1C5BH

Decarboxylase catalytic antibody 21d8 unliganded form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
b'QVQLLEPGTELVKPGASVKLSCRASGYSFTSYWMHWVKQRPGQGLEWIGLIDPSNGRTNFNDKFKSRATLTVDTSSSTAYMQLSSLTSEDSAVYYCVRIAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHIMERIC DECARBOXYLASE ANTIBODY 21D8
molecule tags Immune system
source organism Mus musculus, homo sapiens
publication title Catalysis of decarboxylation by a preorganized heterogeneous microenvironment: crystal structures of abzyme 21D8.
pubmed doi rcsb
total genus 41
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1999-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5bH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5bH02
1MCWM 3MROB 5EO0A 3T4AB 5HHXH 4YXHL 5SWSB 1CZ8L 43C9A 2R9HD 2EH8L 5IIEB 3CMOH 4QRSB 4XBEH 2EDNA 3FOLB 5F3BA 1GH7A 4M9OA 4F3FA 4RAVB 3PDOB 3QZWB 4WY7H 4BH7A 3RUGA 3BW9A 3ULUE 1J87A 5HYIA 3ARXA 4PYGA 3TZVA 4KAQL 3RKPA 2VDML 5I15H 4L8CA 4KI5D 4MB4A 1PW3A 5TE7H 4WI2A 1F5WA 4XP9H 4XPFL 3NFSH 4MQ7B 4BSWA 2JIXA 3ESVF 2VLJB 8CGTA 5IG7A 4HIHA 1JGUL 3GMLA 3P4NA 3TF7C 3TN0B 5I17B 4MX7B 3AS1A 4JR9H 1HKFA 3WKMH 1BQHB 4W81A 6FABH 1T21B 4I0PC 4DK6A 3LZFL 4HD9A 1ZKAA 4TQEL 2A6JB 3HE7C 3EKCA 4UT6L 1Q9OA 3FOMA 3GHBH 3WS6A 2NY4C 4FQXC 5GSVB 1D9KD 1CQKA 3H7BA 5BVPL 3STBA 2IADB 4ODXA 1VA9A 4H8WL 5L9DH 1F45A 4LHJB 1JYNA 1A22B 4ZS7H 3G6AA 4LLQA 3MNWA 3RAJL 1NC2B 5GIRB 2WLZA 1VEOA 1WT5C 2DQGH 2JJVA 3I6LE 1FZOA 1CD1B 4EXKA 3VMNA 1XR9B 2IPKA 3PQYB 4DAGH 3RY4A 3T2PA 5LGJA 4JFZL 4XCYA 2ITDA 3TNNB 5GJTH 3ZZ1A 5ENWA 3VXRB 4HWNA 1A0QL 3HLAB 3V4UH 2I9LB 1A64A 2O61A 3NH7L 3QDGD 2Z31B 3EOTL 3JV4B 5I8KH 4JQIH 5IVXE 3GIZL 5IT2L 1EZVX 1R3KA 1AXIB 5DQDL 3DXAD 1CK0L 3BN9D 1ND0B 2Q1EA 5IVOA 3PGDA 4KKBC 2P5EB 5J3HC 1DL7L 3FN3A 2BC4A 5AAWA 3S4SG 4QF1A 1R3IH 5L6YH 4J3XA 5IBLC 2I60L 1RUQH 3ARUA 3E3QC 2V7HA 3CZFB 3VI3F 4LSTL 4HLZG 1KSRA 1GC1L 4FG6D 4HUXB 4HJJH 5H94A 4PV8A 1IGJB 3V0WH 1KEML 4JHWH 2QV2A 1JV5B 3NFPB 5H37H 3NN8A 4ODBD 3K8LA 3RVUC 1B9ZA 4XNQB 5DUMH 4Y2DD 4PLOB 1NCTA 1FFNB 1XZ0A 4FFVD 2XQYK 5CCKL 4ELMB 1HHKB 2VUOA 2X70A 5LXGH 1NGWB 1TZHA 1CU4L 1S7VA 1WJ3A 5E00B 5F9WC 3QJHA 1G7LB 4PGZA 3EO1B 4M7ZC 2NCMA 4XBGA 1FAKT 5C0NC 4X7TB 3RTQA 5CEXA 1TLKA 3LS4L 1LP9E 4MJIB 4WW2B 5J6HA 5IMMA 1N0XL 2MQCA 2G75A 4CW1A 1EEQA 3ARRA 4FQIH 1SY6L 3OJ2C 5DJAA 5ESVA 4NJAL 5EU3A 3B6SA 1P5VA 5TF1L 2APBA 4XCCH 1I7TB 5DUPL 4GMSH 4HZLB 1I9JL 2WUCL 2G60L 3RIFF 1QSVA 5D5MF 1HH6A 2VLJA 3FMGH 1I4FA 5I74C 4WO4A 4PRDA 3U0PB 1FL3A 1A7NL 5C70A 4OM1L 4A6YA 1G7PB 2LTQB 2K7QA 1BAFH 4R96B 2AQ3A 2C3WA 2AGJH 1DFBH 4CDGC 1LE9B 2CLVB 3NCYP 3HI6L 3MRCA 3FQNA 4AIOA 5HI3C 1B4RA 3LRSB 3H2WA 4Y1AB 2OP4H 3VMPA 3VFWA 1H8SA 3V7AG 1OOAA 4P2OD 3FRPG 1AY1H 2ZP0T 3DUSA 4U1KB 4U6HB 1S9WA 3O2WH 1JGUH 5KSVB 4Z8FH 5FO8A 2UZXB 5E1AA 2QSVA 4NZJA 2CLZA 1T5XA 3MBXH 1R3LA 1MCBA 1XEDA 3MXVH 4OZFH 4O4YL 1QSFE 1EGJA 2DQHL 5D1ZD 5F7LB 4Y4KB 5DS8B 4OCXH 2YPVH 2CMRL 3QEQD 1U2HA 5GHWH 4JM2C 2EO9A 4QRRE 1YPZF 4L9LA 5I75B 3L3GB 5F1NA 3ZE2F 5TE6L 2BK8A 5ENWB 4GAGH 1CFTA 4IRJD 2CIKB 2FX8L 4XWOC 1IAII 2KKQA 3MOAH 1UKTA 2R9HC 1U58A 4MJ6B 4NQVB 5IVXB 5JA8B 2FWOB 3VFMB 1QPXA 4K8RL 7CGTA 3BPLB 4M4PA 1I9EA 3ECBB 3CLEL 3E2HB 1KEMH 4DVBA 5JQHC 2DL2A 5ICZA 3QG7H 5ID1B 3DMMB 3KPSB 3QDMD 2XXCB 3BQUA 1NGZA 4PBXA 3QI9B 4JFHE 3OV6A 2W59A 2Z31A 1G7HA 3IFOB 1DEDA 2P8MB 5GRXG 3ALXA 5I1CH 1DEEA 5T3ZD 4Q6YA 2JCCE 4X6EA 1DANT 3TWCL 1KUMA 3NPSC 4LP5A 1R3IL 2C3HA 3KPQB 3P9MA 1F6LL 1HCFX 3P2TA 5I75C 3PHQA 1OW0A 4PUBL 1NAKH 5DLMH 3PDDA 2X70B 3U9PH 3CFCH 5KG9A 1TZGL 4LRIA 3DXAB 4OCNC 4XP5H 2NY1C 4YHYB 1G0XA 1OTSC 2UY7A 3HE6A 4P59L 4PLKD 5CP3A 3SGKA 3U7YL 1KFAH 5DJYB 2ITCA 3PP3K 1ZLWK 4HCRL 1WBXA 3QXAA 4XC3H 2P45B 2BNRB 2D31B 2OZ4L 3QAZC 3FB5A 3CSBA 1FFNA 4HF5L 4OZGB 4OGXL 2VDOL 4UZGA 2JIXD 5ADOH 1EO8H 4XP1H 4XCFH 1BIIA 3MJ7B 5IFAH 3T8XA 4YPGA 4D3CH 4IHOA 4W70A 4X5WB 5E9DD 4K7FA 5DD6B 5DD5L 1GIGH 4F3FB 3B9DA 3TBVA 1A1MA 1WIUA 4NKMA 4P4KB 3SDDA 5IKCB 2HA1A 4RWYH 3MLSH 1BEYH 5A40E 3QH3A 4HC1A 3HMXA 4M8QB 3ESUF 1N5AB 4X7SH 4TNWF 5HVHC 3TFKC 2ZSWB 4QHUB 1NBVH 5EBWB 4JO2L 4ALAL 3K8KA 2YPLB 3VFTB 4O58L 3REVB 4OLZL 4HJGA 5D70L 2FYYB 3U0TA 5LKNA 4EIGB 5D9SA 1PG7L 3X3GL 4XHJD 2NLJA 1M7XA 4DKDC 1KTKE 4V1DD 2NW2A 4XBEL 5KAQG 2PUQT 4U3HA 4NNXB 4KKCD 1F6AA 5D7SH 3PL6D 3MBXL 3ROOA 2X4QB 4JO1H 4P2QA 5EG6C 4N0FA 4Y0GA 4ZOAA 1WC7A 3MLTA 3S37X 5MI0C 3EBAA 5KANI 1ITCA 3FKUS 3VD5A 1MLBB 4RMTA 5IVNA 2XA8L 5D2LF 4QYOB 4PRIB 2IAMC 4KMLB 1R5VB 1U8LB 2F8OA 3AB0C 4KUCF 3P0GB 3ES6B 2FDBP 3MV9A 3SDCB 1IQWL 1SMAA 5DD0H 2QQKL 4AH2A 4OLYH 3SDAD 3S3SA 3T0XA 3X3FL 4XMPH 5KOMC 3BP5A 3U2SA 1QQDB 5IFHL 4AG4L 1HHIA 4HIEA 5K9JH 1UWGL 5FUOH 3SDYH 5L6YL 4HIIB 3TT1H 4EI6A 4D9LL 2J1KA 4JRXD 2E7HA 4IIQB 4ZFFB 1BLNB 1CDJA 5BO1L 4RZCB 3QQ9D 2GITA 5K9JL 2DLTA 2AK4B 3DOSA 2R2CA 3CPLB 5HI3D 1SY6H 2VLKE 4EQ2A 1D6EB 4F7PB 2QEJA 3FO1B 1JNHB 1MAKA 3PF2A 3TBYB 5JMRA 3VFNB 1P2CA 4KK8D 2Y7QA 2MQ0A 1K8DA 1M05A 2NY5L 3RGVC 5F9OL 5C07E 5K9KA 2OL3L 4O2CB 2ID5A 4R90L 5FAAA 3OWEA 1JZ4A 1AR2A 4NQCE 1FYTD 4OCWL 3QI9D 3O45B 4ZS7L 4JZJA 1UQSB 2W60A 3FQUA 4AQ1B 1F58L 5ESAA 4JKKA 1P69B 1EO7A 3ARQA 4YHZH 2X89A 5DJ2B 3MZTA 1ORQA 2GY7B 5CEYA 4LK4A 4G3YL 2BNQB 5GS2H 3MRLB 2DWDA 1FO0A 1MFCH 3T3MF 4HFWB 4UU9A 4HFUH 4N0RA 1K8IA 1Z3GL 5DJ8B 3TGXA 2Q86A 2Z4QA 2FIRT 1A1MB 3QXAB 5E08H 5KSVA 5HDQH 3SGJA 4Z7VF 1T0NA 1OSPH 5IW3A 3I3EA 2EIEA 4YDKL 3S8WA 1GCFA 1FL6A 3DI2B 2M26A 5DF0A 2P44B 1RZFL 1OTUC 1CF8H 3GSUB 4H0GA 3X14B 3O3AB 4JRYA 4FFWC 4PJIF 1TQBB 3RX5A 3WJJA 1DDHA 4LSPH 4BYHA 1HHGA 3HPLB 4PGCA 1JNNL 2EE6A 4GXVL 4JFZH 5MEPA 4E41D 2EIZA 4NQCD 3JWOH 4HV8B 4OFPA 4X4ME 3E0GA 3BISA 2I9TB 4NJ9L 4NKMB 4NFBA 4K23L 4PJ5B 4Q0XH 4JB9L 3UDWC 2FLBT 4HMEA 1RQ5A 3RDTD 3VFUB 1RU9H 1CZ8H 2C4FT 2AXFB 3TYGL 4QXUH 1R24A 3BDYL 4FHBD 2HFEA 4DFIA 1AGCB 2XZQH 1T83C 5ITFA 3JV0A 3S4SB 2X4TB 4ZFOL 3REVA 3C5SB 3WFHA 3GRWA 3DUUB 3FT2B 5C2BH 5E2TL 4LF3A 5IFJA 3IU4H 3UTSA 4LPVA 4X6EB 5KSAA 4Y4HD 3CSPA 1LMKA 4PRBA 3L3GA 3OZ9H 1GSMA 5TDNA 2JE8A 3QDGE 4PRAA 3V7MA 4Y89A 1QLEH 1TCMA 3NACL 2FYYA 1WICA 1I8LA 2A0LC 3M8OL 3DBXB 3PUCA 1MHEB 1QR1B 4M7LH 5IW1B 2Y72A 2YD4A 1EVTC 3FJTA 3V5DA 1CG9A 5H35B 3O2DH 2DICA 4XMLL 5MP6H 2QQKH 4X9BA 1KIUA 3MLXH 1M05B 1FJ1B 1ZHLA 3ZE2E 3MACH 3O41A 4NC1C 1UB6B 1HCVA 3X12A 2XWBA 4ODUB 3H3KA 2R0KL 1JGLL 3PWUA 3SDAB 1YPZB 5IJVB 2QSTA 4X5XA 2Z93A 4UT7H 1KLGA 1J05B 2XWJB 4D8PB 2QQLL 2CD0A 2IQAA 2Z91A 3EYQC 3DGCR 5GRUH 4BKLB 4DCQB 3EHBD 1PAMA 4I48B 2AK4A 5DD6A 4WDIB 4Y5VA 2UWEB 2JB6B 2BVPB 3DURA 1YEGH 3HE6B 4L3ED 5C0AD 1S7RB 3WFCL 1RFDL 5DJYA 2FX9L 2HVKB 3QB7C 1UJTA 2FJGA 4MXQD 2IQ9H 1YDPB 1K6QL 4NRZA 5CWSB 3HC3H 2JJTC 3EZ8A 1RZGB 2DBJA 3GSXB 5IEHA 2NX5E 4XH2A 4CRPA 1D6EA 1CVSC 5CP7B 4DN3L 2BRRL 4KFZC 1DR9A 1NBQA 3SO3C 3GM0A 3W39B 1WBZB 3IU3B 2XKSA 3FQWA 4LSSL 1A6WL 2EDOA 3Q6GL 4NKDB 4D9QD 2BVEA 2MHAA 4PJEF 3GBNH 1U3YA 4GRMA 1P5UA 1RIUL 3N1PC 4Y4FA 4C4KO 5E5MA 1IAIL 4MDIA 1A6TB 4RAHA 3WE6A 5IUSA 4I77L 5I1LB 4R26L 4BUHA 2OX5A 1LD9B 3ZLQC 4YFLF 2H6PB 4XNYH 2HTKC 2DQCH 3ARFA 4XP4L 1CLCA 3ARGA 5I1JL 2W65B 4M5ZH 1HILB 5FV1L 3V52L 3RY5A 4P2RD 4DGIH 4TTDD 3V6OC 3S6CA 2DWDB 1CR9H 4Z5RA 1KELL 3BWUC 2RHEA 5F3BB 4JJHA 3Q1SL 3FN0H 4U0QB 5HDOA 3MV01 1FVDB 1IC1A 3QIUB 1A14H 3E6FB 3LEXA 3G5VB 4URTB 2I9TA 1DVFA 2NX5D 4ZFZA 2VITA 1M71B 1G9NC 5IEKA 3U7YH 3MNZA 1QYGH 1A6UL 1J1XH 3P30L 3BEWA 2JCCA 1MFBH 4PY7A 1TZGH 2GCYA 1F3JB 4LPWA 2NY6B 4RX4A 5E8NA 1BZQK 3K8MA 3F7QA 3C2AH 1XGRB 1EEYB 1CD0A 1MY5A 5C09A 4H25B 5F9DC 3EYVA 2Z31C 4KRLB 4C54A 2E9JA 3HG1A 4TSBH 1UXWA 2OM5A 1WIOA 1DZBA 4JO4L 5FF6A 3W2DL 2ZCHL 2VXUH 2WINA 4MMXC 4U49A 4YXLH 4LRNH 1ACYH 1CD1A 2AEPL 4PRPB 1X5LA 2Q8BL 1LEGA 1XGTB 4BSVA 3SOBH 5AUMB 5GSVA 4D0BB 2A6DA 1CXHA 4X6CA 1L7IH 4JN2B 4LSSH 3CLEH 3K80A 1NGPH 4N5ED 4R8WH 5IROA 4J2XA 5INDA 4KRPC 3SGKC 3IB4A 3T3PE 5EU4B 4KTDL 1FGNL 2BY2A 3RGVD 5C3LD 4WWKA 1SM3H 1MJUL 2DM7A 5HI5C 1FL5B 4YBLC 2HJLB 4AM0B 4FA8A 1A0QH 3SO3B 1N2RB 1IZJA 3SGEI 1T7YA 4GBXD 3N1QC 3QNXA 4RNRB 5D2LE 3S7GA 2WBJA 3GI9H 3LHPL 3TPKA 1T1XA 2GSIB 5LGJB 3MRDA 1A2YA 2DKUA 3I50H 4OZ4B 4UILH 4OCXL 3RKDC 1H0DB 1G9NL 1Q0YL 3BIBX 2A0LD 4L8CB 4QO1A 5JLZA 4JLRA 4XTRD 3H9ZA 1RVFL 4WI9A 2FJGB 2QHRL 2IH1B 5L8JB 4TNVF 2ENSA 1MJ8L 5C0JA 1KENL 4XNQA 1A6ZA 4O02H 4I5BB 3MCKA 2VWEC 3NIFF 4NP4L 1NC2A 2VL5A 3KR3L 3P4OA 4RWHA 3JV5A 1MAJA 4G8GD 2DTMH 4UB0L 3O2WL 1A3QA 3BVNB 4X0KB 3RNKA 5I73B 1B3JA 3AXLA 3DVIA 4K3GA 4GKSA 2J8OA 3D39E 3D0VB 3BUYB 2VC2H 1A3LL 3OF6A 4KK5C 4XMLH 5MP6L 5FUCC 1JPTL 1PQZA 3KYMA 1XR8A 2LVEA 3I9GL 1VFAA 2RGSA 3FOMB 4WHYG 5T3ZL 4OLVH 1E4XL 2IEPA 3VFPB 5EO0B 1NFKA 1MNUH 4UT9H 4J8RA 4J3OC 1S7SA 3IDXH 2P5EA 1DCLA 1OAUH 2VDLH 3MV7E 4PD4K 3GMRA 1Q8MA 4X6BA 2HN7A 2J2ZA 4HUWB 2BFVH 4BH8B 3OG6B 3HNTL 5KSBA 1PX4A 4NT6B 4ZSOA 2XZCL 2HTLD 4FQIL 2V17L 3QXTA 4K8RD 2PYFA 3NAAH 1FC2D 1XF3A 3M1BB 4NO5B 3QIWD 5FCSH 4D0CA 3NTCL 4UQ2A 4PJ5E 1MI5B 1FVEA 5BW7C 3NZ8A 5KW9H 4PGBA 1RUAH 3EYQD 3GJFA 1TIUA 3RBGA 4GQ9L 3W9DB 3LD8C 4KMQA 1U3ZA 2GJZB 4PG9A 2XZQL 1R3KB 4S0SD 1RHHB 2FCBA 1WQVT 3EYOB 3HG1E 2GCYB 4JFEE 1KLFA 1FV1B 4CN4A 1WUNT 3BDYH 5CCKH 4YEEA 1H3VA 3MRHB 4P57A 2X40A 1DQTA 4U1JB 1FZOB 3RNQB 3JSSA 2XNAA 1MCRA 5IOPA 1ZAGA 3UBXG 2FBJH 2R0WH 1TQBC 3IAQA 4IM8A 1S5HB 1X5IA 3F7YB 1HHHB 1NFDA 4GXVH 1M71A 1SBSH 4LCCA 5IJKC 4LSPL 5GGRA 4S2SB 2YA1A 1X6LA 1AXSB 3PHOB 1P84K 3QDGB 2UVEA 1RZFH 1S78D 1IC7L 4QOKB 1GHFH 3TIDA 1RIVH 4JFOA 5DK0A 1F4HA 5L8KB 4U7KA 2I5YL 4IMKC 3O3DB 1F11B 2N4IA 5I8KL 3IXTA 4YO0B 4PJGE 2VLRA 1RUKH 2IANE 3H9SA 5GJTL 3L1OH 5D7IE 2ZUYA 1UKQA 4JZJC 4LHQB 4P23D 2W0PA 1Q9KA 1WEJL 4EVNB 4M6OH 3ZTJH 4XC1L 2KQMA 4MNHA 7FABL 2EXYC 5ABDE 5E0QA 4E42A 3IFOA 5E2WL 2RQ8A 3ULVF 3EZJB 4IS6A 4Z7OF 3GDBA 3TBTB 3N85H 1YN7A 1XF2A 3A6CL 3KYAA 4WENB 1TJGL 2X1QA 1NANI 2NXYB 5D1XA 1QFHA 2HFFB 1EPFA 1YEFL 3C5ZB 1RZIA 3LEVL 4M61B 4OD2B 5HVGB 2P8MA 1VGEL 3QCUH 2NY6C 4HKBB 1NGWA 3L5WB 3VGDA 1NDMB 3QRGL 2O5ZH 1RIHL 3DRTB 1IGCH 1A6AA 3DJ9A 5CJQH 2WWMC 2BX5A 4OAWA 3OJMB 3R8QA 1AGBA 3IDYC 1DBMH 4LVHC 1RJLA 5DD3L 4QHKI 1J0JA 4Z7WF 1CT8B 4NHUB 1UVQA 3DLQR 4ZSOB 4DKFL 3VG0L 1T0MB 1NGQL 3BIAX 4JPWL 3ZO0A 4ESKA 4KZEL 1U9KA 1ZVSB 4WW2F 5D93C 4PY7B 1PKQA 1IMHC 1UCBH 3UAJD 2XA8H 3U9UB 2WNGA 3WFBH 1B90A 3ZDXF 1QBLH 4F7MA 3RFZC 3O8XA 4HMCA 5KSAC 3OXRA 4HK3N 2WQ8A 1NBYA 5T1LD 3KXFE 4YAQA 4RGOL 5T1MB 3SY0B 2FBOJ 4K94H 2R23A 1HYSC 1UXSB 4TUJA 3VFGL 3WO4C 1UT9A 5L2JA 3PGFL 5KJRH 4NQDA 1IEBB 3OX8B 4Q9BA 1R3HB 4UTBH 3KPRA 2Q87A 1BQLH 4TVPH 4CAGA 3AVEA 1KGCD 1WISA 3FCTB 1DN0A 1R0AL 3QUML 1U8QA 2YEZB 3WL9A 5I0ZA 1NBZB 5IVXA 1AIFB 3FB8B 3B9KA 4PJGA 3SDXB 3P9MB 4U6VL 1CICB 5H2BB 4E41A 3QUXD 3D1MC 1YEHL 35C8L 4OZHF 3EJJX 5KG9B 1QEWB 2QKIB 3I2CL 3F6LA 4PGDA 3NCJH 1QFWL 4ZNEA 3IDMA 2W9LA 1JFQH 1CFTB 4NM8L 4JFDA 2VLRB 5ILTH 3QNZA 2DYPD 4MAUL 3LS5L 4GW1B 4ZDHA 3S5LG 1KJMA 3AS2A 2HKFH 3OKKB 2O5YH 3WCYA 1WZ1H 3MUY1 4N0CD 2F5AL 5BV7C 3MOBL 2NY1D 4FXGB 1EFXA 3CC5A 4HWEL 2WSKA 2Y07L 4OI7A 4F57L 1ZT1B 1P84J 2MFNA 1XGQB 3IDJB 3QPQC 4CVZA 2H26A 4PGJA 5C9KA 3Q3GA 1WVZA 1A6VL 5DMKA 1N7ML 1I1YA 5HY9B 5IR1A 1UACL 1WBYB 4YNYB 5BRZB 5KVGH 2LVCA 4QOKD 5BS0B 1EXUA 2P8LA 1IT9L 5DEFA 3FONB 1A7QH 1CXIA 2DQDL 3LB6C 3WLBB 5K9OB 4ELKA 3S36X 4EOWL 3P77A 4TOYL 4LPUA 3OGOE 1C5CH 1I1FB 4Y19D 4Y4HC 4UV7H 1W72B 4CMHC 1N3NB 2LTQC 2BP3A 4N0UA 4N9GA 4XP6H 4WGWB 1NCBH 4G9FD 4IIQA 1GHFL 1SYVB 4YHPB 5D72L 5BZWB 1NC4B 1P7QD 3GGWB 4NT6A 5E1HB 3BKCH 3BGAA 3UMTA 1YNKL 2GK0A 3O6MH 4FP8H 1PKQE 2QQNH 3M1BA 4Z6AT 3VFNA 2Q8BH 4LLAA 4JFQA 1ACYL 5CJXC 3UTOA 3BKYH 4HKJB 1S9YA 3G5YA 1RULH 4HMDA 4QTIL 3HA0A 4RFOH 4HW6A 2YZ8A 4G6KL 3CFBA 3N9GL 4KY1H 3T8XB 5EIIB 1JYXA 1LVEA 3P11H 2KH2B 2QR0B 4JKLA 1J1OL 4N8CL 1QTYT 3V4VH 5LQBL 1BX2A 1FFOB 1VPOH 5M94B 3B9VA 3MOAL 2AABL 3DV4A 4HWBH 4HH9A 4WV1A 3GHEH 2DQFA 2XXMB 1DQML 4G7VH 5KW9L 1J1XL 3OTTA 5I66B 1ORSB 3OXRB 2VB5A 3VJ6B 4HDIB 4L4VA 3S88L 4PRNA 5GGTL 2H2SD 3MRQA 2WUBH 3PNWA 4H5SB 5DJDB 4E41E 1IL1B 1JRHH 1F6FB 1R3HA 1W72L 4J4PD 2CUHA 3CH1B 5SV4A 1RV6X 2BY0A 4HLJA 3W9DA 4R2GB 2EO1A 4HXBH 4XVSL 5EZOL 5FGSA 1RURL 4J4PA 1L4IA 1PBYA 3MRNB 2ZUQB 5DO2C 1GOHA 1VENA 2NW2B 2BHZA 4NGHL 1A9BB 2AJSL 2GTWB 5CGYD 5I19L 4HUVA 5IROC 5HVHB 1ZVSA 5KS9F 5IOPB 5F7FA 1MREL 1S7WB 1XGUA 4PR5A 4WFHE 1KULA 3KJ6L 1CIUA 3C60A 1CBVL 2IFFL 1N59B 4WCYL 3JZ7A 2VZTA 4O2CA 5F89A 1CGVA 1F8TH 4M7JL 1A7NH 2E7BA 1PD6A 1JGDB 3CDYA 3TBWB 3HHRB 1XIWB 2BMKB 3M45A 3RGVA 4MS8C 4MQSB 1ZVHA 1TVHB 2X89D 3QWOB 5F72S 3BMVA 3QDHA 1JJUA 2MPAH 1LO0L 5D1QD 4RMQA 1FIGH 5I74B 1ZLWH 3ZHKA 3O6KH 1MCFA 1XGYL 3AFLA 2VH5L 3DX9B 4LGRB 1UWXH 3EJYD 3LV3B 3SE8H 2DLGA 5B38G 4HFWA 4ZUSB 3QUMB 3KNBB 4GW1A 4ZDHB 3ZYZA 3B2VL 1KG0A 4M1CC 1YEGL 3V5DB 4L4TB 4GKZB 5I8EA 5I76B 2AEIT 1MWAA 4KQ3L 1FZJA 4EVNA 2OR7A 4FXGA 2EKSB 1ZGLB 4ODVL 1M7DB 5GRUL 1QSEB 1QNZL 5DHYB 4A6YH 4JFPA 4K2UH 2FECL 2VLJD 3WEXB 1T2JA 4GUPA 4JFDB 1AFVL 1DQQB 1KTLA 5A16A 5TQ2L 4C83A 4G6JH 3UJJL 2ARWA 2IBZX 1A6PA 1I1CA 3J8F7 1S7UB 1B2WH 5HYSB 4TSBL 5DYOB 4RSVA 1S7TB 2VQ1A 5LAXB 3MR9A 4JZJB 4GSDH 4PJ5A 1PGRB 4JZNB 3VXTA 2CR6A 2X4SA 1YMHA 3R06A 2B2XH 4YHKH 2WBJD 1LEIB 1K9TA 4FZEH 4LASH 4HXBL 4G5ZH 2UYLB 5MEOA 2BNUA 4JM4L 1NCAH 4LCUB 3RL2A 4FQCH 3LMJH 1BFSA 1S9VB 2EYRA 4UU9B 5FHBL 3OKNB 1CDIA 2DYPA 3QZWA 3PDOA 4E5XB 5I1DA 3BW9B 2G75B 1XF5B 2DF3A 4UAOB 4CW1B 3W5MA 2LQRA 4EQ3A 2VDQH 4GRMB 3PQYD 1T3FA 2OTUA 1V8HA 2AJVH 3GSQB 4S1RL 2FIKA 1RMFL 1YDPA 2ATPA 3SBWC 2XICA 4MQ7A 3CXHJ 3ULVL 1LO4L 1W8OA 2UWEE 2V2XB 4RAUB 4LLMA 3FOLA 4DGYL 4MD0A 2PCPB 3HTLX 4MXVF 3CFDB 1T7WA 5IJKA 4HAFA 1MRFL 1C5DB 3DSNA 4KMTL 4NZRL 3NCMA 1IFHL 5KANG 2DD8L 2VLRE 3L9RA 1T66C 5EZLB 3IGAB 1V3JA 3JWOL 1RD6A 3T0EB 1YNLL 3VD9A 2F19H 3OAUH 4OT1H 1MFDL 3QDJD 5FO8B 2B39A 4X99A 3RWEB 4I3SL 3O41B 2CLZB 2A38A 2R1WA 3LKPA 4OD1L 1J05A 2CKBL 1K4DB 3DYOA 3O3BB 3SCMD 5L0QC 5BRZA 1GGYA 3GBLA 1BWWA 3ZE0E 3G6JA 3VXNB 4ZAKC 4NRXA 5BV7B 2GTWA 5EU6D 4X4YB 4KAQH 1U8PB 4UOW1 3PWNB 5IBTL 4J6RL 5IQ7L 2BSTA 5L88L 4O51A 2A9NL 2MWCA 2NY5C 4CADA 4OQTL 1MHPH 2VXQH 1D7FA 2XFXB 1ADQL 1RK1A 2VISB 1MCHA 3MNWB 2E7MA 3AREA 5B8CC 4JFFD 2FGZA 1HDMB 3C8DA 1JTPA 5CJ5A 3TH3T 4ZTOL 2BNQD 1ED3A 1IKFL 3MRIA 4Z95H 3I75A 1XGUB 4PR5B 3O6LL 1BWMA 1TPXB 5HTSA 5CGTA 1I9IH 5B38B 3QIUA 5H94B 2MHAB 3O2DL 3FHAA 5D1XD 4KK9C 4NM8H 2LU4A 5C86A 4OUUA 4D0DA 4L3EB 2IQAB 2XQBH 2YXFA 3KJ4B 5EPMA 1YEHH 3Q48A 1J10A 3MODH 3KPLA 2A73A 2D3VA 5F1IA 4JJ5B 1X4YA 1QLEL 3CFKB 4PJ8C 5ESVB 3THMH 4HXAH 3ZSSA 3MRMA 3WNMA 4OZHA 2NXYD 4I4WA 2H2PC 4CDHA 2K9UA 4PJEA 3TN0D 2PW1A 2R8SH 2KPNA 2QJDA 3KNBA 4OZIF 3A6OA 4FNLH 3V6OA 4PRPA 3CXDL 2DQJL 3L5JA 5D7JC 3VRLE 5F7EL 3O8XC 2FO4B 4YQXH 1ZHNB 2D03L 3HR5B 4ODSH 4MCZB 3BKJL 5L2KE 4YR6A 1WSST 3NZHH 3U46A 3BKML 1Y6NR 1LO2L 1A9BA 1LGVA 2WBJB 3QEGH 4W4NA 1EEYA 3SKOA 1DQLH 4HX1B 1NMBL 1TQCB 3G5VA 3MLZH 1CTNA 2XN9B 1RK0A 2HJKA 3CVHH 1BF2A 2R2BA 3K0WA 5DS8A 4UTAL 5EU3B 4NQDD 4PS4L 5D70H 1EAPA 5AG9A 1S9WB 4D0BA 4LIQH 5DJDA 2JCCB 3QDMB 4I8DA 3ARSA 5CJQL 3RWEA 5D7JB 4MD5B 5FKPA 1T5XB 5AD0A 3RHWF 5C1MB 5KSUA 3RIAF 3MLYL 1AHWA 5ACZB 5I6XB 2W9EH 5ESQA 5JW5A 5ADPH 3G9AB 5E2VL 3GMQB 4OF8A 1HXYB 4UNVA 1TPXC 5DJ6B 3QEUA 5A2IH 2IBGA 4HK0B 4DVBB 4QRUB 2ADGA 3TYFA 1NGXB 4XNMA 2WBJC 1ADQH 2EKJA 5EIQA 1NEZB 2FJHA 3JTSA 2CSPA 1GYAA 3BQUB 5FA3A 1U41A 2MTPA 1MF2H 5EC1A 4Z0XA 4U1MA 4HWBA 4OB5H 1YA5A 4LVOC 3RGHA 3OXSA 3LEYL 4APQA 5B39B 2BCKA 1U36A 4JAMB 4XTRC 1H3PL 5EOQH 4JFOB 4I0PD 1T22B 2AQ1A 3F7YA 3JWNC 1OD9A 4JZNA 1EMTL 3WDHA 3H3BC 3H9SB 3ZKMD 4LCCB 3ARBA 1G6RB 4MJID 2XKUA 4L4TE 3BWAB 5HPOA 3UPCA 3U6RB 3TNMB 2Z92B 4I18C 2JTDA 1FZJB 4Y2OA 4UV4H 4LDEB 4PJIB 1WAAE 2CXKA 5HHOD 1MPAL 4QNPE 3RNQA 4YHLL 1N6QH 4G8IB 3EFDH 4JGMA 4R4BA 3WIIL 2HT2C 3P73B 4R4FL 3JTTB 4Z7VE 5BVJA 5DRXB 2PKDA 1WWCA 1PY4A 5KS9A 2GJJA 4M4RA 4LLYB 5CHNA 3ROLB 5F7KC 2G2RA 4L4VE 2ATPB 4NUJA 4HGKC 3QG7L 1MI5A 5D96B 2EDFA 2AJZA 2LFGA 1A02N 1HHJB 3FQUB 4XXCA 4WI3A 1FH5L 4TUOB 2EDTA 4EDXA 4EI5A 1R3JA 3QG6B 4K8RH 3PV6A 4DQOH 1YQVL 1WWWX 1S3KL 3VWKB 5C8JB 3T0DA 5EOCL 1QRNE 4AEFA 3DSFH 43CAA 2IJ0C 2Y25A 4LCUA 4XPHL 4YXKH 2DS4A 3LMJL 2X05A 1OGTB 2R56L 1J0KA 1CI5A 4Y4KD 2YPVL 2W0KA 4YHKL 3QUKA 1HNFA 3VXUB 3U7AA 3G5ZB 3GFUA 4MWFA 3MXVL 3MNVA 5D2NA 3T0AA 4LMQE 5F97E 3CDGB 1OSZA 2A6KB 2VDLL 4L29B 3BT2L 2ERJC 2WMPA 4I4WB 4G6JL 5C0EB 3VH8A 3BH9B 4JDTL 5KVFH 4NYLA 4RWYL 1SMOA 4K3JL 1KN4L 3QHFL 1U8PA 1BQHA 1IGFH 1F11A 4LU5H 1LO5B 3MRGA 1I85C 2WV3A 3HI1B 3PL6A 2XN9A 2CKBA 2EYSA 2PN5A 1RZKH 2JB5H 2P48B 3L3DB 3OKMB 4P5KA 5IMKB 5D7IB 2AJYH 2XN9D 1AXSA 3HAEG 2HLAA 4JHAH 2VLKA 1WC7B 6CGTA 1ZTXH 1ZT4A 4JFHD 3GSNB 4PJFA 4DZ8B 3DYMA 1FCCA 5DRZA 3SE8L 4BFIA 3MRIB 4NQEB 3O6FB 5CMAA 1YNTB 5TPWH 1AGBB 4IOFD 1T21A 2HJKB 4LCYA 5E7BA 1IRAY 3SJVE 5SWSE 5J8OA 1UM4L 3OJDB 3WUZA 2A77H 5L2JB 4JKMA 5FYKL 1U93A 1B88A 1KPRB 4KK6C 5E8PB 5DK2B 1RJYB 4P2OC 2FH6A 2I9LA 3RJQB 3Q5OA 3TT3H 3WO4B 2BY3A 5D1XC 2EZ0C 2HJFB 1AHWB 5ACZA 3ZTJG 3TJHD 5DLML 1EJOL 3MRMB 3T4YA 4JN1H 1C12A 3FN9A 4NKIH 5IV2A 1KNOA 5BQ7A 3FO0H 3BH8A 4KU1A 3B9AA 5TH2B 3GO1L 2MCPL 1IGIL 1FRGH 5D5MA 2A6JA 3QEQA 5C08E 3B8YA 5JZ7D 5GSRB 3WIFA 4KHXL 4HPYL 4YXLL 4JHWL 5AYUL 3VFRA 5GS1B 2EDBA 4Y1AE 3ZYIA 3ARBB 3H42L 4X9FA 2GFBA 1GGBL 1AIFA 3FB8A 3IETB 5GZND 3MLPA 2B4CL 3CC5B 4OD3H 5IK3A 3UX9B 5GGTH 4XCNB 2Y1VA 4HIXH 1O7SA 4B53A 3BPOC 2EDXA 3QZWG 5I8CA 3CFJA 3ZKMC 1AQDB 2I25N 1MIML 3U7WL 1T22A 3TBYA 2GW5A 3RUGB 1U8MB 3BGMA 4ZYKB 1DUYB 3HI5L 3SKUD 3SBWA 2D4FA 4OD2A 4M1GH 5D2NE 3QSKB 4YPJA 2ENYA 1XF4B 4WTXA 2XTJC 5LWYH 4ZO6A 4MJIA 4WW2A 5E4EB 5T1KD 4RBPH 3GIVB 3QUZB 3BPCA 3ZHDA 2X4UB 1TJIL 3PP3H 4Z76B 3QJFA 5E8OA 3FZUD 5IMLA 3QRFM 3CDGA 5KVMC 3W0WE 1CL7H 4XP4H 1L0YA 1OAKH 5DWUH 4HIJA 1G0YR 4YDVB 3BRGC 1G7LA 4OCYL 5DJ6A 3RDTC 3CVIH 4YAQB 4LSQH 4QRUA 3ARTA 4U0RC 1T04A 4RAVA 4EN3C 4TRPH 3BDBA 1MCCA 5T1LB 5HBBA 4TQEH 4F9PC 3HRPA 5CGMA 3C6SB 3QUXC 1FVCB 1AGEB 2AK1L 3TT3L 4PJAA 3B6SB 3EW3B 1EAJA 2VABA 4Q2ZA 5FGBA 5TQ0H 4AEHL 1R24B 4JG1L 4TULH 3OF6D 1F2QA 1HEZA 3EO0B 3T77B 2WBWB 1SJXA 2YZ1A 4ENEC 1INEH 5F7NC 5J06A 4R3SB 4XCCL 2WIMA 1XCTB 4NKQB 1FYHB 1UXSA 1IC5H 1F3RB 1YEJH 1NUFA 5BV7H 1D5BA 4U6YB 2NNAB 5IHUL 5J3HD 3UTPE 3RVUD 5DEGA 4G43B 5CS7A 2DJUA 5SWQA 4YX2L 3VI3E 2YHGA 4M6NH 3D3VA 3KVQA 4TSAL 3UYPA 5F9WB 5IBUB 4WY7L 2E7LC 1ZLVK 4PJCF 5D5ME 3TIEB 4PJDB 3SCMB 3JVGC 3CH1A 1ZHLB 3NPSB 2M1KA 2VJXA 4YHOL 3QIUC 3LPWA 4N1HB 4V2BA 1P4LA 4JVPA 4ERSH 2H26B 3MRFA 2ZNXA 3P73A 4M7ZB 5IV2B 5IB2A 2XWJA 1YNTA 3H3PL 1WBYA 5D1QA 5IHLB 4NO2B 3VFOA 4Y1AA 1DBJL 2G9HA 4XNXL 4UIKH 1OAQH 3UPAA 4BFGA 2IPTL 3V4PL 5K9OA 1I8MA 5DA4A 5TE4L 3V6OE 4PJ8A 2GAZA 5LGKA 3OMZA 5JPNB 3V2AR 1N8ZB 1J8HA 4YHML 2Y06L 1RZ7L 5E9DA 4PJCB 1CQYA 5TDNB 1HHKA 4DZ8A 1N5YL 2FSEB 3MV9D 2DBLL 3KPMA 5CJXA 4HHAA 1KJ2B 3QULB 4WFHD 2YWZA 3BD3A 1KPVB 1QRKA 4U1GC 1IBGH 1JPST 3NIGF 2AKRA 3QQ9C 2EKSA 4LSVL 3T0EC 1ZGLA 2FGWH 5ALBL 1A9EB 4MS8D 2VNCA 2EZ0D 3QFJD 1YYML 4KRPB 1E27B 1NGYA 4PG2A 5CILH 1ORSA 5KN5B 2R4RH 4G80A 1BOYA 1Q0XH 3U30C 3VFSA 1FH5H 2J4WH 2N56A 2VXVH 3NN8B 3W0WA 1P53A 2GFBB 1IVLA 4LLVB 5JPMB 5ACLA 1KNOB 3NABL 3GI8H 2Z91B 3N06B 5HYJB 3ULUH 5HGBA 1X9QA 3P4OB 3U83A 5FYJD 3WFZA 5EO9B 1FCGA 2A1WL 1UZ6F 2DQJH 5FYLL 4CJ0A 5ID1A 4OQTA 5DA0B 1Q72L 4IDJL 5GGTA 2H41A 3UYRH 3QEQB 5I30H 1AQDA 3MV8E 4PB0H 1IAKA 4JFXB 4J1UB 3KPSA 1E6JL 4OFDA 1JNLH 1LO3L 1MPAH 1YY9D 4J4PC 4S0TD 5TDOB 2YD8A 3HNSH 1IGCL 4XBGB 1ZGLM 5DMYA 3ARFD 3TV3H 2B0SL 2B1HH 5DZNA 2OJEB 4LLUA 5C08B 3UCRA 5MERB 4Q74A 3D18A 4ZFOB 4L8SC 3GSXA 1UCTA 3BZFA 1IM3A 3PXJA 4BFIB 2WZPD 3K46A 5JOFA 1P7HL 2XI9A 5CIPH 5CJBA 3UTTA 3L6FA 2HWZH 1H3PH 5EOQL 5SWZD 4X6FB 4CN1A 5GGUA 4PB9H 1QLFB 3OPZL 2RAMA 2NXYC 3GSOA 4DN4H 4RAUA 2B1AL 2VE6B 4WHTB 4G6ML 3LEXB 3FB5B 4N9OB 4G43A 4X6DE 4NHCL 1FFQA 1C7TA 5ERWA 5FF6B 4IOFC 1L7TL 3H6JA 5JA9A 7FABH 5F89B 3L9RB 3B5HA 2BXZA 4XHQA 1YC7A 2VXQL 1YEKL 4P5KB 2AJ3A 2CPCA 4U6HA 3BPOB 2ZPKL 3QWOA 3BH8B 2WWMD 5FFLA 1KC5L 3BJ91 3HRZA 4JRYD 3GSNA 4LCIL 4HUVB 5EZIH 2NXZD 5DVKA 5EB9A 1T04B 4MA7H 4NQEA 5EORL 1IEHA 2MJWA 5E6ZA 5T1LA 2H45A 2VUYA 4POZD 2HWZL 4MD4A 3U4BH 4H26B 5EBLA 4I0PA 3S36L 1JPSL 1MCOL 5DUBA 1V7MH 5FB8B 3BP5B 5LAXA 4ZTPL 2X4QA 3DX8A 5LJYH 4XCNA 4PV9A 4FQXA 1KEGL 2X4SB 5JLZB 1DBBH 5JORB 1P7QB 2J5LB 4CVWA 1IEAB 1KJ2A 3HNSL 3FT4A 4JY6B 3RX8A 3RU8L 1KB5H 4P9MH 1RK1B 3K1DA 1JNLL 4BQ6A 5AAMA 1KF9B 3IRZA 3CPLA 2ADIA 5KAQF 12E8H 5TFSH 3H7LA 5A16B 4C83B 1I3GL 4IRJA 4WHCA 3B9KD 4WW1A 1IQDB 4JFDD 3PWNA 1RZJL 5C71A 4JVUA 3TIEA 1IQWH 3F7RA 1NLDL 4LOUD 3MLTB 4QY8B 2J6EH 3UXFA 5INDB 5T5FH 4YHNA 1ZT7B 3MV7D 3SHSA 1U3JA 3PIQA 2VZUA 1S9KC 2VQTA 2YPLD 2YR3A 3ZE1E 1CD8A 5E99H 1O7VA 4MZ2A 3RPIB 1T1ZB 3CSYA 4OGAD 4ACPA 3EOAB 3MV9B 5CILL 5GGVL 4M43L 3WUWA 1CL7I 1DQDH 2FD6H 3ULSB 1A1OA 1RUPH 4M5YL 1NEZG 3KAAA 5JPNA 1U8MA 1F02I 1RJZA 2FRGP 2YA0A 1X7QA 1D9KA 3DIFA 3DPBA 3QPXH 5KVDH 1OL0A 3IJHB 4G9FE 4U1HB 4WTWA 3W82A 2VN7A 4MNQE 5JW4R 1D5ZB 2DI8A 1YEEH 2QADD 1A7PH 1BD2E 2VTFA 2R0ZH 2BNRA 2D31A 4KDVA 1NMAH 5HYJA 3AMLA 5DHVB 4PRID 2FEEI 1T0NB 1WCBB 3W5NA 4QLRA 5EBWA 2DL9A 4PJXB 1QFUL 1HQ4B 1LQSR 4S1QL 3KJ4C 2DKMA 1G9MH 1VFOA 2NY7H 4XVUD 5DC0A 2YS4A 4FXKB 3UJJH 4RISL 5F6HJ 4FFZL 1Y0LB 5FKAA 5JXED 3KYKH 2AI0H 3RL1B 2XPGB 1AXTL 1KJ2H 1NQBA 4HC1H 5K9KB 3RVVC 2OTUB 1UA6H 4H88L 3KYMB 3WDIA 5I18L 4B5EA 1JWMB 1X5JA 1LK2A 4L1DA 1MJJB 4NNYA 4UINH 3DVGA 3OGCA 1FBIL 3RWHA 3H9HB 1RVFH 3PG2A 4X6DB 4OV5B 3CLFL 3O0RL 1LP9F 5EO9A 5GISL 3WIHH 3TJEH 3BZFB 2YXMA 4KHTL 4YE4L 1LDPL 4GAJH 3KPTA 1K4CB 4QYOA 1G6RH 4KKCC 2KUTA 2BHYA 2V6HA 4LAQH 2F53E 5CFHA 5E5RB 1KIPA 4M6AA 1I3UA 1PEWA 2DAVA 5HJ3B 2GY5A 3LPFA 2DLFH 3MCLL 3GSNH 5D96C 1DBAH 4P2OA 5B8CA 3H8NA 4XC3L 4Z7UE 5EN2A 1KCSH 4QRTB 4Q6IB 4M48L 4FTVB 3ZT6A 5CSBA 3O3DA 2W0LA 3OKDA 5E9DB 3C8KB 3I6KA 3NA4A 5HHOE 4LVOB 4KXZI 3VXSD 2V9RA 4OT1L 4XMKL 2VWEE 3SDCC 1QLRB 3IDIB 4WWID 4OLWH 2VOTA 4N5UA 1CICA 5H2BA 2RCSL 1CDHA 4MJ5B 5FKPB 2DD8H 3KPOB 4N0FB 5AD0B 1WFOA 5K93A 1A9EA 1FNSH 3BE1L 1A5FH 2DJSA 5JW5B 3VE0B 5I1CL 5DMIL 4LCWD 4ONGL 4Y16C 2DQEL 1S5HA 4JPVL 4M3JA 2EXYD 5HHMB 3STZA 4JPKH 1RK0B 4MGXA 1EBPA 3I3DA 2NXZB 2HTKD 5BMFH 1BVZA 3DTXA 2UZYB 5CINH 4PLNC 4ZO7A 1WAAF 4HQQL 1NDGA 5FO9B 1Y18A 3EJYC 2O5XL 4GXUM 2R1YB 4L9LC 5E5UB 5ISZD 1XGPB 1JF1A 3MO1B 1S5IH 4XAKD 5GGQH 2F5BL 5T3ZE 2R29H 2YK1H 2D9QB 1J88A 3BMWA 1DBAL 5JHDA 5DEFB 5F71A 1JBJA 4ZUVA 4NWTL 4ZD3L 3WXVH 2Z31D 1BD2A 3MBED 3ARWA 1BVKA 3V5HB 1FDLL 2R2EA 2OJEA 4JM2D 1MUJB 3FO2B 4PJDE 4LFHG 2H3NA 5HDBF 5KN5A 3KPLB 1FJ1A 3GEWB 2CR3A 4FQHA 5D7LB 3VDCA 3VW3L 1YPZA 3UTQB 1RULL 1ND0A 1R5IA 3R4DA 3INUH 3AAZB 3KXFA 4LPXA 5DXWA 4C57C 1JTOA 2W60B 1GAFL 4NZDA 1YN7B 1XF2B 2DM4A 4BFBD 4KUZL 3QUXA 1OW0C 3SDXF 1WWAX 2BRRH 5FGBC 1HSBA 4KK5D 1SVZA 1INQA 4ODVH 1P4BH 5JDSA 2PXYC 4JY5H 1CFNB 4MXWL 3RPKA 1B0WA 2BVOB 3PWVB 2HH0H 4PRHD 2OTWB 4BSWB 1BBDL 1F90H 3EOBA 3IFPB 3UBXI 1Y6MR 2IADA 4Y88A 3Q2CA 2G60H 4ZNEE 5F7UA 4XPGL 3ILQC 3O8XB 5CD5D 4OLUH 3FFCB 4P99A 4U6TA 1HXYA 1QA9B 2C9AA 2DDQH 1B4JL 5F21B 2R23B 3GNML 3CD4A 3L3KA 1C16B 4PGCB 4QHKJ 4KKAC 5IGXH 1K85A 1CFVL 1A1NB 1ZTXL 4GS7C 3LRGA 1ZA6A 3MOQA 1CE6B 1ERNA 1D5XA 3GRWL 1KPUA 3RUGE 5SWSD 5E9DE 1S5IL 1HQ4A 1RUML 3W39A 5AZ2H 4NCC2 3WNPA 4OGYL 4WTZG 4YGVB 1WZMA 1EFXB 2DLEA 1QZ1A 2X09A 1J0IA 4GAFB 4QF1B 3LKRA 3PWPE 4YDJA 2CIIA 4I18A 1T4KB 4DK3A 2ITDB 3TNNA 4EN3D 4GRLA 5DR5H 5DVLA 5D4QA 2GEEA 2UVFA 3SJVD 3SDAA 5IJVA 4CMMA 1OWRM 2KQNA 1R0AH 4ZTPH 3UZEA 1KN2L 2DQIH 3OKYA 4NM4L 1F3JA 4P3DB 2HLAB 4I48A 4PJ5D 3RX7A 2AS5M 3PE9A 3VMOA 2CGRH 4U2ZA 5FM5O 4KJQD 3MRRA 5LGHL 3BN9C 3L5XL 2QL1A 3U4EA 1T2XA 5F1OB 4KI5F 5LBSL 1I1YB 2A9MH 2GK2A 3T2OA 1BMGA 1WFTA 2OQJA 3EAKA 3E6FA 3QFJA 4MA7L 4LPCA 1LO5A 1QKZH 3QIWB 4JCLA 3DIFB 4HS8L 1MCKA 3KS0H 4F37F 2WM0A 2JELL 1Z2KA 1JHKL 1QLRA 3WFBL 2MOVA 1IQDA 2ZPKH 3OKMA 3ILPA 1RU9L 5E8PA 1FPTH 4ZUTA 2BDNH 4QKXB 2VXSH 4LDLB 5GRVK 5CP3H 1PVHA 1FSKC 4UQ3A 3WFEH 4HWZB 1CLYH 2EEDA 4JPWH 5K33A 1ULVA 4RGNE 3E6HA 1MH5B 1O0VA 3IETA 1TMCB 3VCLB 5I16A 2E9BA 2V2WA 1F4AA 3GBMH 5EBMA 3TO4A 1BX2B 2OXGA 3OHXB 3D0LA 3C6LC 3BGFB 3FQXA 4L8SA 3HR6A 2GSIA 4UT6H 1IGYB 1AP2B 3BAEL 4ZXBC 3LDBC 5LBSH 3SDCD 5ALCH 4X6DA 2Z8SA 4EDWH 3G5YB 3P9LB 1G9ML 2NY7L 2P7TA 2ZUTA 3SO5A 2IPUK 4Y16B 4MWFB 1I85A 5CBAA 3AB0B 1K4CA 4YIQB 4NM4H 1S7VB 3UYOD 1EH9A 3QCTL 1J9CT 4L1HA 4NCC1 3UTPD 2BNUB 1A7QL 1BGXL 2DIJA 1MHCA 3C5ZC 4KTYA 1SEBB 2D7OA 5TE7L 5IF0A 4TVPE 4NQEE 3VRLF 4HSQA 3QIBB 2XPGA 4I3GA 4ZFZB 5IB5B 5I15L 1OWWA 1TZIB 3MYJB 3DRQB 4KDWA 3ARDD 3CVHA 4NQCA 3VWJA 3UTQA 4QHLB 4YZFE 2R0LL 1KPRA 3FB7A 1FVEB 3ZE0F 4J8RB 4U4BA 3PWPA 3C60B 1RUMH 1EGJH 2RR3A 5J12B 1NANH 5F9OH 4ODXB 1FVCA 4KVCL 4LLDA 4HGWA 1AD9B 2FWOA 3VFMA 1A8JH 3N1FC 4AIZA 1AR1C 5I6XC 4CL7A 1JF6A 2BOBB 4P46D 4K7FB 2ICES 4Q9RH 5ICXA 4I18B 2XV6B 3WJJC 5DFVC 5GSRA 1EO5A 4Q6IA 1U93B 1AI1L 2AV1B 3G5XA 4HUUA 1E6OH 1N59A 2HMID 3MLWH 4RRPA 1EBAA 4KGJA 1NAML 3IXAA 3MNZB 5JUEH 3QFJE 2H8PA 1RHHA 3UDWA 4HUNB 1P4IH 1QSZA 5J9PB 1AKJD 1OTUD 3MRNA 1I75A 4ZG1A 4I3RH 3UBXA 1MRCH 1QFWM 1OLZA 3QEGL 4GRWE 4JZOA 3BGMB 4J12A 2NY4D 1E4KA 5IB3A 4LBEB 4PTTA 1Q9LA 4JKPL 4OCRL 4F58L 1EHLH 4AYFA 4UAOC 4F15C 4G9FA 4YQXL 4OZFG 1WBXB 2Y6SD 1A6ZB 5A3ID 4S2SA 1H5BB 1MCSA 1IKNA 1JGEA 4P3CL 3VWKD 1HDMA 4WI7A 5HYJE 4QTHB 1VACB 3ZT5A 4F7CA 4S1DD 3R06B 3WJLC 1OB1A 5C6TH 2ZUSA 4HHAB 1HYSD 1OT2A 5I16B 1LNUB 3KYOA 2HT3C 2JF1A 1PLGH 1AD0A 3MGOB 4MMZC 5J4MA 4OUUB 3OKNA 1FAIL 4F2MA 3VGAB 3IF1A 3S35L 1AP2A 2R2EB 4O5LL 3RDTA 3X11B 1T89A 1HINL 3SPVB 4X8XA 3VXQB 4MVBC 4W6WB 3ZL4L 3WNNA 3U4EB 3G6DL 1QBMH 3D85B 5IHBA 3MRFB 1RPQA 4M8QA 4EKXA 4DW2H 1HEZB 2GJ6D 3ULUD 3T2NL 2VMFA 3QIWA 1TETH 1CDCA 5T33L 4N1CA 4O00A 2PTTA 3SGEH 2B4CC 3ULVC 2GI7A 3MZGB 4MD0B 1A4JA 2BRQA 4UB0H 2EDEA 1I8MB 1J18A 3ILPB 1F4XL 3TBVB 3RWGA 5DEGB 3LN4A 3HMXH 1NLBH 3VI4E 4YC2C 2NLJB 2L7JA 4P4KA 3SDDB 2B5IB 3LB6D 3A67H 2EEAA 5B3JF 2YA2A 5EWIL 1ZHNA 3HR5A 3QHZL 3QPQD 4PLJC 4YR6B 3WFEL 2PF6A 5FXCH 3WFDL 2YD7A 1VGKA 4C58B 4UUJB 4YLQT 3TZVD 2WQRA 2NY0C 3EOBB 4QHNB 5FM8A 3BD5A 4F58H 4FZ8L 1U8IA 2I5YH 5JOFB 4XPBH 1FO0L 2R4RL 3O4OC 3FO9B 4BM7A 4NHUA 3ES6A 4OLXH 5HD8D 5CEZH 5EZLA 3DO7B 3ARGD 2H9GA 3ZTNL 3SJVA 1G6VK 4MDJB 2VKWA 3LN5A 4Z7WB 2X9YA 3QIBD 2NX5A 3EYSH 1D5XB 1FHGA 1QACA 5AYUH 3WV0A 1I7RA 4NDMB 3MJ8A 2CRYA 3UC0H 3VXSE 2COQA 5EUOF 1IM9D 1KCRL 3GMQA 3OKLB 3EYUL 5KOVC 2EYTB 3PDGA 2G9HB 5IB1B 1JMXA 3ARZA 2FH8A 4WTZA 4BUGA 4TUJB 4CKVX 4TYUA 2E8YA 1KCKA 2O93L 3U1SH 4O51B 1T2QL 3WYRA 3HB3D 4BZYA 1QBML 2XFXA 3IRPX 3LKPB 1KBGL 1MI5D 32C2A 2V7NB 3T1FA 5ISZA 3SE9L 4PJEE 1UH2A 3QXVA 3LH2L 3VXNA 1UM5H 1GL4B 1KCSL 5ICXB 3LKQA 1UH4A 4P2RB 2VDNL 4X4YA 2XZZA 1FAIH 3BN3B 5ID0B 5HYFA 2AV1A 3G5XB 4FQCL 4M5YH 3UROR 3KPRB 5IHUH 1E4JA 2JJSC 2M2DA 3ZE1F 4P4RB 2Z0BA 4KKLD 5IB3B 3GUTB 3D9AL 5L2KA 1F90L 2ADJA 2RB8A 2B2XL 5EC2A 5I1JH 1MNUL 3VXOA 4JPIA 2VISA 1CGTA 1AY1L 4N0UB 1UQSA 4E9LA 1HIMH 5L8LB 3VXRE 4MNQD 4OAWB 2OSLA 4NFDA 3HI6H 2NY6D 4JY5L 3K1KC 5KVFL 1B0RA 5IW1A 1F3DH 3JV6A 4FMKA 2Y9RT 1QNZH 5GJSL 3R1GL 2O26U 3T08A 4MLIA 1BJMA 2VIRB 2R0ZL 4QTHA 3GKWH 3EYSL 3D9AH 3LQAC 4RFEB 1KTRL 1DN2A 1X5KA 4WNQA 4JQVC 4NZUL 5C09D 1Q94B 3ZKND 3BQUD 3CSYB 3L3JA 3EO1A 2LU7A 3VRJA 4TPRH 4ZFGL 2JELH 3UTZA 1NUNB 4ETYA 5ITFB 4POYA 1OQXA 3P0VL 5KBNC 1M6OB 3NCYS 3GMMB 1DQDL 3JXAA 5IMMB 3B2UD 4FFWD 5F7WC 5I71B 1YQVH 3SE9H 5M95B 4PREB 5DVMA 2R1XA 3P4MA 2ADGB 3TYFB 1G7IA 1QVOB 5CBEA 2NXZC 5CZXC 1T2QH 4HQQH 5MENB 3H7BB 5C0EA 2NPLX 5EWIH 2QR0A 5IB4B 1HHGB 3WIHA 1I1RA 1VFUA 5IW6B 1YEDB 4HKJA 4DN4L 4Z7VB 2R4SH 3AUVA 1OTTD 4PRNB 4RFNC 1MJJA 3SY0A 2H9GB 1IAOB 5I1AA 4V2CB 4EUPB 1ZV5A 4G42A 3BE1H 5FHAH 3V95A 3O9WC 4QOKE 2NQCA 5E1AB 1QYGL 3D39B 3EIFA 3HLAA 3X12B 5DEZA 1EFXD 1C5BL 1HH9B 4LQFL 4PJXA 1JGDA 3MJ8B 4I1NB 5C0CB 1INDH 3S35H 4WDIA 2CH8A 4EN3B 1MHEA 1QR1A 1Q1JL 4CJ1A 4XNZB 2X10A 3BEVB 3PP4H 3SJVB 3FO1A 3D6GA 1RI8A 3QUYC 3AM8C 3RDTB 2AJXH 3DVGB 1RJZB 3KLAA 4M5ZL 1TDQA 5I1IH 2VDRH 3VXRA 4ZFGH 3IDNA 4JFFE 4XZUA 3GMPB 4N8VB 4X6CF 5HYJD 1HWGB 2DQTL 2ARJA 4ZUWB 2CJUH 5E8DH 1UEMA 2A74A 5C0AA 3C8HA 4HJ0C 3GKWL 1JTTA 3RVWD 4LCCC 4Q0XL 1ZWIB 5JXEA 1F00I 3RPIA 4OI8A 3CLFH 4MSWB 3HMXL 4PJIA 1YMMA 1KIPB 4P9HC 2NW3A 1OARL 1C1EL 4GG6F 2EE2A 3PQYA 2VERN 1TTGA 3QISA 4YDLC 1MHHB 4LVEA 3CX2A 4FTVA 4PB9L 3T0ED 1NCNA 4KXZH 1OD7A 3QI9A 4I3RL 5KS9B 4LARL 3TO2A 3DX7B 4ORGA 4LFHD 1J7VR 4F2MB 3HS0A 3TP4A 3PHSA 2Q8AH 5L7XL 3QNYA 5I1LA 1P7KA 3FAWA 4JFED 1KJVB 1S7TA 2VQ1B 3NIGE 4K9EC 2KZ1B 2AXGB 1FG2B 5HHQB 2V5YA 4PJXF 3MLWL 4UOW0 1LEIA 4WV1B 2DQFB 1MQKL 5D8JL 2PO6A 3VWJC 4QXTB 2ICWA 4GKOA 3QNXB 4RNRA 3RP1A 5E6IB 1DBJH 5B3NA 1LO2H 4PJ9D 1MCLA 5F9AC 3GMMA 5BRZD 4FABL 4Z7WA 3DSFL 4RGND 4UT7L 3VI4F 2C26A 1IARB 2EIDA 4KK9D 1ZGLP 4YDLB 1H0DA 4GG8A 2ED7A 1O5DT 2GJ6A 3F12B 3TC9A 4Y19B 2H32H 4Z18A 2VL4A 2O5XH 3CFBB 4K94C 3OAYK 1DVFD 3WO3B 1KIQB 2EYTA 2OR9L 3QJHB 3VGGA 1B0RB 1EFQA 1AO7E 2YKLL 4GG6A 3I6GB 2E9WA 5IGXL 1CFQB 1CICC 3BIKB 4OSUH 2EDJA 2JJUA 5ALBH 4PPTA 2H2PD 1CLZL 1HXMA 3QUYB 5D8JH 1IAMA 3V79C 1JVKA 1INEL 3RZCD 1CLOH 4ODHL 4PJ8D 4BSVB 8FABA 1BQLL 2PYEB 2B8OT 2ZCLH 4KPHH 2X42A 4R3SA 4ODTL 4RDQF 4HBCH 3FL7A 5D6DC 1U58B 1E4KC 4XRCB 1FVDA 2YOCA 1XF5A 1FSKB 5SWQB 5CEZL 1J1PH 2J88L 2VITB 2F8XC 3LRSA 9CGTA 2HRPH 2EYSB 1IKNC 1CN4A 1KC5H 3MCLH 1TFHA 1FO0H 2VXTL 3BEWB 1V5JA 1IAOA 1OARH 5I1AB 5DQJA 2CK0L 5EZIL 1EGJL 1YMME 3WJLA 2HT4D 5D1ZA 1MRDH 1FGVH 5D7KE 4OQTH 3KXFD 5HVFB 4WFFE 2BDNL 4PG9B 4CMHB 5GISH 3V5KA 2ORBL 4NWUH 5C0JB 1CXFA 3MSPA 4PRHA 3LRHA 4IRZH 5ISZB 3HC4H 1AR1D 4LVNC 3RWCA 4LCYB 3F58H 1NLBL 5E4IA 4P3WA 4MJIE 4NQDE 4XNUH 3VGEA 4KTEH 4NSKA 3KPRE 3BUYA 2YUWA 1MEXL 3U0WH 3MFGB 4FFZH 4FQJL 1LK3L 1NCCL 4X98A 1BFVH 3VFRB 3MBEC 2R29L 3PWPD 5DD1H 1C5BH 1PSKL 3EDFA 2L7UA 1RZKC 1UWEL 2X6MA 4I5BA 1DSFH 5IP4A 4HFUL 3BAEH 1I1AA 4KRNA 4XH2B 3QO1B 4QRPE 1KB5B 4P4KC 5IMLB 1HN1A 5BMFL 2OSLB 1KT2B 4MHHG 4M7KH 3MLZL 3CMGA 3QUXB 1W0YT 4PJGF 2D4DA 2GJ6E 2PO6B 3N85L 5FUZL 2HT2D 3BP6B 3GK8H 3F62A 3DX6B 5EU6A 3QDJB 4JREB 1KTLB 4R4ND 1S7XB 1DQLL 3RWDB 3TO2B 3P4MB 1QFWI 1HKLL 4JDZA 1A7OL 5C0AB 1FNSL 2W9DH 5I30L 5DYOA 4M1DL 3UJTH 4ETQB 4X80L 4JANB 5KZCD 1VFBA 4U6XA 4LHUA 5J1AB 2NW3B 4LSUL 4Y4HA 4OCSL 5I8CB 4Y8DC 2EDRA 3I85A 2Z8RA 5E8EA 3HFMH 3FRUA 43C9B 1I3RA 1LE5A 4FTVD 3D3VE 1C08B 4QRQB 1UZ8A 4OZIA 25C8L 4F33A 4BZ2L 4AJ0A 3T0EE 1F4WL 4YEFA 3QQ3A 5C9JA 5F1IB 2R1WB 4OZGA 4FS0A 4JQXA 1PZ5A 1DBBL 1MCNA 3S37H 1PG7W 4MCZA 3G04B 3S9DB 1ZK9A 2JJWA 4ZPVB 3SDAC 1FV1A 3MGAA 1FORH 3EFFA 4QXTA 5MENA 4UOJA 4HS3B 1SYSB 5A2LH 4KHXH 1E6OL 2DN7A 3IJSB 4WEBH 3FQXB 4L8SB 5HHNB 1CDBA 4UBDC 3VGFA 4ONHA 3DV6B 4KUZH 3GO1H 3VDAA 4GRWB 1MFNA 1U3HD 2EH7H 2ICWJ 4O2FB 5C0DA 4OGYH 4XVJH 4M9PA 4TVSa 5T3XH 5JW4M 4LCIH 3QEHA 1T1WB 3VWJB 4ZS6D 4PJBA 4KVCH 3BO8A 4TNVK 2AV7B 1UENA 1J5OH 4PLJD 3PHOA 3K4DA 1WZLA 4E42B 1X5YA 4XVUC 5T5NG 3V8CA 2JJSA 1TJHL 3MLUL 2AJUH 1TCRA 2CUMA 1MHCB 3MJGX 3MRBB 4HULB 3RVXC 3N0PB 3PGCB 2CMRH 1JPGB 1IZKA 5FECA 2FX7L 1OPGL 4JFEA 4J3WA 4OTXL 1QOKA 25C8H 2XTJE 2NZIA 5EBLB 5GGRB 5KSAB 4X7SL 4PBWD 4OKVA 4U1SB 3DX8B 5T5NF 3BXNB 5TGBA 3OAYH 2BSTB 3SE3C 3TN0A 4ZXBA 1CBVH 4Y2DB 4JO3H 4JG1H 4TULL 4XXDB 1QFOA 2H8PB 4X80H 3I9GH 2OK0L 2VDKL 4WJ5A 5CIPA 4NIKB 3MCKB 4FQ2L 1FIEA 1ZWIA 2Y4SA 1BBJA 5EUKA 2HKHH 4Y8AA 4DZBB 5I2IB 2DQEH 4OM1H 4KQ4L 4NFCA 3LCYA 2VZSA 3WIIH 2P24A 3C5ZA 1N6QL 1OGAD 2YSSA 3E1F1 3MRLA 3DX7A 4GW4A 1BZ7A 1CL7L 1TJIH 3EUUA 3RU8H 4ZO9A 2BVQA 3F12A 4EUPH 2LAAA 2Z93B 4QHLA 3ABZA 3MRJA 4LQ1A 1WZKA 1KIQA 3C9NB 4NQED 4XMKH 1KYOK 2GITB 3WMSA 1OAYL 1XH3B 4MAYB 4PFEA 4K7PL 3WUWB 2A73B 2P1YA 1XR9A 2IPKB 3QO1A 1KFAL 3KDMB 4KH2A 1BREA 2HN7B 5B3JE 4JFFB 1I9RH 3L6FB 1LNUA 3VD4A 5IB5A 4HEME 1XIWC 4YDIH 4YFLI 5E6IA 1I9RL 2W38A 4G9FB 2VE6A 3ZKSD 4WUKL 4OTXH 1U95A 3HE7A 1I7UB 4UQ2B 2FX7H 5HYEA 4IOIA 1U6AH 1ZANL 2YPKB 1DN0B 3SOBL 1I1AD 1KB9J 2Q6WB 4R4BB 4L4TD 4QNPF 2Q76A 4AMKL 4HPYH 3BUTA 5D2NB 1KT2A 4PJXE 3RY6C 5CJOH 2NY2D 1QO3B 3D2UB 3W2DH 4E41B 2D7PA 1OGAE 4GG6B 4OKDA 4Y5YB 4XNXH 3S4SA 3ULUC 3BP7B 3MA9L 1I8KA 4K9EH 4Z7QE 5D1ZB 4JFQB 1Z0NA 3HI1A 1JHTB 4LBEA 4NN5B 2BVTA 3ULVD 2R2BB 1NPUA 5EC1B 3CX5K 1FNEA 2RFXB 1C8PA 5TE6H 5E00A 1EJOH 5C0AE 5F8RC 5EIIA 3ZYJA 3MQIA 2VR9A 4UUJA 1MCEA 1CLOL 3TV3L 1T03H 3V6ZB 4NC2B 1N64H 3J7HA 1CLZH 3FT4B 5DJCB 4KJYA 3TZVC 2W1NA 3B5GA 3DVNA 2DQGL 3OKLA 4HV8A 4C4KT 4BZ2H 4HGMA 4OSUL 1QRNB 3QUZD 4JRYE 2GKIA 3QO0A 1GZPB 1OCWL 4R2GD 3D69B 2A1WH 2VAAB 2YPLE 1XCQB 1WZ1L 3TBSB 3PWLA 3NABH 1EEZB 3UBXB 3G08A 5HHNA 4LU5L 2V7HB 3CZFA 4CGTA 5GRYA 1BAFL 4OFVA 2C1PB 1MCPH 3HG1B 2J5LC 3E3QE 3KJ6H 2EEBA 1MLCB 3KYKL 3WS6C 4R7DB 1UJ3A 4FOMA 3DO3A 2YD2A 3QIWC 4ORZC 3MLYH 5D7LD 3UJIH 3LD8B 2ZG3A 1NCWH 3M07A 1FNGB 3O2DA 3TO4D 4RDQG 3BOVA 1GGCL 3JWDH 4YHNB 5EU4A 1NCDL 4CVUA 4AENB 4DKEH 2PO6C 5DRZB 3BRFA 2X4PA 1U6AL 1NAMB 3BPLC 3TCXA 2W91A 3MREB 2WLYA 1BIHA 3G6JE 1DSFL 2SEBA 1MCOH 3U6RA 4F15B 2JIXB 4WUKH 5GPRA 1AI1H 3L3OA 4EBQL 1PZUB 4DOHB 1T7XA 4GO6B 5TF0A 1NMBH 2NR6C 1JK8B 4F8QA 1K2DB 5EOCH 5C92A 1U8HA 3X11A 4FQJH 2XY1A 1EJ6A 3CAFA 3MLVH 1X7QB 3U7WH 4N1EA 3QUKB 4K55A 5HGAA 5EU6B 3OBAA 3NZHL 1FQ9C 4Z7NE 3GUTA 4D2NA 1IGTA 1Z5LA 1ZA3B 4MDIB 1E4WH 1A6TA 2B4CH 4OD3L 3GMOA 2J6EL 1S9XA 2Q7YB 1RZGA 4KY1L 5AZEL 2V2TB 2DMBA 1M7DA 5FOBB 3BD4A 4IRSC 4MYWB 4NYLB 2GT9A 1UYWL 3CCHA 1MCDA 3HPJB 1PYWA 1JL8A 1S7QB 5F9JA 3DWTA 4PRIE 1ZS8B 2Y36H 3VRJB 2F54D 4GXUN 4PJBB 2ZWLT 1KYOJ 3MRKA 4DUXA 4F33B 3LN5B 5J6HB 4XNZC 4OZGF 5FA4A 1KEGH 5DQDH 3W0WD 1FLRH 2F58L 1HI6B 3OKDB 3GIZH 3DGGA 3PJSB 1WV7T 3ARGB 1TENA 2PNDA 4P5TC 3V4UL 4I2XE 1U8IB 4ZO8A 4XP6L 1I7TA 3DYPA 4OBSA 1NBZA 4C55A 3PABB 3L7FB 4L5FH 2N1KA 4ZYKA 4HS6B 2VZ1A 3T77A 3AMKA 3EFFB 4GKNA 1SYSA 4NQXA 2X4NA 2ZKHL 2Y23A 4GJTB 5J89A 4NZRH 5DMGD 3RAJH 5HI4C 1MRFH 3WNKA 2KZWA 4Q58C 3D48R 1Q9WB 2UUDK 5JW4N 4OBRA 2DLFL 3RRQA 4PJAF 2AJUL 3WS3A 3LEYH 3TA3C 3GI8L 4WO4C 4GAJL 3KLDA 1TNMA 2FJFA 1BZ9B 1SY6A 3TJEL 1WTGT 5F6IC 1XZ0B 4FXLA 4U2YA 1FPTL 4X5WA 1VKXB 3I02B 3ARVA 4KRMB 1FFRA 2ZZUT 5DMKB 3VE0A 1JPGA 2XTJB 1C5DA 1G0DA 4KK8C 4S11A 3C8KA 4UDTB 4P4RA 1EUUA 4WEBL 3JV4A 5IEKB 2VAJA 4CMMB 2CKBH 1JYVA 1ZSDA 5LGHH 1V7NL 4EUPA 4QEGA 1DTUA 1IGMH 3KLSA 2MCG1 1FORL 3IDIA 4H1LH 1UB5A 3V9FA 4X6DF 3BXNA 3CXHK 5C3TA 1OTTC 2F19L 4MA3B 1FZKB 3CVHL 3MO1A 4MJ2A 2HVJB 4F37K 1A7PL 2X9XA 1FYTB 1OP5K 3T4YB 1KPVA 4B50A 3IAGC 4MNGE 1Q94A 1PG7X 5GGSB 5DFWH 2R2HA 4PRDB 1E6JH 3K4AA 3CZJA 4JQVA 4KQ4H 1BJ8A 3UJIL 4APQC 2EC8A 4X8JB 3V6FB 3H3PH 1YQ2A 5HYSA 3Q6FB 5DFTA 2J3SA 4G80B 3WN5C 5D71L 1OAXL 5DVOA 4ENED 1Z5LB 4TN9A 3HS0B 1L9NA 3AY4C 3RWFA 4P2CG 1SJEB 1OCWH 2R0LH 3HMWL 5HHQA 3IDYB 5F7EH 1HKLH 3TESA 4H0HB 1TVBA 4HUKB 3VG0H 3QUZC 3BQUC 1RY7B 3QHTC 3OL2A 4U33A 4P5MB 5EOTA 2R8SL 4KI5C 2V9QA 3IKCA 2FL5B 3LH2H 1KB5L 1NAMA 3QH3B 1MQKH 3EYFA 4D9LH 2Q20A 4WNQB 4IRSB 4JDVA 5IHZA 4U0RB 4MSWA 2CDFB 4MXVE 4KI5E 3HE6C 2QBWA 4X6BB 3S98A 2IFFH 2AXHA 1IGML 1F13A 2OMNA 5IW6A 1UWXK 2Z35B 5CZKA 1L6ZA 3G6JB 4YPGB 4M02A 3JBG7 1A3RL 4K2UL 5CJ8A 1A21A 4XPTH 1GZQB 5EORH 3IGAA 4K9EL 1XF3B 3O2VL 4NO5A 3DUSB 2LAGB 2WK2A 3EO9H 3P3YA 5F7HA 1Q9WA 1RURH 5CUSH 3VGAC 3O45A 2AEQH 2OR8A 1HXMB 3GMPA 4N8VA 3QUYA 3D39A 5SV3A 3LSOB 2FO4A 1Q0YH 3D25A 3EYOA 4HUWA 1F97A 2VZOA 3AROA 1D5MB 4YHIA 2DQTH 2HFEB 1ZANH 2A9NH 5D2NC 1VKXA 2W0FA 3FFCA 4YDIL 5ISZE 1UJ3B 1OVZA 4NHCH 3LKRB 3DECA 1UADC 3A6BL 4Y1AD 4R9HA 4G6MH 5JXEC 3SKJH 2P46B 3MV7A 4GH7B 4NQDB 3O4LB 1LO0H 5E2VH 5H8DA 1QQDA 5B4MC 4M93B 1FGNH 2ATKA 5IFJB 3MGTA 1DANU 4ZFFA 4TPRL 3QULA 4ONFH 2DWEB 4Y19A 2XKNB 3C6LD 2VAAA 3H9YA 4MNQB 1JI1A 5FDWA 1ZLVH 4NRYB 4RRPG 2HLFD 4K7PH 4NRXB 4QTIH 5GRJL 3UJTL 2WWKT 3GKZA 1JYWA 1FLRL 2F58H 2WW8A 2W9DL 4F7PA 2B1HL 5ICZB 3HAEH 4DOHE 3RVTD 1P2CB 3CIQA 4JZOB 1E0OB 1NMCC 1U92A 1UFUA 2P4AB 1R5VA 1U8LA 1Z9MA 2ZG2A 1NGZB 4PTTB 3VFOB 4BK5A 4GOSA 4YK4C 4HK0A 4IRJB 4H26A 5I8OL 4YHLH 4RCAA 2YD1A 5GZOC 1IGYA 3D85D 3IS0X 4PJ7F 4J3TA 2ARJQ 3QDGA 3LKSB 1WWBX 4H1LA 4HCRH 3SGJC 4ODUA 3V5KB 4IOSD 4M93C 4NBZB 1IC4L 1PYWB 4UNUA 1MSPA 2C7UB 1WFNA 2AJVL 4TOYH 3C60D 5F7DA 4ZUUB 4BKLA 2AKRB 5IIEA 2R2HB 2APVA 1KTDB 1U3HA 1OGAA 2YD9A 4NO3B 1NCAL 4XP5L 4YBHA 3ULSA 5AEAA 3CFCL 1H9VA 4LNVA 4RQQA 2FO1A 4OF7A 4N8CH 4FZEL 3SPVA 3V52H 1A6VH 2HG5A 2Y7QB 1G1YA 1BFOB 1ZHKB 2CRMA 5HGAB 1T03L 1DBKL 4RX4D 4F57H 2I27N 4U1HA 1II4E 5CBAB 2JK5B 3PIQB 2IANA 3H9SE 1J5OL 4NN5C 5T1KA 3D87B 4EXPX 1YUHA 4X7DC 1U8OA 5BXFB 4N8VG 3KWWA 4OZFA 4U1IB 1NCDH 4IHOB 2X9WA 2XOTA 3BESR 5HGBB 3UTTD 1H3GA 4LLMB 4CUCA 4PLKC 3OHXA 4WGVB 5TE4H 4XPTL 3X13B 3F5WB 3RWGB 1IAKB 2VZ3A 1T83A 3BKCL 1LHZA 1RZIB 2AI0L 3I2CH 4Z9KB 2EH7L 1MCPL 4DJMA 2ESVA 4RISH 5D72H 4LSRH 4KRPD 4Z7NF 5C0GB 4PY8I 3FB7B 4PRPE 3RWFB 2FX8H 1K6QH 3MC0A 3ZYOA 5FA4B 3GB7B 3GSRA 2LE9A 1KCRH 5C0CD 1KENH 4XGZA 1EV2E 2CJUL 5E8DL 1L0QA 2Q7NA 3OB0H 5DGQA 5HPMB 3T65B 3CGTA 1JUFB 3L7EA 4YFDB 4O4YH 4HS3A 4GKNB 1F4WH 1ZMYA 3ZTNH 3MV9E 5F6IB 4OIIH 4NNXA 1LK2B 3NCCB 5DDHB 3MV7B 5LG1A 1VESA 2IF7A 4MAYC 4C56A 1YN6B 3DV6A 2Y07H 4HIHB 3BKMH 4M62L 1CIDA 5F1SA 4YH6A 3H9HA 4MA3A 1NEUA 1QSEE 4MA1B 5SWZA 2BVYA 4KC3B 1U8QB 2YEZA 3WL9B 1MLBA 4PP1D 2JLLA 4M1DH 1UJ3C 4QRRB 4CU7A 4F7MB 4ZPVA 3OR7A 2AV7A 2OXHA 3NFNA 4L3AA 5GGSA 5I19H 2DKSA 3I02A 1I8IA 2AGJL 4ZODA 2D7TH 2X5PA 4LRNL 2CDEA 2ERJB 5E95B 3WHXA 3DROB 4XCEA 1H3XA 4JPVH 5D6CB 2DMKA 3PL6B 3VFVB 4XWGH 1IJ9A 5BS0A 3KPPA 1CGUA 5CHNB 3EYUH 2IWGA 4GMSL 4Y7MA 4NUGL 2HKHL 2ZUQC 5TF1H 1FLTX 3O3EB 3BO8B 3E2HC 5ETUA 3C08H 2OK0H 3IYLW 3T0BA 2E7LA 2AEWA 3S88H 2VQUA 2D0FA 5B4MD 4ZAKD 2Q8AL 5L7XH 3PV6B 5LVEA 1MEXH 3U0WL 4L3CA 1JWSB 3DX9A 5E8EB 4KTEL 1J86A 1I3RB 1S8DA 4I13B 1KTDA 2PW1B 1KGCE 2PR4L 4DQOL 2OI9B 1NFDF 3DHJA 2ADJB 5DK3A 4YUEL 4BZ1H 1C1EH 4IRSA 4JM4H 4GT7A 1MUJA 3FO2A 1VEPA 1NDGB 2VR4A 4LNRA 5GQBA 4Z7WE 5JQ6H 4P0DA 1CDYA 3EDEA 1TJHH 1OAYH 3B8SA 3MLUH 1UB6A 5FV2A 3O4OB 1MCQA 1I8LC 1GC1C 3OQ3B 2IANB 3Q5YA 4I2XA 4QCIA 4ISVB 5CEZD 3PWJB 3ARGC 2ORBH 4NWUL 3BP6A 2BOCA 1SVCP 3O6ML 5EUKB 2AEQL 4JG0L 4U1NA 5GJSH 1FGVL 1UZ8B 3GSWB 4OZIB 3QUYD 3H9SD 4X7TA 1UZ6E 1TVBB 4NO0D 1W2KT 3PP4L 4KKBD 5HHVL 4P5TA 5FO9A 1ETZA 1LD9A 1I3VA 4CBPA 3C5SA 3WFHB 1JHLL 3LQAH 1IGIH 3WNLA 3MRPA 2WP3T 2HRPL 4B0MM 4X4MA 2YSSB 2K3TA 1TETL 3KS0J 1J1PL 1GRWA 2K1MA 3HC0B 4PG2C 4X4XA 5EUOB 2FZ3B 2IG2H 1CFNA 3R0NA 2W65A 2VDKH 4FQHB 1HILA 4LQFH 5C0FA 2BVOA 4NRZB 4PRBB 4TVPD 1MCJA 4Y5VC 4FN0A 3MUGA 4Z5RB 3OAUL 4IEFB 3GGWA 4Z7QF 4UTAH 1BBJB 3AU1A 1JIBA 4JGJA 5HYQA 4C56E 4M7LT 4F80A 3MJ6A 3PGCA 2D7MA 3X13A 1WBZA 3O4LA 3TA3A 4EOWH 1KCUL 3DXAE 3ARDA 5C0RL 4M6MH 5SWZE 5IVZA 2BSRB 3NOIA 1HSBB 4OB5L 2YD5A 1MFAL 1AC0A 5DDHA 2JJTA 3MOBH 3T1WA 1YY8B 3HFML 2AXFA 5AZ2L 5TDPA 1CTOA 5HGDB 2YUVA 4OF5A 1MVUB 3UEZA 3LSOA 4KGLA 1E4WL 3MV8A 3ZDZE 4L4VD 3WLWD 1H3TA 2F15A 3MRBA 3MLXL 3SE3A 4NQSA 4WWKC 1AE6L 4FABH 5BS0E 5KSBE 3TN0C 4Y4FC 4JM2B 3B3IA 4MNGA 4WRLA 4MAUH 4MQTB 5B22A 2YBRB 4JRXA 2XZCH 3WKML 2CO6B 2C4FU 3WHXB 4XPGH 5GZNC 3F7VA 4XB7A 3GK8L 3ARFC 1IC7H 1IBGL 3LKSA 3C6SA 3THML 4NZUH 4AL8H 4PJDF 5DQ9B 3KLHD 1H8NA 4R7NB 4UT9L 3BWAA 5IBUG 4EEEA 4XB8A 4HH8A 4F8TA 2PTUA 4OLYL 3X3FH 4OLVL 5JTWA 2OMBA 5MHSE 3BZEA 5DD0L 2EE9A 2XTJD 4OFIA 2DMCA 4DZBA 3G08B 4QRRD 1CG9B 4Z0BH 5CEZE 4QGTA 5C09B 5H35A 2R56H 4KJYB 2I26N 3I84A 3LQAL 4GBXA 3B83A 3WIFB 3UPRB 4PGBB 3RWIA 4KROB 3SDXE 3STZB 4ZXBB 5I0DA 3VA2C 5EU6E 1GZPA 3F58L 4JG0H 2BZDA 2HYMA 2NYYD 4BA8A 1JZ3A 2DOCA 3P11L 3KPQA 3QUZA 4ONOA 5DTFA 1QPPA 3O8XD 4HZAA 3K7UA 5EH1A 3W11D 3VXTB 5C07B 5I1KL 2VXSL 3T09A 3U48A 4M6NL 4PJ9B 1A47A 4K7PY 4MAYD 2OQJB 2BOCB 1JZ6A 1DUYA 4G8FB 5JMOC 3KGRA 4GRLD 2HVKA 4X4ZA 4FP8L 4KV5E 5I1IL 1N64L 1JN6B 1KLUB 2HFTA 4O9HH 5T33H 4LDOB 3RTQB 1U42A 5GS2D 1UM6H 3P4LA 4MA8L 4UNTA 2ZKHH 1JHTA 2UUDH 4LNRB 3FB6B 3C09C 5GGVY 1KBGH 3NCBB 3GMNA 1E4XH 5JIPA 4L5FL 1F8TL 3MREA 3HAEA 3MNVB 3T3PF 4HWZA 2ICWI 1N5AA 3QFJB 1OSZB 2A6KA 3L3JB 4U1IA 5EO1B 2VRAA 1LK3H 2X41A 5HGGS 3MXWH 1YEFH 3FFCE 4JPKL 4P2YA 5JDJA 1IM9B 1M6OA 1JK8A 3ARBD 3BYYA 1TJGH 3QYCA 5DRWA 2C5DC 1BQHG 2IH3B 4Y2DC 3C2SA 3UTSD 4F9LA 4YBQD 2WINB 1CGXA 3EDDA 4FQXD 5DSCA 1ZA3A 1P1ZA 2X4PB 3ULVH 1D9KC 4PJ7A 3ROOB 1HOCA 5E2WH 3LKOB 3BJLA 5L88H 2YUXA 3VXUD 4Y5XB 3NCFB 4L8BB 1A6UH 2P5WB 1JRHL 2V2XA 4UIMA 2CDEB 4LLDB 4AIZB 1DLHB 2VXTH 1OP9A 5DJCA 4HJGB 3U0TB 2HFFA 5DRNB 2BOBA 3HNVL 4OIIL 1MIMH 1CR9L 2PYFB 4NCDA 3HZMA 3IDUA 2VABB 4Q2ZB 4CVXA 5LCVH 3P0VH 2FHBA 3TWCH 4HUUB 4PJIE 4R8WL 4ODTH 3NZ8B 3HZKB 4HIIA 1X5HA 4EI6B 2EDQA 1MVUA 4FFVC 2UV3A 3F7PC 1XGRA 2PCPA 4RIRA 4R97B 4Z78B 4UTBL 3CFEA 4YHMH 1Z6JT 2EDWA 4DKEL 3L95B 4WU7B 1ZS8A 4P49A 4POUB 4NKOA 1TNNA 4U3CA 1DJSA 3FQRA 5BW7A 5C0ND 1ONQB 3VU2A 4OF0A 3D0VA 5D6CA 1N8ZA 1P9MC 1XMWA 5FA3B 1HHIB 5E7FA 2OR9H 2WIIA 3GSVB 4ODWB 1RZ8A 3GMOB 2Y5TB 3VCLA 1MCIA 3NAAL 2X4RA 3SDCA 4P9HL 4ZOEA 1QR4A 4DFHA 3OKOB 1DBKH 1T1XB 3ARYA 4K71C 1CXKA 1FYTA 4JREC 5J12C 2IBBA 1DBML 2J8UE 5DURD 1UM5L 4X4XB 2FSEA 4Y16A 2ARJB 4ZUWA 1IGTB 3S34L 1NBVL 4ZOCA 4ELKB 1PJ9A 2SEBB 1OF2B 1JNJA 2DQCL 4KROD 1VADA 1NH6A 2F53D 1BQUA 2CDGB 3FB6A 2GTZB 4YZFF 4ZXBD 1XT5A 2EC9U 1KB9K 2AJYL 3M17A 1B2WL 3MACL 4Z7UF 3TCLB 4YWGL 5TQ2H 3S5LA 5CLWA 3QR2A 1DFBL 1KIRA 3E6HB 4X6FA 4G6AD 3GSOB 3QDAA 4XI5D 3OKKA 1A4JB