1C5BH

Decarboxylase catalytic antibody 21d8 unliganded form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
QVQLLEPGTELVKPGASVKLSCRASGYSFTSYWMHWVKQRPGQGLEWIGLIDPSNGRTNFNDKFKSRATLTVDTSSSTAYMQLSSLTSEDSAVYYCVRIAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis of decarboxylation by a preorganized heterogeneous microenvironment: crystal structures of abzyme 21D8.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords CHIMERIC DECARBOXYLASE ANTIBODY 21D8
total genus 41
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1999-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5bH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5bH02
3W2DH 5J7CC 4G5ZH 4JRWA 3W0WB 4KROD 4NKMA 3RP1A 4G8GA 5D72L 1CICA 4CKVX 4KKLD 3LIZH 1QLFB 2BY0A 3REWA 2E9WA 3RPIB 1AGEB 4WTWA 1A6AA 1ZHKA 5E7FA 4FTVB 5ABDE 2GCYB 4QT5B 2GFBB 4JFXB 1DL7L 2F19H 1YEFL 2PYED 3V6ZA 4WW2F 4G80B 4MJ4A 5B38A 4LARH 4DUXA 1WISA 4PLJC 1UVQA 5GGRB 4F58H 5C0EA 1KNOB 2AV1B 2R0LL 5I1EL 2VTFA 4NFBA 2Q6WB 3CFEA 3MROA 3CVHB 1P84J 3DO7A 3GMNB 1CGVA 4I9WE 3V6ZB 1J1OH 5B39G 3E2HC 1UCBL 2QLVB 4AEIL 4AQ1B 2FJFB 3KYMB 1ZHKB 3O2VH 4Y0GA 3RPIA 4XPBL 1D5ZA 1KJ3L 4HIHB 3RVTC 2B2XL 3DVFA 4KGJA 4W4OA 5DJCB 1R3KA 1NCTA 4X5LA 1NBQA 1UJ3C 3BKMH 3SDXB 3SGKC 3T77B 3TESA 1IZKA 1MLBB 1RZFH 3OKEB 3MOAL 1JI1A 1CU4H 4PJDA 5DVNA 5ALBH 5I8KL 4ODSH 3FO0H 3ZE0F 5MENE 1F8TL 4HC1L 5GIRB 3EYSL 1XR9A 3IYLW 1P84K 2A6DA 3QEGL 3WFCH 2V2XB 3GUTB 2DIAA 1R24B 1RURL 4PJFF 2GJZA 1C5DA 4LFHD 3SDDC 2OK0H 1KLGA 3BGFB 4HGKC 3FL7A 3EJZC 2V17H 2NZ9D 5AD0B 4HGMA 4L8DB 2ID5A 3GSRA 1DLFL 1T0MB 3BKYH 3EYQC 5E03A 3TJHC 5IGXH 2UZYB 4OD3L 4QXWA 5DR5L 4P3DB 3MRIB 4ELME 5IR1A 5KBNC 3B5GA 2A77H 4XMLH 4HWEH 5C0AE 2DKUA 4BSWA 4ORZC 3MLVL 3NA4A 4HLZG 4ZFFB 5I0DA 5J13C 3ARWA 4KK9C 1CQKA 1CD0A 1MREH 4UB0L 3PL6D 4Y4HB 3PXJA 1ZEAL 3W9DA 4XHJD 1NFDA 1YJDC 4N68A 4UOW0 2X1QA 4F3FA 2FLBT 3OZ9L 4UV4H 32C2A 3TCXA 3E3QC 2WWKO 5C2BH 5D5ME 3VXOA 5E1AB 1TJGL 3L95B 4G7YH 1GGBH 1ZT7B 3MA7A 5C0BA 3FO2B 1FP5A 4U2YA 3QUZB 2YK1H 1KEGH 3KPMA 4Y4KD 2IBGA 5E0QA 1AR1D 1MCOH 3QJFB 4G8IB 4ERSL 4X6BA 3LB6D 4CVXA 5AAWA 1UZ6E 1MCDA 3PQYB 4LMQI 4AH2B 5J8OA 3ZE2E 4JM4L 4C56D 4U1JB 1CE1L 2ORBH 3K4ZA 2GY7B 4JFEB 3PF2A 3UXFA 3QT2A 3PE9A 1GIGH 3AS0A 1N64L 4NO0D 4KHTL 1DQML 2DM7A 3DARA 3GM0A 5D1ZB 1JGLH 1H15B 3HPJA 5DK2B 2O61B 4QHUB 2VDNL 2XN9A 2CRMA 4C56E 5CMAA 3N50A 1OP5K 3JV6A 2DLFL 2Z91B 5IOPA 1X5JA 1NC2D 2A73A 4BFBD 3GMLB 4YE4H 3TWCH 2FECL 4M1CD 3GM8A 3RGHA 4BQ8A 3IS1X 4N8VA 4LLUB 1X5LA 3TO2A 3HZMB 3L3OB 1D9KB 4I48B 5L2KA 3IDMB 1YEKH 1RPQA 2D9QB 5DJ6A 1QRNA 4APQD 1MLBA 5I8EA 3VFSB 4RMSA 2Y6SC 3AUVA 5C0DA 1NCNA 5GS3A 5BXFA 1JTPA 3H9SD 3SKJH 4ERSH 1C16B 4CJ0A 2BNRD 3QUXB 3JZ7A 1JZ8A 4YDKH 1FIEA 1LEGB 4JRYE 3STZA 1S9KC 1CG9A 1BVLB 5HHQA 1FVDB 3ARYA 2AV7A 4ZUSB 4YBLC 1KCSL 3VD9A 2RB8A 3RX7A 2CO6B 4HUVA 4G6JL 6FABH 1FCCA 2A6KA 4P57B 3F6IA 4JFDB 2PYFA 1B90A 1T7XA 1ZT1B 4ZFZA 3OAUL 2R69H 2DQFA 2M26A 1QNZL 4XZUA 3BP6B 4YK4C 2ICCA 4JPWH 4N9GB 1F3JB 2IMMA 5I1HL 3Q3GA 4FZ8H 4K9EL 3GJFB 4JR9L 4TSAH 3ORJA 4D2NA 1EAPB 1A9EA 4HWEL 3O41B 5EU5A 2HH0L 2Q86B 3QDGE 3JTTA 3GMMA 3HC0A 3W0WA 1JGVH 1NSNL 2EXWC 3D2UB 3QDJB 1QRND 1Z0MA 2E8ZA 4XPAH 5CBAB 1CBVL 2VC2H 3BUYA 3ARPA 4XBEL 4LAQH 1YNKL 4LLWA 2FIKA 1F4HA 1MRCH 3LDBB 3LMJH 4FABL 2Q86A 4RAUA 1MEXL 1CGSL 3U46B 4PGJA 3GJFA 3QPXH 5IMKA 4MGXA 2R4RL 5E56A 3CUPA 4ZTOH 4XBEH 4YH6A 1J8HE 1T83A 5ADOH 4YE4L 4QRQB 1CLYH 1FNHA 4I2XB 4AM0A 1E28B 2HKHH 3BKJL 5FO8A 3MODL 4YAQA 4LBEB 4Z7VB 5D7SL 4L9LA 5DHYA 4L8BA 4L3CA 3MCKB 1INQA 1LD9A 5C0CB 2W0LA 5E8PB 3OR6A 2DAVA 3AREC 3RTQC 1KN4L 4U1HA 1LDPL 5HYFA 1VFBB 4FQQB 1EERB 3MRRA 1RUKL 5IFHH 1VADB 1QO3B 5I66A 4GRLB 4ETYA 5HDQH 3D85D 1ZHLB 3CX2A 4X4XA 4JFFE 2F5AL 5H35A 3AU1B 5JIKA 2V9RA 1RVFH 1MFDH 2G5BB 1G9MC 1DEEB 1DR9A 2UWEA 3MLXH 1D9KA 4KKAD 1KYOK 2Y5EA 5BZDB 5GGTH 2W9DL 1I7UA 4H26B 2B1AL 1RQ5A 2X10A 2EH7H 2AK4A 3FB5B 4K2UH 5K9JL 5FGRA 2ZWLT 2VKXA 2Z91A 4XP1L 1KCKA 4E5XB 4X9FA 3LQAH 1TZGL 3FRUB 1JP5A 4JFPA 4MDJB 3N1MC 5E6YA 1UJ3B 4MSWB 4XP5H 5FYLL 4FTVE 4GG6A 1VPOH 3QIBD 5BO1L 3M8OL 5HXMA 5KOVC 4QRRA 1H5BB 1PYWA 3IFLH 2CXKA 3I6KA 4MJIB 2DYPD 4OQTA 1X7QA 1Q1JL 5F1SA 2FL5B 4S2SB 1UXWA 5JORA 5C3LD 1NDMA 1Q0XH 3B4NA 3UDWA 2P5ED 1I8IA 1MCPH 4EI5B 3TYGH 4PRHB 3MRHB 5EZIL 4J12A 3B8YA 4X98A 1A7RL 1RULL 4APQB 5A2JH 1FV1B 3TLRA 5DC0A 3VMNA 2PYEB 5IIEA 4KMQA 3U2SB 2QSCH 5IVOA 1DLFH 1OT1A 1EK3A 2FJHA 3H3BC 5IGXL 1U8KA 3QUZA 5FCUL 4GW4B 4KVNH 1TXKA 1PFCA 5HVFB 1QYGL 4IMLB 1GAFL 1CE1H 5BZDA 3ZKNC 2R8SL 1NBYA 4RA0C 5EH1A 1XF2A 5CSBA 1BLNB 1IC4H 1FL5B 3RKDD 2AQ3A 5L2JA 2NYYD 4PJ7A 2Z92B 1R5VA 4KDTC 3QUYC 1KIPA 4TQEL 4XPHL 3RAJL 3UYOD 5D2NB 5IHLB 1K8DB 2ERJB 5EZLB 4G8FB 1W72L 5F88A 3LIZL 3QEQD 4WHYG 3ZSSA 4BSWB 4XHQA 5L2JB 3BW9A 4KQ3L 4L3ED 5HYQA 1MAKA 3DVGB 3WS6A 4YEEA 2XN9D 1UB5A 1TZHB 3WS3B 2NXYD 5E2TH 4H0HB 3RZCB 4KGLA 2UYLA 1J1OL 5HYSA 1KLGB 4APQC 5HHOA 2C1OA 3BRFA 3ZL4L 5ALCL 2R2CA 4FNLL 3TBWB 2OJEB 4JFQA 1TJHL 4EI5A 3S35H 1YNTB 1EMTH 1SYVB 3QZWA 3JWDL 3MBXH 3V4VL 5HGHB 3BKCL 1Z5LB 3HAEA 4XPAL 3I6KB 2R15A 1KCRH 4NRXB 1IZJA 1V05A 2YPVL 3GJFH 1LQSR 5D1ZD 4AIOA 3IU3B 3GSXA 3U48A 4LDLB 1GOGA 1I7RA 5T5NG 4P5MA 4K8RH 4JPWL 1NCDL 2K7PA 4HIIB 4AIZB 5FFLA 3L5XH 1H8SA 4LGPB 3BQUA 5C0FA 1H3PL 2G5RA 1AO7B 3MPCA 2DQFB 4KDWA 3QIWA 1IKFL 2PYFB 3HG1D 3RVTD 5IMMB 1A0QH 3CFEB 2NTSP 4U4BA 2A74A 3RZWA 1U42A 3WSQL 1S7VA 4GBXD 25C8H 3UTTD 5FOBA 3S4SA 2X40A 5D7LE 3BO8B 3HUJB 4Z77A 3I6GB 3I75A 3KHOA 3QRGL 4AEHL 3AMKA 2CKBA 3BZEA 4JFXA 5D93C 35C8L 2GCYA 2QADD 5EOQH 1QR1B 3QYCA 5E4EB 3E6FA 3ZTNL 2X41A 2J4WH 4C56B 1FFRA 5MEOA 3UTSA 1EPFA 4GG8A 1YMMA 3CH1A 4NQEE 3AVEA 5FA3B 4GXVL 5GGRY 4CDGC 1LEKA 4OKVB 5J11C 4XX1E 4WHCA 3LEXB 5DJ6B 1W72B 3K8MA 3NCFB 1R5IA 1S7QA 5K9QI 1I9RH 3S36H 1QZ1A 4YDVA 1F4AA 1JYVA 3D9AH 5E94A 4QYOA 1W0VB 4IMKA 5I1LA 2DQGH 2HT3D 2YSSB 5L7XL 1KYOJ 4ORGB 5IT2L 4TNWK 2YN5A 2GJ6E 2DD8H 4CMHB 5C1MB 5ID0B 1S9XA 3GZKA 2IGFH 5EOTB 4NNXB 4ZFOA 4YHPA 2PKDA 4AENA 3QFJA 2ICEB 1KF9B 4O02L 3WEXA 4NO5A 4WGVB 1R3LB 2APXA 3QWRA 5C09E 2H32B 3VGHA 2H41A 4KY1L 1DP0A 5F21B 2G60H 3RWHA 3LN4B 2MHAA 4KVCH 1QQDB 3AROA 3R0MA 1TCMA 4JAMB 2R23B 3MLYH 3KYOA 5E08H 4LSVH 4QXUH 5I15L 4RFEA 1P4BH 3QDGB 1AD9A 4KK9D 5C07E 4HPOL 4NWUL 4ODTH 4UV7L 5DMKA 5F9OL 2E9IA 4PS4L 5GGUA 4XX1G 5HHQB 4OKDA 2CIIB 4FXGA 3NIDF 3WJLA 3VXUD 5EOQL 2OR9L 3OKMB 1KCUH 1NH6A 4OFYD 1OLLA 1S5HB 2VLJB 3GGWA 2PNDA 4YEFA 2HJLA 3NCYS 3CFCH 5C07D 3MXWH 3QZWG 1ED3B 2AXGB 4OZGA 2Q76B 3IDMA 4XZUB 4U1MA 1DQLH 4FS0A 1HNFA 2X4NA 4PRIB 4ELKA 3CDFA 3T0EB 4EUPB 5B39B 2GAZA 5AG8A 5JLZA 4M6OH 4NN6B 3O6KH 1IILE 4M62H 2SEBB 3OR7B 3RDTD 4NIKB 4QRRD 2F74B 1NMAL 2P4AB 4GAGL 3STZB 3GRWA 4L29A 3QULA 4KTYA 4PJ8C 5AZ2L 4PY7A 5I1AB 3HE6A 4LCCC 3O6KL 5CEYB 2VR5A 1C16A 2HMIC 5F1IB 3MCLL 1IKNC 1UXSB 4M4RA 4EIZC 1GJIA 3NCJL 1OAXH 2COQA 4I77L 3U36A 5DJXA 1T3FA 3ZMRA 3KPOB 3VXQB 1CT8B 1WC7B 2CGRH 5GGVH 3U7WL 4DVBA 4Z7WB 4GG6E 2PTTB 3KPLB 1J8HA 2VZVA 3WNLA 1LEIA 4WCYH 4RQQA 5DJCA 1I4FB 5SV3A 2DKMA 5CILH 3L3GA 4WGWB 2W0PA 3D85A 4GAJL 4LKXA 5F7YC 3OKMA 4P9ML 4HBCH 4R8WL 4CW1B 5C0AD 1YN6B 2BP3A 2CIIA 3HRPA 4CRPA 3GMNA 1U8MB 3VXOB 4PGBB 3SE4A 5LG1A 4AJ0A 5I75C 3OPZH 2R29H 4NKQB 5F9JB 4Z7WF 3QUYA 1OGAA 2XZCH 5I2IA 2AJZB 4ZD3H 5CS7A 3OKOB 4TUJB 1P7KA 3T0EC 4H1LB 5EORL 4HXAL 4HS8H 4PTTA 1BGXH 1S7TA 1A1OA 1QQDA 4LHUG 2Q76A 1MNUL 2IC2A 2JB5H 4XAWH 1Z9SA 4MA1C 5FKPA 3HZKB 1BIIB 3PGDB 2UVEA 2DYPB 3K3QA 3B6SB 3A6CH 1OY3B 5A1AA 1BX2B 5E6ZA 5IESH 1P7KB 2Z93A 5CEZE 5EFIB 3WEXB 4MCZB 4OLZH 4JEGB 4PTUB 2XZQL 2O5XH 1RZIB 1OGAB 3GSRB 4FP8H 2AJYL 4PYGA 5F7WC 2J5LC 3H9HB 4MXQC 3BH8A 1RI8A 4OLWH 5D9SA 3CSGA 5EC2B 4YR6B 4F33B 1DVFB 3T09A 4B41A 1CXLA 3GJFK 4ZTPH 4WCYL 1FGNL 2BVUA 1MCPL 3ARFC 1JTOA 5GJTL 4DQOH 4JZOA 5KVEH 2P8LB 4TNVF 4IRZL 4PD4K 3ARDD 3T1FA 3V6OA 4YIQA 3T0DA 2A6DB 2QQNL 4XNUL 4K8RC 4GW1A 1IAIM 4FFVC 4M61B 4R96A 5EO1A 4YDVB 8CGTA 2HT4D 4C54A 1FL6A 4YBHA 4MD0A 1PKQE 1BBDL 4U7KA 4ZSOB 1AJ7L 5MP6H 4LLVA 3IDIA 2UWEF 3U0PB 4PJGB 4M48H 2XV6B 4X9GA 4HUNB 2C3VA 1KACB 4FA8A 4IBLT 2QV2A 1N6UA 2Y06L 1EEYB 4WI9A 3VG9C 5DI8B 1BZ9B 4HS6A 4RGOL 2VQTA 1AHWA 1B4JH 5TDNA 1Z9MA 2JJTC 1RUPL 3MLXL 4QTIH 2PO6B 2Q8AL 4G43A 4ISVB 4FRWA 1W0VA 3B3IB 1YEIH 5IQ7L 5FGCB 1KPUB 4MQXC 1ZK9A 4X7TA 3O8XD 3BX7C 3V95A 2GFBA 2IAND 4P2QD 2OR9H 3U4EA 2WBJB 3VGAB 3C09B 4Q6IA 1MIEL 4NUGL 5IT2H 2NY5L 1PSKH 2BVQA 4I0PB 1CGXA 4YX2L 3MZGB 3UCRA 3SKNB 5BV7L 2FRGP 2G75A 2G9HA 2VUYA 5LVEA 3I6LD 4OI9A 3P0VL 1EEZA 4HHAB 3L5JA 5GZOD 3KJ6H 4ODWB 2BY2A 2HVKA 2VXUL 5E5MB 4NZUH 4F9PA 4XCFL 4QKXB 2WW8A 3VH8A 1I8MB 1AD9B 5D6CB 4F80A 3VJ6B 1M7XA 4PJHF 3MCG1 1MIEH 1BVKA 4XP4L 5JZ7C 5FO7A 1GAFH 3TNMA 2EKSB 3GSUA 5DI8A 2DQDL 3NGBB 1ES0A 3QQ9D 1JWSA 1LHZA 1LO3H 2VAJA 3RGVB 4YO0A 2H6PB 3P9MA 5KTEH 4LF3B 4ETQA 1T1XA 1S9VA 3FJTA 3NFNA 2HFFA 3IAQA 4KK5D 5T1LB 5C0BD 3VFNB 25C8L 2DQTH 5L88L 5IK3A 2N1KA 1FDLH 3GB7B 5GISH 5T5FH 2R1XA 3ESVF 1VERA 2QSTA 3EZJB 3CFDB 3GI8L 5HGBA 2V5YA 3INUH 4U6VH 2ADIA 4W6WB 5EZLA 3RL1A 4Y16C 1DLHB 5IESL 1JYWA 1SYSB 4UB0H 3A6BL 1D5XA 2JTDA 2DJSA 4K8RL 2D31B 2OL3H 4JO2L 5CKGA 3B9KA 5J3HC 1CFVH 4PBWD 4YHLH 3LQAL 1CF8H 3BN9C 3SDCA 2GW5A 1IC4L 1LILA 2WMPA 4KI5D 4EXKA 3JUYA 1ORSB 1XGPB 3BWAA 5E99L 4LPXA 3PDGA 2CLRB 2XZZA 4MA3A 1INEL 3T0VA 4JKMA 3O3UN 3EJJX 5C8JA 2FSEB 5EBLB 3SO3C 6CGTA 1NAKL 5JW5A 3IFPA 2J2ZA 4U7SA 4X98B 2YD9A 5DT1L 2X7LB 4PG2A 3C5ZA 4G42B 2E7CA 4HLZH 3ZE0E 2HFTA 1L0YA 4X7FC 3F62A 4R7DB 5K9QG 1HHGB 3ULUE 3MACH 5C08B 3ZZ1A 4DKEL 4M3KB 3I6GA 3I75B 3SDDB 4WNQA 1A3RL 3BMWA 1WCBA 5DO2C 2BJML 3GSNB 4G9FB 3MJGX 4OLUH 5MERA 1KTLA 4OLZL 2C4FU 4LLMB 3VXTA 5JPNA 1A64A 1BLNA 4POZD 1HSBB 5DUML 4JG0H 2YPLD 5GS0D 5INDB 1WT5A 4PJBB 4NQCD 1FQ9C 4XI5C 5I19H 4AYFA 2EYSA 2P42B 2VWEC 4JFHE 5L2KE 2DQIH 2NW3A 2ESVE 2H8PB 3GMPB 3VFRB 5MENB 3OSKA 4XNZC 3NH7L 3D85B 3T65A 3D1MC 4KK5C 5F3HA 1IAMA 5INDA 4XCEA 5GGTL 3LAFA 2PW2B 5D6DC 2W65A 2VSDA 4JDTL 3ARBA 3ZYOA 1KTLB 4R4NC 1R3IL 4JB9L 1BMGA 3RWDA 2DDQL 2WLYA 2R8SH 5INCB 3FT3A 5AWNH 2CUIA 1VEOA 3LPFA 3QXTA 4KDVA 1PYWB 5I1AA 3LN5A 2WSKA 4L4JA 1LDPH 4NCC2 5E8PA 4PJFA 4YHMH 2H32H 3WD5L 1MCIA 4LCCB 1B2WH 4U1IB 3DVNB 2IJ0C 5C8JB 3KXFD 3STLB 1ZEAH 1VFOA 2JCCF 5MEPA 3PHQA 4HF5H 1I8KA 2VDOH 4O2EA 3IDNA 5CJQH 5EO9B 5SWZE 2YD5A 3U7YL 2VLKA 4X7CC 3P4LA 1DEEA 3CUPB 1A7NH 1OOAA 1UM5L 1KCRL 2CLZA 4HMDA 4XGZA 4HJJH 1RIUL 1T03H 1MAML 1WIPA 3QXDB 3KXFE 1DUZA 1QA9A 4XNXH 2YD3A 4RGND 5DZNA 3DV4A 3MBXL 2YWYA 1NFIB 1WTGT 4M9PA 2QKIB 1WZLA 1OLZA 4ZUVA 3ET9F 4P48A 4YPJA 3G9VA 4BFGA 1J1PL 3N1FC 1OAYH 1BWMA 1JK8B 2FBOJ 4PJAF 4HEME 3QWRD 4F15C 5T1LD 1XF5A 3OAZH 4U1NB 5D2NC 4OAWB 2EDOA 4LSTL 3VD7A 1KJVA 3EYVB 1MCQA 4MA8H 2DWDB 4UQ3A 2A6KB 2CO7B 4PRHA 5L7XH 3CFBB 3VGEA 1I3RA 2VDPH 3V7AG 5L8JB 2AXHA 4O2FA 5C9JA 3SDXF 1QSEA 2VISB 4HIEB 3RY4A 1OSPH 5TPWL 3OHXB 3RVVD 1U93B 1JHTB 2PN5A 2A2QT 2CUMA 5JDSA 1U8NB 1UYWH 3LZFH 5HVHC 1WVZA 2FATL 5CGTA 3QXDA 1PG7W 1EAPA 2G60L 4HKJA 3TN0C 4HWUA 3QNXB 5F6IB 2Q7YB 1RK1A 3EO9H 4OV6F 4KVNL 1NMCB 3IKCB 4OCSL 3P73B 2QSVA 3C6SB 2OJZH 3IDYB 3TBVA 1CLZH 1AXTH 1UACL 2V5SA 4P2RA 5GS0H 3PHQB 3SN6N 1T66C 4G6AC 4DCQA 1AGCA 3C8DA 4QGTA 1KEGL 3QH3B 4ZUSA 5D7KD 5D72H 3E2HB 4NQDE 4S10A 3AU1A 3EDDA 3B9AA 1T04B 4LHJB 2VQ1B 2BSSA 1IGJB 2MNUA 3OJMB 2NW2A 5CHNA 5A16A 2IFFL 4LDOB 4F7MB 4D9RD 5JR1L 2DMKA 5I66B 1YEGH 5JW4M 2AS5M 4C58B 3X13B 2N7AA 1RJCA 1FORH 4X99B 4ENED 4H8WC 5E8DH 4TN9A 2EDYA 3QUXC 3BZEB 5K59E 5A2KH 2WQRA 2IPKB 2VERN 5F96H 5INCA 2HP4A 3A67H 1CFSB 5DHYB 1AKJA 2V9TA 4ZSOA 3UYRH 3MV9D 1CFNB 2XKUA 4ZOBA 4QRQA 4J1UB 3ARGA 1I1AA 2I9TA 1A1NA 4ZUUB 3ES6A 5J1TC 2FNBA 1IKNA 1K4CA 4LAJH 1S9YB 4PRDA 1WZ1H 4M5ZL 4YIQB 4WEMB 3GMLA 4Y1AA 2AJSL 3DHJA 2R9HD 2NY1D 4PRPA 3MA7B 2EDJA 4NQDB 1MCWW 2IMNA 4YR6A 4ZNCD 5KS9F 2VDLL 3NCCB 4Y2DA 3VG0L 1F8TH 2HJKB 4MWFA 1MY5A 1FAIL 1UM5H 4ONGH 3WFHB 5EDXA 1KXQE 3D25B 3RX5A 1ULVA 5D7LA 3WO3B 4MNQB 4OB5L 5DHVA 4OLVL 3GMMB 5DUBB 4LVNC 5C08A 4PLKD 4RFNC 4JFDE 4KQ3H 2ZSWA 3QP3A 4LSQH 5D2LB 5HY9B 3PIQB 1NQBA 2O5ZL 5JR1H 4NZRL 2D7NA 3D69A 3N85L 1Z3GL 4RZCB 4BZ1H 3WXVL 4FOMA 1LE9B 1R3HA 2P7TA 4F9LA 1KELL 2APVA 3OB8A 5KVFH 3ARGD 1E4XL 1NGYA 2BOCA 3FAXA 4YHML 2Y9RT 1RY7B 1E6OL 2HFGH 5D1QD 1UACH 3UPRA 5DMIL 3FO2A 1TZHA 3MR9A 1NBZA 4G9FE 5T3ZD 4WTZG 3DVGA 1M6OA 5EO0A 4PJCE 5HYQB 1NFKA 1D5BB 4YDJA 5T33L 2RJMA 1R24A 2KQMA 3L3GB 5BW7A 2X9YA 2GTWB 1GZQB 4O2CA 2AJVH 4XP6H 4MNQE 3VFSA 1AH1A 1AIFA 4MA1B 4CVZB 4G5ZL 2M8XA 5H2BA 3QFDA 1GZPA 2HFFB 3FRPG 4YDIH 3ARFD 4P3DA 3KYKH 2DLGA 2JCCE 4LQ1A 1MJ8H 1CLCA 1REIA 2BXYA 2CKBH 1Y0LB 1JBJA 4K7FB 1IGML 4J4PD 5DRZA 4WV1A 4N8VG 4UBDC 4Z18A 1MAJA 3TH3T 1JPFA 1YDPA 4WFGE 1YEIL 4JZNA 3QRFM 3AC0A 4UILL 4LPWA 4D0CB 3H3PL 4HDIA 3LKNB 4PP1D 3TBTA 2I07B 2ILLA 1EFXD 2DQDH 1CGWA 3FQWA 3LHPL 5GIRA 1QSFE 3CGTA 4JHBA 1KIRA 5JHDE 4JM2B 5GS2H 4ODWA 1ZTXH 3D39D 5IVZB 4OGZA 3VFTA 3VXSE 1HHJA 1F2XK 1AFVH 1AGEA 3ARBB 4WWKB 1CDJA 2QSCL 2V2TB 4HUKB 4X6CF 1RIUH 2J6EH 3WN5B 2F8OA 5F96L 3F7VB 1SVZA 2E3VA 3ROLB 1U8LB 2VH5L 3EOBA 2VZUA 1NEZG 1QSFD 3T4YB 5E5UB 4WU5A 1H0DB 1I7TB 3FO0L 2WINB 1BPVA 2EDDA 4GLRH 4PJBA 4PUBL 1QKZL 4X7TB 1MJUH 1ADQA 1KPUA 2EH8L 5KJRL 1XCQB 2UWEB 4O58L 3H9YA 1DJSA 2OLDA 3DETC 5ACMA 1TJIH 4F3FB 3WD5H 1Z6JT 3MGOA 3QAZB 4LSUL 2DIJA 3KR3L 4U1GB 4P99A 5DRXB 4Y4KA 1LK3L 5E24E 4HKZA 3ZKXC 4JAMA 4R97C 5FECB 1A6AB 2P8MA 1YY8B 2AGJL 4ONHA 2R39A 3DYMA 1PX4A 3KDMA 1MI5A 4MA7L 1B3JA 2NQCA 5ERWA 4JCLA 4L8SC 3MV7E 3DYOA 5B3JF 1ND0A 4KTDL 4GRMB 4JZJA 1B4RA 3W5NA 2ZG2A 3AS3A 3KXFA 2ADFH 4OIBA 3VRJB 4JKWA 1YEFH 3CXDH 4MA3B 1GCFA 4LPVA 4P2OA 5DD1L 5CEXB 4PJHB 5KW9L 3HNTH 1HHKA 1KENH 1G84A 3TF7C 4FFWD 1DDHA 2GQHA 3LEVH 3JWNC 1Z9OA 3MV8D 5DEFB 1KCVH 5CUSL 4PP2A 3ULUC 3TCLB 1FNAA 1MFAL 1CXEA 2R2EB 4XXCC 2DB8A 4DUWA 2XPGB 5ERWB 4LLWB 1DSFH 2KL6A 3SKOA 3L7EB 3AXLB 1PQZB 4PJ5B 3UTTA 2VDLH 1F13A 3JTSB 5FYKD 5DRWA 4HD9A 1U8JA 2DS4A 2D2OA 4XVSL 1YEHH 4L8CA 4WJ5B 1OTSC 2VB5A 4P2CG 2FZ3A 2VLKD 4R9HA 1PVHA 3TNMB 1HE7A 2BDNH 4PTTB 2VJXA 2CDEA 2GEEA 1I8LA 3V5KA 5ESAB 2M1KA 1X5KA 2VXVH 4GOSA 2DQIL 4XWOD 1L9MA 1FLRL 1PDKA 3QO0A 3VA2C 1UVQB 5GGRA 3UROR 2D7OA 5TH2B 5D71H 2C4XA 1BVLA 4AK1A 5JPMB 2D7MA 1CFBA 2VLKE 4WU5B 4H20H 1JPST 4MZ3A 3S34L 2V2TA 2I26N 3MRGA 4BUGA 3P0YL 4HWBH 3PQYE 5HYJB 4DKEH 3K8KA 1CL7H 3MZTA 3PWNB 1DQLL 1DBBL 2ZNXA 3BN3B 5ADPH 4OCRH 2QQNH 4XNUH 4ODVH 4H25B 5TE7L 5I71C 1BM3H 1A3LH 4LL9A 4DTGL 4X4MA 5MI0B 1DQMH 2Y36H 3VFTB 3Q5TA 1FHGA 1I1AC 4R0LB 1MH5A 4E0RA 4ZPTB 3RI5K 4G3YH 3TV3H 2NY2B 5I16A 4K94C 1H3PH 4WEUD 1KXVC 2EDKA 5C0BE 1KLFA 3KPSD 4LVOC 3VU2A 3QO1B 1JVKA 1A2YA 3IDUA 4NZUL 1BZ9A 1Q9WA 5JLZB 2GAZB 2ZCKH 2IH3A 3UJTH 4BQ6A 1WLHA 5MEQA 1KPVA 1T1WB 3TNNB 1OM3L 4D8PB 4LVHB 3HR5B 1ED3A 3UZVB 3CVHL 4YHOH 4AH2A 4FMFA 5CGMA 3PWJB 2HJLB 1GZQA 2VKWA 4X7DC 3VXMA 2BVOB 5DC9B 1NKOA 5DJZB 1V8HA 5JOPE 3MBEC 2H1PL 4BQCA 1P2CA 3C08H 4M1DL 4MJID 5TF0A 5IB2B 3KJ4C 1BEYL 1LE9A 1QVOB 3QB7C 2MOVA 5KN5A 5HGDB 3PL6C 4OJFL 4B0MM 3EYOB 5CUSH 1RIVL 4F37F 4I4WB 3IDXH 5EBMA 2EC8A 3QWQB 4MCZA 2Z31B 1T83C 1NGZA 1JNLL 2EIZB 2VLRD 1JZ7A 1MAMH 4MLSA 1XGRB 1QOKA 3TH2T 1FNGB 1BIIA 2VQUA 4DZBA 4HJGA 1DANU 4Y88A 1IAKA 4WI7A 5DFVD 1S7TB 1K2DB 3QDJE 1HKLL 3KLSA 3O8XA 2RFXB 4KJYB 3MRIA 1FE8H 4JJ5A 4CU8A 5I2IB 2IBZY 5I6XB 3WFHA 1RFDL 3RUGF 4N1HB 5AD0A 2X4RA 4C57C 4PRDB 3UBXI 1S9YA 3S3PA 4Z7UB 3RZCD 2NYYC 3O6FC 4MSWA 4GG6B 4X0KA 1JN6B 2OI9C 4V1DD 3D87B 1IRAY 3CPLA 2YSSA 5EZIH 3K74B 1OAQL 3QDJD 2LQRA 1NGQH 1TIUA 4AEEA 1HXMA 5E94B 4OZHA 5ID1A 1AQKH 5I73C 4EVNB 3ARUA 4KPHH 4RCAA 2ZUQB 4U1SB 4J1UA 3WLBA 1MRDL 5KANI 2YPLB 3BXNA 1QPPA 4PJAB 4XWOC 1WWBX 3MYZA 3GSOA 5B21A 3U36B 2FYYB 4IEFB 4HIHA 4PV9A 1VDGA 1KG0A 2XQBL 1UA6L 3HNSL 3IDJB 2EYTA 1GL4B 4PRNB 3ARGC 4NFCA 3ARQA 1CICD 2W60A 2NZIA 2Z35B 5I15H 1HDMB 5EN2B 4EVNA 3RY6A 2VQ1A 5F8RC 4WFFD 1NCAL 4PJ8B 3RWJB 2SEBA 4MXWL 3BUTA 1JGUL 4E42A 1A3RH 1EIBA 4OFIA 1XGYH 3PV6B 1AE6H 2FX8H 2VDQH 3NA9H 4L3EE 1EV2E 4XPBH 2IGFL 1S78D 4ZO7A 2DD8L 1JGUH 2BK8A 1B0GA 5HHOD 3WHXB 1SVCP 1EFXB 2VXSL 3QG7H 4W6YB 4BH8A 2RFXA 4PV8B 4P4KA 2ARWA 3WO4B 5FK9B 1UZ8A 3RL2A 4KUZL 2A83B 3L5XL 1F58H 4F7PB 1KENL 3CNKA 5DJYB 3LKSB 5E9DD 3V4UH 1NEZB 5I1JH 4J2XA 2BHZA 1NKRA 3TH4T 4YWGH 3Q5OA 1CF8L 3FO9A 4QTHA 2OX5A 1S7UB 4EQ3A 1XF5B 2NXZC 1S3KL 3I9GH 5KN5B 1U8HA 3BD3A 3KG5A 43C9B 3RA7L 4P2QA 4U6XA 2ESVA 3D0VB 1IL1A 2RCSH 1Q38A 4P46C 2X89D 1JFQH 4ALAH 4TPRH 5DEZA 1BQLL 2EDNA 4MMXC 1KB9J 4M7KL 1OB1A 3WIFA 5EU3B 1JPSH 2D9CA 3V6OE 1CIUA 3M1BB 2X89A 4AMKH 1TJIL 3SPVA 1NFDF 1ZWIA 2GUOA 2NY4C 1KBGH 1B0GB 3EOTH 1TCRB 4K9EH 5F88B 4GMTH 4YUEL 1Z9LA 1AD0A 4MAYA 5EUOE 2VLKB 3ALWA 4RMVA 3AREA 5CJ5A 4HKXB 1FLTX 5E9DA 4G6KH 4KKCC 4QHKJ 3OAUH 2F53D 4J4PA 2RCSL 4TVPH 2VLME 2DI7A 5FUOL 5I17A 2Z92A 3CLFH 3UZQA 3O9WD 4TSBH 3H9ZA 3DGGB 1YYMH 4LRNL 1NBYB 1KN2L 5GGSB 4L4VB 4I3RH 4YHNA 4K2UL 1CE6B 4MAYD 3UTPE 2MMXA 4FG6C 3SDCC 1K8IA 1FVCB 12E8H 4MB5A 4NSKA 3H9SA 4YX2H 2F53A 4HH8A 4K3EL 3QUMA 1AQKL 2BNRA 2XN9B 3QXVA 1A14H 1JMZA 3EYQD 3JWDH 5CSZA 4BQ9A 4CMMA 2DWEB 3ZKSD 3F5WB 3BD4A 1J8HD 3K0WA 3CVIH 4JRXD 1QHOA 4KI5F 2IFGA 4ODHL 2H1PH 3C60C 4UIKL 1MCHA 3O6FD 5F97E 3U4AA 1RFDH 2CUHA 3RWDB 5JMOC 1RZ8A 1A7RH 1RULH 2P24B 2X9XA 3ESUF 4U1JA 4B5EA 3BRGC 3CPLB 3TYGL 4QXGH 2W65B 4U0RB 4QRSB 5F89B 1WAAF 3V4PL 1D9KC 5DGQA 2ZUTA 4BELD 3T65B 4Q6YA 3D0LA 5SWQB 3THML 4R26H 5A2FA 4NQXA 3S36L 4JHWH 1MHEA 4X6CE 3IU3A 1S8DB 4ZG1A 2VIRA 5E2VL 2AEPH 1JZ5A 4I0KA 1F3RB 5C0NC 3GFUA 4BKLA 4MD5A 4KY1H 4RIRB 2I27N 4PJ8D 4S0SD 5D7IA 1NCCL 1UT9A 5K9JH 4OFKA 2HYMA 4JM4H 4HT1L 4WNQB 4FN0A 4IRJA 2IQ9H 1AGDB 2MFNA 4OIIL 1WBXB 1ZTXL 5JNYA 3IVKA 2X4OB 2CXGA 4QRUB 2IADB 1IBGH 35C8H 3HC3L 5FCUH 3V9FA 4XAKD 3QXAA 3L7EA 3WFEH 1TDQA 4NM4L 3T0EE 4PGCB 1RV6X 1QSED 5HHOB 4O58H 3NFSH 4ZTPL 4IRJC 2R4SL 5D1XB 5C2BL 5EU4B 1SJHA 2O5ZH 3BYYA 3HE6D 1AGFB 4MNQD 1VGKB 2W59A 3F58L 3TPUA 3QUZC 3EYFA 1BF2A 1EJOH 5T3ZL 1A6UL 4KV5F 3R0NA 5E00A 3X11A 5I1IH 3HB3C 3JVGA 2Q8BH 4PY8I 2CIKB 4X6CB 4ZOCA 5IMKB 4GRMA 4L9DA 2GUOB 3FRPA 4ZNEA 5T1LA 3WV0A 1JJUA 1QRKA 2XZAL 3NFNB 5E4IA 4D9LL 3IAGC 1MI5B 2BRRH 3RWCB 5CZKA 3T2PA 3RWGA 3QNYA 5IJKA 1UKQA 5J13B 3CFDA 1Y18B 1BFSA 3C8KB 2NCMA 1OGAD 4KVCL 5HGAB 4NRYA 3EJYD 1EZVY 1FYTE 4UT7H 2EKJA 3JTTB 1CDUA 2V2WB 3PABA 3KPNB 5ESQB 5DUPH 2EDXA 4X7SL 3NPZB 3FQNA 2NY3B 5IMLA 4FNLH 3HZVA 1VKXB 1C5BL 4FZEH 1T0NA 4NZTH 1A7NL 1DSFL 3QQ4A 5FM8A 3VXRB 1U3JA 1YEEH 3L3KA 5ESVA 1OF2B 5FB8A 3DO7B 1I7TA 4APQA 3GSWB 1QTYT 3KYAA 3G6JB 4K8RD 3EDEA 3U7WH 3RNKA 4TSCL 1I8IB 5FGSA 5HI4C 2NX5D 2BNUA 3FOMB 1LO4H 5ITFB 3QHZH 4EOWL 1FVDA 5KAQF 4YQXH 1HSAB 4P4KB 2C3XA 4DEPC 3FT4B 7FABL 4ZO9A 4EDXA 4UOJA 1F6LL 3EHBD 4HULB 2ADFL 2YRLA 4G8GE 2FR4A 1BQHG 3FHQA 5KW9H 1C5BH 5IG7A 5I73B 1HSAA 3G5VB 3OJ2C 1CGSH 5DJ0A 3RPKA 2BCKA 1SY6A 3RDTA 3RNKB 2FCBA 3ZYZA 3QPXL 4W4OC 3RVXD 1HOCA 2ICWA 4ODXA 3EOAB 3BPNC 4K7FA 2ATPB 2G5BA 1LK2B 4O5LL 1VSCA 3PABB 5I19L 2NLJA 1EHNA 4NN5C 1ZHLA 1GPOL 5K9KB 1KCVL 3DROA 1OW0C 1KCUL 4OZFA 2YHGA 2NXZD 4OB5H 3MRPA 1T22B 1NPUA 3LEYH 4FQ1L 3RWGB 3UBXG 5DD0L 3OR6B 3BPLB 1XCTA 3QCTL 5IMOB 1UJTA 3DSNA 4BH7A 2VDMH 2KH2B 4YAQB 3GBML 2P8LA 4JQVA 1VHPA 4PJEE 3LD8C 3ARTA 3BIBX 1IVLA 5IUSA 4JY4A 2G2RB 3I50L 4GW1B 5EO1B 3BZ4B 4JPVH 3TBSA 1QEWB 3WMSA 4HJ0D 3E3QE 4OJFH 4JREC 3AAZA 4OFPA 5EU4A 4XB8A 3U46A 2X70A 4JO4L 2BOCB 3PNWB 5CCKH 2WLZA 3I50H 3VGDA 3RGVD 2Z93B 3SKJL 1BX2A 4Z5RA 3CC5B 4GJTB 5BS0B 1J0HA 4H88H 3D2UA 4O4YL 5C0AB 3RIFF 5HPMB 3TFKD 4HAFA 4UDTB 4CN4A 3G5YA 3QI9D 2YD4A 3QCUL 4QXTB 4WO4A 5D7LB 3MOAH 2VAAB 5HTSA 1YNLL 2YD8A 4WW2B 3WXWL 5BS0A 2P49B 3KYKL 4TTGA 2HAZA 1FZJB 3LS5L 1VGEL 5F7MC 2HLFC 3K2UH 5DFWH 1KPRB 3GMRB 4NZJA 1G6RB 3NFPA 2XXCB 4PJHE 1HWHB 1T0MA 2MCPL 2AKRB 3KLHD 1TVHA 4U0RC 4Z7UF 4LMQE 5CWSB 1YYLL 3F7RA 2LAAA 1AHWC 2UY7A 3FONA 3VI4F 3SDYH 2XYCA 2DJ4A 1QD0A 3CCHA 1I1AB 5IKCA 2A9ML 3MV11 1RAMA 2YD1A 5JW4Q 3KHQA 1MCOL 4JQIH 1GHFL 1AKJB 4EQ2A 5B3JE 3RWFB 1P5UA 1MRCL 5FGBC 1WTLA 3ARSA 1T5WA 4K3JL 1M7DA 1XIWC 4WY7L 1QFPA 2D0HA 5CIPH 5MHSD 2H45A 3DJ9A 2DWEA 4D0CA 5DO2D 3VXQA 5M94B 4JZNB 3EFDL 4GXUN 5ADPL 4HWNA 1WCQA 2NY5H 2A1WL 1A2YB 2X1WL 2MCG1 3HUJE 3Q6GL 1DBJH 5F1IA 5JW3L 4FFZH 1KTKE 5I1HH 3OZ9H 3QXWA 4UV4L 5EULV 4NC1E 4MDIA 3VW3H 1MWAB 1OD9A 4L4TB 4M6NH 4YFLI 1YEEL 4L3AA 4A2LA 2ARJB 3AS1A 1SEQL 3TBVB 1WGOA 3GO1H 4XCYB 2A77L 3HNVL 3GHEH 3IFNL 5H2BB 4GUPA 1PY9A 1OPGL 4R4BB 5D1ZA 3UTQB 1GC1H 4M7KH 4EI6B 3BKYL 1WZ1L 4HS3B 5J1SC 1G7JA 4HFWB 4MHHI 3X12B 2DF3A 3RUGB 4HK0B 4MCYB 5DTFB 2CK2A 5I0ZA 3DETD 5FO9A 4OF8A 3QUZD 1D5BA 3CH8A 5C08E 5KVFL 1QLFA 1U93A 3OHXA 4NKOB 4LFHG 5GPRA 5LCVL 4NKMB 3QWOB 1NAML 3O6FB 2MKWA 4JGUA 3FQTA 3QO0B 4Y5VB 4PLOB 2VLRE 1D3CA 2B1HH 4PG9A 1IEHA 5I1IL 2WAHA 4Z0BH 2AJUL 1ZLWH 3DV6A 5ESVB 4L4TE 4N0YH 4KWUA 4RISH 1V7MH 2G2RA 4JKLA 4WIQA 4YDIL 2AI0L 4ONOA 1HYSD 1V3KA 3IXTA 4P46D 1DBJL 5JW3H 4UTAH 3TIEB 4A6YH 3V6BR 3SDAA 4EN3D 4GKSA 5ICYA 5L6YH 3G5YB 3MLRL 1U3HA 5JHLH 4DVRH 4NO5B 1IQWH 4R4ND 2YPLE 4PJAE 5L8KB 2HT2D 2Z31C 4P2OD 5DVKA 1P9MC 5F7HA 4JJHA 3MMEA 1I3UA 3OG6B 2BVEA 3C5JA 1TZIB 2ESVD 1U8PB 3GNMH 5DLMH 3V7AE 2CPCA 5I74C 3BI9X 4YC2C 3RA7H 4D3CH 4HBQA 4XAWL 5HHXL 5FYJU 5KVGL 3C5ZD 3P77A 1FFOA 1FSKB 3TVMD 2XQBH 4GKNA 1I8KB 5D1XD 4F7EA 4LLYB 1C5DB 3QNZA 5H8DA 1F6AB 3OL2A 3FTGB 4PJ8A 3RWJA 3F7PC 1J5OL 4ZDHB 1HQRB 4NDMB 5D1XA 5DURB 3OV6A 2IBBA 4U3HA 4OZIB 3MRLA 4WWKC 2HN7B 3QXAB 1MFCH 3V8CA 1ZHNA 4HXBL 2YC1A 4W81A 5IB4B 3O4OC 3IDJA 1QSFA 4OZFB 3U4BL 1FAIH 4ONGL 3T1WA 1G9ML 2LTQC 4FQJL 3WIHA 3GBNH 3SBWA 1L0QA 2F54E 5LBSH 3HLAA 5LCVH 1VFMA 4ZUWB 2X9WA 1DZBA 5F3HB 4GAYB 4JDVB 5K93A 3EIFA 3FZUD 5TGBB 3P4NB 5EIVA 4OGYH 3VFWA 1I7RB 1S7VB 4HPYL 4Z7WE 4G80A 3WN5A 4XC3L 2V2WA 5IW6B 3O0RL 4K3HA 4PJEB 2Q1EA 4FTVA 3O3EA 4LLMA 5D5MB 3V5HB 3UAJC 3QCTH 3DI3B 1QFWM 1WIOA 3GIVB 5J1AA 4ZS7L 4Z7OF 2IALA 3KS0H 4LU5H 3TYFB 2DKSA 1J1XL 4TOYH 5B3NA 3GSWA 5LWYH 3CX5K 3KPRE 5CP7B 1XGRA 4LIQE 1QSZA 4YZFF 5HI3D 5GS0L 3DRTA 3OKNB 1ZAGA 5HHXH 2AQ2A 4I4WA 4U31A 1Y0LA 1GH7A 3QHFH 4OAWA 3NZHH 1ZS8B 5GGQL 1CS6A 3CK0L 1GGTA 3T2QA 4NHUB 5KZCB 2XICA 5DVMA 5BRZB 1Q9KA 1JL8A 2JE8A 1B4JL 3FO1A 4LCUB 4P23D 4KI1A 2XWJA 4JRYD 1JZ4A 1D6VH 5T5NF 1W0YT 3MV9B 2ICWJ 3U7YH 5F6HI 1L7TH 3QNYB 3U30B 2DQCH 1EUTA 3QG6B 1K8DA 1MCWM 1JNLH 4FXLA 4WUUB 4OF0A 3TT3L 1LP9F 2FO1A 4IRJB 5D1XC 4XNYH 2NR6C 1ZV5A 1H8NA 5C0IA 1MVUA 4P46B 4KV5E 1DN0A 4OCYH 4CNIA 2DQEL 1NUNB 3S5LG 3IJSA 1XF2B 5EWIL 4EN3B 3MACL 4ENEC 1NFDE 3FFCB 4OM1L 1S9VB 4PJCA 1T1XB 3MR9B 3F58H 4QRPE 3EYFB 2B1HL 3BP7B 3NACL 4Y2DD 3BHBB 1F3DH 1J0YA 4ODUB 2VN4A 4D9RE 4GMTL 5FKAA 1CGTA 2XQYK 2JK5B 5GJTH 4DQOL 5KVEL 3REVA 1NAKH 2VITB 4Q58C 4Q9BA 3MNWA 4L8SB 1QRNE 3DIFA 5EU6A 4Y1AD 4BSVA 1UG9A 1K6QL 1B88A 4QRUA 4NQVA 1U8OA 2X1XR 4NHCL 3DRTB 1G9NC 5DHVB 3UJIL 1KIUA 3OX8B 1ACYL 3LKSA 5HYEA 3C6LB 4WFEE 1H3TA 1JWUA 5E1HB 1OPGH 2OL3B 2XZAH 1DCLA 5C7XH 1O7VA 3CSYA 2VLRA 1FJ1A 5C0JB 3HAEG 3FRUA 4Q7DA 3QR2A 4L1DA 3DOSA 4LSRH 3U9UB 4KQ4H 1BQUA 1JWMA 3VFGL 5E8OA 3S35X 5C6TH 5T3ZH 5JIPA 2YXMA 4ZXBB 5FV2A 3QEHB 3INUL 3KYNA 4U6VL 5FUZH 2IAMD 1HQRA 3IFOA 4U1KB 4X4YB 1AO7E 1GGCH 2OP4L 3G6JF 3SY0B 3STBA 1WCBB 1F6AA 3NFSL 1AXTL 1CLZL 2OMNA 2YWZA 4PJCB 4OIIH 1AHWB 1G7PA 5FYJE 4GRLA 2X1PA 1CDGA 1I9IL 4HC1A 3P0YH 4XP4H 4KRMB 3P4OA 4KKBD 2QQLL 4QLRA 2CR6A 3PDOB 2W0FB 4UAOC 3RJQB 1INQB 1LD9B 3FN9A 4OFDA 5C07A 4N5UA 4Y2DC 1OB1B 4K94H 2LTQB 2NNAA 2ZPKL 3MCLH 4NSKB 4JQXA 4DZ8B 1DUYA 4WHTA 3JSSA 3D3VD 3Q5YA 3WLBB 3I3EA 3VFVA 4J23A 5E8NB 3VXUE 4R96B 3R8QA 5JXEC 5CZVL 1BREA 3GI8H 4JG1H 4RDQF 1OP9A 1HXMB 4U7MA 2XFXB 4RSVA 2OTWA 4F7TA 2B5IB 1IGIH 2Z4QB 4XMPH 2HRPH 3NZHL 2CJUH 1FAKT 4GRLD 3MUZ1 3O2WH 4I13B 1WBYB 4IS6B 3G6JE 1FIGH 4KAQH 1DLHA 2JJSC 4QRPA 2FX8L 1QR4A 2VDQL 3OJDA 5DQ9A 4D0DA 1G7MA 3NIFF 1KOAA 2ZCLH 1IAOB 1JPSL 3JV4B 2CK0L 1N5AB 4JANB 5IB5A 1U8PA 3QIUB 8FABB 3B6SA 2DYPA 3ALXA 4P2YA 3HZKA 1ZE3C 1ITCA 4PP1C 5TFSL 3BUYB 5ETUA 2OXHA 2Y06H 3HTLX 4X83A 4F2MB 3O3EB 1A1OB 5D5MA 3UO1L 3BPLC 3HC0B 2P5WE 3CFIC 1LO5A 3MBEB 4X7EC 3WJLC 3T3ME 1U8HB 3T4AA 2OTUB 3TIEA 4WUKH 4WI3A 5CEZL 5DVLA 3L6FB 2FB4H 1SMAA 1F45A 4JY6A 1QVOA 1MI5D 1CDIA 4MMZC 2IPTL 5EBWA 5BCAA 3IB4A 5EN2A 1AJ7H 1C8PA 2FH8A 5EUKA 2JF1A 5KSUA 1WSST 1H3GA 2O5YH 3EOTL 4KUZH 1B2WL 1BOGB 2EYTB 3ARBC 3QWOA 1IM3B 3V2AR 2D7TL 1RJLB 3MUGB 4NJAH 4POZC 3NIFE 1HXYB 3OKDB 1F6FB 1FGVH 2AJYH 1EUUA 4PJBE 1MI5E 3LQZA 5C0GB 1WC7A 3ZDZF 2GHWB 1RUPH 5F9WB 5SWSD 4L3EB 3MLWH 4I48A 3OAZK 3ZYIA 4XHJC 5IV2B 1TQBC 3BPOB 1UXSA 1HCFX 4Z95L 4HS3A 1OQXA 4HDIB 3MV8A 3SGKA 3FB7A 1EXUB 4G43B 4GMSH 4BK5A 4XMPL 1HINL 3V0VB 1KFAH 2DQHL 5HI4D 1YUHA 2F15A 3WIHL 1JPTL 4ZAKC 4ZXBA 1H15A 4C55A 1JHLL 3WKML 2P45B 4JHWL 1LGVA 3QEQA 4LEOA 4KI5C 3TA3C 1IGCL 1VB9A 3NVQA 4NC0B 1EVTC 4GRWF 4HFUH 2JIXB 4IM8A 5J57B 4IRZH 1T1ZB 4WWID 2YPLA 4PJAA 5DC4B 1MRDH 1IAKB 2CRYA 3C6LA 4WW2A 4M5YL 1RJZB 3HG1E 4KPHL 5B8CA 1FNGA 3I3BA 2F5AH 4Z9KB 1IQDA 5JO5A 3ULVD 5CSGA 1XIWB 4YC2B 3IDYC 4RBPK 4LLDB 1A9BB 1MOEA 5ICZA 1QUNA 3LCYA 3DGCR 4JZOB 1MSPA 3EO1A 3W9EA 3TO4A 1T7YA 2J6EA 3DMMB 1PX3A 1A22B 3A6CL 1U36A 3KJ4B 1JN6A 3S37H 4OCYL 3KPSB 5HDBE 4PLJD 1NBVL 4X6BB 4POUB 4N0YL 4RISL 2WK2A 3FONB 1CTNA 2DLHA 4N8CL 1NCAH 3WYRA 4OD2B 5GXBB 3ARBD 1RZIA 3GSNL 4MX7B 4R7NA 5IEHB 4DWHA 1MCLA 2E6PA 5BVJA 1U6AL 5E2WL 4ZD3L 2ZCHH 4B7LA 3BZ4A 3LKOA 1MHHA 1KFAL 1PEWA 2DQHH 2WQ8A 1EEUA 3VDCA 5CD5C 3VFUB 5DGRA 1N0XL 3O4LD 2FGWL 4POYA 7CGTA 3QJHA 4OLYH 1JPGB 4ZOEA 3OKOA 1XCTB 5F1KC 5K33A 4MNQA 3QDMD 1CGUA 1P7QA 4JREB 1W8NA 2ZG3A 5KSVB 3MV7B 2JJWA 3QCVH 1CD9B 4Y2DB 5HGDA 4G9DA 4R4BA 4NNXA 5KSAC 5IHZB 5K9KA 1Q9KB 1D5MA 4DGIH 3MXVH 5HPOA 4NM4H 4PRPB 3VDBA 1P2CB 4AY0A 1ZLUH 4JR9H 4TSAL 1MJUL 1IEBB 1UM4L 3NACH 4X6FB 5IM7A 1A1NB 1P6AB 2HT2C 2Z31D 4NP4H 4P23B 1GGYA 4G6JH 6FABL 3MRMB 3ILPA 3LH2H 3QA3A 4NO0A 3TYFA 1R3KB 3O3DA 5BW7C 1ACZA 1LNUA 2D4DA 2JB6B 4JFEE 1M7DB 4K3GA 3LKQB 4LF3A 3P9MB 3L3JB 4JE4B 3VXSA 4N5EC 4ZYKA 5C3TA 4C59B 3UX9B 5I76A 4C56A 2WBJC 3I2CL 2OTPA 4DGVL 3K1KC 2C1PA 4PJXB 3LY6A 3CCHB 5IKCB 2DI8A 1IGJA 5IFAH 3MROB 2H2SD 4NN5B 3FOMA 4PRPE 4CL7A 3WL9A 4FQHB 1PW3A 3E6HB 1T0PB 1G6RA 5SWSB 5CFHA 3DECA 3K2UL 1HI6B 4YHKH 3KR3H 1FZJA 2Q7YA 4XP9L 5L0QC 2VDRL 4LHUB 5J9PA 1F02I 1A14L 1WAAA 2KPNA 3ROLA 5IMLB 5HVHB 2Z8RA 4QXTA 3GSXB 4WENB 1RJYA 5JOPD 2DQGL 5TDOA 3WBDA 3DURB 5EIIA 2E7LC 3KS0J 4L4TD 1RZKL 3ECBA 2EZ0D 2K1MA 3REWB 1YMHA 1N8ZB 2NY0D 2ZOLB 3SKOB 4JFYA 1S7WB 2X4PB 5I8OL 5I30H 4JANA 1K85A 1VEPA 5JQ6L 2MQCA 4D0BA 3ZHLA 4WDIA 5CLWA 3ILPB 4Y5XA 1V5JA 5CBEA 1HZHH 1FZOB 3L3HA 1TPXC 4QHNA 3L7FB 3KYOB 4QGYA 4OF3A 1LK3H 1FFOB 3UP1A 3RZCA 5F7DB 1NC4A 3X3GL 1EHAA 1J05A 1HH6A 2Z4QA 4P2OC 3HZVB 1ND0B 4XPFL 4BH7B 4OZIE 1RZ7L 3SKMB 4PR5A 5TPWH 4MAYC 3MV01 1OCWH 4MQ7A 5TE4H 2ERJC 3IDIB 4HQQH 3BW9B 3JTSA 1XH3B 3C8KA 5KS9B 4ZS6D 3WS6C 3LRSB 3OXRA 3ZKXB 3OKYA 5L2KD 1B0WA 4E41B 5ID0A 1JNHA 3S88L 5C07B 5M7QA 5C86A 1FZMB 4XRCB 1CDHA 1CN4A 1VESA 1S3KH 4LSTH 5DFVC 4NQSA 1LP9A 1J05B 1BFOB 1CR9L 3CU1A 4PRAA 1VFUA 15C8H 1FLRH 4P2OB 4LSVL 4QXUL 3QDMB 2F54D 4RFNB 4OD2A 4JZJB 3IDXL 1R3IH 4JB9H 1U8LA 3RDTB 4PTUA 4PJGF 4XVTH 5IQ9A 1TPXB 2Q20A 2P7TB 5LJYH 4OLEA 3PGDA 5HBBA 2W9EL 1MFBH 4M1CC 5C0CE 3SO5A 1EGJL 3U1SL 5KSBB 1NC2B 3MUJA 3NH7H 1Q94B 5CZXC 5DJDA 3ILQC 1YEDA 3IDGA 5DDHA 1X44A 2X4OA 3U0TA 4Y4FD 4S2SA 3FT4A 2XT1B 2LU7A 5JHLL 5E2TL 3BO8A 3QHZL 5D7IB 4LRIA 4OCMC 3LKNA 4NZRH 4PJIB 5ICXB 3BGMB 3EFDH 5IMMA 4Q2ZB 4XCEB 4NPYB 5HHPA 3SGJC 3LKPA 1JPFB 1YDPB 1W72H 4JO3H 1U8OB 1E0OB 2DLIA 5GRJH 1BHGA 1T0NB 1U2HA 2KDGA 4Z0BL 3GMPA 3VFRA 4KTDH 2YR3A 2A9NH 4RGNE 1Y6MR 3UDWC 1YN7B 5I71B 2FHCA 5DEGA 1YUHB 3EO9L 3PWPD 1DTUA 1XAUA 1J0KA 4GMSL 2EO9A 3B9VA 1BFVL 4PGDA 3CLEL 3U79A 5AAMA 2YBRB 2OI9B 4FQXA 3TP4A 2EE2A 1I9IH 5HHMB 4JVUA 3AREB 3RIFK 3O3DB 3TV3L 1N2RB 3HI5L 1BVZA 3IJSB 4X99A 4CU7A 4F57H 4R7DA 4M1GL 3MRRB 3M07A 1X5GA 4FQQA 5C9KA 4PLNC 1ZGLB 5I8CB 4B7IA 2FD6L 3BP4A 4NJAL 3EW3B 4LHUD 4RMQA 4XC1L 2OP4H 3FB8A 4JO2H 5F44A 1J0ZA 1MJJB 1SY6H 1SMOA 5D1QC 4HUUA 1QNZH 4UQ2B 2GIYA 4IMKC 3ZTJH 2VE6B 2UUDK 4OBRA 2FSEA 2X1OA 3V52L 1CWVA 5JIHA 4CADA 1SEBA 5I18L 4NBXB 3T0EA 5EUKB 4KKCD 4N0FB 1XGUB 2R2BB 3HI6L 2CRZA 3VA6A 2PR4H 4RZCA 4JHAH 1XT5A 2RR3A 2EICA 3MLTB 3ZLQC 5IJKC 2NR6D 3T4AB 4YDKL 4ZFOL 5DR5H 1H9VA 1NCWL 4HKXA 2Y6SD 2JIXD 3PL6A 1AFVL 3UTSD 3BH9A 1R5VB 5B8CC 3DUSB 3UMTA 3C5ZC 4Z8FH 2APWA 2JJUA 4TULL 1GHFH 4B53A 4K71C 4GW5B 3ABZA 4Z0XA 3MFFA 4G8EA 3LKOB 4LCWD 1A3QA 2IANB 2MPAH 4YO0B 5I30L 1DEDA 1T4KA 1PG7L 4R7NB 5F9DC 4GW4A 2LAGB 3L3DB 2NMSA 4R26L 5E8DL 3Q3GB 4H8WH 2FEDD 3QQ9C 4PJ5E 3TBSB 1N0LA 2PYEA 4HLJA 5IIEB 2DLFH 2CKBL 4FXKA 2J8HA 4ZFZB 1Z3GH 1G7LA 3VJ6A 4OFYA 5DJ2B 4EJ1C 3BKML 2AI0H 3ARXA 1II4E 2ED7A 1FDLL 2EE9A 4Z7QF 2LFGA 1PZUB 3MV9E 5M95B 2ED8A 1NLBL 1RU9H 5C09A 1ZSDA 1B0RB 1RJZA 5J06A 2W60B 4ZUWA 3SCMB 4ACPA 4C83A 4TQEH 4XPHH 3RAJH 1DE4A 4ELMF 1OTTD 2NNAB 3FOLA 4KU1A 4PV9B 3MLUH 1X5XA 3P11H 2P48B 1OAYL 2YUXA 3WHXA 1OHQA 2P5EA 3QH3A 5IB3A 1NSNH 3NMEA 4RAVB 3MRLB 5IJVA 4LAQL 2X42A 3C6SA 4N8VB 4BUHA 4ZODA 1YYML 4WFHD 2H9GA 1JYNA 4MQXD 3QNZB 3TBYB 1N26A 4GBXA 5HHNA 2NX5B 4JG0L 3D3VE 2E7MA 4BSJA 2Z35A 3P77B 1MREL 3MJ9H 2ZUSA 4LSQL 3MRCA 1JWMB 1UM4H 2ZUQC 2OZ4H 1ZVHA 5F6IC 4LLQA 5KVDL 4M7ZB 2E6JA 1DFBL 2DTML 4XNZB 4CN6A 1X5AA 4R90H 4U49A 3WLWC 4HJGB 4I2XA 3MMEB 4AM0B 4KZEL 1BAFH 2EEDA 2BDNL 4BFIA 3L3KB 3V79C 4JPVL 1IGTA 3EFFB 4M5ZH 1N6QH 3F7YB 3WUWG 3NZ8A 5JQ6H 2OTUA 3IFNH 3MJ7A 4NRZB 2Y4SA 3GO1L 5ACZB 3OAYK 4Z7UA 4N0UE 1NEZA 3LZFL 5E2WH 5CBAA 4PG9B 3LKRA 3O6MH 1YEGL 3J7HA 4LPYA 5ETUB 2NXZB 3BE1H 2EO1A 4O00A 2PXYD 3OPZL 4XTRC 2R1YB 3SO3B 3E8UL 1TQCC 3JV4A 5HYIA 1P9MA 3ARVA 4BH8B 3JWOH 4IOIB 2YZ8A 5DJ8A 1SYVA 1BJMA 2DI9A 3KWWA 1KJ3H 2VDKL 2I60L 5SWZD 3BE1L 3BH9B 3T0AA 4CAGA 2DWDA 5MEQB 5JOFB 4XP6L 1QBMH 4I3SL 5LXGL 1N5YH 5HHOE 1QLRA 1PG7H 2ZSVB 2AVGA 1AGFA 3TPUB 1MJ7H 4KJPC 3W0WD 4ZTOL 1IC5H 3N0PB 2RHEA 5I1EH 3FO1B 4CJ1A 3H0TA 1I3GH 3QEQE 1QFUH 4BA8A 3M45A 5GZND 1UYWL 4M00A 1EO8H 2VWEE 1EX0A 1KJ2H 1AR2A 3HNSH 5DVOA 4FHBD 1IC7L 3PHSA 3PWJA 1J11A 1JGVL 1FBIH 1CXIA 1A6ZA 3T04D 3W0WE 5FYJH 4TVPE 5KVDH 3HG1B 2VDPL 4YZFE 1IGFH 1OAKL 3PV7A 3HZYB 3U9PL 4M9OA 1JV5A 3MGAA 4G7YL 5L2KB 2WZPD 4HEPG 2NY1B 2R0WH 2BJMH 2OM5A 1UCTA 4U2ZA 5GRVK 1W2KT 3CZJA 2IWGA 1FYTB 4XBGB 4DUVA 4HBCL 5KSAD 1AP2A 3GMOA 5AUMA 4U1IA 3O0RH 5FCSH 2I9LB 5HHPB 4C4KO 1I1AD 3SE9H 2YS4A 1X5FA 4JRYA 5I16B 3V5KB 5T3XE 1AKJD 2F53E 4ZQKA 1JZ6A 3NCJH 4PBXA 4A6YA 1NCUA 2IPTH 1J9CT 4HSQA 4LIQL 5JHDB 2KQNA 1GSMA 1C08A 3HE7A 4H25A 4NNPH 1CFVL 3VRIB 2X7LA 4YHLL 4G8GB 2PW2A 2XI9A 3MV8E 4R90L 4FQJH 2OS7A 1J18A 4HC1H 1UJ3A 2AXFA 3G04B 2NY0C 5HJ3A 2BNRB 3QUXD 1OW0A 3OB0H 5D7LD 5DS8A 2CLVA 3EO0B 3WFCL 2BNQD 5FXCH 2AK4B 4ELMA 5ISZE 1WAAE 1OVZA 4N1CA 1BJ1H 1JF1A 2VO5A 3NN8B 4OZGE 3HE7C 3NABH 4P4KD 1P1ZB 2VITA 1SBBA 5HI5D 3NIGF 4K23H 3S5LA 3ZDXE 5CJXA 1NFDB 3GKWH 3BHBA 3MXVL 1WEJH 1UB6A 4LLYA 4OD3H 1TVBA 3I02A 5CEXA 4ODHH 2EDEA 1HNGA 3VRJA 5C0IB 1EEYA 4DN4H 3CX5J 4F9PC 5F6HJ 4D8PA 1V7NL 1A7PH 2H32A 2ICWI 5FHAL 1T6VN 3TNNA 3IFPB 3PHOB 1QSVA 5IHUH 5FUCC 2AEPL 2IH3B 3UTZA 2V5MA 2H6PA 3NGBC 3C5JB 4PJ9B 2YD7A 2E27H 4BJLA 5BRZE 1R3JA 4JLRA 3RZCC 1PQZA 2NY4D 1QBML 4I3SH 5E99H 5LXGH 9CGTA 4OZ4B 3I02B 5D7JC 4JPIB 3PQYD 3PUCA 4YXLH 1FNLA 4JN1L 2BOBA 3PP3H 4KXZH 3MC0A 1TJGH 1ZS8A 3VD5A 3BPCA 1KB5A 3LH2L 1NC4B 1ZVSB 3NTCH 5F9AC 2PETA 2A0LD 2R0KL 1P1ZA 5D5MF 2EE6A 1WZKA 43CAB 1T5XB 4JFYB 1UWEL 3QIBB 4AEHH 4HAGA 2WWKT 4NO2B 4H88L 5IQ7H 4HGWA 5LGHH 1YPZE 3RUGE 3SDXA 2B0SL 1A6VL 2FEEL 4PRPD 4YHIA 3G04A 2IALB 4M5YH 4ZOAA 3C9NA 4J3UA 4NOFA 4NKOA 2NY2C 2DL2A 1A9EB 4IDJL 1D5ZB 5KSBF 2KKQA 3C09C 4ONHB 4I9WD 1UWXH 4L4VE 1F3JA 3MLSL 3MRFA 4AEFA 1N59B 5MI0C 2ZUVA 4YNYA 4LSPH 3MYJA 4LASH 3EKCA 3R1GH 3FQWB 1INEH 4Z7VF 1WUNT 4LRNH 3T3MF 3H3KA 5FOBB 5BS0D 3VH8B 1JNNL 1I8MA 1MQKL 2Q8BL 3VI3F 1X6LA 2RBLA 5T3XH 2HLAB 2HVKB 4XCYA 1A6PA 2CMRH 5E8EB 1J8KA 4M6OL 1QBLH 3WL9B 2Z8VC 2NY1C 4WHYH 1IAIL 4JKKA 1FYTD 1K6QH 2LVCA 1ZLVH 5F7KC 1T21B 2BVQB 4I0PA 5BXFB 4G6MH 3GSOB 3DHMA 2GSIB 3QG7L 2VXSH 2J7LA 4Q6IB 2FECI 4HG4J 2EDQA 3HG1A 1WICA 5LAXA 3ULVC 5D7JD 3CDGA 5CJBA 1F4WH 2J88L 1I1YA 3TPKA 4M61A 1TTFA 4O2CB 4PJXE 1LP9E 2XTJD 3QIWD 5EOCJ 4HT1H 1E6JL 1QFOA 1H3WM 2GITA 2F5BL 3VWKC 5AWNL 4JFZH 1U8IA 4DAGH 4XCFH 4U1LB 4L29B 4P3CH 3MREB 3C2SA 4KTEH 4OLXL 5CMAB 5TDNB 3VWKD 3TJHD 4G8GD 2MKLC 5FM5O 4HS8L 3VI3E 1JCKA 1PY4A 2FLRT 3G5ZB 4NFDA 3H9HA 2FWOB 4WI8A 4GRLC 3O2DL 4JKPL 3PJSA 4Y19B 2B7DT 3PXHA 2BNQB 4FQ2H 5D2LE 1NLBH 1D6VL 2V5RA 4XI5D 1S9WB 2VL5B 2CRIA 2X4NB 5DURD 4FQPA 1YMMD 1DVFD 4ELKB 2E7BA 1N3NA 5CKAA 5I6XC 5J6HB 3VXRE 4OZHE 4WWKD 4YHKL 2IADA 2HWZH 4G8FA 3QCUH 4TSCH 4O02H 4WO4B 4MD4A 2R1YA 5D7IE 2ZCLL 5D2NA 5HPMA 1EAJA 2P5WA 2HJFA 5KSAA 2EEAA 1R0AH 4KK8C 4NYLA 3IRZA 3MFGB 1JMXA 1JF1B 3VRLF 5EC2A 2AABL 1AQDA 4Y16B 5DYOA 4OM0H 4KKLC 3W39A 3QFJD 1A9BA 1CI5A 2HRLA 4M48L 3C2AL 1VPOL 2YA1A 4Z7VE 5BO1H 3I9GL 1KULA 3DMMA 5FYLH 3H8NA 1XR8A 2WUBL 3K80A 2JCCB 5JHDA 1HHJB 3UJIH 1KXTB 2XA8H 3X12A 1R3LA 2UWEE 2OSLA 4ODSL 1X7QB 5DWUL 4ZQKB 4RGMB 1EBPA 3D25A 4JFOB 5TDPA 1MCCA 3PJSB 4Y19A 1E4KA 1H5BA 4PY7B 1H3XA 1N7MH 2ADJB 2XRAL 3BT2H 5DF0A 2JJTA 4RGNC 4RBPH 4XBPA 3TBYA 1EHLL 5GZOC 1GGCL 1P4IH 1UQSA 3AY4A 5EU7E 3FB7B 3MV8B 3QQ3A 5FUZL 5FDWB 5F8QC 2QQKL 5KANG 5JZ7D 4FQLH 4QRTB 2XG4A 1JRHI 3HPLB 3HE6C 4R0LA 4RX4A 5LAXB 2XKNA 4JDTH 2AXGA 4OZGB 4U3XA 1NCCH 4DN3H 3MRKA 2GSIA 3OAYH 3M8OH 2ZOKB 3OWEA 3LRHA 4J3XA 2DMCA 1MNUH 3C2AH 3SE3C 3OGCB 2E5EA 1CFTB 3LQZB 5C0GA 4YLQT 4J8RB 3P9LB 2WIMA 4M6ML 1XF3A 3FFCE 4AL8H 2ZUUA 1M6OB 4WEBL 1IGYB 2F74A 5GSVB 4K7PL 5GS1A 4X80H 1YECL 4JFFA 2X44D 5IB1A 5IW1A 1YNKH 3GJEB 3OKKB 4LP4A 1OWWA 1OSZA 5ESAA 5H37H 4RFEB 1BOYA 1NGYB 1E6OH 2OR7A 2HFGL 3MBEA 5D7JB 2ITDB 4LSSL 3Q48A 3NBNA 4G3YL 1IL1B 4GKZB 1ZVYA 3D0VA 4PGEA 5C0FB 5BQ7A 4G7VL 5CJOH 3MLRH 1UADC 4H5SA 3L6FA 4PRBA 4QTHB 2AAVA 4WJ5A 1A6TA 2L7JA 5DMGD 4I77H 3RVVC 5HD8C 5BOZG 1KT2B 4YHIB 4PJ5D 4NRYB 1A7OH 1HN1A 5EA0L 1G6RL 4MVBC 4F7PA 1KJ2B 1NL0L 1RIHL 1NLDL 4O9HH 4YHPB 5T1KA 4ZFGL 5EOTA 2NY4B 3VG0H 1AGBB 1DUZB 1QA9B 1C12B 3MJ8B 5FIEA 3MJ7B 2P8PB 5C7XL 4RAHA 2VOTA 4TUOA 4N5ED 3BPCB 4XPGH 1A6WL 3TGXA 3DX9A 4MQTB 4N9GA 5IW3A 1X6NA 3IETA 4NQCA 1XGUA 5H94A 2QQKH 4JPIA 4MNGA 1KEML 5ANMB 1CD8A 2HFEB 2WBWB 3ILQD 5L88H 3LEXA 3AY4C 1NUGA 4NCDA 5DRNA 2NY7L 4KMTL 5GSVA 5SX5K 2HG5B 3ZSTA 1L7IL 4KROB 4LLQB 2J1KA 3EBAA 3TZVC 4HXBH 4J8RA 3X13A 4C4KT 4DZ8A 5D93B 1AO7D 3E6FB 4ZFOB 4WFHE 4GG6F 3KPQB 1NCBL 5CHNB 1BIHA 3LS4H 4OM1H 5ECJE 4GBXC 5JNYB 3U9PH 1AGDA 1K4DB 1UWXK 3R06B 4R97B 4X8JA 3SY0A 2ZG1A 2H9GB 4KK6C 1I85C 4Y7MA 3VE0B 3TO2B 4OF5A 3TFKC 3ZE2F 1BBJB 3KJ6L 3HNTL 4YDLC 1UEMA 4OV5B 3VGAC 5DMYA 1F2QA 4I18C 1HCVA 2A73B 3PGFH 3QNXA 4LCIH 5D1ZC 3C60A 2EYSB 3F7VA 2XNAA 5EPMB 2VLRB 1VENA 4QRSA 5F89A 4MYWB 5EUOF 1A7PL 4OUUB 1QYGH 2PXYC 4JFOA 1JF6A 3GSNA 5MERB 3WN5C 5JW4R 4P5TD 5JORB 4JFHD 2J8UF 1HHGA 3ZT6A 3S97C 3SBWC 3B5HA 3V6FB 1D9KD 2F9BT 2VZSA 1J12A 4X5XB 5HHVL 5A2LH 1RHHB 1V7ML 4UDUB 3Q2CA 1G7LB 5T1MB 2VZOA 1V3LA 2XNAB 5IVXE 5KS9E 3R4DA 4LRIC 4RMWA 2VDNH 3JWOC 3VXRA 2UYLB 4HIIA 3H9SB 4AIZA 5DD1H 3HMWH 4W6XB 1AQDB 1I7UB 4H26A 1CE6A 4OZFH 3MNWB 3GIZL 4PG2C 1GZPB 5T33H 1F90L 1JNNH 4M6AA 4MA7H 3AGVA 5DJZA 4NP4L 3B9KB 4KXZI 2EH7L 4M8VA 4WUUA 3GBLA 3HFML 4MJ2A 4PIRF 4PY8J 1SYSA 4XCNA 2XA3A 4MZ2A 2JJSA 5BOPA 2YMXH 2VC2L 3ZTNH 4MAYB 4PJXF 4EUPG 2Y25A 1MVUB 1KBGL 4JGMA 2R1WA 5DA4A 3D39A 4S0TD 1IKFH 1KPVB 1S9WA 3N85H 4GLRI 4IMLA 4CADB 3OGOE 1F4XH 3UPRB 1IGMH 4KRLB 5I8KH 4OZIF 4H20L 2VRAA 1ETZA 5ANMA 3WS3A 5D1QA 3VWKB 1BVKB 1NJ9A 1I1FB 4PB0L 4XP5L 5CBEB 4JVPA 4UU9A 1JGDA 2VR9A 3O2VL 5DD3H 2X2YA 4K3JH 3DYPA 1VCAA 1CCZA 3CDGB 3VFPB 3ECBB 3CSBA 3V5HA 4NZDA 4LPTA 1MLCB 1XGTB 4PGDB 1G9EA 3CLEH 4J7RA 4PLKC 1DQQA 5TDOB 3WDIA 4NQDA 4PV8A 3FB6A 3WFBL 5DMJB 3LMJL 4Y4HD 2AERT 5ISZB 5IBLC 2DQUH 3BP5B 4K3DH 3FB5A 1QBAA 5CILL 2NW3B 1N6VA 5MENA 4YXHH 3ZDXF 3RWIA 4LEXL 4I5BB 1K4CB 1PGRB 1MFEL 4YPGA 3LKPB 3KNBA 4LK4A 1A5FL 3LS5H 3S7GA 3UJJH 1FIGL 1U0QA 2ADGA 1S7XB 2ITCA 4FQHA 1FL3B 5GRUH 3ULVE 3BQUC 1YECH 5IW1B 4LU5L 3NABL 5FYKL 4YXKH 5CD5D 1MCEA 1QBLL 1O7SA 2VLMD 1A4KA 2X4SA 3KPQA 4CUCA 2GK0B 1LEGA 1NC2A 3S96A 1VADA 2O93L 2ED9A 3TA3A 4UZGA 3L9RA 3QISA 2DQUL 3VGGA 3MRNA 1F11A 4UTBH 4Y1AE 4YFEA 2ZPKH 1H8OA 1WWCA 4UINH 1HEZB 5I1GL 4P23C 3UTTE 2BSSB 3SGDI 4NO0B 2GJ6D 4NQDD 3BXNB 3S9DB 5FO8B 1AXSA 5IB4A 3TN0D 2AJSH 3UC0H 4DCQB 3AXLA 3CAFA 2KBGA 3HPLA 3L1OL 4P59L 1ORSA 1T1YA 4MNHA 5H94B 1MRFH 3VE0A 3ULSB 3IKCA 3IETB 3DTXA 1FNSH 3SDCB 3P3YA 4NT6A 1H3UA 1Q0YL 2O26U 2B0SH 1T66D 4G6AD 4A6YL 4OD1L 4NM8L 4P9HL 5JXEA 2P5EB 1IC1A 1JHKL 5DD5H 5JQHC 2FX9H 4MXVF 4KDTA 3ROOA 4EXPX 1M05B 4HS6B 1X4ZA 3SJVD 3PG2A 1SEQH 1YNLH 2X4RB 3IFLL 3MV7A 3BIKA 1KJ2A 3CFJA 5T1DH 5IK3B 3UAJD 2A6JB 2EC9U 2PUQT 1CFQA 2HT4C 1GGIH 3Q6GH 3PHOA 1F97A 4ETQB 1IGFL 5JMRA 4LBEA 2JKXA 1XMWA 1FNSL 3IAPA 1G9NH 2P8MB 4MD0B 4I1NB 3I85A 3RBSA 1ZANL 1QFWH 1CXKA 1JE6A 2C3WA 4TUJA 4NQCB 3T08A 4OI8A 5KOMC 4RMTA 2ZKHL 1HQ4B 4IIQB 3TM6A 1L6XA 3OKKA 5AYQA 4F37K 3IXTB 5GGQH 5E5MA 3UYRL 1NAMA 2J3SA 4WO4C 4JFDD 1ZT7A 4G8EB 2Q3AA 1JK8A 4QCIB 1NFIA 1QSEE 1KC5L 3DV4B 3QUXA 2D0GA 2NY6C 4OCWH 1IQDB 5JO5B 1E27A 2XTLA 4ZS7H 3VFMB 3JWOL 1QRNB 1I1CA 1P4LA 4WW1B 2QR0B 2RAMA 2B2XH 5FO9B 3BIAX 3KPOA 1JGEA 2WBJD 4ZAKB 4P57A 4I0PC 2BRQA 1OSZB 4JKPH 3BEVB 5MEPB 3CXDL 3G5ZA 4PGBA 4UQ2A 1EH9A 2MPAL 2GTZA 5DRZB 2EDWA 3DX6B 3IJYB 1NUFA 3QEUA 5TDPB 1LO0L 3RU8H 1N2RA 5F1NB 2C3GA 2J88H 2JB6A 1R5WA 2KZ1B 4KFZC 1I1YB 2EDBA 1IEAA 3FT3B 2GT9A 1JV5B 4WI6A 2D3VA 4ODVL 3ZDZE 3WXWH 4YFDB 2VDML 3BMVA 3PWUB 4P9HC 2P46B 4AG4L 1UH2A 4CVXB 1R5WB 1QKZH 2EYRA 1RUQH 2VLJA 4M8QA 1ZLSH 1Q1JH 2K3TA 3RWFA 1IEBA 1KCSH 3IJYA 4YDJB 3KLAB 4OGAC 3V52H 2FJFA 3KYMA 1J5OH 1S7SA 1Z0NA 3W81A 4AG4H 1BZ7B 5C0BB 2HLAA 3H0TB 2UZIH 2YPKA 3S8WA 3ISWA 3OR7A 4M43L 4UNUA 5C92A 2FX9L 4Y5XC 4ZPVB 5CEZD 2C4FT 1AR1C 1GIGL 4GH7B 1JGEB 1MQ8A 4LQFL 3CDYA 4MD4B 2OYPA 3C8HA 3DBXB 4ZFFA 4KZDL 1FRGL 2JJVA 1HWGB 1E4WH 2H3NA 3RWHB 3FZUC 4F15B 4UTBL 1XR8B 1DFBH 3VFUA 2VAAA 1X5ZA 4IOSD 5F7FA 2YUZA 1K3IA 4P3WA 1X4XA 2H2PC 2P43B 3U7AA 2YD6A 3TWCL 1BECA 2ICEA 3VRLE 3A6BH 4Y16A 5HDBF 3QIBA 1CU4L 3V4PH 2A1WH 2VABA 4QCIA 1S9XB 4IS6A 1W8OA 1G0YR 3RKDC 5J6GB 3HR6A 2VLLB 3B9KC 2R2EA 1PEZA 1YN6A 2FBJL 3MREA 4HZLA 1V3JA 3KLAA 1JHKH 3VXNB 3VXMB 3MODH 1K5NA 4IIQA 1HQ4A 3ULUF 2BOBB 1MIML 1MFEH 3DWTA 3WKNA 1CFNA 4Q6IC 1W72A 1MCSA 3K4AA 5KS9A 1RK0B 1QFHA 3OKEA 1JIBA 3BVNA 1FFQA 3AS2A 3GSQB 3GRWL 3VFNA 4EIGB 2UY6A 1BFVH 2GK2A 1HEZA 2NLJB 3HHRB 2A6JA 4HFUL 4EI5C 4A2MA 2I5YL 4LVHC 3CIQA 1HH6B 2AW2A 3HS0B 3QEQB 3MRPB 5F3BA 2A9NL 2ATPA 5CJ8A 4GFTB 3FQXA 4P5KB 4YBLB 4TNWF 4JCMA 3T2NH 2CR3A 4IOFC 15C8L 3O4LE 5JDJA 4Z7UE 2UZIL 1CR9H 1M7IB 5JXAH 4KRNA 3MOQA 4NT6B 2EH8H 2APFA 2JLLA 4N0RA 3HAEH 2BNRE 4D0BB 4E41D 4LVOB 3GEWB 3G5VA 3EOAA 1T1YB 1DBAL 4YPGB 3RVUD 1YQ2A 4OLVH 1KC5H 2YXFA 3MRFB 1YMHB 4XMLL 1C1EH 4OKVA 1F00I 2UZXB 5FA3A 1MFBL 5HDOA 5J11B 3C6LC 2HA1A 5DD5L 1NAMH 3MXWL 3C5SA 4XT1C 3ZHDA 1QP1A 3UTSB 4Q0XH 2BNUB 4QTIL 2F54B 2ZKHH 1U8NA 1MRFL 1ZSDB 1L4IA 2IANE 4FXGB 5IBTL 4EDWH 5J56B 2QHRL 3RIAK 3GRWH 4PJIE 1RMFL 5TH2A 1GVIA 1U91B 3GKZA 3HUJA 2D0FA 4IRSD 4UNVA 1G7IA 2FX7L 3DUUB 4M7LT 4OSUH 5I1KH 1I1FA 1YEJH 1UWGH 3FQRB 1G1YA 3GIZH 3QIBC 1KJVB 3EYVA 4JQXC 2DLEA 1G6RH 4DKFL 2YN3A 4LCWE 5F3BB 4KRPB 2Z9TA 4MVBD 3IU4H 1CLOH 3V5DA 4XNQA 3UZEA 3KPNA 5ESQA 4Z0XB 3WHE1 4RWYL 1UM6L 1IM9A 5GZNC 3MOBH 3U0PA 5HHME 5HI3C 2WANA 5GS0C 4KI5E 5E95B 3DUSA 3MRMA 5FYJL 4G6FD 2VDRH 3VXPA 1LO3L 3HI5H 3GSVA 1QBBA 3WDHA 3RWCA 1A6ZB 1T20B 4X6FA 5IM7B 4FP8L 3BEWB 5KVGH 4M4PA 2XZQH 4DJMA 3MLTA 3MV9A 1YNTA 4UT9L 3T1FB 3UPAA 1WFNA 5DUPL 1OD7A 4TULH 3MRBB 3MLZL 3TZVA 2XFXA 1KB5H 4KKNA 3G6DH 2W91A 5EBGA 4FABH 2FO4B 3AMLA 3BISA 3RVUC 4RFOH 1D5MB 5EIQA 1IC5L 2VXQL 5D1QB 2VABB 4JRXA 4ZO6A 1X5HA 2VMFA 4Y4KC 1S7RB 1QFWL 4LARL 1R3JB 2BVPB 1FPTL 2FJGB 3CFKB 4OZFG 1MWAH 1MIMH 2XZCL 3U2SA 2J5LB 4I3RL 3L5WB 2JELL 2I60H 4GG8B 3D39B 3GDBA 4TRPL 5FKPB 1C08B 1ZGLA 4NQCE 3HMXL 3MRQB 3BN9D 5DD0H 1ZLSL 4IOIA 4HKZB 5B22A 1HK6A 4R8WH 3MO1A 1MHHB 2VZ3A 4R3SA 4BZ2H 3X3FL 1U95A 3VGBA 3MGOB 3HRZB 4PJ7B 3QUYB 3WFBH 4PJEA 1S7XA 1T7WA 2ITCB 2CDFB 4DTGH 1S5IL 3ULUH 1S8DA 1WFTA 4N90D 2YA2A 1SQ2N 1BZ7A 2QTEA 4JFPB 4MDJA 3HC3H 1H0DA 3RU8L 3EO1B 3W9EB 2XTJC 3QIWC 5BVPH 2UVFA 4M03A 3D0LB 5EU6E 5SWQA 3VXUA 2AJXL 3LPWA 1OAXL 3U9UA 3VFGH 12E8L 2HKFL 4GT7A 4N0UB 1TQBB 3BPOC 4NO3B 3S34H 1XIWA 3SQOL 4WVRA 1A02N 5DQDL 2FB4L 1DQQB 2I9TB 4LOUC 1ZLUK 3F5WA 4PJ7F 2PO6D 2YEZA 1UENA 3K81A 1NDMB 1T1ZA 3GBMH 3SDDA 3HLAB 4A6YB 1T3FB 3VCLB 4N0CD 5DQDH 1A7OL 5D4QA 1CDYA 4GSDH 1BWWA 4XWGH 4JRYB 1NLDH 4O9HL 2X4UB 4YQXL 4HG4K 4NKDB 2V7HA 5BVPL 2HN7A 3SJVA 3DIFB 3RY6C 5GGSA 2A6IA 4QOKD 1F5WA 1T7VA 4QXGL 4LOUD 4FFYL 4KK8D 1HHHA 4IRJD 2YOCA 3RWEA 1G0XA 1M4KA 1KSRA 3B8SA 3EGSA 3A0OA 5E9DB 4L4VA 3TIDA 4OCXH 1UCBH 4QHKI 1A8JH 4U1MB 3QFDB 4EBQH 3DO3A 1DN0B 3EUUA 3TZVB 5IB3B 3RTQB 4YFLF 1LP9B 3KWWB 4NQSB 2P8PA 3LQAC 1HILB