1C5CH

Decarboxylase catalytic antibody 21d8-hapten complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
QVQLLEPGTELVKPGASVKLSCRASGYSFTSYWMHWVKQRPGQGLEWIGLIDPSNGRTNFNDKFKSRATLTVDTSSSTAYMQLSSLTSEDSAVYYCVRIAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHIMERIC DECARBOXYLASE ANTIBODY 21D8
publication title Catalysis of decarboxylation by a preorganized heterogeneous microenvironment: crystal structures of abzyme 21D8.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 41
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1999-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5cH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5cH02
4UQ2B 4ALAL 1JTTA 2K1MA 2R4RH 3S98A 4M6NH 5EU4A 3SKNB 2EDXA 4S2SA 2YD2A 5DJ0A 4KI5F 2XFXB 5I16B 4TRPH 4OCRL 2FD6L 5ANME 2C3WA 4F57H 4GRLB 4F9PC 3C08L 2NXZC 4GXVH 5H37H 5E4EB 3SJVE 5LG1A 4O4YL 3HA0A 4F33B 3SDAD 4MAYB 2D03L 1MWAB 3CMOH 5D8JL 3IYLW 4XPTL 1VPOH 1P69B 1SY6L 3I6GB 3F6LA 5F97E 4HIEA 1A7OH 4NCC2 4JFED 1K3IA 3BYTA 4PRPA 4LAQH 3D85B 3KYNA 4DOHE 1YECH 4E5XA 3O3EA 4DUVA 1LQSR 1P4LA 1G6RB 3MFFB 1ZANL 3BP4B 4NJAH 3GMPA 3V4UL 1DTUA 5SWSA 4KGLA 3QDJA 4JFOB 5D1QB 5J9PA 2XZQL 1H5BA 3L3JB 5JW3H 2A2QT 4MCZB 1IGFH 4ZSOB 5AWNL 4LQ1A 2APFA 3FB7A 3VXQB 2XRAL 1H3WM 3ZE1F 2B2XH 1MCIA 3UYRH 2E3VA 4Q6YA 4MNHB 5F93C 3O6MH 5F3BB 3CDGA 1QTYT 1A3LL 3C60D 2OTWB 4H26B 3GI9H 4LCIL 4LSVL 1NAMH 4LU5L 1P84K 3VH8A 4KK9C 3GJEB 2VXSH 2WINB 4B7LA 3H42L 1L6ZA 1F58L 3RPIA 4JFFB 1XCQB 1M71B 2MTPA 2GJZB 3LN4B 1JWSB 4RISL 1PKOA 3BP6A 1UWXK 4FFZL 2XACC 3TNNA 4MA7L 4NQUA 3BN9D 1HDMB 2H32H 3GSNB 3AUVA 4U33A 3N06B 4CVUA 2JIXD 5GRVL 3P4OA 4X6FA 5D1QD 2YUVA 3LV3B 4QRUB 1MI5A 2EKJA 3C6SB 3RZCD 1MPAH 1IKFL 3D39B 3BEVA 1SBSH 4P3WA 4QRPE 1UJ3B 4K7FB 4XHJC 2FYYA 4ELKA 5CGYD 3RGHA 3ILQD 5DRZB 4PY8I 2CLRB 1KV3A 7CGTA 1OM3H 5HHPB 5FCUL 1TQCC 4GLRH 1WISA 5ID1A 3TN0D 1D5BA 2VTFA 3T0AA 3BDYH 4HAGA 2IFFL 2Q87A 1JV5A 5DJ6A 4HXAL 3QUZC 4CNIB 3D9AH 3QZWG 4LLMB 2YRPA 1C08A 2CDEA 3FT2A 4MSWB 4U7MA 4M9OA 1DL7L 2W65A 3U46B 2DMCA 3MA9H 3QUXA 3KR3H 1CGUA 1I1CA 3H9YA 1GGCH 4GG6B 3QG7H 3NFNA 2HJFA 4JGJA 3S6CA 1HQ4A 1T5XB 5DFVC 3IGAA 3WHE0 1TZIA 3SE8L 3B3IB 3NFSL 3QPQC 3RWCA 1CFVL 1NDGA 4JDVB 4K23H 4N8VB 2D3VA 2V7NA 4J3WA 1HH6B 3MCKB 3BQUB 2FHFA 3MJ9L 5FB8A 1ES0B 4E42A 5EPMB 2R9HC 2DQFB 1FFOB 4NGHH 1F4WL 2DQIL 3QWRD 4GLRI 4UIMA 3SDXB 3WS6C 4CDHA 1KC5L 1D3CA 5BQ7B 2OL3A 1Q0YH 5J13B 4YC2C 1UVQA 4PB0L 5EU5B 4HS8L 3MGTB 4UILL 4NOBA 1A5FH 1WZLA 2CO7B 2OCFD 4JG0L 3OL2A 2MHAB 1ZS8B 1JCKA 1JF1B 4HJ0C 3EDKA 5GRUL 3QQNA 3B2VL 1V3MA 4QOKE 1YA5A 3CVHB 5DR5H 3H42H 1KPVB 3ZYOA 4NZRH 5DUML 2MPAL 4GG6F 2NXYC 4MA7H 4LSDA 1YNKH 1L0YA 2W92A 3FCTB 1ADQL 2GYSA 32C2B 3MACH 4HIXL 2R4SH 1OAUH 5DJZA 1SYSA 1B4JH 4HUXB 3OGCA 3UTTD 3D2UB 5H8DA 2CR3A 2QLVB 3R0MA 3QNZA 5LWYL 1TVHB 4N8CH 2COQA 5E70A 1PBYA 3M1BA 3T0WA 4OF3A 5DRWA 4X6CB 5DMIH 4C56B 1WCBA 1Z9LA 4Y16B 3MJ7B 2ZCLL 5J7CC 3JUZA 1NEZA 4H88L 4MX7A 4HFWA 5AD0B 3MJ8A 1MRDH 4Q7DA 1PX4A 1B2WL 3PQYE 5F7DA 3EOAB 3RWIB 2G2RA 3CUPA 1EJOL 3W9EA 4HXAH 4L9LB 3EAKA 5GSVA 1LDPL 4XT1C 5LJYH 3DPBA 3PGCA 1QSFB 4RFEB 4S1DD 5E2WL 2GJ6A 3DUUB 3CFCL 3O4LE 4JR9H 1UZ6E 1J0HA 2C5DC 3MPCA 4N0FA 4BH8B 4PRHE 1V5JA 4JRXD 1R3KA 3H7BA 4NDMA 3O45A 4FQQA 5K59F 4Z7OF 1NH6A 2XY1A 4JFDB 5DJYA 1B0GA 5ALBH 1X3DA 1BP3B 4LCUA 3PWJA 5I73B 4NJ9H 1FG9C 1T1ZB 4NBZB 1TCRB 4KHXH 5C0IB 3MNWB 3BRFA 1D9KD 2X70A 3PDOA 4X6CF 3FQNB 3UX9B 1R24B 4GBXC 1S7SA 4HKBB 1TTUA 2DL9A 3KXFD 1INDL 3GMLA 2Q7YB 4LFHG 3O4OB 3FZUC 1N0XL 1JK8A 2B0SH 4PB0H 2WQRA 4U6HA 4WV1B 4JG0H 1R5VA 1RK1A 1H8NA 2AEQL 3V7AE 3VWKB 3NGBB 4ETQA 1A6PA 3OMZA 5GRUH 3B2VH 3NPSC 1JPSL 5IOPA 1UA6L 4MA1B 5HHMD 4QXTA 3NCBB 1FZOA 4JRWA 4ZS6C 1UH4A 3B83A 3VXUE 4NM8H 5KJRL 3QEGL 4LLUA 5GGTL 4Y5XB 2VAAB 4JY6B 4PLKD 1HXYA 3S4SG 4E0RB 5E5MB 25C8H 3BJLA 5EBWA 1NC4D 4AEEA 3MBEB 4HMCA 4GAJL 4UNTA 4FXGB 1RZIA 2BX5A 3VWJC 4C58B 4DVRL 3QO0A 2NY4C 1FGNH 5F1OB 3QCUH 3RHWF 4BK4A 2BY3A 5D2LE 2QEJA 1W0VB 1NL0L 5C0GA 4JHBA 2J8UB 5DZOA 2NY1B 5I19L 4MS8D 1MY5A 1TFHA 4S1QH 3HAEB 3IVKA 5EORL 3MLTB 4O2FA 1CU4H 4KJWC 4Z78B 1C12A 1INQA 4OGXL 2R2BB 3EYSL 5DVKA 3BP5B 4LVHB 2VWEE 4NNXA 2DDQL 5GSRA 5C9JB 1CE6A 5I2IA 1XGYH 1H15B 4PJXA 5GGSY 5L2JA 1DQDL 4HS6B 2Z8SA 2H41A 4IM8A 4ZFOL 3OB0K 1BM3L 2D7NA 3QEQA 1T2XA 5EO9B 5BV7C 2R56L 2ARJA 4QTIL 4JO1L 1CWVA 3MGOB 4I0PB 3WS3B 1AGCA 3MRQA 1OQXA 5FYJL 1E6JH 4ZFZA 1HHJA 1WTGT 4BELD 4YHIB 5IMLA 1OF2B 5T3XL 4WUUD 2R0WL 3QNXB 1U2HA 1UCBH 4GG8A 4MWFA 1MLCA 2FWOB 2J8UF 3MRJB 1AE6H 1UB6A 1VENA 2NCMA 4Y8DC 2P8LB 3MRLA 1YEEH 1B9ZA 3MV8E 4XP6H 2EH7H 5I66B 1CXIA 4M7KH 2BXYA 4QT5B 2F8VA 5L9DH 5TJWK 4Z5RB 2GSGA 3P0VH 1KNOA 4GAGL 5GGRB 4ODBD 4MXQC 4OI9A 1DE4B 1S7WA 4K8RH 3GBML 2FHCA 4LEXL 5T1LD 4PJAE 4RMTA 3LCYA 4R7DB 3EFFB 1A7QL 3VI4E 3W39B 2Z93A 3E2HC 2Y6SD 4I0PD 4HC1L 1DVFB 3NIFF 1CQYA 3QEHA 5I71C 3KDMA 1CZ8L 5IMKB 2BP3A 2CPCA 4XPFL 2AQ1A 4UZGA 4NP4H 3PWPA 1ETZA 1YEKL 1BVKB 4DVRH 5MEOB 4X7TB 1HE7A 4PJDB 3VA2C 3LEXA 2IANA 3O6FC 3VD4A 3E3QC 3PL6B 4U1GC 3MCG1 1JRHH 1G9EA 1BFOB 4GUPA 4LSSH 1I1AB 2JK5A 4M1DH 3WLBB 5KS9B 1F8TH 2ZOKA 3A6BL 3WN5C 3EYSH 2VDOH 5D6CB 4NRXB 2HVKB 4PGCB 3HR6A 4LOUD 3LEYL 5HYSG 5F89B 2D0GA 3WUZA 3C2AL 1DVFD 5BZDA 3O6FA 3O3AA 5L6YL 1OARH 4Y5VC 5CJOL 5JUEH 3S7GA 3KPQA 4AH2B 4JPVH 4X7CC 2XZCL 5JXEC 1ZGLP 4RAUA 4NSKA 1XF5B 2EYTA 3AC0A 3KWWA 4PJDF 4G7YL 3CFEB 1N5AB 2APWA 2CO6B 4UT6H 3WKML 2VDRL 1JRHI 2W9EH 3IDGB 4JG1L 4UTBL 2H9GB 4F3FB 4C57C 4JQVC 2J2ZA 5D7JD 3EOBA 1MCFA 5J3HC 4Y5VA 2EECA 5JR1L 2OXGA 4G6AD 5KS9F 4EJ1C 3GRWL 2X4NB 2DICA 3HG1B 3S97C 2ARWA 4XI5D 4CVXB 3OJDB 1FAIH 4LHUA 4O02L 5F9OH 3ZDYE 3FFCB 2FB4L 4H8WL 3BFOA 2DLHA 1BAFL 1NC2A 3GBMH 4NZUH 1ZT7A 5IVZA 3FO0L 4JQVA 1OB1A 5FDWB 1RFDH 2WLYA 1SM3H 2WLZA 1SVCP 4NYLA 4MXVE 1CZ8H 1KCUH 2HT2C 4XPFH 5IEHA 4XB7A 3KHQA 4UDUB 3V5KB 4PJHA 1TVBB 3DX7A 4DEPB 4HJJL 2J7LA 2N56A 1CXLA 3I2CL 4LLQB 4PJIB 2Q7NA 4N1HB 3RVTC 3BE1L 1CGSH 3HLAA 3LKSB 2QR0A 2DWDB 2PO6D 2ADFL 1ZWIA 3QUMB 3G6JE 4LMQI 4YDLC 2OZ4A 1A9EA 4OD1L 4UNVA 3ZHDA 1RJYB 5GGQH 3LKQB 1NBQA 4P59H 5JPNA 2CUHA 5FV2A 2ZJSL 1MFCL 3K8LA 1C5CL 1UZ8B 3PXHA 1L9NA 4YEFA 1HHIB 1QLEH 1DQTA 5AG9A 5JXAL 4ZQKA 5GQBA 2OR7A 5DZNA 1UWXH 2BNQD 5C0BA 4JPIA 4NNPL 5CGMA 4BH7B 4Q9CA 1MLBA 1RIHH 2R1YA 4Y2DA 1I7TA 1P6AB 2W60B 5EUOE 5E7FA 5B4MC 6CGTA 1I9RL 1EFXA 2DQUL 1IM9A 2GUOB 3U1SH 4PJIF 1NGPH 3PHQB 1IT9H 3C5ZB 2WBJC 3OB8A 4BQBA 2CMRL 3WFEL 3VG0H 4ZO6A 1MIEH 4BJLA 3GRWH 1WZ1L 4Y5YB 2Q6WB 5C0CB 4RAHA 3C8KB 1AO7D 4UDTB 3GSVA 4PD4K 4PP1C 4YFEA 5FA3A 3KPRE 1QBBA 4PJFB 2JCCE 2Y07H 5L2KA 5IM7A 3MRMA 1X4ZA 3G5VA 3KJ4B 4H8WH 4DZ8A 1BAFH 3ULUL 4LLVA 2YPKB 4HT1H 5IFJA 2R1XA 2WBJA 3HRZA 2R39A 1LO3L 1A1NA 2VSCA 4Z7UF 5DS8B 5EC2B 3VXSB 1LO2H 4DKFL 4XP4L 4TUOB 3O6LL 1U8KB 3FQTB 2WAHA 5E2UH 3QA3B 4X4YB 3EGSA 5KW9H 1T4KA 9CGTA 3LS4H 2IQAA 4GRWB 1H3PH 1XH3A 1GC1L 2A83B 2P5WE 1KEGL 3TO4B 2VKWA 3E6FB 1XGRB 4TQEH 3B43A 1NCBL 4Z95H 3PJSA 3S5LB 2GITA 5FOBA 3KNBA 3RWGA 3RVWD 4X8JB 5D93B 3RGVD 4D9LL 3L3KA 4N0UE 1N6VA 4I2XE 3RWDB 4JFEA 4XVTL 5A2JH 5K9QG 1FL5A 4R4FH 3ZYIA 4Y2OA 4PGBB 1KSRA 1C5CH 4HGWB 3PWNA 4GRLC 3UBXG 2JF1A 5E4EC 4P2QD 1KULA 3BGAA 4MAYC 2OTUB 5A3ID 1H3GA 1S5HB 1EVTC 5HI5D 5AUMB 5HHOD 5C0JA 5L7XL 1PJ9A 5E6ZA 3FT3A 3X12B 2RHEA 2J5LB 4NQTA 5J89A 1QYGL 2P7TB 4HV8A 1EHLL 1QHOA 3SKNA 1JHTA 4M02A 2Q8AH 1I9RH 1U8LB 1F4YH 4GRWF 2XFXA 3U6RA 4EN3B 5D1QC 3ULSA 1FNAA 4ENEC 1EEUA 4GRLA 4HH8A 1RUMH 1FNGB 4DW2H 4BKLA 3C60A 4Z8FH 1WT5C 1EBPA 5EO1A 1MWAA 3NVQA 2H1PL 4ZG1A 5BXFB 3HC0B 3CX2A 5CGYC 1DQLH 1TJHL 3I84A 3ILQC 2I27N 4YWGH 2BSED 1TETL 1RJCA 1PSKH 5EOCL 2CKBB 2DJUA 1XGTB 1RJZB 5E8PB 1YPZB 5DDHA 3BP4A 4NFBA 1U3ZA 4NQDE 3R1GL 2K7QA 2JIXA 1Q9KB 3DUHA 5E6IB 3WXWL 5D1QA 2VH5L 3P9WB 4OZ4A 5DUPH 5IR1B 2AJUL 3BAEL 1BZ9A 3RZCA 1VFBA 2J6EH 4QRQA 5K9JH 4MCZA 3ABZA 2ATKB 2IBBA 3O8XD 2AK1H 3VXQA 1LGVA 4R0LC 3UTZA 1FORH 1FVCB 1FG2A 4EN3D 3V0VB 4Q58C 1MHCB 4G6JL 1LO0L 5F3BA 5TPWL 2Y72A 4IRSB 3H3PH 3VFGL 4BSJA 4NQSA 4Z7WA 4H26A 1UCTA 4JHWH 3TN0A 5I0ZA 1DEDA 3TP4A 2F54B 5I1DA 4MD0B 1NFDE 3SCMD 1J05B 1KN2L 4YDJA 5KTEL 4MJ5A 1U36A 1JZ6A 4K3JL 1GPOH 1JWSA 5ALCL 1CG9B 1Q8MA 4R0LA 5ESVA 3O11A 1HDMA 1Q9LB 1YPZF 2Q8BL 2H6PB 4AJ0A 1JN6A 2W0FA 3LV3A 4M8VA 4PJ7B 4U3CA 4WWID 3G5ZA 1FDLL 1V05A 2KDGA 3L3GB 4URTB 5FYKD 4LARH 2ED7A 2X41A 4B7IA 2NYYD 3D3VB 3ULVD 1SBBA 3BDBA 1LNUA 1DBJH 4HWUA 4L1DA 5DJ2A 2F74B 5KVGH 1A6WH 3QWRA 5E8OB 3O9WB 1EHLH 1M7IB 5JHLH 3BZDA 1UYWL 5HGHB 1DBKH 5DZLA 1G7JA 4BSVA 3MUY1 4A6YA 4FQPA 5DGRA 5E9DB 3UYOD 4RAVA 1I8KB 3RP1A 1NCWH 2VUOA 3BQUC 3IJYB 4MYWB 4LRNH 4BK5A 4OAWA 4KDWA 5A43C 4OLUL 4MSWA 2XKNB 1XGQB 1QKZH 5DD6B 5JHDE 3OAYK 2C3VA 2WP3O 2XOTA 3MOBL 4XPGL 5J13C 3D69B 2DQJH 3MRGA 1XAUA 1M7DA 1QRNB 4PJ7F 1UENA 4LQFH 1QR4A 3NH7L 3SE4C 3D3VD 4YE4L 1JZ7A 3B3IA 4G9DB 3RDTB 2BJMH 1PGRB 3DVNA 4J3UA 4PJEF 3BKCL 5EZOH 4MD5B 3T0EB 4AEHL 1UM6H 3BSZH 3CD4A 1F2QA 1UXSA 1YDPB 2CXGA 3UTTA 5A1AA 4D94A 5J12B 2DQFA 1X7QA 3N85H 3SDXA 4S1DC 4JO2H 1KEML 5BQ7A 5IV2B 3HNTL 4ZPTB 4OUOA 1JGEA 1NKRA 4CAGA 1LO0H 1I1FB 4JAMB 1QFWH 2Y5TA 2MHAA 1ZS8A 4IDJL 5FGCB 3FB6A 4XB8A 1JF1A 2V5SA 2VE6B 4OF7A 5DQJA 5C7XL 3CVHA 5F88A 5FGBC 1S3KH 5TQ0L 2E7HA 1RUQH 5TE7H 1D9KC 4Y16C 1YEDB 1YN6A 3W2DL 4L3EB 5IVOA 5CEZH 4Y1AE 2DI9A 2Q8BH 2VZUA 3TGXA 1CFNB 2KKQA 3C8DA 4B50A 3F8UB 4MJID 4XWGH 4QHLB 1HWHB 4JRXA 4L9LC 4EUPB 5DJAB 4OUUB 1G9MC 4BZ2L 1OLLA 1EAPA 5GGVH 3GHEL 1UADC 3EJJX 1YJDL 2LV4A 2A6JB 5FGBA 1A6AB 4YXHH 1D9KA 3MJ7A 3T3MF 3DV4A 1TZGH 3GDBA 1QFWI 3KXFA 5ITFA 1G9NH 4PLKC 2FJHA 4I0CC 5HHQA 3B5GA 5ICZA 4HG4J 2EEDA 5IBTH 3EOAA 4WDIB 4J3OC 5I73C 4LASH 1K5NA 3VXPA 2HFFB 1JPGB 4L4TE 3IFPA 3DJ9A 3TYFA 2PTVA 4G5ZL 1UQSA 5FYKU 5HDQL 2YKLL 2W0PA 4NKDB 3O4OC 2IMMA 1AD0B 4KROB 1A14H 2OJZL 2PXYB 4KV5E 1NGXB 3WIFA 2RGSA 1UG9A 3S3SA 3ALPA 1IAIH 3ZL4H 3GZKA 4PGDA 4WV1C 3K1DA 1MHHB 4R3SB 1E4WL 1RIUL 1AXTH 3VXMB 4EI5D 2ITCA 4WFFE 3NGBC 3TBWA 1GIGL 3TPKA 3UXFA 1B88A 4FABL 1NC4A 1I4FB 1JFQH 4KZEL 4MA1C 1H8SA 2HLFD 2NR6C 4LSQL 5I1GL 4NUJA 1U8IB 3JTSB 1Q9WB 4ZFGL 3TLRA 4HKBA 4F7EA 4K07A 1I8LC 2R69L 4Y5XC 1NEZG 3ZKMC 5I1EH 1ZLVK 5T3ZD 3HNTH 1VSCA 2DD8H 4MNGE 3ZSTA 4HHAA 1QSEE 3MBEC 4XCYA 3THMH 5M94B 4P4RB 1RZJH 1FP5A 2MOVA 4R26L 3EOYG 1EJ6A 4U0RB 4C83B 3DO3A 5MERA 1CTNA 4MJ4A 3K46A 2F19L 2L7UA 4RQQB 2KL6A 2NY1C 5DEFA 3UTSB 5JOPD 1PKQE 1T03H 3WNNA 4M43L 2DBLL 1RZGB 1IAII 2QSCH 1MCWM 4I1NB 4CW1A 3GSQB 4JHAL 1XR9B 1CCZA 1FO0L 5E5MA 5LXGL 3DO7A 2VLRB 1RURL 3I02A 3FKUS 5IIEA 4LVHC 3GBNH 4ODSH 5EWIL 4IS6A 4OD3L 5T1MB 5D6DC 3T4YA 1AC0A 4LPWA 2XI9A 1FNLA 5GS0H 3CH1A 1G0XA 1KLGA 1QUNA 1G7IA 3O0RL 5DVMA 5ISZE 3FT4B 4WUUA 1PLGH 3TBSB 1CICB 3HUJA 5K9QI 1AQKH 1GGYA 2Y6SC 2R0LL 2VZOA 4I0PC 4YHZL 1RMFL 1A6UL 2HJKB 2EYRB 4NO5B 4R7NB 1A7PH 2CRMA 4HSQA 3BP5A 2F53E 2ICWJ 1LVEA 1N64L 3GKWL 5IFAH 4IJ3B 3HMXL 3FONB 2CDGB 1HQRA 4G42A 1NJ9A 4P46B 2XXCB 4X80H 2GFBB 3VFRB 4JM2B 4F7MB 3VMOA 2ADJA 1T7ZA 5EO9A 4FXLA 3LQAL 3WXVH 5T1LA 2ZKHH 2VR9A 1Z0NA 2BRRL 3N0PB 2CRIA 4I0PA 3WS3A 4KK8D 2AJVH 1Y6MR 1BFTA 4YHIA 3PWUA 2YD9A 4IMLB 4WWKD 2Z8WC 4L4VD 4LSUH 4U0QB 4LOUC 1NCDH 1GGBL 1U3HD 3JV6A 3QP3A 2JELL 1DVFC 1T66D 1LK2A 1RU9H 1T2JA 2VDLL 5EC1A 1A9BA 5FYLL 3BMWA 2WIIB 1CXEA 1FZJA 1N6QL 1KF9B 4KWUA 1QFOA 4PTTB 5D1ZB 4ZYKA 4XMKL 4WW2A 5T1KB 2UY6A 5J06A 3BH9A 4HK0A 4Z5RA 5ANMB 5TDPB 1UJTA 1AY1H 3T4AB 4R4BA 3GEWB 3G6DH 1U8PA 3SJVB 4JZOB 3PL6C 2C1OB 2QQKL 3MOQA 4HWEL 4JM2F 5DJXB 5GJTH 4R7DA 3IDIA 4KZDL 3BH8A 3F58H 1OGAE 1DVFA 4DOHB 1MJ7L 1C8PA 4TSBL 4G6AC 4XCCL 1EEYB 3S37L 4HDIA 3EZ8A 4OZFA 1Y6KR 1IKNC 4OZIA 1CDBA 4G7VH 5DC4B 1C5BH 5JDJA 2VLKD 1E4KA 1K2DA 3TCLB 4P2RD 3MCLH 1DLFH 1R3HA 1PZ5A 5FCSH 4RRPG 1BFOA 2W9DL 2DTSA 5J1SC 1NGZA 5D7JA 1K9TA 3SDDD 3DMMD 2EDRA 1MRFH 3IJSB 1VCAA 5D6CA 3U7YL 3UJJH 4J12A 1JE6A 2Y36L 3R06A 3GKWH 5GZND 2J88L 2YD5A 5EU3A 2DI8A 2CIIA 4MQTB 1WEJH 2VL5B 2DKUA 5C0NC 3UC0H 3I9GH 4JO4L 4WI3A 5E99L 1ZSDA 5E5RB 4AG4H 3MBXH 4QF1A 4HBCL 4Z76A 5HDBE 4ZNEA 3P4NB 3CZFB 1CXFA 5C0RH 4QRPB 2OMNA 1S9YB 3HFMH 5KSBE 3IDGA 1W72A 1U6AH 2H2SD 2UVEA 4NQCD 1EO8H 5HJ3B 1I9JL 5CD5D 5FYLH 4U3HA 2NX5E 2LFGA 3LN9A 2P24A 3K4AA 1VEPA 5FO7B 4WRLA 2PO6A 3JSSA 1WGOA 5D7LD 3ARGB 1JMZA 1AGFB 1K8DA 4DEPC 1CXKA 1RZ8B 5IW6B 1QBMH 2ICWA 1P4IL 4LNRA 4GW1A 1KUMA 1ED3B 3HC3L 1WQVT 3TV3H 5B3JE 1P7KA 3HCVA 2WUBH 5IQ9B 1NMAH 3ZKQD 2OL3H 2BNRD 2EXYD 5EU6E 1KELH 2YN3A 4I3RH 5HYJD 1DBAL 3U48A 2O5XL 1MJ7H 4OLWH 4S0SD 4RGNE 1D5XB 4HWZB 4PG9B 1H3XA 2BNQA 3U0WL 1QBLL 1V7MH 5CS7A 4CADA 5ADPH 5FF6A 2OP4L 4DTGL 1J1PL 3VJ6B 1AGDA 1PYWA 2HWZH 4YX2L 2DQCH 1T20A 5JNYA 2AK4E 4WHCA 5EU7E 4KGJA 3MYZA 1MFBL 1NBZB 2FNBA 3BVNB 3QUMA 4ODXA 4OLYL 2OSLB 3QB7C 3NZ8B 1TZHB 4WU7B 1LEKB 3OHXA 5D72L 4EQ2A 3S36L 4GH7B 1AO7A 5ACZB 3LKQA 2HMID 4MB3A 4QOKB 3AAZB 4Z7VA 2VZ1A 1WITA 2GK0A 5DJCB 3ARBB 5T1DH 1WWAX 1YY8B 3C5ZC 5F7UA 2EDNA 1J0YA 1JNNH 2B1AL 4K9EC 4XH2B 2H3NA 5FGRA 2Y1VA 2AJXH 4Y5YC 1DQJB 4DUWA 1IJ9A 3FHQA 2DBJA 3HN3A 3HNSL 4GS7B 4UB0H 2YOCA 5D7SH 4EZMA 1T1YA 3HMWH 1PDKA 3RVXD 1WFTA 4CMMA 5B39B 4FNLL 3RVWC 1AP2B 4B0MM 4LSPL 1GXEA 3QPXH 1ZHNA 3PHQA 2HFEB 1JGUH 2GTWA 3S34H 3WUWA 2GT9B 1I9JH 2CQVA 3JZ7A 4NWUL 2DLIA 3DX9A 2Q6WA 3TZVD 2PUQT 4KKCD 2R2CA 4ZAKB 5F9JB 3PQYB 4PJFA 1CL7H 4JO3L 1K8IA 2DWEA 5HI5C 1ACYH 1JWUA 4G3YH 3RGVA 2NY5C 5MEPA 3UO1L 3O4LB 3TO4C 43C9B 2XIDA 1BQHA 1U95B 5BV7L 1K3ZA 2AS5M 4HUWB 4PLJD 4LSRL 4PRHB 3KS0J 1EX0A 4W4OC 4WI2A 4I4WB 1JNJA 2HTKC 3JV0A 5DS8A 1KLFA 4XTRD 3GMMB 5D93C 2RCSL 4MCYB 3RWFA 3RFZC 2YK1H 4QWWD 1T3FB 4TUOA 2VXTH 2B5IB 3ORJA 3HNVL 4MNQE 5C1MB 1HOCA 3RKDC 3V5HB 2QKIA 2AP2A 5CBAB 3KYKL 1CR9H 4RBPK 5HHOA 2G75B 2OP4H 2XWBA 3EDJA 2V2XA 5EZLA 4XNYL 3UZVB 2VDKL 1AKJB 2A83A 5EFIA 4C54A 5DURB 4PV8B 3UAJD 4MJ6B 5IK3B 1RULH 4MXWH 4P2YA 3HTLX 1S9XB 4W4OA 1CL7I 3G5YB 5IKCB 2VKXA 4RFNB 2FH8A 3DTXB 1WICA 2A9NL 3O8XC 4S1SL 3MRKB 3O4LD 1EIBA 2ZUTA 5F71A 4XPAL 3U0PA 3PHOB 2VLJE 4M7JH 3QDGD 4X98B 4EN3C 5J6GB 1UZ6F 5IB3A 1LO4H 3FN0H 4XVSL 5ABDE 3CNKA 3INUL 2R0ZL 1IAOB 2CGRH 3OAZH 1N4XH 4N9GB 2A74A 2Q86A 3DRQB 5AUMA 1I3GL 1TJGL 2G60L 4TUKH 1SEQH 1S8DA 2B7DT 2BHYA 4KJQD 4XRCB 2DQDH 3O8XA 3L5JA 1UACH 4HGKC 2CXKA 2YS4A 4OSUH 2A9ML 5DURD 1U8LA 5D2LB 4EN3A 2X4SB 5E6IC 3QDMD 3T04D 3S35H 4RDQG 2AW2A 1FNGA 3JWOC 4UI2A 2DM4A 3MRBB 4W70A 1T2QL 3V52H 4PS4L 3ULVC 3DSFL 4Y4KB 4PJ5E 2Z31D 2AXFA 4Y19E 3SCMA 5DI8A 4HEPG 1MVFA 1J1XH 5D2NA 1EUUA 3T2QA 4I13B 3ALWA 1U8HB 3RNKB 1F3RB 5F6HJ 4IRSC 2EDWA 3CFJB 1F4XH 2XKSA 2DYPB 4U1KB 2A77H 1QLFB 2FATH 3IU4L 1IGYA 5IR1A 4LSRH 2ATKA 4FQ1L 5T33L 4ZFOB 2PKDA 1A2YA 4LEOB 2A73A 3MV01 4YPJA 4X4MA 5C2BH 5CD3A 1MCEA 4M5YL 3GMRA 5GGSA 5D2LF 1P1ZB 3L3IB 3QJHA 3ECBA 4BZ1H 1ZMYA 2VDKH 4QO1A 5CZVH 1JPFB 1NAKL 4FZEL 4BYHA 5IHBA 1MCOL 5ETUB 3RU8L 3MV8B 3MO1B 4UUJA 1IQDA 3CK0L 4HK3N 1LP9E 1Q72L 1U8QB 2EXWD 3IFNL 4KKAD 4B53A 4GSDL 4HX1A 2WBWB 4NKMB 3O9WC 4S1SH 2FLRT 3IDUA 5I30H 1IAKB 1ZLWH 1MY7A 4PJAB 1WFOA 2X05A 1MAMH 4DCQB 2BSRB 4X5WA 3H9SD 4ZPVA 3BP7B 3D3VA 3MLVL 1ZKAA 4FFWD 4N5ED 2I07A 3UJTH 4K3EL 3LKRB 5JW4R 5FHAH 2DKMA 5C6TL 5DTFB 2F74A 1I3GH 3QDAA 2EKSB 1VKXA 4LSTL 2DIBA 4JCMA 2CLZA 1FC2D 4U6TA 5FYJD 4N0YH 1M7IA 5C8JB 4XNQA 4KMTH 5F7EH 5T3XD 2DMBA 3RHWK 1I8KA 3CFDA 3WIHA 12E8H 3OKMA 1KIPB 2ZUVA 3RL2A 4YHKL 5J12C 3EYQD 5J1AA 2P4AB 5AEAA 1AI1H 5DMKB 3O3BB 3SQBA 3H0TB 4GO6B 3FQWB 1G84A 1HIMH 1W0WB 2K9UA 1F6AA 3R8BB 1MELA 4TULL 3S36X 4PJAF 2XN9E 1GYAA 4AT6B 4DKEL 5ACLA 1FJ1A 3VI4F 3L5WA 2VO5A 3DIFB 1FC1A 2X4OB 5DD0L 3DLQR 3PIQA 3DGCR 4MD5A 4JPWH 5HVWA 4MJIA 1YDPA 3QG6B 2B4CL 3NAAL 1K4CB 3D0LB 5CAYB 3WHE1 1EEQA 1VA9A 4LRIA 1HYSD 1CYGA 2V2TB 1PW3A 4OI8A 4LCWE 4PBWD 3L1OH 3P77A 3NN8B 4F37F 5TE4L 2BCKB 4TTGA 2GQHA 1IEHA 4HKJA 1J0IA 3VRJA 3X3GL 1OTTD 1A7RL 1MOEA 4K7PL 4RNRA 5DEGB 5C0AD 4FFVC 2V5YA 1HI6B 4FFYH 4UU9B 3EOTL 4WI8A 2MCPL 1J88A 1P4BH 5D5ME 4PBXA 2XWTB 2C3XA 2HP4A 1CT8A 2HLFC 2QV2A 4XMPL 5LKNA 1WWWX 1Q72H 4PJCE 5IB5A 3IFNH 4DAGL 2YPLD 1WAAE 3P0YL 5A2LH 1OL0A 3O2WL 5HHNA 4D0BA 4N8VG 3B8SA 1QSVA 1VFAA 2YZ1A 4GKNA 4OZHE 4XCEA 2R1WB 1R3LA 1F6LL 4LFHD 4P4KB 2BSTA 5E8NB 2J8HA 2GAZB 1Q1JL 5JZ7D 3BGMA 4KROC 1IFHL 1BEYL 5IBUB 2PXYC 4PGEA 1FPTH 5FO8B 1IC5H 4XXCC 3NACL 2YRLA 4OT1L 4OKVA 2NZIA 1M05A 5DHVB 1KPRA 1X6NA 1IQWL 4OGZA 2QQNH 3BPCB 1QFUH 3EFDH 1MFAL 5TF1H 4Z0BL 2O5ZL 3LPFA 1IE5A 5DQ9A 4EDXA 2GI7A 3OXSB 1TENA 3G6JB 4JE4B 4L8CA 1NBYB 5FUZL 1JNHB 3ZDYF 2NW2B 3S96B 4HCRL 3X13B 4P5MA 4HG4K 4TULH 3AY4C 3NTCH 1MHHA 4R3SA 1DBBH 5H35B 2EZ0D 5DD0H 3WV0A 3T65A 1QLRB 1T1WB 1PG7W 2JTDA 4UV7H 4MXVF 3JWDH 1Q9WA 1X5JA 2VIRB 4ODUB 3MRCA 1S9WA 3V0AC 3I50L 4HJGA 5FM5O 4HKZA 3PE9A 4HQQL 3SKJL 4ZUUA 4OCWL 5EUOB 1X4YA 3F12B 5I1IL 3AY4A 3RWJA 1DANT 1R3JA 5HGGS 3QYCA 4NQVB 1YEJH 2FIKB 4WU5B 3IXAA 2PYED 1QA9A 3EOTH 2PNDA 3VFSB 1U8NA 4L5FH 2VOTA 4LDLB 4UOJA 3G6JF 2PF6A 2BSSB 5KZCD 1FZKB 4ONFL 2FBOJ 2ZPKH 3KPRB 1S7RB 2NZ9D 4XMPH 2JCCB 4PJ9D 3ZSSA 3GSQA 1UM5H 5AG8A 2OJEA 5ESAB 4F7CA 2AJZA 4G6KL 3ZHLA 4U1MB 2FO1A 5BZWB 4RIRA 2H26B 2BVTA 3GMQB 3HE6B 1AFVH 2EE9A 5DSCB 2D7PA 4IJ3C 5SWZE 1KJ2B 3PABA 4P46C 2D7QA 1VGEL 1FH5L 4JM2C 4LVNB 2VQUA 4G9FD 1JNLH 3ELAT 4WWKA 4MA3B 3DUSA 4L4VA 3GSNL 1A47A 4KQ3L 4ERSH 1U3HA 1KIRB 5EUOF 1HYRC 5C07D 3KPSD 4DKDC 2R29L 2BVEA 1S7QA 4APQD 1FNEB 1GGTA 4EI6B 2OR8A 3V5DB 4IIQB 2WSKA 1F4HA 1MFAH 3ALXA 4D9RE 1U8OA 2P5WB 1NDMA 4HLZG 1I7RB 1MH5A 1OSPH 1NCTA 2VDQH 3MYJA 4GMSH 3FQUB 4TUJA 1HSBB 1P9MA 1KJVB 1CDUA 2GFBA 4GMTL 5EZJA 1T5WB 5IHUL 3LSOA 4D2NA 4F7MA 3TA3B 1BWMA 3WFHB 3EDEA 3IDJB 2JCCF 8FABB 4DGVL 4N0UB 4XPHH 4WTZA 5D1ZC 1F6FB 3K74B 2GCYA 4I2XB 1IGCH 5FOJA 1VFMA 1FVEA 2VLMD 1U42A 3SDDC 5KSUB 4JFZH 1DFBL 2OXHA 2BZDA 3ULUD 4P23D 1ZA6B 2D0HA 1X5GA 1JHKH 1MWAH 3WCYA 3HAEG 1VFOA 3FO1A 1U91A 4P2RA 3DROA 3MMEA 3BKML 5ENWA 4ZOCA 4YXLL 1G6RH 4OLVL 3N1MC 4HZLA 2E8ZA 4EIGB 3ZDXE 1JZ3A 4Y88A 1D5IH 5CJQH 1MCCA 3H9HB 3QCVL 4ESKA 4L8BB 2NY2B 5C09D 3C9NA 3SDDA 1AQDB 5DK0B 4MQ7B 3SQOH 2ZUQB 4G8FA 1II4E 4ISVA 2VXUL 1E27A 4JZOA 3WO4B 1ZGLA 3BPNC 4KKNA 5IP4A 1DQQB 2P5EE 5L88H 1ZA3A 3ZE0E 1BX2A 3EW3B 3RWHB 1ZVSA 3SY0B 3C6LB 5IWLC 1YEHH 1T7VA 4HPOH 1OP3K 4PG2C 5HY9B 2FR4A 1JWMB 2E9BA 4AY0A 3QXTA 1MNUH 3NZHH 4YDKH 4TSAL 3EHBD 1AGEB 2BMKA 4NQDB 1SY6A 3N9GH 1FYTE 1B6UA 1UGNA 1MJJB 2IGFL 1U3YA 3VD9A 3VD3A 1OPGH 3IS0X 4MA8L 1CDHA 3MV7D 3V4PL 2OM5A 4MZ3A 3V0WH 4F80A 4WFEE 1JZ5A 4NC1E 5E8EB 1WUNT 4R8WL 1S7VB 5BW7C 2C7UB 4OD2B 2AKRA 4WUKL 5IWLA 5E08L 5SX5K 4FG6C 3IAPA 4XBEH 4KQ3H 3S9DB 4PG2A 5ADOL 4XMLL 4NQCA 4A2MA 3TC9A 3L95B 2QHRL 4KDVA 2V2WA 3UTOA 1KGCE 2FO4B 3TIEB 2FECL 2J12B 3CPLB 2YD4A 1EHXA 3RL1B 3B6SB 3MLPA 3CXDH 1NFDB 1Z3GH 5D7LA 1KXVC 1FVDB 2OR9L 5HPMA 5I8EA 2E9IA 1BBDH 3ARED 5DUBB 3G08A 3ES6B 5BW7A 4NHUB 1MVUB 2EDDA 4J3VA 2X9XA 1IBGL 3T0DA 4GXUN 1TXKA 2BNRA 4OZGB 5CEZE 1KBGL 5HYJA 4UMGA 4CMHB 2P42B 2IPTH 5EB9A 3VFUA 4JFXB 2AV1A 2Z4QB 2HMIC 4DQOL 2I5YL 1JGLH 1L0XA 4Q9QH 5CCKL 3OX8A 3EYUH 2ITDB 4A2LA 4K94L 2DQTH 4FZ8L 5CKGA 1G7QB 4C4KT 1WCQA 4KVNL 4NRYB 4DN3H 4I3SL 4NKOB 4OJFL 5FK9B 1JUFB 2NY0D 5TH2A 4Y4HD 3LEVH 3QCVH 4GKOA 2ZCKL 4LPYA 3OKKA 3T1FB 3DRTB 4LIQH 3I6LD 1NFDF 3VCLB 3RVXC 1HILB 3RWEB 2AJSL 4U1HA 5CSBA 5FUCE 3KYOB 2F5BL 4LLDB 3SKOA 3L3DB 2YMXL 3LQMA 5IQ9A 4BSWA 4OGAC 1D6EA 5JHDB 2BVPB 4PRNA 1CD1B 1NCCL 2UYLA 1T0NB 1ZK9A 1CBVL 3QEUB 1AR1D 1QD0A 3TZVC 3LRSB 3TBVB 1A3RL 4DGIL 5EIIB 3CVHH 2IGFH 4JKPL 4ELME 4GAYA 1X5IA 3L3OA 1CN4A 1WIPA 1QHPA 1AD9B 5CEYB 4PTUB 4FQ2L 4X5XA 1FBIH 2XG4A 1ONQA 4Q2ZB 1A1MA 2GTZA 3QJFB 4GS7C 2Q20A 5BRZD 4R2GD 2VDNH 3TZVA 4G8IB 4JJHA 4E41E 1WF5A 4QRRD 4QWWC 1D5MB 4ZS7L 4U1LA 5FHBL 4UTAL 1QR1B 3ZTNL 3ZZ1A 4HIIB 4HS3B 4XH2A 2E7MA 4XX1G 3CVIL 1VERA 4DGYL 5GRJL 5C08D 4ZOBA 2ZUYA 4Y1AB 2AXHA 2IWGA 3UAJC 3BOVA 1NLBH 1MQ8A 4ZAKC 3QIBB 4OCSL 5FUOH 1BIIB 1BD2D 1G9MH 5HTSA 3P30H 3F7QA 3AXLB 5B39A 3BZFB 3CSBA 5GIRA 4FS0A 1ADQA 4M8QB 4N90D 4TSCL 3UPAA 4DQOH 2VB5A 4ZO9A 4OFKA 3U4BL 2X7LB 4O58H 4Y7MA 4I3SH 1EGJL 4UV4H 3ZDZE 4CL7A 4N1CA 3AS1A 3G04B 4YHML 3WFBL 2B5IC 2X9WA 4EVNB 5H94B 4WEBL 4OTXL 1UWEH 4YDIH 3GJFB 1ZLSL 4L4TB 5DD1H 3WNKA 4Q9RL 4OCYL 3O4LA 4Y1AD 3Q2CA 4O51A 5CIPB 4NM4L 4JLRA 2ZSWA 3QDGA 2CDFA 1ZHKB 1CFQA 5KSAD 1TTGA 1R0AL 2KZ1B 3EDDA 4PJGA 4RFNC 4OLXH 4UNUA 5IROC 5IJVB 1MJUL 5DQDL 4KHTL 1CE1L 2UWEB 3NA9H 1YEFL 3OKNB 3MRPB 2EO1A 5HGDA 2IG2L 1MFEL 3TIDB 4DWHA 4X99B 5FM8A 3P11H 5I15H 3FB8B 3L7EB 4G8GD 5DHXB 4XC3L 2C4FU 3QDMA 4POZC 4I48A 5TDOB 3HPLB 4MNGB 2PW1B 4PRPE 1AH1A 1QSEB 3MRIB 4H20L 4N0CC 2MQCA 4IOFC 1B0WA 4PR5B 4YPGA 5IROA 5JLZB 3OTTA 2Z31A 3QDJE 3OKLB 3W0WD 1KCKA 1EFQA 3GI8H 1GAFH 5E00B 3QFDB 4FTVE 4JFYA 1PKQB 3MXVL 3CVIH 3BN3B 3DX6A 1P84J 4KV5F 4DGYH 1JHLL 3MLSH 4XPBL 5LAXB 4DZBB 2QADB 1HSAB 1IAOA 3IXTB 2VQTA 4Y4KC 4ZD3L 3SGJC 2VWEC 5TFSL 2UUDH 3GSXA 3KJ6L 4Q74A 4XRCA 1N7MH 1XZ0B 4U6VH 4YDVB 5GGTA 1LK3L 3NABL 5H2BA 3VMPA 5I1LB 1FO0B 1T22B 3A6CL 5HGBB 3GGWA 4D8PB 4FQXD 3FB5B 3QFJD 4XNMA 3HE7D 2FEEI 4P99A 5ISZB 5HYFA 2A0LD 5DLML 5E4IA 2FJGB 3BZ4B 3MRBA 3P73A 4LLAA 3U4BH 4RX4D 4K55A 1P2CA 2I9LB 3BW9B 4ZODA 3AU1B 3REWB 1NMCB 4TVPL 4MD4B 4OQTL 2HVJB 3S5LG 3ZT7A 1T0MB 1F4AA 4IRZH 5DO2C 4XZUB 3WFBH 1GL4B 3SGJA 2F53B 1W8NA 5TF0A 3NFPB 5SWSD 3G6AB 4ZXBB 1MI5E 3D0VA 1EBAA 1VGKA 2UZXB 4TVPE 2X6MA 1NAMB 4YO0B 4Q9RH 2IQ9H 2NXZD 3MV11 3UP1A 4OCYH 4PREA 1FNFA 5DHYA 3BIAX 4XWOD 1NUNB 4YEEA 1G7PB 3H9SA 1L7IL 1YN7A 1XMWA 3LRGA 3BT2H 3EYQC 5CWSB 2H32B 3RTQB 5JMOC 3RUGA 5A16B 3B5TA 1KB5L 3BD5A 4QY8B 1BZ7A 2UV3A 2HN7B 5CJ8A 4MZ2A 5I8KH 1MFEH 3PV6A 3MLRL 1DR9A 2P8MA 4WTXA 3LS5L 3MRNB 4QHNB 4YAQA 1CTOA 3TT1L 1QVOB 4FQLL 3AROA 5C0DA 1OAKL 3OPZL 3MO1A 2F53D 2HT4C 5DK2A 2IALB 4NO0B 5GPRA 1U8QA 4YNYB 2VISB 4KRNA 4YH6A 4NQED 4PRAB 4NKMA 2J8OA 4HGMA 1MIML 5D70L 3HB3C 4KK9D 3DV6A 5K9KA 2PYFA 4J1UB 2BFVL 2HT3D 1OGAB 1RUKL 1OTTC 2P44B 1XCTB 3LKRA 1RZ7H 1EDQA 1PVHA 4JDZA 3SPVA 4WCYL 3SOBH 2EKSA 5F9WB 1ODAA 2GW5A 2HTLD 3QI9B 2EH8L 4N1EA 2X1OA 2AGJH 2VDML 3FO2A 3FN9A 4XHJD 1ZTXL 5CSZA 3BEWA 3GIZL 4O9HL 4OF5A 2YPVH 3O2DL 1KIPA 4W6XB 3ZT6A 1CFTA 2HG5B 1OTSC 5F8RC 4YR6A 5C0AA 2RR3A 3M8OL 4JY5H 3BHBA 2QSQA 5FYLD 3V79C 5EZIL 4P5TD 3AFLA 1XF1A 3GSUB 3VXOA 3IETB 3EJZC 3Q1SL 5B22A 4G43A 1NCAH 4JY4B 2G5BA 5EN2A 4NZDA 1YYLL 4Z7UE 3QUZD 2YPLA 4K9EL 1EUTA 1E4XL 3ARQA 4LHJB 1UXWA 1I7UB 3DHJA 4O2EB 2E7LC 2XTJE 4KTYA 4J6RH 4K7PY 2FZ3B 3EYVB 1DUZA 1NSNL 5DFVD 4I0KA 4UT7H 1KCRH 3QPQD 4PJBA 3ROOB 2A6IA 3EJYC 4JQIH 5KSBB 3GSRA 5IMOB 1I8IA 1CDIA 3DETD 1V7NH 3NCEB 2APTA 2F5AH 2GJ6E 3LS5H 2R9HD 3TT1H 1HI6A 4ZUTA 1AGBB 2EZ0C 4P4KC 2NX5B 3OPZH 2D31A 5D7KD 4D0DA 1FAKT 3HHRB 1XF3B 3CCHB 1KIQA 4U4BA 1I1RA 4NPYA 3BUYA 2D0FA 4ZFFB 3S4SA 3BWUC 3GRWA 3IDXL 4Z77B 4HJ0D 1KFAL 3OJMB 4PJ8B 4KTDH 3F7YA 1KENH 2CIKB 4J8RA 1YMMD 3VFMB 2AABL 2N7BA 5EBLB 5EU6B 4KXZH 3FTGA 3QUMH 1IC4L 4CU8A 2R1WA 2NXYD 3ESVF 1OP3H 1R5IB 2GAZA 3LPGA 5HDBF 3IDNB 2ICWI 4RGNB 2CLVB 3CZJA 5E2VH 5D1XB 4P2OD 3L3HB 3HI1B 3QSKB 4M4PA 5DHVA 4HUKB 5KSBF 3LRHA 2EH8H 5CP7B 3DI3B 3U30C 1FLRH 1N3NA 4TPRH 4ZO8A 5B8CA 3L7FA 5C0FB 1HZHL 2VABB 5A2FA 1BF8A 4O9HH 2OBGA 4XVJH 3EO9L 2RAMA 4V1DD 2AK4B 3MODH 4PRBA 1RZKL 3JV4A 2JB6A 2KH2B 1MEXL 4KUCF 3L6FB 2ZNWA 2PYEA 1NBYA 3VFPB 5ITBL 3KPPA 2E5EA 1U92A 3C8HA 5B3JF 2O61B 1FSKB 4EUPG 5FKPA 4K9EH 1BVLB 5EOCJ 4RWYH 4KXZI 2HH0L 3BKYL 4U6YB 1G7LA 1QLRA 1R3IH 4I9WD 1FV1B 3WJLC 1INEL 5IB1A 5HBBA 3KLSA 1G7MB 3QRGL 4N8PA 1DBMH 4ODUA 1HNFA 2Z9TA 4PV9B 3MJGX 4K3DL 2CKBL 4RFOL 5KSVA 4G9FA 2E8YA 4S0TD 2HLAB 4M7LH 1F97A 4B41A 4I3GA 2AJ3A 4PJXE 3HE6C 5C07A 3KPSA 3T2NH 1NFIB 2FIKA 4APQA 1Q0XL 4C59B 2LU4A 4GBXD 1L7TL 3O3DB 4LVNC 3C5SA 3QEQE 3BWAB 2FJFB 2Y06H 5ICYA 3FZUD 2B1HL 4HPYH 4LBEB 1KTDB 5FO9A 1GJIA 3OKOA 3ISWA 1SJEB 3FRUA 5JO5B 2PW2B 4HF5L 3Q6GL 3TPUB 2NY5H 1GHFL 5BZWA 3HE6A 1J0JA 1UT9A 4AIOA 4JZJB 3DBXB 4ZS6D 5SV3A 5BO1H 2H45A 1ORQA 3LIZH 3T3PE 5JOFB 3TA3C 4P23A 4IRJB 1BF2A 1GC1C 2G9HA 1BOGB 2XQYK 1MUJA 3HI5L 2ADGB 5CJBA 4MNQB 1BQLL 3LZFL 3VWJD 2NY7L 2NY4D 3GB7B 4E9LA 2QJDA 2CJUH 2NY6B 1FZMA 1XGPB 3TWCH 4MDIA 4L4JA 1HZHH 5HVHB 5HYSA 4J3TA 4Y4FB 4QRTA 3R4DA 5MEND 1ZHLA 1HSBA 1KCLA 2XZZA 5CLWA 3MFGB 2F8OA 1OAZL 5IMMB 1C1EL 4KJWD 1T83C 1LD9A 1OGTB 3FO9B 1QG3A 4PJEE 2X4TA 4XXDB 5C86A 2WBKA 2YC1A 4BUHA 1TJIL 4U1NA 4ODWA 4XP9H 4CVZB 3PWPE 1CDYA 2VLJB 4OLZH 4WY7H 3SE9H 4IOIB 4M62L 2NY2C 4L3CA 1MRCH 5KSUA 1KJMB 1MREH 2IANE 2ZUQC 1N8ZB 2EDOA 3RAJL 3PP4L 4Z18A 3WO4C 1AR2A 1DEEB 3X14B 1G7HA 2C1PB 5DD3L 2AXGB 4RGMB 1RUAH 1ORSB 3QXVA 3F7VA 2ICEB 3JV5A 4YIQA 4N9OB 3V6OC 3REVA 4YGVB 3MV7A 4NZTL 3F5WB 3P4MB 3LN5B 4PRID 1RJLA 1DDHB 1QO3A 3Q0HA 5LQBH 2C9AA 4Y4FD 3H9HA 1CF8H 1A4JB 5DJDB 1OVZA 3ZKSD 4MQ7A 3P0GB 3JWOH 1Q0XH 4LKCA 5FYKH 1KT2A 3VRIA 2JJVA 1SJHB 1DQQA 1T1XA 3P3YA 4ODHH 5LGJA 2EIZB 4ORGA 3OR6B 3ULVH 4AENB 4HXBL 1OOAA 5ERWB 4PJ5B 4Y19B 5E1HB 2XA3A 4MJ2A 3SDYH 3V6OA 3BPLB 2PR4L 3MRDA 1F90H 3ZYZA 4IEFB 1EO5A 5FKAB 1AGEA 4RGOL 1HHGA 1OCWH 4MXQD 3TF7C 4WI6A 4M6OL 4JANA 5KVEL 4U31A 1QZ1A 3EO1B 3F6IA 4G6MH 2W07A 5BVJA 1LE9A 2R2HB 1D6VL 1MCJA 2I26N 5E8EA 3GK8L 4OV5B 1W0YT 1I3RB 2WW8A 1EEZA 5D7IA 3HI5H 1EV2E 1J5OH 4I77L 3RJQB 1YEIL 2APXA 1XGUB 2DQEL 4FQIH 3KPOB 3FMGH 4ZTOH 1NBVL 5GRWA 4CMHC 1UKTA 3V8CA 3KGRA 1P7QB 1CLZH 4KUZH 3RL1A 5E1AA 2EDLA 4Y4HA 4U1SA 4WFHE 3KS0H 2RBLA 1FVDA 2VSDA 4JKWA 5DUBA 4JPKL 3I6KA 1FN4A 2V9TA 5F1NA 1LP9B 3MX0A 4ZDHB 3U4EA 1X5FA 1FL6B 1TJIH 1U58B 2ESVD 4FQJL 1X5YA 2M26A 1VEOA 1DJSA 5E0QA 2BVOB 2WP3T 4PJHE 1A6TA 4OZGA 4OCLC 4JFHE 5T5FH 3WIHH 4P57A 5IGXL 2O93L 2OZ4L 3I75B 3RAJH 5GGUB 3V6FB 4DN4H 1BPVA 2XV6B 2MJWA 4XAKD 4WTWA 5JDSB 2ENSA 1I1YB 4JJ5A 5DRNA 5I76B 2FX7L 1N5YL 1C5DB 3GM0A 5JXED 1YQ2A 4NZTH 1I7ZA 4NKOA 3LD8B 5GZOD 1VESA 1IGIL 2LAGB 4GKSB 2BNUA 4POUB 3GO1L 5HHXL 2XQBL 5BRZA 3T1FA 4X0KA 1IILE 3RWEA 4AMKL 1P7HL 3TVMB 2EIEA 2QQLH 1LP9F 3L3DA 2CKNA 4NNYA 4QRRA 1S7TB 2ZNXA 5C0BE 1QOKA 1HHKB 3U36B 2PTTB 4M03A 3U7WL 4G80A 1G0YR 5DMJB 2VR5A 5BMFH 3STLA 1P5UA 2XN9B 2Z0BA 2XQYG 3QEUA 5C08A 2OQJB 2HAZA 4KPHH 4PD4J 5I1KH 3HRPA 3U9PL 3TBVA 5KVEH 4I18B 4HKXB 2YR3A 3CSYA 2DQHL 5HHVH 2X4UA 1BGXL 1BD2A 4M7ZB 4U7KA 2R23A 4YHYB 1A6VL 1D6VH 4WGWB 4X5LA 3CFBA 1FFNA 4JN1L 3ROLB 3D87B 4WO4B 1ZT4B 3P9MB 5DD5L 4LCWB 1YEIH 1AHWB 2SEBA 1EMTH 3QIBC 5L2KE 4FP8L 3BKJH 1A0QL 2EC9U 2NY3B 4G8IA 3TVMD 2BDNL 5EUKB 2IAMB 3OAUL 1YY9D 1QACA 1J86A 1NGYA 3QXAA 5F8QC 2X4PB 5D5MB 4Q0XH 1I8MA 5GISL 4JPKH 3UBXA 4P9HC 5BVPH 4PJCB 5KVFL 4MVBD 1YJDC 4Y1AA 2VC2L 1WBZA 2UZIH 3B9DA 1RVFH 1EZVY 5D9SA 2X4RB 3BIKB 2R2EB 5F3HB 5KSAA 3HZMB 5HDLA 1OD7A 4AM0A 3OSKA 3SDCB 4QNPE 4UQ3A 3WFCH 5LGHL 1QEWA 3VXNB 4OZHB 4H5SA 3W5MA 4YHNB 1BBJA 1MF2H 5F96H 3ESUF 5AZ2L 1VADA 2Z91B 3QIUB 2NY3D 5F6HI 5IW1B 4PP2A 4U1JA 2RFXA 3RZWA 1VDGA 4G8GA 3QIWB 1MJ8H 5B4MD 4JFEE 2DTMH 4TTDD 1FL3A 3DVGA 4DK3A 4YQXH 1CGXA 4FQHA 4TOYH 4L4TA 1PZUB 5D5MF 4AMKH 3VXRD 3D25B 5GGRY 5CIPA 3T8XB 3V6ZB 1KN4L 4PJCF 4NN7B 3UPRA 3W0WA 4PP1D 1RK0B 1A02N 3MNVB 1OW0C 5TE6L 1WAAF 1J0KA 3CFKB 5C70A 5I1JL 4ZUVA 5IJVA 3U9PH 5C9KA 2UWEA 5B39G 4KI5D 5BS0D 5JORA 5T5NF 4OZHF 2VXQH 3DGGA 5EBMB 1JP5A 4JKKA 1JF6A 3RKPA 5MHSD 2E6PA 4ZUSA 2YXMA 1YC8A 4KAQH 4D0CB 4FQXA 3QFJA 3QCTH 3QQ3A 3HE7A 1A7NH 5TDOA 1OW0A 4XWOC 3MRIA 3IDMB 5DYOA 4RX4A 2DLFL 4HUUB 3U2SA 1OAYH 3MR9B 4DVBB 4F58L 5CILL 2X40A 1AJ7H 2Z8VC 4XNXH 3KPLB 2BRQA 1F11A 4FQCH 3IAQA 5F44A 4QRSA 5LCVH 3GSOA 4BQ8A 4S10A 4F9PA 3C5JB 4NQXB 1NMCC 1RZFL 2YWZA 1HSAA 3O6KL 3IXTA 4AQOA 1IGTB 1BFVL 1KCVL 2XPGA 5FM4A 2NLJB 4UINL 4AIXA 2IH1A 1ND0B 1DLHA 4ZXBC 1WBYB 5KANG 1FCCA 3HC4L 4Z7WE 5SWZB 3KLHC 3RA7L 5DWUL 3LKPA 4GRLD 4L8SB 3UJIH 5IB4A 1FO0A 2EDFA 4ZTPH 4O2CA 4MAYD 3BO8A 3K7UA 4QCIB 3EYFA 1SJXA 3VD5A 2R8SL 3LKOA 3BZ4A 3HPJA 3VD7A 3BW9A 4QTHA 3T77B 2HT3C 2NW3A 3OKYA 3D85D 1S9VB 2IH3B 1JZ8A 1T0MA 3RTQC 4XZUA 1U9KA 3QT2A 2HFGH 3LQAC 1IAMA 2DI7A 2F53A 2FCBA 3V7AG 1U41A 4MHHI 1JBJA 3M17B 1XF4A 1QP1A 5IVNA 4ENED 5EOQH 5I9QB 4NQEA 5ID0A 3EYOB 2HTLC 4LL9A 1FFPB 3CLEL 3QHFL 3HZVA 4X7SH 3BJ91 4MGXA 4AEIH 4NWTL 3HMXA 1NGWA 4A6YL 1QNZL 6FABH 1XT5A 3QUYB 5CWSA 1ZEAH 2D7OA 4FHBD 1KJ3L 4ALAH 2ZUUA 4P5TC 1EO7A 4L29A 1QSZA 1YYML 3CGTA 1OAQL 1SVZA 2HRPL 2FD6H 3QO1B 4OCRH 1LO5B 4JFFD 1Q9OB 1YNTA 3IF1B 3C08H 4U1IB 4HIJA 5L0QB 5GJSL 1Y18B 1CIDA 4O4YH 4WHDA 2D03H 4R9HA 5D8JH 4XPTH 5FGSA 4F9LC 1IM3B 1J11A 1SY6H 4MDJA 4PRDB 4QYOB 5F9WC 1WC7A 4X9FA 3ARUA 4P5TA 3QI9C 3D39D 1U8MA 1ZANH 5ICXA 5F9DC 3V4UH 1HINL 3L5XL 1EH9A 3GMNB 1K6QL 2P5EB 3IFOB 3TNMA 4HH9A 1CGYA 2JJSC 4LIQE 3UTTE 5JW5B 3GSWB 3QUZA 1J1OL 1C16B 3VFWA 2DMKA 5HDOA 3VFTA 2XZQH 1S78C 3DETC 5I6XB 1RZFH 2NQCA 2ID5A 3O6KH 4KJYB 4C4KO 5AWNH 2X1QA 1DN0A 4F9LA 5E8DL 3MTRA 1T04A 2XRAH 3LMJL 3VE0B 3OKDA 1FYTB 3CX5K 2XG5A 1BJ1H 2ZOLA 2Z92A 5E94A 4OIAA 5DWUH 1PY9A 3E8UL 1A3LH 3GMOB 3Q5YA 4LCIH 2R15A 4LU5H 5IFHL 4LSVH 4K2UL 1CGVA 5GS1B 3GUTA 4CDGC 1P6FA 5CHNB 2VITA 1KXQE 3ZDXF 1I3VA 4JDTL 1IRAY 2YD3A 4CU6A 1F58H 3C87A 4JVPA 1I3UA 4RISH 1E6OL 3GSUA 3WS6A 4FFZH 8CGTA 1BECA 4YHPA 3E6HA 4JRXE 4JY4A 3GIVB 4P2OC 3DX8B 3L5HA 3BQUD 3ZE0F 4LLWB 1IGJB 1IKFH 4QHMB 3FQRA 1UB5B 1E28A 1Q94B 1AXSB 1I7UA 3Q6FA 3MREB 2BC4A 5F70A 4ONHB 4RA3A 3CC5B 1YMMA 5CUSL 2FZ3A 5TDNB 3KXFE 3OR7B 1MFDL 2YD8A 5EA0L 5FCUH 3O3UN 5AZEL 1PQZB 5BJTB 1KPUB 3T09A 5L8LB 1XIWB 1QRKA 4GRMA 4PJ8C 4RZCA 2IFFH 4KK5D 4P2OA 1OAQH 1J9CT 3G9VA 5DMYA 3TJEL 1GZPA 3SGKC 1B0RA 1KOAA 5HHME 4WNQB 4RGNC 1DL7H 5DRXA 2B20A 4EQ3A 5JA9A 1YQVL 3Q5OA 5K33A 4V1DA 4NT6A 5D1XC 3WHXA 2EDJA 3D2UD 3BRDA 3SE8H 4CBPA 3FFDA 4X4ZA 3OKEA 3NFSH 2RIKA 5TGBA 1CFVH 2CIKA 4C56D 4LAJH 5ESQB 5F6IB 3ETBF 4JFPB 3MJ9H 4Y16D 5EU7C 5CJXC 2VN4A 4BA8A 1R5IA 2FSEB 4XCNA 1F4WH 2DQIH 2RQ8A 15C8L 1KC5H 1W8OA 3QH3B 2CLVA 1IEBB 5D1XA 4YHOL 4HS8H 4NO2B 1FNSL 4UILH 2CRZA 2H8PA 2DIJA 1FSKC 1N59A 1QSFD 1HH9A 4Q9BA 1M6OB 2V7HB 1H0DA 4R96A 4OBRA 4Y89A 3MROB 1WFNA 4WJ5A 3MV9E 5HYIA 5DUMH 2CK0L 5CJXA 2MPAH 4GBXA 3LKNA 4MLIA 3VFPA 3PWVA 1E6OH 4JFDD 5FA4A 5E2JA 3ARTA 4NRZB 4YK4B 4E41B 1ADQH 4HIXH 3V4VL 2YXFA 3BX7C 2A6DB 1LDSA 5LWYH 4GT7A 4WUUE 4YBQC 4ZOEA 4XP1L 1C7TA 5I1CL 2EDEA 4X4XA 1G7MA 1RSFA 3HUJE 1TCMA 1U93B 5IBUG 2N4IA 2ZCLH 3WSQL 1K4DB 3VFVB 1IEAB 4H88H 4ELMF 3VWKD 3TYGL 2P48B 3K2UL 3U82B 2HLAA 4HULB 4GW4B 2ZSVA 1XF2A 1JPTL 1B2WH 3G5XB 5EULV 1EJOH 3D18A 1LDPH 2NR6D 3LDBC 3VWJA 4JZJC 2J4WL 2YA1A 4KRPB 5HVFB 1KLUA 2DB8A 3O3DA 1I85C 5E2WH 5HD8C 4IRJC 3ZKMD 3CFCH 5MENA 1NUFA 1YQVH 4M1GL 1OTUD 3MBED 3O81A 5JO5A 2O5YL 3DURA 2A6KB 1S7UA 4P5KB 1HHHB 3UDWC 2AEIT 5IHZB 4XC1L 2EYSB 4Y4FC 5B38B 4L8DA 3KPMB 2NY1D 2VZTA 5JQ6L 3DBXA 1ZHBB 1HKLL 1SEBA 3EKCA 3MRRA 4M61A 1A4KA 5I1HL 1INDH 4NHCL 4RRPA 1BOGA 5EU4B 1VACB 1N0XH 4M5ZL 1CXHA 4KQ4L 1YC7A 3GB7A 4PRIA 3UYPA 3UDWA 2AEQH 4EBQL 4Y4FA 4RGMC 1JPSH 2HA1A 3ILPA 1UA6H 3ZDZF 5IEKA 4HIEB 3EO0A 2W38A 5JW4N 2LU7A 4PRPB 2FL5A 5KANI 3KYNB 3FO9A 2BOBA 4E5XB 5KJRH 4M3JA 3O3EB 3QEGH 5JPMA 4K71C 4QHUA 3L9RA 5GGTH 1GCFA 1OT2A 5F7MC 1CLCA 3QDJB 4OZIE 1E4JA 5MEQA 3BZEA 1GZQA 4GAJH 1KCSL 3T2OA 5C71A 5J9PB 1H5BB 4FTVB 2IADA 4QGTA 4UIKL 2AEPL 3X14A 5JW4Q 2AXGA 1NL0H 4X9IA 5I19H 1Z9OA 3X3FL 2YZ8A 3OJ2C 5EORH 2IPKA 3TFKC 2GEEA 4HUMB 1LE5A 3K2UH 5IB2B 3VH8B 4OGXH 2NNAA 2QSTA 2DDQH 1NPUA 2I60L 3IFLL 3RPIB 2J4WH 1HXMA 4EDWL 1T80A 5GS3A 3LHPL 3BP6B 1DQDH 2V17L 2E27L 3OR6A 3TNNB 1OSZA 1PG7L 1BM3H 5ERWA 3KG5A 4KY1L 2R56H 3P4OB 3U0TA 4QTIH 2FLBT 3IJHA 4JO1H 1MI5B 4ZNEE 3QHZL 4KDTC 1MCPL 3BEVB 5FYJH 2JJTC 3MLZL 3WN5A 1PFCA 2ESVA 2FYYB 3PL6D 4ELKB 3MOAL 5GZOC 3WFZA 3EO1A 1N2RA 3NCYS 5T3XH 3QQ9D 3TBTA 5DMGC 4XGZA 4IHOA 2R0WH 3IDYB 4AK1A 1TDQA 1I1AD 1KG0A 5ID1B 1TPXB 3PWLA 5HGAA 1RD6A 5HI3D 3BESR 1D5BB 4Z6AT 1WBXA 2IBZY 3QUKB 4OIIL 1JV5B 5DJ6B 1EVUA 2WNGA 5LVEA 5JXEA 3KPOA 4X6DA 4X9GA 1X9QA 2CDEB 3FT2B 4GAGH 1KB5B 3OZ9L 4F2MA 2LE9A 2W65B 3AM8C 4LEXH 3QUXB 1A7QH 3NFNB 4TVPD 4HC1H 1HQ4B 2UZYB 3KVQA 3IGAB 1TZIB 1U58A 3LD8C 5I18L 3RWCB 1U8JB 2BNQE 3GJFK 2V7NB 1L0QA 5FB8B 4E42B 1YEKH 5GGUA 1IC7L 5ILTL 3DXAE 3TVMC 4UIMB 5JW4M 3TBYA 1KXTB 3AM8A 1T21A 1YY9C 2OL3B 5C0ND 5I1AA 5IVXA 3HG1D 1UVQB 3X3FH 1P5VA 2DQGL 1CLYL 3FFCD 3WKNA 4OFPA 1AO7E 3A6BH 3WL9B 4MVBC 4AIZA 4GFTB 4Z7VE 5DGQA 1NFKA 4I18C 3LEYH 5IBLD 1QPXA 3ME0A 4M7ZC 4YHYC 3C2AH 2ARJQ 3TVMA 4H1LB 5L6YH 1F3DJ 4M93B 4CN6A 5CJOH 4NN5B 5I8OL 5J6HB 1F13A 1HHKA 4KY1H 4YC2B 5IESL 4KU1A 1D7FA 2E7BA 4KKBC 5DJZB 1EAJA 1SYSB 1AHWC 2B4CC 2JJWA 3QWOA 4JM4L 2XZCH 4Z7UB 2W0LA 3HR5A 2NY3C 2Y4SA 3QNZB 1A8JH 2OLDA 4UBDC 3M1BB 4G7YH 3IRZA 5DRWB 2VDRH 1V3LA 3FL7A 3WKMH 3MXWL 3WE6A 2XTJB 1WCBB 4TTDC 1GH7A 4JG1H 4UTBH 5KVDL 4ZO7A 5KAQF 1H3UA 4P48A 4HFWB 4BQ6A 3MJ8B 2P8PA 5JR1H 2FDBP 1CFSA 3KHOA 5INCA 4HUVB 5E2TL 3WD5L 4OIIH 5F7DB 2O26U 3ZKND 3CUPB 1AHWA 4RCAA 3W9EB 3PNWB 5GSVB 1KTKE 4QXUL 2FHBA 4O02H 4AL8L 5INDA 2FB4H 1KJ2L 3SDCC 2GJ6B 2PCPA 4LPTA 4KI5C 4N0FB 2XZAL 1LEGA 3FO0H 4J4PC 1R3KB 3H7BB 3W5NA 5D71L 3O45B 4FQQB 3QIUC 4P2QE 3RI5F 5DHVH 3VXRA 3UCRA 5DJYB 1B0GB 1HEZB 2FEDC 2W9LA 4LCUB 3UTQB 3PWJB 1RHHA 3QIWC 2R2EA 5F3HA 5HHOE 5CEXA 3IU3A 3PDOB 5J0BA 3C5ZD 4HJJH 1S7SB 1NMBL 3GMLB 4MAUL 3AMLA 3I2CH 5BS0A 1FIGL 5C0CD 1QQDA 4NN7C 5TQ2L 3BE1H 1MHEA 1N26A 4Z0XA 2R0KL 3FQXA 2Q76A 5GHWL 5IW1A 2ADFH 1R5VB 3QQ4A 4OD1H 1JVKA 4AZ8A 4ETQB 1OAXL 5IOPB 2WZPD 5E56A 4JB9L 3MA7A 4QXTB 5CINL 1FZOB 1XR8A 5E24E 2ZJSH 1JTPA 1MFCH 4LLUB 3V6ZA 3VXSD 2Z8RA 5I8OH 5JXAH 2F15A 5EBWB 2Z35A 4LVOB 2X5PA 4NNPH 1RZIB 4I8DA 3QO0B 4XBGB 5K9OA 1JGVL 3P9LA 3R0NA 4UQ2A 3D48R 5IF0B 4HCRA 3TO4D 3MXWH 1UM4L 2DQUH 3IVKB 4O2FB 5I16A 2FX9L 4O5LL 2AQ3A 2CMRH 2HTKD 3WFEH 4F33A 1C12B 4KJPC 4D9QD 1INQB 4MAYA 1WZ1H 3I6GA 4NNXB 3RKDD 5GSRB 5D2NE 1CE6B 5I2IB 5L2JB 4PJXB 1WSST 4AL8H 3D85A 3TESA 4OCXL 5K93A 4OF8A 1G6RA 3MFFA 4WFGD 2ED8A 3ULUH 3QEQB 4XP5L 3QDHA 2XWJB 2ARJB 3BD3A 4JFOA 5FYKE 5F7NC 1AGCB 1BJMA 1XEDA 3MRQB 4YBLB 5C0EB 3RY6C 3GNML 3L3JA 3ULVE 4ZFZB 4LKXB 1WT5A 1LO3H 3ARZA 3H7LA 4ZSOA 4YXKL 2EDKA 3DVIA 5IMLB 4DKFH 4XP4H 1ND0A 4X4ME 3O6LH 1EK3A 3MQIA 4LGSB 3MLUL 4MNHA 4MWFB 1H9VA 1MLCB 1UB6B 5I9QC 2OTWA 3MRLB 4R90L 1GC1H 4QCIA 1KEGH 1UJ3C 3MNZB 3GJEA 2WINA 1T7YA 2R0KH 2VNCA 3RY6A 4JFFA 1NCBH 1XCQA 1M71A 3OG6B 3QUYC 1TLKA 2GJZA 3LN4A 4W4NA 4PJXF 2GSGB 1KNOB 3CLFL 4EOWL 4D9LH 3GSNA 5E6ID 2Z93B 4XVTH 1H8OA 4QRUA 3C6SA 4LPCA 3EYOA 3WEXB 2VQ1B 2ZCHL 3K3QA 1HCVA 3D39A 5L0QC 4PJEB 3QEHB 1IGML 1UJ3A 4K7FA 5HSFA 2ED9A 3KDMB 2BY2A 4OM1L 5DRZA 4BFEA 2CLRA 4YBHA 3PWPB 1ETZB 3RNQB 1ULVA 5DVLA 5L7XH 5HHPA 3VDCA 4IRSD 4OB5L 3LEXB 2IANB 1QYGH 1WWCA 3T3PF 4HBQA 5DEZA 2A1WL 2CH8A 2F54D 4GUPB 2WUCL 2JK5B 4CNIA 2V5MA 3IF1A 1UEYA 4LLMA 5I6XC 3PGFL 2ZOKB 4Z7NE 3MZGB 2H1PH 3U46A 4PRDA 1TJHH 4GG6A 1TETH 5EOCH 3O6FB 3O3AB 2JB5L 1T5XA 4U1GB 4GQ9L 3R1GH 4NC1C 3IFOA 4MJIE 1HN1A 3KPQB 4JDVA 1GRWA 4N8VA 5EOTB 5GS1C 3Q3GB 2OK0L 4OBSA 3WXWH 2VH5H 3RVVC 1HH6A 4KK5C 3MCKA 2AJUH 3BAEH 3BQUA 1FE8L 2EC8A 3OB0H 1ES0A 4G8EB 3TT3L 5EPMA 3UTPD 4YXKH 4KJYA 4RAUB 4NSKB 1FFOA 1NLDL 1V3KA 3VRLE 3KWWB 3O9WD 4M4RA 1Z2KA 1GGIL 3ARFB 5AYUL 4M6ML 2VZSA 5EU5A 1V8HA 3MGTA 4G6JH 1ZOXA 5E9DD 4CKVX 5TPWH 4LLYB 3GMOA 4K3GA 3SE4A 3TO2B 4Y5VB 4XNUL 3VFGH 4KVCL 5J56B 2MQ3A 4NFDA 5CHNA 3HZYB 1KPVA 4LHUB 1KN2H 5KTEH 1JI2A 3DI2B 5DT1L 4Z7QE 3FOLB 4K3JH 1QRND 5ALCH 1NANH 3CLFH 1NGQL 4EOWH 1NC2B 3RDTD 3FCTA 1ZT7B 1REIA 1XIWC 32C2A 5IVZB 1U2CA 2LVEA 3T0ED 1R6VA 4WI5A 1OB1B 3GIVA 4HUXA 3BYYA 5FM5M 1FDLH 3D2UA 4P9HL 1AIFB 2WANA 4HZAA 5KOMC 4D3CL 1AXSA 1TVHA 4NYLB 3ARFD 3MUZ1 5IEHB 3CSPA 4X6CA 4C56A 1YEGL 4P3CL 5FEBA 4PJHB 2ATPB 3DX7B 4Y16A 4K94C 5IT2L 3OR7A 3F62A 1DSFL 4ZUWB 5AD0A 5T3ZE 5BJTA 3VDAA 1UYWH 3HLAB 3RWIA 2QR0B 2HKHL 2LTQB 4L9LA 5DA0B 3PG2A 1ZWIB 4OGYL 1QSFA 1A9EB 4RFEA 4L3ED 1NANI 3DUUA 4OLUH 3BD4A 3U4AA 3K4ZA 1MHPL 5JOPE 3QXWA 4BH8A 5JPNB 3MOBH 4XPGH 4NN6B 4PB9L 1MCHA 3NH7H 4JFDA 4FFVD 4YE4H 1FNHA 2X9YA 1J12A 3VWKC 4ZQKB 4LDOB 4HWBL 3BKCH 5LBSL 1T1ZA 5C0BB 4AEHH 1TCRA 5C0IA 3MNWA 4JFHD 3FQNA 4ONGL 2R1YB 1GGUA 1R24A 4Y2DB 1I7TB 5EBGA 4PJHF 2FSEA 2R4RL 2Q7YA 4M6NL 1JTOA 1KEMH 4YK4C 1ZXQA 1EFXB 3RVUC 4TRPL 1OTUC 1RHFA 4WV1A 4F57L 4GXVL 1UKQA 4IDJH 4KVCH 2CRYA 4DKAA 3VWKA 3CMOL 5C7XH 3GSVB 5FA3B 4KROD 2YUWA 1A7OL 5TQ0H 2PXYD 4LAQL 1FLTX 3DOSA 5L2KB 1YECL 3MRMB 3G5VB 3W2DH 1I8LA 2MKWA 4Y5XA 4DZ8B 2VAAA 4JY6A 4NJAL 4NRZA 1LILA 5E7BA 3VXMD 4LLVB 1NEUA 4E0RA 3N1FC 5IFJB 3MBEA 3HRZB 4WW1B 3TH2T 4FXGA 5JW3L 1WV7T 1A1NB 4BZ2H 1JYVA 3GHEH 4L9DA 1YJDH 2I9TB 4L4VE 2B2XL 1W0VA 2D4FA 3UYRL 2J8UA 3HAEA 2D7TL 3EGSB 1KB9K 3O6ML 3MLTA 1K4DA 3K1KC 4Z78A 1T4KB 3GI9L 1NAML 2IQAB 3UBXI 1XH3B 4EKXA 1IARB 2R2BA 5CIPH 1Q38A 2VXSL 5C9JA 4FA8A 1H15A 3UTSD 3MUHL 3PJSB 5D6DA 1PAMA 4G5ZH 4HS6A 3SDAB 3WNPA 3KNBB 5FOBB 3RWGB 5HDQH 2YKLH 3L3KB 2VLRD 1MHPH 5C3TA 2YSSB 4JFEB 3LPWA 2OJZH 2QBWA 1FL5B 3B8YA 3MGOA 1VEMA 4PB9H 1MPAL 3PWNB 2A6KA 4U2ZA 5IHLB 1U0QA 1EGJA 1SBSL 1E4WH 1RIUH 1DQML 4HWBH 1GIGH 1OF2A 4FABH 4KZEH 3QNXA 1OM3L 5C0JB 1CICD 4LSQH 2VLKE 5I1GH 2FWOA 3MRJA 3FT3B 4ZFGH 2QSVA 4P2RE 4ODVL 2P8LA 4HV8B 2R69H 2ZP0T 2VZ3A 1JHTB 1VACA 3BDYL 4QNPF 5I66A 1OHQA 3U6RB 5IUSA 3ULSB 4RDQF 3RY4A 3D9AL 4QT5A 4BKLB 1H5BC 4P46D 3C60B 2CR6A 35C8L 5EO1B 4JM2D 3T0BA 4R26H 5GGRA 3C09B 4NKQB 1NUGA 3WNOA 1DE4A 2JLLA 2YEZB 3MA9L 1SQ2N 3KR3L 2F19H 1GGCL 3EFFA 3QQ9C 3W39A 3QG7L 4AYFA 1I1AC 4M43H 2BVYA 2DBLH 5DDHB 4JFQB 4ZNCD 4X8XA 1BVZA 2C3HA 5HYQB 4JHAH 5HI3C 1FO0H 5LXGH 4K23L 2JIXB 5IMKA 1RURH 4OZ4B 4RMRA 1S5IL 1BZ9B 5EWIH 3RZCB 4OCNC 1VFBB 4QRQB 1BVKA 4FTVA 5MEOA 4X7TA 4PJDA 4OD3H 4RMSA 4NGHL 3PL6A 1CS6A 3UTZB 3SO3B 3VGAB 1Q0YL 3O0RH 5D1ZD 1FG2B 4WEUD 1JJUA 2X89D 2D7TH 4NQCE 5T1KD 3ARPA 1A5FL 1I1AA 3FN3A 2R0LH 3WLBA 5KS9A 4YHZH 1RMFH 4NQSB 4Z7WB 1A6UH 4CU7A 3TN0B 3SJVD 5IB2A 3HKFA 4NRXA 2HVKA 4P49A 4BUGA 4PGCA 5DR5L 5I1DB 1N64H 1IKNA 4NZRL 5D7LE 5F89A 4YDJB 4MJ5B 3HMXH 3IDYC 4J3XA 4R0LB 5ESVB 1TPXC 3O11B 1YNKL 3LQAH 3MACL 2BNRE 2ZG1A 2R4SL 1JN6B 1OAUL 2W0FB 1B4JL 4AH2A 2BRRH 3G5ZB 5HYJE 3P40A 4EXKA 3AS2A 4OQTA 1F2XK 1X5AA 2VLLB 4N8CL 1XF5A 1DQMH 3CFEA 1N5AA 5EIQA 1FFQA 5DMIL 1LNUB 3QUXC 3QWQB 5DJ2B 2H9GA 5IBLC 4F3FA 1GGBH 3D1MC 4ODVH 2VN7A 4H25B 2JELH 2VDLH 1QFHA 1MRDL 2WQ8A 3NIGE 4Z7WF 3QUKA 1N6QH 2X4NA 4M1CC 3HG1A 1G7JB 4BSVB 1KYOK 4XMKH 4A6YB 4CVXA 1EPFA 3OJDA 4RAVB 3AS0A 4OAWB 1J8KA 3FFCA 35C8H 4JR9L 1KB5A 2KZWA 4B5EA 1LEIB 2YD6A 2QQKH 4HWEH 3MUJA 2C3VB 4FG6D 3VMNA 4KZDH 3MRGB 1M7DB 3V7MA 5FDWA 4UT9L 5ALBL 5FFLA 1U8JA 4TSBH 4NJ9L 3DVNB 4RMWA 4XCCH 4QRPD 3RX8A 3S37H 3ZKNC 4KHXL 1J7VR 1S5IH 1UXSB 2VZVA 4UDUA 3UTTB 3V5KA 4XCFL 1TVBA 1X7QB 2HJLB 4LLQA 4M93C 4PJIA 4NN5C 4YGAB 2BY1A 2B0SL 1JGEB 3LKSA 2DWDA 2W9DH 5M95B 2Y5TB 2ZZUT 3ARGD 3FB6B 3WL9A 1OP9A 2F58L 5DQJB 1RJYA 3QBTB 3U7YH 5F88B 2Y36H 2XTJC 4PLOB 1T7XA 1UC6A 2J88H 4NM8L 3UZEA 1YN6B 4H1LA 1UZ8A 2Q3ZA 4KK6C 1HHIA 1GOGA 5J6HA 4BZYA 25C8L 3UROR 2D2OA 2OMBA 3O2DA 4JO4H 4JRXB 5E99H 3DWTA 4HBCH 4Z7UA 4BH7A 1FGNL 1EAPB 3B2UC 3K8MA 3QCUL 3KJ4C 5F7KC 2W60A 5A2KH 3SDXF 1ZVYA 4OGAD 4S1QL 2GUOA 1B90A 1D9KB 3DV4B 3C5ZA 1CU4L 2D9QB 3KXFB 4FXKB 1VB9A 5ITFB 2FJHB 5HHQB 2KPNA 4Y5YA 5ICZB 4HUVA 2BERA 5C0CA 3C8KA 4UDTA 1LWRA 3LQZB 1K5NB 3PNWA 4QOKD 3VXPB 1XGYL 2GHWB 3IFPB 3ARBD 2LQRA 3TYFB 2VYRE 1UQSB 3VGGA 1LHZA 4XVUD 3I3DA 4M00A 1P4IH 3P2TA 4CJ0A 3QDGE 3HC3H 5HHMB 2YPKA 5IG7B 3WIFB 4PGDB 4KRLB 4PJGE 4UT9H 1E6JL 1DBAH 2O5XH 3OGOE 1HEZA 3OAYH 3VXSA 5EC2A 2ITCB 4KFZC 3TBWB 3UTQA 2NTSP 1JIBA 2VL4A 1NC4B 1U8KA 3FQTA 3U0WH 1QBLH 4XNZB 1UCBL 3QA3A 4X4YA 1F02I 4XCFH 3CFIC 4NUJB 1AE6L 4F7EB 4DTGH 1J1PH 1YEEL 4O00A 4XP6L 2EH7L 3QDME 3TO4A 4H0HB 4DK6A 4YX2H 4M7KL 4HHAB 3E6FA 4ZAKD 3PQYD 1XGRA 4XCYB 4LVOC 2EE6A 1MFBH 4OLYH 5L9DL 1RZKC 3LH2L 5GRXG 3S5LA 3TH3T 4W6YB 3P0VL 2F58H 4X8JA 5D72H 4F15B 2J5LC 3S36H 4K8RL 5MERB 3MRHB 1KACB 3RWDA 5DEFB 5M7QA 3MV9B 4PRHD 4PGBA 4HGWA 5SWQB 4CW1B 3RY5A 2B1AH 3VXUB 2IFGA 3WDJA 4NZJA 3DO7B 2OTUA 3I02B 4NP4L 3OJVC 5IIEB 4CVWA 1S5HA 5JMRA 3HNSH 4JN2B 4XBGA 4RSVA 4IS6B 3T4YB 5CFHA 3X12A 1AKJD 1ZV5A 2P7TA 3CH1B 4FNLH 1JRHL 1KLGB 3S37X 5IF0A 1FRGL 5T5NG 4CRPA 1G7IB 2PTUA 2J3SA 4LSPH 4WUUB 1EHNA 3X17A 4LSSL 2AVGA 3HUJB 4M1DL 4YBLC 1F8TL 1I9IL 4M7LT 3GFUA 3VI3E 3B5HA 4NWUH 2VDOL 5C6PB 5BXFA 3HC0A 3K4DA 1SMOA 5F21B 4G42B 1HQRB 4JO3H 3MV9D 1NJ9B 2CKBA 1XGTA 5JA8B 1RJZA 5E8PA 1OARL 1YPZA 3VXUD 3IKCB 5JUEL 2XTLA 2ADJB 3UO1H 5F7FA 2XWJA 5T1LB 5JOEA 1Q9KA 5E6IA 3H9SE 5BV7H 4POZD 3L5IA 4JPVL 4N0CD 5C0EA 4PBVC 4IOFD 4LKXA 3RUGE 4W68A 4UT6L 3PWUB 1F5WA 2RCSH 2W9EL 3FRPG 4I5BB 3HNVH 1FVCA 3V0VA 1MHCA 3KYKH 5FYJE 2CK2A 3JV6B 4IRSA 1LK2B 4XNYH 3HUJF 5EC1B 1A9BB 2X09A 5T3XE 3FOMB 1FZJB 2ZWLT 3MNZA 4ZYKB 2F54A 4Y4KD 4MD0A 4WW2B 1FAIL 3EUUA 1J05A 3BH9B 2AERT 4HK0B 5F9OL 3LH2H 1ZLVH 3F7RA 2GKIA 4R4BB 1U8PB 1CG9A 2A9NH 1Q9LA 2DYPD 4NZUL 4F7PB 2H6PA 1ZVHA 4XPAH 4LMQE 3IDIB 2L0DA 4PJ7A 3BH8B 3ARWA 3L3GA 3WEXA 2VQ1A 1RFDL 3WLWC 4PJEA 1SM3L 4XVSH 1A21A 3INUH 3I85A 3LY6A 1KCUL 2R0ZH 5DO2D 4BM7A 4HDIB 4OZFB 3RNQA 4OZIB 1TJGH 2G60H 1ZAGA 2YA2A 1K2DB 5KG9B 5E8OA 3O9WA 1FRGH 2FIRT 1R3HB 2A9MH 1PZ5B 3RDTC 5HGHA 4YZFE 1CGSL 4MLSA 3MV8D 4TNVF 3T0EC 5E9DA 1NGZB 5D7JB 3IJYA 4WW2F 5C0AE 1I9IH 1T2QH 4PS4H 2XKNA 1XGQA 5GGQL 1BIHA 3DSFH 5DD6A 3R06B 4P59L 3ARFC