1AX9A 2RGUA 3FLEA 1QONA 2XLCA 3KSRA 3ESBA 3WZMA 1BN6A 4QDXA 4WFIA 1YSCA 2PPLA 5T4EA 1GPNA 5AKKA 5FV4A 1AKNA 1E89A 2HRRA 5YASA 3WIOA 1IUPA 2C4HA 4FBLA 2YH2A 1UK6A 2WUGA 4LXGA 5LKAA 4X97A 2OPHA 3AILA 5CH8A 4AMYA 2BUBA 1VE7A 5CT8A 5FPPA 2GBFA 1TIBA 3STVA 5ALFA 3BIXA 3UUEA 1BROA 4DSZA 3A70A 3WL8A 3C8HA 5DWDA 3R41A 2WFMA 3VJLA 3QMVA 4XWGA 5JAOA 4J3JA 4GEGA 4AXBA 2WG1A 2RAUA 2Z3WA 2WUEA 1VZ3A 3STWA 2EDCA 4M0EA 2XUIA 3I1IA 2JGJA 4LYDA 1H2ZA 4P92A 2JGIA 5AKIA 3R0VA 1K63A 3HLKA 3HJUA 1XZAA 5ALSA 5EHZA 1MX1A 1KU0A 2QRUA 1AMNA 3O9VA 3IUNA 5EIHA 1RYYA 1CFJA 3DNMA 4Y2SA 1R3DA 5ALGA 4JYPA 1JKMA 5CRIA 7YASA 1BRTA 5AKYA 2J3DA 1XLUA 4CIAA 5ALTA 1AGYA 1E8NA 1TKRA 1ETHA 2WSLA 5D3ZA 2BUAA 1U4NA 1ZD4A 5FP0A 5HFNA 1TCAA 3KWFA 2G5TA 2PKYX 2V96A 4LHEA 4KYVA 3BIWA 1X2BA 4DMFA 5AOAA 4Q05A 1XZFA 1S8OA 4EZIA 3H17A 3VVLA 3H1BA 4UHHA 1NX9A 1Q83A 4B80A 3A2LA 3WK5A 5CH3A 5LKRA 4A23A 1D07A 4OB7A 2DFPA 3C70A 5IH7A 2QZPA 1THGA 2WKWA 4ROTA 1LPSA 4AZ0A 4QZVA 3KDAA 2XMCA 2XUQA 4EY5A 4E46A 5F4ZA 2P8SA 2AJ8A 5JAPA 3WK4A 2HA0A 3F8SA 1UZAA 2WIDA 2JEYA 1ZD5A 1EH5A 2GZRA 2WG0A 3D5EA 4D9JA 3AFIA 3EIOA 1XQXA 4F0JA 4M0MA 1N1MA 3BDIA 1ZI6A 1XZIA 2RI6A 1YA8A 3I2IA 4UFNA 5K3FB 1FFCA 5BWBA 3FYTA 2XUKA 4LXHA 3JYHA 1CUZA 1C7IA 3AIMA 3FVRA 1ZI8A 2AJLI 2WQZA 4DGQA 4BE9A 1U65A 1QOZA 2ZJFA 4UBIA 4H7DA 3C6BA 1MAHA 5K5EA 3ANTA 1ORWA 1UKCA 5ALWA 1X2EA 4X6UA 4W63A 4Z49A 3TEJA 4FDMA 1F0NA 2O2GA 4X92A 4CG1A 1CUAA 3T52A 3VISA 4FWBA 5DTJA 4PSUA 5A6VA 1MX9A 2GBGA 2FUKA 1E8MA 3C43A 3K9BA 3F96A 2DR0A 5ALKA 4H7JA 2C5GA 3PUHA 3IA2A 2K2QB 4JNCA 2OCLA 1JT2A 4BTLA 2FJ0A 4W1QA 5K3DA 1XZMA 2DQZA 2HA6A 5JYCA 4X6YA 1THTA 2VJDA 4XX1A 3A2MA 4CG3A 2XUPA 5KWJA 1ZOIA 4BP9A 3WZLA 4BBZA 2PX6A 5FOQA 5A7GA 5LLSA 1YAHA 3HZOA 5DYYA 5JAUA 3SWWA 3IURA 4GDMA 4CCWA 5JZSA 2WFZA 3I2GA 2GBIA 4P08A 1G42A 4W1RA 2XUGA 4OYLA 3ZLVA 1AUOA 1KEZA 1LPPA 3G9UA 2J4FA 1A8QA 2HU7A 1DT3A 3Q0TA 1A88A 4X93A 3E1GA 3PF9A 4IQ4A 4CIBA 1XZHA 2WILA 4ARBA 4ZRDA 4WFJA 2AXEA 4GECA 4MEBA 3H0CA 4BCBA 3QMMA 2QUBA 1XZDA 3D0KA 3B5EA 1GKKA 2WIFA 2VJCA 1EXWA 4UHBA 4EB0A 5LZ2A 4B6GA 3FLBA 5T4HA 2PSJA 2RONA 2HL6A 1QIJA 2PM8A 1R1DA 5A7HA 1BE0A 5E2IA 3CN7A 1MNAA 5C8VA 2Z5GA 1TK3A 3VVMA 2B20A 4Q82A 5JAHA 5ALYA 2PL5A 4E11A 2VQ6A 3UMJA 2IIVA 5C81A 4Q34A 4B82A 4UPDA 1HQDA 1ACJA 3DKRA 4RPCA 4N8EA 4CG2A 2IX9A 3X3HA 1LPMA 4F5ZA 3WJ2A 4N8SA 5AHXA 3PFBA 4B9AA 2RIPA 3HC7A 2CMFA 3S2ZA 3S8YA 3PF8A 1CUDA 4A16A 4G9EA 4OYYA 1ZD3A 3EQ9A 3ZLTA 5A2GA 2FX5A 1CUGA 1R9MA 3D2AA 1B6GA 4QLOA 4UUQA 2IITA 4BC1A 1JMKC 5C7YA 5D6OA 3STUA 4KR0A 1YAJA 5JZ9A 5ALJA 3H1AA 3AZPA 2C0PA 2V9ZA 3VJMA 4X91A 3JW8A 4J0HA 1TAHA 3QVMA 4FTWA 3WWDA 2XMQA 3H2GA 4CCYB 1YS2X 4HXFB 1OCEA 5AM5A 3V1LA 3RKSA 5SYNA 1Q0ZA 4K2AA 3PUIA 1EVQA 3FNBA 3WL7A 4HXEB 3DJYA 5AJHA 3W9UA 1ZICA 3U0VA 3RM3A 3K6KA 3C6XA 1G5FA 3AZQA 4BVLA 2PSEA 5K3BA 4J0DA 5HK8A 4PSCA 5HF9A 3HACA 3WLAA 1BN7A 2H7CA 3WYNA 3C6ZA 3MVEA 4J0JA 1GPLA 1OILA 1YCDA 4H7IA 4J7AA 3HYSA 3WKEA 5JASA 3L1IA 3QPDA 5IVDA 1U2EA 3WK6A 5ALPA 1WOMA 2DSNA 4GWLA 4HAIA 4OUKX 5AK6A 5ALMA 2XB6A 2XMBA 4ZI5A 5HK9A 1DINA 4PW0A 1EINA 3QM1A 3VXKA 2QR5A 1VOTA 2BAGA 3PDCA 3O4JA 2PBLA 3ZWQA 4B83A 2G4LA 1X70A 3G7NA 3O4IA 1XZKA 3PFCA 3E0XA 1EI9A 4EHBA 3D4LA 5EIEA 2XUOA 3AIKA 3MGAA 4W1SA 3C5VA 4OB6A 1U8EA 4TGLA 1Q0RA 4YX9A 2Q0XA 4AO8A 5DNVA 3RK4A 1EDBA 5LZ7A 4AQDA 2XMSA 2E3JA 3H18A 4K6GA 4B0PA 2HA7A 5JADA 3DOHA 2XLBA 4DMHA 3RLIA 4L0CA 2QXUA 3H2JA 3I6ZA 2DQYA 3G0BA 4BATA 3WL6A 1RP1A 5AI5A 5AO9A 4U2DA 1KU6A 1LPBB 4Y9SA 1CEXA 3FCYA 1BCRA 4OCZA 2WUDA 1XQYA 1AC5A 1GPKA 4C88A 1DWPA 2R11A 5LZ9A 2WUFA 3I6MA 4FLEA 4QDOA 5LP1A 4DNFA 3EQ7A 4X95A 4Y2YA 1SOMA 2C5FA 2Y6UA 4UBNA 1XZEA 2OCIA 1ODSA 1QTRA 4GXNA 5E4TA 4BE4A 4CI9A 5ALZA 1E5TA 2B61A 2QTBA 4UBOA 3KOOA 3R3ZA 3QMWA 4J0IA 2WTMA 3F9CA 1UOPA 4QDZA 1UK7A 3IUQA 1DQYA 3ZV7A 4M0FA 3G9XA 4KE9A 4H7HA 1W52X 1N5RA 2ZYIA 5HQ3B 1HLGA 5AM4A 2WHQA 2CZQA 4AX4A 4WDQA 5AKZA 1I6WA 3W05A 3HRHA 2WIJA 2WTNA 4G5XA 2JGMA 4EY6A 4HTAA 4F60A 1BS9A 4HZGA 3H2KA 3P2MA 4PV7A 2O7VA 4G8BA 5AKJA 3QITA 2BGRA 1EVEA 3ICWA 5EIAA 3T4UA 2WG2A 4MQMA 4I19A 3WK8A 5CW2A 1UK9A 1XRPA 2LIPA 4B84A 1H2YA 3DKKA 4HS9A 4Y2QA 4XVCA 3CCBA 3G02A 2ZYRA 3IB3A 1QTIA 2QS9A 2W6CX 1WCYA 1CUWA 1CRLA 3GELA 5I7UA 5T4FA 1BCSA 4EY4A 3ANSA 5BOVA 2ECFA 5FUMA 3H04A 2PSHA 3O9MA 4U2EA 1P0MA 2G63A 4A5SA 4PO3X 1DT5A 4I3FA 3AUKA 4G4GA 4XIIA 5EHXA 2OGSA 5ALXA 2PU7A 1TRHA 1LPNA 5LZ4A 4EA6A 4S0XA 5ALIA 4FHZA 1XZBA 2CKMA 3DL7A 3ZPXA 4QDUA 1K8QA 3I2HA 1QIEA 2HFJA 1A8SA 4OU4A 1MPXA 3AIOA 2ACKA 2FJPA 4Y2JA 3IDAA 1ZJ4A 2EEPA 1EDDA 4FOLA 2ROQA 3WI7A 4KEAA 2D5LA 5IVIA 1CUSA 1VA5A 2OQIA 5AK4A 5EHQA 2ZJ7A 2WFLA 2ZSHA 3WK9A 3M82A 1GQSA 4Y2XA 1UOOA 1IMJA 1LBSA 4UFOA 3FAKA 1TCBA 1EHYA 1W6RA 1VJ5A 2VJBA 2H9YA 2OGTA 3AZOA 4K6KA 4X00A 3K2IA 2ZYSA 4V2IA 1VZ2A 4Y2PA 2QM0A 5CT5A 3G9ZA 3AINA 2C7BA 3G0IA 3ESDA 4HXGA 2XUAA 4UHEA 5ALQA 3WWEA 3WWPA 2GBCA 4DSAA 4Y2UA 3DD5A 4DIUA 3E3AA 2WHPA 4HVTA 3IULA 1UFOA 2VSQA 4LXIA 5HKAA 2HA3A 2HADA 2PVSA 4EY7A 3DEAA 5KREA 2O7RA 2BKLA 1JJFA 2ZJ6A 1E66A 5ALLA 4NMWA 5JIBA 3R3VA 4ZREA 3FYUA 3OPMA 5ALHA 4AO6A 1QO7A 1Y7IA 5JALA 3IBTA 2GYVA 2ZYHA 4WJLA 4DMKA 1VA4A 1P0QA 2VATA 3A6ZA 3O4HA 4IH1A 5ALUA 4MQLA 4UBKA 4XJVA 1SFRA 3H2HA 5AP9A 1FFBA 4BCDA 4KJXA 3WKCA 2QJRA 1H22A 2Z3ZA 2WJ4A 4BVJA 4C89A 1AZWA 4G1FA 2Y6VA 1K6EA 3L1HA 1L7QA 2G5PA 1UXOA 5CXXA 5J3JA 3WKAA 2XQGA 1TCCA 3CN9A 4WY5A 4ZV9A 3HABA 1ODTC 2XE4A 2XUDA
chains in the Genus database with same CATH superfamily
4J0KA 2HIHA 1GUYA 4L15A 1VHDA 4WY8A 1GZSA 2ONCA 1MN6A 1NBOA 4K5QA 3LUJA 1SU7A 1LLFA 1X1AA 2C5AA 4PZAA 3GI1A 2DHEA 1SG9A 4I50A 5IAKA 5IBRA 1WXDA 3ZVNA 4EPXA 1CUBA 1LS1A 1EUDA 4LOHA 3AVXA 1U5BA 1MEEA 3P27A 2MU1A 1OLXA 4BU1A 1VBKA 3AY6A 4DLAA 5AOVA 1PEYA 2WJYA 3WAKA 1NBAA 2H4FA 1QKJA 3OIWA 3ZI4A 3W2TA 4HUJA 4LF9B 2ISCA 4ND6A 3TTVA 1K7SN 2NU7A 2AJCA 4U9HS 1W88A 2BFCA 1C2TA 3NNNA 3ITNA 2PUWA 3OEED 4JBIA 1G21A 4AX8A 1AG9A 3HWSA 3HCPA 4WOCA 1V41E 2PLRA 1P6QA 4DWWA 2W5UA 4Q0MA 2PRYA 5AM2A 4JX8A 2WJ6A 4NJMB 3WHPA 2X5XA 5CFOA 3F78A 2HQBA 2OUIA 3AP1A 5HX7A 4LQDA 2QD2A 1MXHA 2IVFA 5CEFA 4DHWA 1I5OA 3H2BA 1PUJA 1MMFB 1W73A 3L7NA 3LHDA 4U9UA 2VJMB 3DZBA 4EKNB 4OGLA 4H35A 3B3QA 3LC1O 3WB0A 4EL5A 3E4CA 3U4HA 1VJTA 5ALNA 2WTUA 4LX0A 4X3PA 5IT0A 4ND2A 1J0EA 3GPCA 3U62A 2FY8A 5EIFA 3G6WA 4Z7OB 1ZH8A 3M9XA 4LZOA 4RTKA 2ORVA 1P45A 4LJ5A 1Z0SA 4OO3A 4Q39A 3V34A 2IHTA 4XWOA 1AHNA 3ZIAA 3FTEA 4JQZA 4FFWA 4NCBA 4NFLA 2XWBF 2ZW9A 3LI2A 3HBMA 5BUQA 1KZGB 4GYYA 4CIXA 2PKXA 3BB1A 1RYDA 1Q7TA 2FXIA 1OLOA 4RCYA 4TVSA 2FGKA 2PUAA 1I7PA 3SDZA 3KWLA 1CUHA 1QORA 3C1AA 3G8DA 2LDBA 3GDHA 1LZLA 4KSCA 4KPGA 1JR6A 1II0A 3IPCA 4Q00A 5EJ6A 5FLEX 4YQFA 3OM0A 4HDKA 4JCOA 5FHRA 2OC9A 2OESA 3TNYA 4F84A 4H1VA 4OAQA 3SQWA 4YCLA 1KDOA 4RHCA 4MVWA 4RKYA 2IEYA 5KS2A 3P45A 2UYQA 5F9MA 5GJCA 1EX7A 4PC6A 2QM7A 4G26A 4JC8A 3VR6H 3O8BA 2HLDA 3PV0A 4X6LA 2ATVA 4I9GA 4OA8A 2JI6A 2YBDA 2JI4A 2HJSA 4N54A 4UBJA 5DO9A 2P7HA 1DJOA 2ODTX 4GSKA 2OCBA 3ZVRA 3SQXA 4BYMA 4HSEA 2DPGA 2V0NA 3B7WA 2Q0QA 1XPOA 2W90A 3TKAA 1OASA 4TTSA 5ERXA 5LQDA 1MHTA 1E2MA 2X2EA 4LDPA 4POOA 2ZB4A 4MO2A 4HUTA 2CNKA 4KRXA 1NLMA 2P4HX 1AZLA 2W6QA 3M8KA 1WHSB 2OZKA 4IY1A 5B2FA 1NW7A 3T3OA 3RSCA 3U4AA 3HTXA 3TLMA 1EUCA 3JXEA 2OCYC 5FPSA 1J99A 4BVHA 4YRNA 2GPJA 4CKZA 2ONZA 3D54D 3G2IA 3JAKB 3EVBA 4FEYA 2O5RA 1M2FA 4MAMA 3SVTA 2XCSB 4WK6A 2EP7A 3ASUA 3GDGA 1DU4A 4GU5A 2FPRA 4MGIR 2X9LA 4QEKA 4QWWA 3U3OA 3FTFA 2GAOA 4CFYA 4RK4A 4QX6A 3ANLA 3HEMA 1AKMA 2PZBA 3FSGD 4XQGA 4F06A 8GPBA 3VNUA 1ZIXA 4W5HA 1W2WB 2MMCA 4DRXB 1EWTA 2H08A 3JYQA 4ME6A 1NOKA 4BN5A 1G8SA 5DNUA 1CUEA 1C3OA 5EJ8A 4KX5A 3SAJA 1CRWG 1RVDA 2QZ4A 4EG6A 2IYUA 1Q1QA 2LZ0A 3NT5A 2Q99A 1HSZA 4XSVA 5B1YA 3C87A 1RIFA 3GRAA 2GAAA 4WECA 5JZBA 2V9PA 2Q4BA 5HRUA 4F5WA 1XVUA 4GOXA 2IZOA 4HWKA 3W9BA 4CJXA 1KY4A 3GGPA 1UC9A 2QR3A 1UPBA 2QG6A 3EODA 2NVOA 5IXJA 3S2UA 2Q7XA 1JQAA 2DWCA 3OKFA 3K15A 3FRJA 2NXNA 3PQ7A 4YGYA 4LJ8A 4BNWA 1RS0A 4PBRA 1OR8A 5AI9A 3GFRA 1QMPA 4C3UA 4HP8A 4B7UA 1AXGA 1G41A 1ZGHA 2QW1A 3Q7SA 5DCUA 3JATA 3RC2A 3D5TA 1Z2NX 1JJIA 2B83A 3LW7A 3C48A 3TW6A 1TCUA 3R1IA 1JDSA 4JYZA 1VI6A 1RZUA 2W2PA 3OIYA 2VSYA 5L45A 2FTKE 3TOXA 4BBAA 4N8DA 1H1DA 2WYVA 5C7OO 2O8BA 3W1EA 4DLBA 1QFJA 2PGXA 4PPFA 2JFNA 1TAUA 2EJCA 3FPGA 3IAHA 3I1YA 4KDCA 1OTYA 3LM8A 2JW5A 3H1TA 4IIFA 4D9HA 1ZJJA 2HK8A 3EFOA 3GUZA 3GFTA 4WZAE 1A77A 1WD7A 1R8XA 3OZBA 4QDJA 4BLPA 3DXFA 1X15A 1OLUB 1HFEL 4XFJA 2R84A 4KWIA 1WULS 5AHWA 2CHUA 1RJDA 3K5PA 2HWYA 3FNHA 3L0DA 1GZ5A 5ILGA 1P75A 4TMTA 3THWB 2J46A 1N6NA 4A6XA 1Y81A 2O2YA 3T7KA 3RS2A 3P1JA 4G25A 1RKVA 4NYIQ 1RI5A 1JBQA 2H29A 4OAOA 2IL1A 3FFXA 1NBHA 4Z4GA 5G4KB 3AT1A 1R0KA 4M22A 2J4CA 1QIMA 3NYQA 4FC6A 1EP3B 3AFHA 1U3VA 3T9AA 1N0HA 4PNEA 3QVJA 1QTNA 1V5IA 3IALA 4MARA 4LYEA 4OHRA 4WCVA 3WKBA 3QEMB 3BGIA 3WL3A 4JUIA 4BDTA 1U2SA 3WSVA 1JEJA 4ED9A 3EMKA 5TNXA 2NO0A 2NW6A 2ZRMA 1YZKA 3R40A 1DS6A 2YV4A 1NZJA 2L42A 1OBVA 3BSWA 4ER7A 1DDGA 3CF4A 4M9ZA 5FUQA 4Y2GA 2BCGY 5HQJA 3C7AA 3AR2A 3A0RB 1EFDN 3LRXA 3DV0B 4HY3A 3GOHA 5DH9A 4OG2A 3EFHA 4IGFA 2X0EA 3T9BA 2VF4X 3IQXA 3LDHA 4LOLA 1E1MA 3I5UA 3STXA 3SZRA 3VM6A 3HM2A 1SKUA 3ADPA 3EG9A 1T8UA 4X5OA 5FPQA 2ZT8A 5K3FA 3NAMA 5CX1B 2V6BA 4MAFA 4XQCA 4PY2A 4TTTS 4HZUA 4ALJA 3T3PB 5BWCA 1KNQA 1WLYA 3VZRA 1R64A 4KIUA 2PX2A 5JC1A 2J9RA 2QMOA 1OT5A 1DX4A 4W99A 5FUYA 1SIBE 1CVLA 2XGMA 2PU5A 2GYUA 3CEPB 3H1FA 1NNUA 3L1JA 2YFQA 2B9VA 3MUEA 4X1OA 5H9WA 2C5SA 3EDMA 4Q37A 1T1EA 1G19A 1W1UA 2EDAA 1OXXK 3Q41A 4BIMA 3KVYA 1V16B 3A1FA 3HB1A 1N0UA 4ND5A 4UASA 1AHPA 3U61B 4FK8A 3MPUA 1QRAA 4Q3NA 3Q1KA 1ZK1A 3OM8A 1Q1GA 1VYUA 4N1AA 2MSDB 3VC3A 2W6IA 1P1CA 2XBUA 3CLSD 4QPCA 4DA0A 1M2NA 2WIAA 2GF9A 1KDRA 3OEHD 2BCEA 3BL6A 3CVXA 2E4AA 3S8MA 4PLGA 4TLDA 2A86A 3MOSA 1X1QA 4N0PA 1J06A 3LE8A 1RE1A 3OOWA 5JCJA 4UPEA 3DDSA 4MK4A 3QW4B 3AKYA 1O89A 5A4IS 2CKDA 3QEKA 3REFA 1JFVA 1QB8A 4R9SA 4G89A 4E03A 2NTNA 4F3RA 1I0LA 3NCHA 1C9MA 3FCUB 4NV3A 4WNYA 1BX1A 3SG0A 2JIDA 2CXRA 1RWOA 1OV4A 2A1UB 4RNDB 1PJCA 4NEHB 1JIQA 4RVDA 4M0CA 3GLHE 1G98A 3IEIA 2R65A 4AVYA 1UDAA 1QIKA 4KSBA 3O2QB 5DOVA 1FYFA 1WLSA 3TLEA 2VYVA 5ICCA 4DQVA 4ZO6A 1YZFA 2M9MA 4M8LA 1UBGA 2BJHA 2R44A 4GBED 2YJTD 4DNPA 4X94A 5A9SA 3I8OA 2VNIA 3BSFA 2BKVA 2QMZA 3NTOA 4II7A 5DZSA 1UADA 4RCVA 4YRRA 3PUXA 4EK9A 4ES6A 5DYGA 1TM1E 1WUJS 2HA5A 4F9EA 1QG4A 3QXXA 1O87A 3H4IA 2WTEA 3OOEA 2WWVD 3YASA 2PUDA 2ANCA 1E18A 3FWPA 3O95A 4PZUA 4UAUA 3O1IC 1I2AA 4RE6A 4R3WA 4C0SA 3J81A 4OX9Y 5LD2B 4ITUA 2FNAA 5BOSA 3JQPA 1LI7A 2IEDA 2ABWA 2XDYA 2Q1TA 5IJWA 3QYAA 5C8YB 4NIMA 2HJRA 5TMEA 4YUZA 3FTCA 5A71A 2ZUSA 3FZQA 1SG0A 3DQZA 2Q2QA 4WXYB 5CHEA 3T5PA 3HE3A 1PX2A 1ZD8A 4GWKA 4QG3A 3HL0A 3TOZA 5KYWB 3C39A 3JARA 4KQJA 2QLMA 1E60A 4L95C 2GARA 1N2GA 3IT0A 1M6WA 1RAGA 3KU4A 3P9NA 3H4TA 4URUR 3V4FA 1VLLA 3I8XA 1TQ8A 4K9MA 4CE6A 4NBUA 4PAMA 5FBKA 3ER9A 2ZU6A 3N8NA 2DP4E 2V0CA 4Y2VA 5EAIA 4WKBA 1Y6RA 4BNUA 1N4DA 3R5KA 4BRZA 2C9ZA 2HJWA 3A1DA 4DLVA 5BSGA 5AHOA 4DYHA 4BPRA 1QFMA 2GYWA 2M1XA 3ZDYB 3I76A 3ND8A 4J6FA 4Z9XA 3FMFA 4X1KA 3DYBA 1LF0A 3DOJA 1V0JA 1DBVO 1XQWA 2W6MA 1WMFA 2QROA 3AL3A 3GGCA 3R0QA 5G41A 1GZ6A 1IJFA 1PJ4A 4ZVMA 3WYBA 1JG7A 4KQCA 4V0KA 3WTCA 1HQYE 1QE3A 4QYIB 2B2NA 1U8YA 1K5HA 2BONA 2O19A 5BSEA 3RJMA 4YAGA 3Q8XB 1HBJA 1QR2A 4PYMA 2JJ2A 3VO1A 4L6AA 2X6TA 3E35A 5G02A 5JBQA 1RWNA 2B7LA 3OF2A 4YLEA 4NVRA 1PV4A 1V43A 3OZ7A 3I83A 3B2QA 1O2DA 3D8SA 1ZI9A 5HYVA 2HAEA 2X3YA 2XTJA 3TVYA 2GN6A 1WPRA 1GTZA 3JQEA 1U11A 4FGZA 1IXRC 2FZCA 2VQFB 2QUJA 1V11B 3QLJA 4OQDA 2NZ2A 5H3CA 3BD6A 3WDMA 4YJ3B 4XVHA 2FOIA 2JFBA 3QX9A 3EFBA 1X0XA 1YASA 1VSUA 1DAIA 1YJ8A 3EIUA 3NB0A 3P71T 4JH0A 2R8BA 4Q19A 2BH9A 3VH1A 4C7XA 3TG8A 1R8JA 3H2ZA 4UNNA 1SJ9A 3LDUA 2I5PO 4URZR 4E0BA 3N39C 3RLFA 2XA9A 4TZ6A 1OX6A 3KB8A 5DGTA 1IL0A 1GZVA 4ZI7B 3HO8A 4GI7A 2R8YA 3SS8A 1ZCJA 2ZTSA 1CQZA 3GF4A 4F56A 3IIEA 2O1WA 2PZFA 5KOIA 2XXJA 3DMTC 3ZNNA 1E1RA 2NQ8A 5KAPA 3FDJA 5DF1A 1T9DA 1H4QA 3DDUA 2DHCA 1PSZA 3JATB 3QU7A 4UHDA 1D03A 3O9ZA 5GAJA 2QJOA 2XYPA 4W7HA 4F7DA 2HBRA 3NRJA 3C45A 2UXCB 4O59O 2F4VB 1MVLA 2BFWA 2X14A 4GOND 3A27A 3DW1X 4RYLA 2X8LA 3O4GA 4TQGA 3IUPA 4BO7A 3RTBA 1UBKS 4YJHB 3RVJA 2PFKA 4UTXA 4YRDA 4BU0A 1KOFA 4CL8A 4TKUB 1K7EB 4OKNA 3ZHXA 3KL4A 3AP2A 5C5IA 3EGDA 1TJPB 3BBPA 2ACEA 1IZ9A 3IP8A 2C3YA 3PK0A 4Z6KA 4MYTA 1PFYA 3PX7A 3QPUA 1KDVA 1I94B 5J58A 3NBKA 3D1VA 3PQ2A 4GX1A 4TT3A 4D6YA 1CY7A 5JDCA 1R0ZA 3NMUF 1DEHA 2O2HA 3JZIA 4FDVA 4LJLA 5TV2A 4R1QA 1WV1A 2P5YA 4HDNA 3H05A 3GPLA 5TPZD 4A1FA 1A8UA 3RODA 5J59A 4AJ9A 4PIVA 3F49S 1YRYE 4TLLB 1JAZA 4FUQA 1NXPA 4CM8B 5JXHA 1W87A 3NDPA 4OD0A 4FNGA 2A0YA 1TQ4A 3DDOA 1J2YA 1P29A 2Y0CA 3FCXA 4GL2A 1N1EA 4NHOA 3SX4A 1QRDA 1X0VA 5F98A 1W76A 2FUNB 2HMWA 5E9JA 2J6HA 5C53B 2BMDA 2YJ5A 2Y1OA 2O3JA 4K9SA 3CUWA 4RD0A 5HM6A 9MHTA 3KHUA 4MKFA 1VHQA 4EFLA 3GJYA 2L17A 2Q2NA 5DI9A 5J5VA 4AK9A 5JNSA 2DU8A 2J33A 2R00A 4KDRA 4TKVB 4L3WA 2ZXEA 2G9NA 4B71A 1ODIA 3FPBA 1OREA 5EE9A 5FHQA 3OKAA 4HG2A 2GASA 4XFKA 3NPAA 3CONA 3Q6IA 3RTAA 1M2WA 2AS0A 1MRZA 2ILVA 4NP6A 1JB9A 3ZV4A 4H15A 1MAUA 2ZRCA 1VSQA 1UJNA 1F12A 4EG7A 5EKXA 2WZQA 3IDOA 1CQPA 3B5IA 3LF2A 2C8KA 4F1KA 2LKDA 1N8TA 4MKIA 1XMSA 3QKWA 2F7SA 4UQOA 3VMFA 1O0SA 4PQEA 1V2GA 1JPUA 2B2CA 3GGSA 1E3SA 3ZGVA 3FZGA 5DNCA 1Q74A 4KKXB 1ZSYA 4K6OA 4OVKA 5CTAA 4YRLA 1YK0A 5EMNA 2BH2A 1MG5A 4BMOB 1A7UA 1ISJA 4O2LA 2GMWA 4FINA 1DWQA 3BXFA 2C2WA 1I4WA 2QZ9A 3RBXA 4CTOA 4Z51A 1MAAA 3W2IA 3HJFA 3AG5A 3ZTTA 3O03A 4ZK6A 1BWSA 2YIDA 1LV7A 2IYSA 1WY5A 3EAGA 2PBFA 3B52X 1ZRMA 5H3HA 5B4TA 2VSFA 3MJEA 3MF4A 1XNHA 2RBKA 4G2TA 4LMPA 2DX7A 4AUEA 3V9AA 4ZHQA 3AR6A 1YR7A 1JSZA 4DF3A 2RARA 3FDXA 5CB0A 4IFBA 1ADGA 2PG3A 3B7PA 1ZLXA 4LXYA 3UMYA 1GHTA 5CXUA 1CRZA 1MZPA 2F00A 3L0YA 1CZOA 1YR1A 3QWFA 3UMMA 1H2AS 3P97A 1RRGA 4NOMA 1M34A 4PVDA 4QQ8A 1HX7A 1NT2A 1OJ7A 3CC8A 3P9SA 3LT0A 4IIYA 3A9SA 3WMRA 2PUHA 2P40A 2VNSA 4RANA 9GPBA 5IAAA 1CUUA 4JK3A 3PICA 1J1IA 2JGEA 4D9NA 1SXJB 5LNK1 2AEMA 2WWGA 1U8TA 1VMIA 4HQ6A 4REQB 5COQA 5EGSA 4Z4FA 2EU8A 1HO3A 2ZWMA 1TF2A 3IVMA 2JAUA 3R5XA 4YQYA 5DBOA 3VC1A 1KVUA 1H2EA 3MJFA 1SKYB 2A4MA 3H42B 2B4TO 1NURA 4ABYA 4UTOA 1WXIA 3RJ9A 4LVUA 2UXDB 2ZSEA 3OOSA 1QLWA 3ZJ5A 1LX7A 2FPMA 4DCPA 3OTGA 4IF4A 2NU6A 4HDQB 4CETA 5FI1B 2ZVPX 3RSSA 2AMVA 2PRKA 2Q41A 1A3CA 1L6IA 3M1IA 3TZQA 3WYFA 4Z3OA 3ILXA 1I1QB 3F97A 4EAQA 4XCQA 3VR6D 5G3YA 1NMZA 4AMUA 1BDIA 2GFIA 1D4OA 1RAHA 1VB3A 1X9GA 2GJKA 4HRAA 4K0RA 4EUFA 4WCFB 2V3CC 3B1VA 1EB8A 3KAKA 2XTMA 4G01B 1XA0A 4O2BF 5ITWA 1M5RA 4B46A 3EDYA 1B41A 2GLTA 4KO2S 3BHIA 5DK6A 1O0BA 3ZLBA 1P6UA 3ZY3A 3IAM1 3FETA 3SN6A 3LGAA 4HCJA 3KYBA 1G2OA 1N92A 3I8SA 1W1IA 3ENWA 3ZXUB 1H23A 5DNEA 2J7PA 2QBYA 3LLCA 3S1AB 3IO3A 4DARA 2EZTA 2IYYA 5LMCA 4UE6A 3EPLA 1HM5A 2Q50A 4GBGA 3U3KA 1SXJC 4IAOA 4GXQA 2O14A 2WIKA 1P1RA 3UIEA 4E33A 1QIGA 4H7PA 2P30A 4BBJA 5C35A 1PDWA 1XCGB 2WFLB 4EQZA 3RSZA 4F3NA 2QRVB 3FKSD 1U28A 3G13A 1VM6A 2NYRA 4KRYA 4PS1A 3L93A 3SXUB 2QTZA 4YGXB 1EMDA 3LUBA 1CUXA 1XRNA 1E6LA 3BZBA 3GAMA 3CA8A 1EBUA 3FDFA 3K73O 1Q7BA 5FAKA 4EY8A 3HPQA 3LVRE 2A9KA 3STYA 2QRHA 4C7BA 4KGZA 4O4JF 3D3KA 4QUGA 1LWNA 2J59A 1CY4A 3TSZA 4BV8A 1N2XA 3OLYA 3UF0A 4DEVA 3L6OO 4M8IA 1F14A 2CDBA 3A9UA 4K9KA 4M38A 4CUKA 4BO3A 1LJLA 1KJYA 4D8UA 5LMUB 3FXAA 1BSVA 2QP3A 4MYCA 1T3LA 1DBIA 3CRRA 3MWLA 1OAAA 1QYRA 2Z8ZA 4GYKA 2UUCB 5B7PA 1R6DA 1XKQA 4DV6B 3R23A 2DCUA 4YHHB 1XLTC 1VLQA 2O20A 4HAZA 4AW9A 3MT7A 4BASA 4G84A 1FMCA 3C3BA 4ER6A 1HLPA 3PNKA 7ADHA 4M9CA 3GQVA 1DC3A 2JLVA 5CLIA 2I3ZA 3Q7RA 5IM4A 1QRRA 4KACA 2IWRA 3U7GA 2E5LB 1XJCA 1TQHA 3CMMA 5KJ1A 1DTSA 4MMYB 3C7CB 4HWRA 1BZYA 1JMYA 1PG5A 2XNDD 3G2MA 4FD3A 1Z82A 2CWDA 3LU1A 5EMLA 4YIKA 4GG1A 4JC5A 5FBLB 1QHHA 1RJFA 3JQAD 4X6XA 3TXXA 4D46A 1NVFA 1VFNA 2OHIA 4OQXA 2GCPA 5HP4A 1PWHA 1YCFA 3FCSB 4PZLA 1EGHA 4LHWA 1WVIA 4Y6GB 4MLPA 1ZGBA 5EXSA 2BFNA 4YDHB 5ILQA 2F43B 3EEFA 2XMRA 5ALVA 2IHJA 5IUNC 4ODIA 1W4AA 2V7EA 4BYGA 2QTGA 4MUAA 4JP8A 3RYFB 1XTZA 1TMOA 2Y1GA 4N5HX 4L22A 4MV4A 4QOSA 3DO8A 5FTWA 5I9SA 3RWOA 1TUIA 3DHWC 4BB0A 2HYIC 3I2FA 3LDFA 4MB2A 4ZICA 3OE1A 1I7LA 5E3IA 5C80A 1H2WA 1IMOA 5D3MA 1GFWA 1K7CA 2B2XA 2BR4A 4NYJR 4TN5A 1I6LA 4B4OA 1G55A 3PSHA 2IGTA 4MWCA 1K7FB 1GR1A 3FZYA 5D1HA 3OEHA 3KQKA 2VF2A 4FGKA 1UAYA 1QU3A 2HQ1A 2FSHA 2G40A 3IQWA 4WWHA 4DC1A 4QL3A 1RZRA 1DZIA 4WEOA 2QZZA 4A4DA 2CWWA 2W4MA 3PC2A 1IZ7A 1U98A 1T0BA 3AJEA 3O94A 2BYTA 1A1SA 3V4RA 2GF2A 1J8YF 2ZYWX 1UFVA 4KRFA 3UCFA 2F48A 8OHMA 2CEKA 4Q16A 5HEKA 3GFGA 5F35A 2H2GA 2Y77A 2FPUA 4NCAA 3C97A 2OCPA 3GFFA 1JEEA 2F3SA 3EY4A 2ZBVA 3V1NA 4A92A 1BG6A 2BFOA 2O0LA 3TZKA 1IAQA 2XCTB 1G291 5JSKA 3EZ6A 5LLTA 5IDYA 2H4HA 2PH5A 2YXPX 3FI9A 4FS8A 5H68A 2QF7A 5BVHB 1E63A 3ORRA 3SJUA 1KZ7B 1GPUA 2OUKA 3NEAA 4IVPA 4M4SA 3HMQA 1XCLA 2IHNA 3W77A 3B1WA 4RVGA 1ZINA 3W5DA 1BTOA 2WFAA 2RJNA 4PS0A 4C78A 4Q3LA 1B16A 1RLUA 3HKDB 1P9OA 3RS9A 3DMNA 2I6UA 3R3WA 4DXDA 4UOQA 3RQSA 4DSOA 4OMCA 3KEOA 3GQBB 4BFTA 4O25A 4Z1MA 5T3YA 3DE3X 3FSGA 2VJQA 3NG1A 3NH9A 4MQ6A 3KEGA 1ZM7A 2Q6VA 3K0HA 4BIIA 5G1OA 5CYOA 3MWDB 3GG2A 2O23A 1EAYA 3QOWA 2CHFA 1BEZA 2XMGA 2ZQ5A 1CD5A 5D01A 2NPFA 3RTCA 4DUYB 3E9MA 1Q44A 2RK6A 3ENVA 4FZVA 3W9YA 2JD1A 4EFMA 1DC7A 2FWBA 2A0FA 3GZJA 3LIPA 2FPIA 1LRJA 1QH8A 5FAXA 1U8AA 3E48A 5IAEA 4NU6A 4ZYWA 3ODPA 2Z2IA 1EZ4A 3CZAA 2DMRA 5K4GA 1WB5A 2PX4A 4LOAA 2VEOA 4ENRA 2EP8A 1RJ9B 4LZNA 4DVGA 2WJVA 3RSLA 3QI7A 2XVZA 2CDAA 3C7KA 5AESA 3FLMA 4NE2A 4TVBA 5BR7A 1N5JA 5LNK6 2G6TA 2IYXA 3GGJA 4XGKA 1YUNA 3BUSA 1NUSA 1Q0QA 4MVJA 2DT5A 1T0IA 1UP4A 3FOZA 1UP7A 1XAIA 2IZ0A 2XA1A 2HDWA 1GUBA 2V7VA 4FGJA 4G5GA 2OXTA 3RNLA 4Y18A 4N5DA 1UKAA 5F2OA 2FR1A 3N05A 5JS1A 4CKXA 2CVQA 4C7JA 3A7DA 2J5QA 2VNHA 5K0JA 4LBVA 2ZI5A 2R6ZA 3U7FB 1TM4E 5LYYA 4YT5A 4OQZA 1NJ1A 3N0TA 3EVNA 4DJDC 3L7BA 5AM3A 2BDEA 4FT2A 4QE3A 1ABBA 2OCGA 2Q5CA 1X1BA 3D59A 5CLGA 2R6DA 1O1YA 2WMOB 4OQEA 3PJRA 1WBJB 5C3UA 1QANA 1D0SA 1VIDA 2VUHB 3H4VA 4BX2A 1BWQA 5JBIA 1H6BA 4PAQA 5J2UA 3QHQA 1Z0ZA 1XIVA 3OTQA 2V98A 4OJMX 4R2XA 2P75A 2HV8A 5ICMA 3TQRA 4DL9A 2VHQA 4J75A 3KSBC 1UPTA 3Q72A 1DJQA 4ZT3A 1UT5A 3AJDA 4P8RA 5HFAA 4GOKA 3QVKA 3SX2A 2QAGB 3N1UA 4M1QA 5LJIA 4QUJA 2PANA 3FPHA 2O8EB 3NKVA 2BSQA 1IQRA 3DHEA 2PUTA 1G9TA 2YL2A 3A06A 4GT1A 4IX1A 1XTIA 2YCBA 1QG6A 2X4IA 4FQ8A 4GVLA 4A26A 3U3ZA 4YR7A 5KWIA 1KWGA 1CEEA 1ZOPA 5IDVA 4OGKA 3OQJA 5FOQA 1G8FA 1VGQA 4DSTA 4NV1A 4KTTE 3FNQA 4ZQIA 3V1MA 5IKXA 1JIIA 2E6UX 2Q4TA 1CF4A 2NUTB 3HKEB 1WF3A 2V45A 3VU3A 2DOKA 1F7VA 3K1JA 3PL1A 3DOEA 4MWTA 3NHFA 1P4GA 3ONDA 2GCOB 3Q8WA 5J1SB 3FRIA 1I36A 1FE8A 2QT9A 3KLNA 4R0MA 5BWNA 4Z99A 2MDTA 4O4IF 3VYUB 3X44A 2X6QA 4LEIA 4L02A 3L9WA 3BZUA 4Y6PA 5ICFA 1GGHA 3JWEA 1BOOA 1Z5WA 4FDUA 2VVTA 4NE9A 6ADHA 4J9VA 3F9RA 1ECPA 4N39A 1ZRNA 2OD2A 3IOCA 1E4OA 2J3KA 1A50B 2ZR9A 2ZSJA 1DOZA 3DBVO 1A9XB 1U2QA 2HMUA 4TS4A 3TLJA 1C0EA 2SKEA 4I46A 3ZHUA 1CRPA 2WB4A 3JQDA 3PDWA 4QPZA 1AGXA 3G5LA 5BWOA 3VOSA 2WLSA 2LE0A 5BV7A 5JARA 1PKEA 1H2RS 3AXTA 3VPSA 1T2NA 4KDEA 1YXMA 2GCOA 2GYYA 3D0RA 3ZS9A 4EO7A 3MSXA 1CB7A 5B1HA 2W6ID 4JR2A 2FEAA 4YECA 4C7OB 1A5TA 2X41A 4IDOA 1C7EA 2IT1A 1SZDA 3ILVA 3A26A 1W36B 3IQHX 2WHPB 2POQX 1EFPA 1T9CA 4IOKA 1J6UA 2EERA 2EKBA 3HA7A 4KXNA 2ORYA 4LQ4A 3NT4A 1NW4A 1CP3A 4Q3KA 1E1DA 1ESNA 4IRXA 3IH5A 2IYLD 4KLRA 4Q4CA 3NFYA 4TKVA 1T0HB 3PQ3A 5EP4A 3NBYC 3ZQ4A 4E2WA 4QC2A 4CMAA 2CJPA 2JCGA 2VHVA 1VXOA 4GPTA 4QHSA 1BHO1 3C6YA 1ZCZA 1WSAA 1OWLA 1T3GA 3DVRX 3W1VA 5KBYA 5HF6A 1DPFA 2PT7A 1A2QA 1OSNA 2CCGA 3MQFA 5LZ5A 3KEFA 3JTEA 1FNCA 2D7DA 2X8BA 1TF5A 5I3CA 5IAGA 2I80A 3IUMA 5KYVA 4FFBA 1AGRA 3ECSA 4FLMA 3SHFA 1SKAA 3IOBA 1TU4A 1NPYA 2WKRA 4POAA 5JPDA 1WQ1R 2IDZA 2P9TA 1CNEA 3LYHA 3NXKA 5EZYB 1NVGA 4B2LA 1VBNA 1M2HA 3G23A 3P0HA 2FFAA 1R88A 1RJGA 2ZETA 3C2QA 3DJFA 3T3DA 4B33A 2ZUEA 2BBTA 3EDRA 1Z6XA 2WSYB 1O95C 2NSJA 1ZISA 2Q3FA 4QXOA 2XYHA 4LYFA 1ST2A 2AFHE 4PFKA 2VYVD 4GM4A 5CH5A 3R75A 4RMHA 2ONYA 4IH4A 3D4BA 4Q66C 4KN6A 5EGNA 1LD3A 4RAOA 4OH1A 3JWJA 5K6RA 5KNCD 1T10A 1Z6QA 1CJKC 2GR9A 1CW2B 1SBIA 1MGOA 4IQ0A 1LDNA 4RK5A 5FKJA 4BTVA 1JHVA 1G8PA 1W36D 3AVVA 2GCEA 1POXA 3OP4A 3ZIUA 1W6UA 1XE3A 2OD7A 5EJEA 1WR8A 4P7BA 4RVUA 4DKXA 3SEQA 1DX6A 3PCTA 3I2JA 1QCZA 3RCBA 1A1VA 1KOLA 2H1HA 2W98A 3OQNA 3DO6A 1OU0A 4GX0A 1JJBA 4Q4DA 3RRYA 1NF9A 3M2TA 4UUAA 4QDTA 5CPFA 1SELA 3PKJA 5TQ0B 4B8YA 2HWXA 4HV4A 3NIGB 4CTNA 3EXHB 2WF7A 4PX5A 4K6CA 3PC4A 4E21A 4IDNA 4Q01A 5ANRB 3M2PA 1IY8A 1NFQA 1NXSA 3B51X 3OZTA 3MS2A 3V46A 2I33A 4AJIA 3EVEA 3JAKA 4TTPA 3ZXIA 4K0KB 3FLEA 3GMSA 2I4IA 1QONA 1MPTA 2NU9B 1V3VA 2WSSA 3WZMA 1I7DA 4DKJA 2AE1A 1KMMA 4U9IS 5LQMA 3K8QA 1WW2A 3DVAB 2AHRA 2OT3B 1JDVA 4ENPA 5T4EA 1VCOA 4RF5A 4COOA 1AKNA 1E1QA 1VLMA 1X13A 1XA4A 1B6SA 3WVNA 5GVSA 2C3MA 4TM7A 3SM3A 2ZJ4A 1FTWA 4J43A 1F8GA 1IUPA 2C4HA 1V8ZA 4TV8A 3UW1A 1UK6A 2AR0A 1QCCA 4M9RA 4MJ7A 3QV1A 2VCHA 3O47A 2QTFA 1EPUA 5CH8A 2AOUA 2Y68A 4AMYA 3TBFA 2E1PA 2Q3CA 4DLSA 2QM3A 4MQ5A 2BUBA 5EZ6B 1GR0A 3A1WA 2GM3A 2B30A 1NLYA 3OUTA 4TXLA 5FPPA 2ESRA 2GBFA 3OFKA 3WFJA 5FH9A 3CUKA 1DKPA 1IN6A 2BOVA 2GZMA 2SECE 1V4NA 5J4HA 1K68A 2ZRPA 3BIXA 4EA9A 2FEOA 5IUJC 2JI8A 1KJZA 1MH9A 4LY3A 1A71A 1E58A 4JVLA 3E1KA 3ZX4A 4KQ9A 2H63A 5C7IO 5KJFA 3R41A 3VJLA 1QP7A 1JHQA 2GUGA 3ER6A 4E5VA 3WNQA 4UOZA 3TUZC 3IQFA 4KXLA 4LWQA 4DLXA 3KQTA 1K08A 1U6JA 4U1RA 4MVYA 3ABRB 1ECFA 5DWVA 1FS4A 7AT1A 5CBPB 4HO1X 5B7NA 3UANA 5I7WA 1S1MA 3W5AA 3W6UA 3GLFA 2OV2A 4ZANA 1DBSA 3ZGNA 5BN4B 5LOVA 2FCAA 2DVMA 1ENOA 1OF1A 4ZOLA 1XB2A 2QSYA 1I5EA 4WLVA 2DKOA 2Z3WA 4OSOA 1OH6A 3C5EA 4DQLA 3NXSA 1Q19A 1MO5A 2XHZA 3H16A 4KODA 4D5GA 2WDZA 1D9ZA 1VG9B 2QN2A 4M0EA 1IG0A 2ZJ0A 1EFUA 1RI2A 3FMIA 2Z5VA 3L2OB 5IC5A 5J9FA 4RHTA 4B48A 4L5YA 1EG2A 2C2YA 1J7KA 3D9QX 3Q3VA 4KN5A 4Q1EA 4P92A 2E4XA 5GMOA 4DCSA 1BXRB 1O77A 1YFKA 1QC5A 5DGDA 3HYRA 2FW1A 3DUFB 3IT3A 3R7WA 1QYDA 1JLRA 4BLUA 2WMYA 1RABA 1FVXA 3KQHA 1T1SA 2PKQO 3E81A 3HJUA 1J5PA 3EIQA 2P1RA 3UH0A 5I51A 2H3EA 2DF8A 4XEUA 3S29A 2B35A 3IBFA 4AROA 4YMGA 5EHZA 4J7CA 1FU4A 1MX1A 2VDVE 1JF8A 5JSHA 2G70A 3VUEA 2VR1A 4BNDA 2QRUA 5MGBA 1AT1A 1IWBB 1IPHA 2AGVA 3O9VA 3IUNA 3PEEA 4FFPA 4M1WA 2DBVO 3A4MA 1C8BA 1R3DA 2FLKA 2YWBA 3DAHA 3IQZA 3SC3A 3VO8A 7GPBA 5MN6A 2OWEA 3L05A 1E0SA 4RA6A 4IIXA 4XARA 1N7HA 2VHJA 4HL6A 1UDRA 5AKYA 4ZDWA 3WO0A 1OLSB 3NEJA 2EATA 1XLUA 1COWD 3K0CC 4CIAA 3OM1A 5ALTA 5K8JB 3HXQA 3OZVA 3EPRA 1HE2A 1XTSA 4FGUA 5AK0A 1A72A 1AGYA 3W1WA 2ID7A 3L8ZA 5JY6A 5KX5B 3MUFA 3H7AA 1SWWA 2WSLA 3BG5A 2BGTA 4JFRA 3P9CA 1Y9ZA 4DV3B 1N5LA 1U4NA 2FPGB 4R7GA 5GONB 4US1R 4ZEXA 3WGOA 1W85A 2O3UA 4GMKA 1ZD4A 1GKUB 2YJ6A 3F71A 1Y9DA 1O4WA 4C6RA 1QRSA 1Y33E 4WVFA 3UC5A 3L43A 1J9ZA 3RNOA 5E3JA 1RLIA 3FCAA 4RVSA 3QVTA 4IXMA 1YUBA 4WGFA 3U9LA 4DM3A 2IYPA 4RY8A 4LC9A 5GV8A 4HMPA 3LCMA 3DTTA 3P0FA 4I8DA 4L5AA 3WIUA 4B1FA 1XN1A 1FSZA 3DMPA 1ZGGA 1U8ZA 2V96A 2XNHA 3L8MA 2R5NA 2WJAA 4HB4A 4IZIA 2FW0A 2ZIUB 3VSAA 4QDKA 1JHYA 2B1GA 2V5AA 3DCJA 4KBYA 2AX3A 3WY9A 1BVHA 4AP9A 3TLCA 2PT9A 1VIMA 1DRJA 1XU9A 1RAAA 4Q05A 4YV0A 4RFSA 4ECAA 1A82A 1WO8A 3VHQA 3W5SA 5JQGF 4RLSA 2NXCA 2XTZA 3WTBA 1AMOA 3GA0A 2PXCA 4L3OA 4EAAA 1IN5A 4DMMA 3Q10A 2SNIE 3LG2A 3KQPA 3VMMA 4WEQA 2AZTA 3N59A 1S6YA 1GP2A 3H1BA 4KWTA 4PU0A 2OBYA 3OESA 4DQKA 1OC4A 1XLTA 3L8CA 3D8HA 2OR3A 4PFSA 3UMRA 5JXJA 2AFHB 1PDVA 2BRUA 2UZIR 5LYJF 5C52B 1UPXA 2AEEA 1T5SA 2HIMA 3LXXA 1Q3HA 4CM4B 4DA8A 3SJCA 5LKRA 1KH2A 1MP0A 2JZNA 3E7PA 4N76A 2WM8A 1AF7A 2PIAA 4KNYA 3I05A 1NYTA 2F17A 2XWPA 2Z30A 3AMVA 3C70A 4HEA1 2O3TA 1E2DA 1K06A 2VA8A 4RIIA 2QORA 3KKZA 2ENUA 2EX4A 3OFVA 4BMVA 5DEIA 3QG1A 1W44A 3EUFA 5DX1A 4MQFB 3HDQA 4ROTA 4XJTA 5ARCA 1MOSA 4AZ0A 2G88A 2H3HA 2Q6KA 1HRDA 2WMNB 2ZIFA 4MQFA 3ME5A 1W35A 4Y1EA 1OFHA 2O5VA 3ACDA 5KWSA 2XUQA 1JAHA 4E46A 1VHJA 2JB9A 5CAEB 3F3SA 3LY9A 4R16A 1U2PA 5JAPA 2PBRA 2PEZA 1GV0A 2PMCA 1M72A 1YNSA 4OK5A 1UZAA 3ABOB 4TOIA 2JLYA 3FJ1A 4WNCA 2P27A 4ZPXA 1FUYB 1XDWA 1ABFA 3AESA 4YXWA 2VDOB 4P38A 5FNZA 1NZDA 3X43A 1G8JA 3EDOA 5CDUA 5LUAA 1J22A 1RWVA 1ZD5A 4N6GA 3JQ6A 4RO0A 2GNOA 3ABZA 2R5FA 3L7OA 3OZFA 4UW9A 4G24A 3IILA 3B1XA 4H0NA 3O26A 4GOJA 2NP7A 1TVEA 2A0WA 3S3TA 4EYEA 4PZCA 1K3FA 1POWA 4F0JA 3COWA 2C99A 4Z0TA 3EXG2 4M7WA 3FHCB 2QXYA 3P2KA 3PGJA 1M6VB 4D45A 1E2KA 3DT9A 1LH0A 1DEAA 3EFEA 3QKUA 3EVDA 4IHKA 4AZTA 3HN6A 1B43A 1HI9A 3C98A 3I5AA 4MRRA 1SIOA 4DLPA 1NKSA 1JW9B 2I71A 4OP3A 1WIWA 3DPIA 1RQXA 2CSUA 1O4VA 3IESA 1JQDA 2RHMA 3JYPA 5LXTA 1DEXA 2FN9A 1IBLB 4LXHA 3GZNB 1FFSA 1C7IA 3SP1A 1XC7A 2CDNA 1TIPA 5F5NA 4ZI2A 2BZ1A 2XF8A 2RGNA 1VJ1A 3EULA 3IQDB 4OK3A 4DLTA 5JI2E 3ZDZB 1V8BA 2AJLI 1JZTA 1AQIA 1O5OA 1MB0A 1RACA 1DAPA 1ZI8A 2BI7A 1JEQB 3LTEA 4MDHA 1JX6A 2I67A 4A1OA 5AR1A 5HPYB 1VG8A 5LM3A 2QX6A 4Z9AA 4HYYA 5GY7A 1AV6A 2GJ4A 1PLLA 5C1IA 3X1MA 2E5WA 1TVCA 4UBIA 1EU1A 3DZCA 3K1AA 2IF0A 4K6MA 2C3UA 2OV6A 1E92A 2PYZA 3AQIA 1Y7LA 2OQ2A 3OO1A 4JJKA 4V24A 1KPGA 3RVMA 3WFZA 3FUWA 2IYVA 1QGOA 3OZEA 3AHJA 2P9FA 1KNXA 4DWJA 4L5IA 4NK5A 1NUQA 3GVHA 2RKOA 3LD9A 5C31A 4MUJA 1IC6A 5ALWA 4D6PA 5CD9A 3UKJA 4OQQA 4BNFA 3IT1A 1SA0B 3ZDAA 2R3SA 4FDMA 4S0ZA 1XYGA 4V0QA 1FF9A 2O2GA 3ANNA 3LSYA 4X92A 1ZJWA 4CG1A 3E3NA 4M83A 3OPNA 2D0PB 3CRW1 4WA7A 5U4XA 1P80A 5ESWA 4DADA 2XKKA 4FWBA 2A9FA 4QBIA 3VV2A 2XT6A 3K92A 5JBNA 2P9GA 3KYCA 3THYB 4NABA 4HQLA 1XJ0A 5DHFA 3ZKWA 1OPXA 4UDYX 4ZD6A 1QF6A 3MAGA 1HT3A 3JQ7B 4GPAA 1MA0A 2ERYA 2PLAA 1M74A 2W93A 3CT4A 2JGRA 3O82A 2RKBA 4S1TA 3VV3A 3TPFA 4JJ6A 4D9IA 1XJQA 3EZXA 4Y30A 1ZAYA 1L7NA 1R0LA 3MWFA 4TMKA 4LFCB 3WGVA 4GS5A 3U7QA 1AY0A 2MSKA 3S0JA 5KNDA 3FFTA 5LYJB 2WSBA 4JNCA 4LV6A 1J0DA 3SZLA 5FO1A 3TIGA 5HJ5A 5JXIA 3T4EA 3J80A 3RQIA 4YUXA 1OXVA 3C1OA 5HIJA 2PZEA 2DG2A 4D9EA 3F7OA 4WESB 3PEYA 4WNIA 1AZTA 1XZMA 3L8HA 2Q9CA 3I9MA 5ADUS 1IWOA 2HA6A 4JT2A 1OTHA 1UC8A 3B1KA 4PTYA 3FSEA 4R1UA 2I7VA 2O2ZA 4EP1A 5IKPA 3M49A 2VJDA 4ZQHA 4K87A 3WQBA 3RGGA 1OOEA 1A96A 1N32B 3CVUA 3QOFA 1HKUA 3NUGA 3GT4A 3BRQA 3ID6C 1LJ8A 4MAAA 2YS6A 3DEJA 2NU8B 1ORDA 3E22B 2A35A 2AK2A 2GF0A 3JD4A 1UPFA 3KZXA 1YDWA 3WOVA 3EARA 2JK0A 4K9NA 3L6DA 3PGA1 1EWYA 3ZTYA 4O2BB 2EW1A 2CLKB 4EMBA 1UH5A 4FX5A 4C29A 4X63A 5EZYA 3HUUA 5LCXA 4MMXB 1CS0B 4XDGA 2NAPA 4GDMA 3G2PA 3PX3A 1L9KA 3R6LA 1FEZA 2Z83A 3G0HA 1JQJC 2C8JA 3OCVA 3PD7A 2V7WA 5L3VA 4R40A 1B1CA 5CCXA 1WZEA 4BKOA 1RQGA 4NJEA 5DEOA 4CYMA 1Y8QA 3ZHCA 1YTLA 2CLEB 2OXCA 3FZNA 4ZKEA 3ZLVA 2L19A 1KEZA 1QHGA 1KYZA 3WIDA 1J33A 1DT3A 3SM9A 2ZRGA 4AKIA 1Q14A 3HCEA 2G1UA 3K4PA 1NV8A 1YZVA 3DZKA 4X93A 3VNSA 3UBTA 5IMBA 2RGYA 3OZUA 2NADA 4A10A 5ARBA 1LRKA 3TQQA 2WF6A 2ZCUA 3Q3EA 5KQMA 2ZAIA 3L7JA 5CA0A 1IIBA 4B47A 4YDSA 5L53A 4ARBA 4O0LA 4ZRDA 3CR8A 3EAFA 2BE9A 5TJHA 5KU7A 4WFJA 3AUTA 4URFA 1MIOA 4MEBA 4HQKA 3ND5A 4BCBA 1Y4SA 3A9VA 4LRYA 3C3EA 4YP7A 3THSA 4CR6A 5T57A 4YLGA 2REXB 2QUBA 5LQSA 1JFSA 3H5WA 1V71A 5F73A 4ZZ1A 3G2LA 2PH3A 4FFRA 2GM9A 2H6EA 1PLJA 4QULA 2WIFA 1U7UA 3PQ8A 4C20A 4GSYA 1K8RA 3KJZA 4ZAVA 2CC2A 4CUZA 5EJGA 3A6LA 3FLBA 4LMBA 2ZPUA 2FZLA 5I45A 5KVVA 2PSJA 2P5TB 5DLEA 5LP6C 3LUAA 3K9WA 3EHDA 3H11A 2D2IA 1DPGA 3D0QA 3USCS 3VRHA 1E5LA 1YIOA 1DMSA 1Y7TA 5A7HA 2GI4A 1D2RA 1XEAA 1I24A 2Y4OA 4MP3A 3V6LA 4AKTA 4LSWA 2JFFA 1U0OC 3I23A 4CGZA 3GIDA 1NNSA 1MNAA 2YVKA 1LF5A 3P96A 2YV2A 3Q9SA 2Z5GA 3E6AA 5C8VA 4IKPA 3VVMA 1RPTA 1QGAA 4M1TA 1HMPA 3BS4A 4Q82A 3ZEAA 2BM8A 3IEMA 1TFRA 2X0IA 1NRIA 1LA2A 2KE5A 3FPEA 3PSAA 5A0FA 3NBMA 1J2JA 5THKA 3HGTA 2V9CA 3O74A 5KNLA 1Z75A 1QGYA 3H7IA 1C41A 4R5HA 2RHRA 4QICA 3UMJA 5IFLA 2OBBA 3AUAA 1YHNA 4YCAA 2YN4A 3JD2A 2HSWA 4M0UA 2JG3A 4E5YA 1KGDA 3G8BA 2AMYA 3DKRA 4P3OA 4XUCA 3I01A 1G16A 2P90A 5FI3A 2IK8A 3NC4A 4OYRA 3HA2A 5L9AA 5J4VA 1KYVA 3AONB 3ZDDA 4FJ1A 4H16A 1ZBQA 1ZNYA 1MFPA 4Q1CA 5IT5A 4CG2A 1QDLB 3KUUA 1UAAA 2FF7A 1NTOA 1DOHA 2Q2WA 5FI5A 4D0LB 4HLNA 4A8JA 4R1OA 1JRLA 2YHAA 3IVCA 3O3CA 4PYOA 5JCOC 3QNMA 1XPRA 1HTWA 2IV3A 2P4SA 1P1BA 1PWZA 4B9AA 3D8NA 4DCVA 1G0NA 3L8DA 3DT6A 1OMOA 3ES9A 2RH9B 1TEVA 5AVRA 1E77A 1BNCA 3EDCA 5MDHA 1ADJA 3RRMA 3HVRA 1XV5A 3V1YA 1HOXA 3CLKA 3OT4A 4A16A 5IULC 1M6VA 4QGGA 3WZ2A 2DKNA 1CUGA 2B4RO 4AECA 2C7RA 5JCJD 5E7QA 3GUYA 4D79A 1B6GA 3L7DA 4UNQA 3S4YA 2YIJA 5E95A 2ATIA 1JMKC 1T4CB 1YJAA 1P18A 3PP8A 4M55A 3LY8A 4BC1A 2H11A 5C7YA 1Z56C 4DBZA 1WSBA 1B8NA 1YBVA 2NNLD 5KYGA 2AD5A 3H1AA 2J09A 1VLVA 2CBXA 5T8KA 2V9ZA 5FFMA 1H5UA 2E9SA 1Y4DE 3S2GA 1ATIA 3DPSA 3GAFA 3JW8A 3KDSE 3WMEA 4PAWA 2XMQA 4C0LA 1D6SA 3MG9A 1NX6A 1JA1A 3OHPA 3LP6A 4KOEC 3KEMA 1NHGA 4WBNF 4HDNB 2FWNA 4XLZA 1DAFA 3RKSA 1ZH2A 3V1LA 3P4YA 4BB9A 1SUSA 2RGCA 3WADA 1Q0ZA 4MLCA 4K2AA 4RHYA 1G8YA 4L7VA 3K4HA 2XZOA 1EVQA 3TRHA 5FCDA 1KJQA 3MT0A 4UUMA 3DJYA 3V8NA 4F72A 1BHSA 3O8DA 5ULLA 4BEVA 1YIDA 1KJWA 3HVHA 4XI9A 1G64A 2P68A 3HSKA 4E7PA 1U2GA 1OXBB 1EFTA 2FQWA 3R6DA 1JR4A 1WX1A 3AZQA 4HI0E 1MB3A 1X3LA 2GTHA 2Q07A 3WB2A 4BNJA 4LFAB 2Y9PB 2VQ3A 3PGVA 4JFAA 4QRIA 5DXFA 4YJ3F 1YUMA 3P26A 3NTRA 2XWSA 3RYCA 3UJ8A 2BI4A 3LV8A 1NMSA 2HZBA 1OYYA 5BSWA 4ARZB 2B5VA 1T8PA 1QK4A 3DMHA 4KFSA 1Z0AA 1YKSA 3BCHA 3FPSA 1BN7A 1UAGA 3PXXA 1S8FA 1WL8A 4D5EA 1FLVA 1R8SA 1SRRA 1SVSA 2YINC 4ERXA 1M2VA 2XTAA 3MVEA 2BR3A 2OO3A 4PGAA 5DYIA 3PTAA 2CL0X 4WZBA 1G5HA 2FAXA 5L6LB 3EDQA 2JIPA 3NKLA 5KTPA 5GJVC 3M6AA 4J7AA 3DDWA 1X1TA 4AN4A 3HYSA 2NSYA 2C94A 1AM4D 1JHDA 1W47A 2FCRA 3KZ1E 3M33A 4MWBA 2WY2D 5JASA 1Y3CE 1RBMA 3EHEA 5J1TB 3TLYA 3BE5A 1U2EA 5LLDA 2CF5A 1UODA 4JJEA 5AJVB 5ALPA 1DIHA 2DSNA 2IP4A 2PHZA 2QW8A 3CS3A 3G82C 2QP9X 5DHPA 2ZTLA 4XM1A 3RC1A 3RSFA 1XDZA 3V42A 4EGCB 4ZYLA 1JEYA 3KZCA 4GPIB 4WOBA 2GRJA 4EGQA 1OQAA 2IEAA 5EHGA 3TS1A 1NIPA 3PDJA 1PRYA 1Z33A 4IGKA 2GBLA 1B2RA 3KETA 5HUHA 5ALMA 3WMFA 1PGNA 3AF2A 3DTYA 3RC7A 5KKCA 2AG1A 1REQB 2V55B 1ODFA 1DINA 2AA3A 4U3JB 3CYFA 4HN2A 4KITB 3MMSA 4CKEB 3Q12A 1S2OA 1NE2A 1R5NA 2PVCA 3Q9NA 4MZDA 3VXKA 1PL0A 2QR5A 3C4VA 3WBBA 5IXSA 2O8EA 2ZUDA 1KVTA 2W43A 2VZLA 5I9NA 1KC3A 1Q12A 3N07A 4PQRA 3O4JA 4NWIA 2Z2KA 3CG4A 4N12A 5BRAA 1E7QA 4MLDA 3RD5A 4YMHA 2ZCJA 4JVNA 5FTNA 5B2EA 1C9NA 1E5DA 3KQVA 3G7NA 1EJ2A 1L3BA 1ODJA 2I29A 3ESYA 4WGGA 3OA2A 2VK4A 1JPJA 3OICA 4QJIA 1EK5A 1GTL1 5GVRA 1PI3A 1IM8A 2IWHA 1A8HA 1TADA 3RWBA 4BUZA 3E0XA 4F86A 4IUBS 2Y1WA 2ZS8A 1EI9A 1TUEA 5TPZA 4AWXA 2K4MA 5CEJA 1GSOA 1KJ8A 4Q02A 1VP3A 2XUOA 3MSCA 1JAXA 1UMCA 4ZO4A 3C5VA 4MUNA 1U2DA 4TGLA 1DMRA 1GSHA 4RTRA 3NUQA 3QKTA 2AK3A 2EKLA 2Q0XA 1KYQA 1GL6A 4QQFA 1E1QD 4W7IA 1J8VA 3FWKA 2RCNA 3EB9A 4WY2A 5CIYA 4TWIA 1NWCA 3KTAB 3X1JA 3VKWA 2VDQB 4BO2A 5B1SA 4V0NA 4TRNA 3VYTB 1KFBB 5EE0A 1CJVC 1RW4A 1W5SA 2XMSA 4YBZA 1TE2A 3RIGA 3E7DA 3RU9A 3H9UA 5HOEA 5J4YA 1C7QA 2QPOA 4V0LA 1P2UA 5DT9A 3AP3A 3NEPX 1YJ5A 3PDHA 2YMQA 4F8JA 3OPYB 3A6DA 4KO4S 2YOFA 3CLTC 1XCJA 1UIMA 3IIKA 1HSOA 2B6NA 4P2GA 4L0CA 4RELA 1WTAA 4YRFA 4UVIA 3T54A 1EP9A 5FOSA 4IFEA 2JGNA 3TLGB 3VR5A 3H2JA 4IL5A 5F9HA 3WRVA 4I4NA 4JLOA 2PJRA 4MW2A 3A0UA 3AWIA 4BATA 4QFCA 4EI8A 1OPRA 5JSQA 5LQJA 3N75A 4J1TC 2D2EA 1QZXA 2W37A 1L3CA 1S8NA 2WBLC 3HV2A 3IEPA 2XNJA 4HDSA 4JUFA 4E94A 4U2DA 4DCCA 3H9BA 1LPBB 1RIIA 1GZDA 4L7QA 4P4NA 2G0NA 1D8AA 3BXGA 1CE8B 1SVKA 2P9HA 3N2IA 4Y9SA 2Q7OE 4M9SA 3OO0A 3G88A 5IJ9B 4R3NA 1BCRA 1O8CA 3LYAA 1L4YA 3B36A 3NOOA 3OPYA 2BEWB 3PCRB 1GPKA 5FYQA 5DTQA 1FXUA 3NHZA 1DWPA 1RRMA 1C9JA 1VLZA 2DSTA 2JJ1D 3N5CA 1YRLA 2R11A 3IKJA 3L01A 2P2SA 3TLAA 1NTRA 1U6KA 2HC9A 2P77A 1IPFA 2YRFA 1IPEA 1XAJA 5BNZA 1NBWB 1W4RA 2IPMA 1JJ7A 2JHPA 1WOYA 3I6MA 4EG8A 1VPDA 2OGWA 5EIOA 2PL1A 2RBGA 4NATA 4R8MA 2JLUA 1JB1A 3WRWA 1KSFX 4F3TA 1SOMA 3GH1A 2XAAA 3OIUA 2JHFA 4X7MA 4EQ6B 1A5BB 1BJKA 2JNWA 3HFJA 3WOHA 2OCIA 2P65A 1ODSA 1W5TA 5HGXA 1AQNA 3K5HA 4YBRA 1RJWA 4IX9A 3RYHB 3VJRA 1KKLA 3V8RA 1QRUA 1I0ZA 1QKIA 2CXNA 5ICEA 3FPKA 5EPEA 4TSRA 3TZCA 5HE9A 3PVCA 1Z5ZA 3K9LA 3O8NA 4CI9A 3LBYA 4TUYA 4DCOA 1NXOA 2JS7A 3N2EA 1NVTA 1E5TA 2B61A 4LOKA 2BFMA 4BWGA 3FOEC 4MVJF 4A0SA 3KKMA 3KOOA 3MBIA 4YO8A 2I9PA 2FVXA 3KQQA 5AVTA 1FSPA 1PT6A 5GV7A 4FMBB 4FVTA 3WS7A 2PUEA 1VL2A 2CNWA 4WX2B 3RVKA 1Z4QA 1JKXA 2A9OA 3RVPA 4XR9A 2O06A 4IBOA 4LRWA 4PVCA 4XQ9A 4F5EA 4EJ0A 2Z95A 3AQ4A 3QNWA 5EXEA 1KPIA 1K4KA 2BE7A 3N53A 4I4IA 4QDZA 2ZE6A 4AM8A 4QGSA 5LD2C 2I6SA 2YN2A 4OGWA 2RGNC 3OLQA 4HK4A 3W3ZB 2EKZA 1SHZA 1ULBA 3MRVA 1W52X 2GOYA 3MTQA 2PWYA 4Q9IA 5DISB 5B36A 2YYZA 2FX3A 1Z38A 4EEXA 4IQGA 2OHFA 3MGKA 4U7PB 4X1YA 5GM2A 2CZQA 4AX4A 4WDQA 5AKZA 2P6MA 1SVWA 1XMVA 1W5BA 2Q5EA 1CDZA 2BP7A 3AF0A 3MTAA 4OI2A 1AVTA 2Y99A 5ERGB 3S55A 2CNBA 3MGBA 4JI2B 3TD9A 4D74A 4JA0A 1ZR2A 10MHA 3A1NA 4G5XA 1D4ZA 3ZHBA 1NQAO 3HV0A 4JVMA 2XHEA 4UE3S 1FW8A 4EY6A 2D1YA 1C3XA 3H2KA 1BKSB 4Q93A 2BEKA 3C74A 2OB1A 2E37A 2GCIA 3WWZA 4ESVA 2FWMX 2I3AA 3AUXA 3CSUA 2FFBA 2GS9A 3GFPA 3P2IA 2KQUA 4LF4B 4JYBA 1UBNA 3DV2A 5AKJA 4F9FA 4KLCA 1B8OA 3RBVA 2ID4A 2JC3A 3AVYA 2XKBA 3SZUA 1QO0D 5DN6D 1FUIA 2J5KA 3D1JA 1RM0A 1MO6A 4RCZA 4B6RA 2C4WA 1OVGA 1KI8A 4MQMA 3MHPA 2GDJA 2VP9A 4CCAA 5TLSA 1ISSA 5JMOA 1KFCB 2E4WA 2F4NA 3DLPX 4TLAA 3PR2B 1TUBB 3GFQA 3OZCA 2B78A 1H2YA 4HS9A 1I9CA 1WJGA 2P0AA 2I4MA 4I1UA 3VOBA 3IEUA 3ESZA 4ZYUA 4OEHA 4DR5B 2AZXA 3CJQA 4PLPA 3CCBA 3MWDA 3IB3A 1QTIA 2H4XA 1QP4A 2IXEA 2QS9A 4GI3A 2AG6A 1JSRA 1VKRA 3DR5A 3I9JA 2NYAA 3IE0A 1E2QA 1JKJB 3G89A 3T3EA 4ESEA 3WSWA 5T4FA 4Q6WA 4EY4A 5JPIA 1GRNA 2E6KA 3ANSA 4P7KA 3CLTD 4AJHA 3LJKA 3BRCA 3TSAA 4MR7A 2IH4A 3ZD7A 1RC1A 3K9GA 3NH6A 5AT1A 3QRWA 1Y48E 5B57C 2ECFA 1JMVA 4IO1A 5KTRA 1LVGA 3LC2O 5DM0A 3H04A 4JXXA 2J08A 5DM60 3S1AA 3EIXA 3L0SA 4ZC1A 5K8UA 3PYMA 3ELYA 4LAFA 1DT5A 4G0MA 4JLNA 4B34A 5B4UA 1HDRA 2HQSA 2G1PA 4I3FA 2RH8A 2CD9A 1Q50A 4U0JA 2PU7A 3MFYA 1JWLA 1D8TA 3P94A 1A7JA 1XP5A 3Q5GA 3EEBA 5BURA 1NM5C 3GWGA 1BCRB 2UYOA 2XYQA 3QVGB 4DSNA 4EA6A 2ZIEA 1TGYA 1NI5A 1RBZA 3RAEC 3CUSA 4Z1OA 1KRHA 4PNPA 1M7BA 4DR1B 3DL7A 1ECJA 1M6HA 5ARDA 3ZE2B 4Z3DA 5KYUB 1L8LA 2EFDB 5LB4A 5KB3A 3I2HA 1QIEA 1HOTA 1SCBA 3PHJA 4YT4A 3ZE9A 4KQ6A 3TTSA 4RS4A 1YC2A 3AJRA 3E03A 1F1BA 3A9WA 4FS3A 4FR0A 3I5XA 2CZCA 2Z3VA 1HGXA 1KAQA 2PS3A 3MQ4A 1LSJA 3IAM6 3IDAA 4MVJG 1ZJ4A 5DSXA 3ZE7A 1P5ZB 4B3DA 5J2TB 1LKZA 2ZB7A 5EJ2A 1W8IA 5E6RA 3CZ4A 1E4EA 1CJCA 4KEAA 4HH4A 3IVXA 4N01A 3WDLA 1CUSA 1TZ2A 4BVAA 4LXXA 2OK8A 4GAEA 2ZSHA 2WFLA 1DELA 2HRBA 2FFRA 1S2NA 4CM7A 1B76A 3MJTA 4BB5A 1V8PA 2MOKA 1SM4A 1DIGA 3AIIA 3N7TA 3QLUC 3W6PA 2QTRA 3LLMA 2REQA 4GZLA 4AZ3B 3TZ6A 1K0FA 3D7LA 5CUQA 1PZMA 2A9JA 3KXIA 4B6PA 4DDUA 4UC0A 3ZWXA 2C7GA 2EFGA 1QHHB 1UDWA 4NPHA 1SU6A 3O4FA 1C50A 1R74A 4L8YA 2UV8A 3BWDD 2YVQA 2EC5A 4R1MA 3PLAE 1GGMA 3U81A 3AZOA 4YRQA 4EF4A 1Z6YA 4QVIA 3B3JA 2BFBA 4IRMA 4OQLA 3K2IA 5E6SA 2ZYSA 3QA3E 2JA2A 1VZ2A 1ZPDA 2XCQA 3GUVA 1RXUA 4QG7A 4YJ2F 2WT9A 1CZNA 5CT5A 1IY1A 5B3LA 3G2QA 3G9ZA 3KOZA 4JY7A 4KV9A 3ZE1B 3D4IA 3JZMA 4J90A 3G0IA 4TL9A 3ESDA 1T9KA 3AC0A 5HKOA 3ANYB 2UU9B 3FDZA 2JD2A 2IOFK 4RKQA 2DWUA 2HR1A 3KFLA 1L5HA 1EGQA 2WAAA 3WWPA 1KYIA 1AK9A 2IELA 3T7DA 2VDWB 4KXMA 3D7SA 1DXHA 1U7ZA 2PR2A 3DCIA 5F7JA 1QG0A 4M8SA 4U39A 1B0PA 3OD5A 3VZBA 4QYTA 4AP5A 4Q4HA 5AW8A 2CV1A 1B2LA 1GTG1 1UBRS 3MTIA 1NHWA 1LBQA 1WVGA 2BTQB 3G59A 3VH2A 3HDJA 3BULA 4OI1A 3RH0A 2ZBQA 3PUVA 1X9IA 2EKQA 2HADA 4C07A 5EEGA 3UY4A 1H85A 2AHOA 1VRWA 1ZZEA 3CGGA 2ZIWB 1U9IA 2NOAA 3GEDA 2ZROA 4GXTA 3VHRA 2PVSA 2R8XA 3OWXA 1UC4B 3ZBQA 3AEQA 3M3PA 2D2VA 2WLTA 2PGDA 3MTEA 4RESA 2AI3A