1C5CH

Decarboxylase catalytic antibody 21d8-hapten complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
b'QVQLLEPGTELVKPGASVKLSCRASGYSFTSYWMHWVKQRPGQGLEWIGLIDPSNGRTNFNDKFKSRATLTVDTSSSTAYMQLSSLTSEDSAVYYCVRIAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHIMERIC DECARBOXYLASE ANTIBODY 21D8
publication title Catalysis of decarboxylation by a preorganized heterogeneous microenvironment: crystal structures of abzyme 21D8.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 41
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1999-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5cH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5cH02
1B6UA 3QUMH 5L2JB 1RK0A 1U3HA 2PCPA 5C3TA 4OZ4A 1U8JA 1LD9A 2VOTA 3WXVH 3D87B 3P9MB 3V5KB 5C08E 3VFUB 1A3LH 1N8ZB 3FQUA 3ZKQD 5HDLA 5AUMA 4JR9H 1U2HA 3MLWL 3O2VL 4UBDC 5T33H 4JZNA 3GSOB 4KKLD 5J57B 2A9NH 3QFDB 5IUSA 3DARA 4E41D 5CGYD 3W2DH 4DUVA 5J1TC 2V2WB 2Q87A 2X4OA 1CI5A 2CJUH 3VWJC 4NQCE 2GUOB 4PRIE 1T03H 1QYGL 4S0TD 3TCXA 4E41A 4HH9B 5MI0C 1ORQA 3WSQL 3VFGH 3MOQA 2AJYL 1G7IA 1G6VK 4WIQA 1GGUA 1KTRL 4JKWA 1E6JL 3PWJB 3PWPD 5HGBB 4XPTL 3P73A 4YO0A 2XNAA 1OSZA 1H0DB 3ZKSD 3TO4C 1HILB 4E0RB 2X4RB 3EGSB 3OXSB 1FGNL 2ZSWB 5IM7B 3ULVH 3ILPB 4QOKD 2NY5L 1R3KB 3PWPA 2EH7H 5CP3H 5ILTL 1MFDH 4M5ZH 3O0RH 4MA1C 1C1EL 5MENE 3PGCA 3ME0A 2NY0B 4APQD 3LKQA 1CXHA 1DBBL 4QOKA 1G9NH 4NHCL 3S36L 1KJ2L 3S37L 2CDFB 3QUMB 4UT6H 9CGTA 2EIBA 1RJCA 1LP9F 4CAGA 2NLJA 3OPZH 3GK8H 3QRFM 5ANME 5DJDB 4RDQF 2EH8L 4GUPA 1N6VA 3RHWF 3U4AA 3TPUB 2YPLD 4FABH 3O45A 4OGYL 3ES6B 1FYHB 1PY9A 3GKWH 4MB3A 4RMTA 5TQ0L 4HBQA 4RWYH 2EEAA 4IIQB 1FNLA 4OTXH 4U6VL 2C1PA 5FM5O 3VXMD 2Y9RT 4JPVL 5D7IB 2RAMA 4AENA 3LQZA 2YPLA 2NY7H 3LEYH 4TQEH 4F3FB 3NFNA 2VITA 1S7VA 4MMZC 5LBSL 1JN6B 1UQSB 1I3RB 4X99A 2V5MA 5FGSA 1QRND 4BZ2H 3VXMA 4IHOA 4PRBA 1KJVB 3BP5A 4LCYB 3UO1H 4IEFB 5DSCA 3MXVL 1OWRM 4LRIC 4TSAL 1WWCA 3NVQA 1IGJB 2OTWA 3IXTB 5EZJA 1MVFA 1QRNA 1EERB 5GSVB 1A9EA 4TVPL 1FORL 1GPOH 4XVJL 3ZT6A 3PNWB 2XXMB 4QXTB 1I7ZB 5T3ZH 1NBQA 3O3AA 4UQ3B 5BVJA 4GBXB 3GSNH 4JO2L 3A6CL 5H94B 4I18A 2YEZB 4CL7A 1JWSB 1CFNB 5DC0A 4ZXBC 4S1QH 3RWDA 1M6OB 1GRWA 3NBNA 1EEUA 3NPSC 1C08B 1D5XB 3I85A 4PJ5D 4YHIB 3PABB 5C1MB 3HC3L 1L6XA 4DKDC 1S7RA 4NJAL 1T5XA 2PETA 3LB6D 3S35X 4Y5VB 5F9WB 3NZHH 5GRXG 1ZLUH 4RMUA 4PJ5A 1KIQB 3DSFH 3KYAA 4O2EA 1Y0LB 3QXAA 5C0CE 4WU5A 3BYYA 3O2DL 1UH2A 1NMBH 3IFLL 4M61B 4FZ8L 3FQTA 2QR0B 2Y07H 1N2RB 5EZLB 3GMOA 3WNNA 3HZKA 2E9WA 1EAPA 1JNLH 1WWAX 4M1GL 5GGTH 4YUEL 3NAAL 1NAML 5IB5B 2VDMH 2LABA 4WI8A 3LN4B 4I8DA 5A43C 3OR6B 4XAKD 1MJ8L 5IQ9A 2VLJB 1IGCH 3IDYC 4DW2L 2YD5A 2QL1A 4PR5B 3X3GH 4M7JL 2IPUK 4NN6C 1CLZH 1EJOH 3W0WB 5IEHA 2P42B 3UJTL 1UM5L 1CLYL 2DYPD 1OAXH 2BNRB 2VXSH 3V6OC 5SX5H 1LILA 1GC1L 1H3XA 2CLVA 4LSSH 4MVBC 2FX7L 4ODVH 2QQNL 3TIDA 3I6GB 3GSNB 2DYPA 1JCKA 4MNGE 1ZA6A 3LD8B 1K2DA 1IM3B 2W92A 3A6BL 3FFDB 1WWWX 1TJGH 1K6QL 5AYUH 1INQB 3TYGH 2HFGL 5IB3A 3QO0A 4A2LA 1WEJH 1F42A 5CCKH 1A3QA 2FO4B 5HYSB 5DZNA 4EZMA 2FRGP 3U83A 2CIIB 2JKXA 4Z7UA 4P23C 3MRQB 5L6YH 5BZWB 2EDYA 3GMPA 4NOFA 2P24B 4L3AA 2YKLH 4XPHH 4RGNC 4H26B 3KXFD 3LZFH 1YEKH 4HPOL 4EN3C 3VRJA 4R2GB 1QTYT 3R06A 4FFWC 3MACH 4KMLB 4U1IB 1N5YH 4Z7WB 3BVNB 5DQDH 1U8KA 5BS0E 3CSBA 4QXGH 1BOYA 4HIEA 3P77A 4HULB 1QBML 1H3WM 4G43B 1MCPH 3HE7B 4XMKH 5I1CL 1YPZB 4ZO6A 3QPXH 3D3VD 3QIUB 4KQ3L 5T1DH 4YHYC 4AEFA 1IT9H 1E27A 3FTGA 5DUML 1X6NA 2IALB 1U41A 2BRRL 1VACB 2H41A 3D3VA 3MRIB 3P0GB 3SDXA 2J8UF 4LIQL 3MR9B 1CXEA 4J3WA 3OQ3B 2PYED 4KH2A 1FFNB 2APXA 1WK0A 5EU5B 2VKWA 1IGFL 1DBML 3BE1H 1F97A 5IW6A 3VFMA 4LCIL 5JW4M 4KTDL 4NZJA 1IQDB 4G8IB 1BOGB 4PJ9A 5EU3B 1XFPA 3WIIL 4OZIF 2PYEA 2R8SH 3O4LA 4F15C 3NIFE 2V5SA 5ICXA 4WGVB 1QLEH 3N0PB 5ADOL 1RK1A 5FOJA 4E9LA 1OF2B 2A1WH 2WWMD 3ELAT 5C0FA 1S7XA 2NY1C 3CMGA 1T0MA 4LPTA 4I0KA 2BDNL 3C8KA 1S7WA 4OQTH 4HC1H 5L8KB 2VR9A 3MV7E 4L4TB 5DLML 1IL1A 4ZFGL 4DVRH 1H3UA 3RVXD 2J88L 5IB4B 5KZCB 3N85L 1FVDB 3CMOH 4UAOB 4LARH 1S9KC 3QNYA 5HHOD 1JRHL 5EFIA 1U8OB 1F4HA 3HE6D 1DLFH 4X4XB 3MUJA 3U79A 3G6AB 2VQ1B 4JO4L 5F7KC 2F53B 2AEWA 5DEFB 1PG7L 4PJAE 5AAMA 1G6RH 2H2PC 3MLRL 1DP0A 5HHOA 3BPNC 3SDDB 2P5WE 5D5MB 5CJOH 2YMXL 4G7VL 3ZKXC 4MDIB 3BGFB 1P7KB 5TQ2L 3MRKB 3GSRB 5CD5C 1LO5A 1JF1B 3V5DA 3FKUS 5IVZB 4JFFD 4FQLH 4JDTL 3W5MA 2YUVA 4LIQE 1I1FB 1TZIA 1BX2B 2IPKB 4P2QB 3MBEC 4OUOA 3D0LB 4ELMF 5L88L 4NO5A 2A9MH 3BUTA 3TGXA 3DV6B 4ZSOE 3L3KB 4QRSB 5AWNH 2DDQH 3LSOB 1DE4B 5E08H 1LNUA 5DO2D 4G3YL 4MSWB 5SWZA 4QHNB 1NBVH 2SEBB 2NY2C 4DZBA 4UB0L 1ONQB 2E7LA 3QUXD 1IAII 2FWOA 4GS7C 1Z9LA 2PO6B 4YHPB 1WAAA 3ALPA 2I9LA 4OBRA 4KDTA 4XCNA 3QUXA 3AY4C 5IIEB 2IGFH 25C8H 3KNBA 1KELH 4HH8A 5HYQA 2P4AB 1FVCA 1KEGL 3UYPA 2NXYB 2YZ8A 5KG9A 1OT1A 3IAQA 3QDAA 1T89A 3SGDH 4NOBA 1JWUA 3TN0D 4LDOB 2QQLL 5CWSA 3DI3B 4WV1B 5J13B 1ZWIA 3HZVA 3ZE1E 1FH5H 2W0FA 3ZDXF 3Q5TA 4O9HH 4F33B 2PXYC 7FABL 3M17A 2ZPKH 4EJ1C 2IFFL 3TN0A 3NMEA 1G6RB 3GMRA 1JWMB 4GAYB 3DIFA 3W11D 2XA3A 4GAGH 2Z8WC 2UZXB 3L7EB 1MCWW 4GQ9H 4JFDB 4KMTH 3M45A 2BVQB 1I9RH 3FMGH 2DMKA 5E2VH 5HI3D 3QZWB 2PTTA 1JGDA 4EIZC 4GH7B 3HTLX 4K9EC 5MERB 1WFOA 5D96B 3PL6C 1QR1A 2YD8A 1NFDF 4JZOA 4HJJH 1JK8A 1S7TB 4DUWA 4ZUUB 5C08D 5F7EH 1KC5H 4HAFA 3AUVA 3FO9A 2AV7A 5E6IB 5LXGH 1I7TA 1NUGA 4JFEB 1TFHA 2FYYB 4XVUD 2RQ8A 3MRNB 4I2XE 2FATH 2EIZB 5F88A 4FXKA 4Z6AT 1YC8A 1R0AH 1IQWL 5C08A 2B4CC 3MGTB 4U1JB 3EDDA 3MOBL 4ORZC 3GJFA 1LO0L 3MV8E 3CC5B 3WKNA 2FHFA 2A6KA 4NQDB 5F6HJ 3EKCA 4KKLC 5FOBB 4PJDE 3WJLA 3KPLA 3V7AG 4TNVK 5E9DE 5JXAL 4PRID 3RI5F 3G6DH 5HHNA 2A83A 3UC0L 3WE6B 5CGYC 1RZ8B 2GY7B 5IMKA 1JTTA 4HAGA 2ED7A 4PRIA 1T22A 5I15L 4ODBD 2A2QT 3MFGB 5JXEA 5T1KB 5J6HB 1A7QL 3O6FB 2GJJA 1MCJA 2EE9A 3LKOA 5GS2D 1RUKL 4I77H 1MQKL 3LKSA 4M3JA 1K8IB 2ED8A 3LV3B 4XTRD 4X5LA 4JREB 5C9JA 5MEND 1NMAH 4G5ZH 1JPGB 4DFIA 5HYSG 4HX1B 1AQKL 4KAQH 3WIHH 5IFHL 4PJGA 4BH7B 5MENA 3PP3K 4APQC 2HJFA 1VFAA 1RUAL 3LN5B 5I1GH 4JG0H 2HT2C 2L7UA 2VE6A 3PJSB 4X8JA 1YY8A 2X9XA 3Q1SH 3IKCA 1CLOL 3G5VB 2C4FT 3OWEA 4Y1AB 4K07A 2C3XA 2Q3AA 4TNWK 2D0FA 3FB6B 43C9B 3OSKA 3V2AR 1GHFH 3R1GH 1A7PH 4NRYA 4PRHE 5L7XL 4MCYB 1L0YA 2DJSA 2A74A 3GB7A 3PDDA 3G6JF 4Z5RA 5IP4A 3RL2A 3IFOA 4A6YH 3WXWL 3C5ZA 4PG9B 2XFXB 1EO5A 1SYSB 4LF3A 3ULSA 3QEGH 4HS6B 2GJ6E 4UU9B 5FUCC 5C0AE 5I18H 5F3BB 2AJ3A 4GAJL 5KSAD 1TVDA 3STZA 2HH0L 1LE9A 5E8PA 1DEEA 4OF8A 1LDSA 4NFDA 2EDHA 2EICA 2AXFA 3QIWA 3RBSA 1XF5A 4X6EB 5EBMA 3VXPB 1CT8B 4I18C 5J11B 3TA3B 3VFOB 1HQRB 1J7VR 4BM7A 3BJLA 3ROLB 2NW2B 1CN4A 5HYFA 3ARDD 2W9EL 1XGUA 3X11B 5I75B 3PV6B 4R26L 2XWJA 4OM1L 1OT2A 3L9RA 1TJHH 5L8JB 3DO7A 2EEDA 4GXUM 3ARDA 3H0TB 4J8RB 4MWFB 4YIQB 2AGJL 2DI9A 1EXUB 2A6DA 4H20H 4PJIB 3S96B 4N5EC 4OLUH 2DQIH 2EE3A 1KJ2A 3EDKA 3RL1A 1EGJH 2JCCE 4HKJB 2DBJA 4HKBB 5BRZB 3MV01 4P49A 1C12A 1FG9C 3LB6C 4WI7A 5DWUL 4NNPL 3SDCA 4L9DA 3TP4A 4JANA 4ONOA 3S35L 1QO3A 3HLAA 4XC1L 3C6LC 1UJ3A 5ADPL 3HPJA 2CR3A 5DJZB 4QXUL 4AQOA 2QADD 4OT1L 1UVQA 1QFOA 1LEIB 4N8VB 3G5YA 4QHMB 2GK0B 4HQQL 2OTUB 1YN7A 4A6YB 4MA3B 3DMMD 1UB5A 4GW1A 2RBLA 4WEUD 4OLZH 2E9BA 4HS3B 4N68A 4NQCB 1MNUL 1QYGH 4HK3J 4TVPD 3VU2A 3QUKB 3DMMA 1A6AB 5DS8B 2BVPB 1ZT1B 1QFHA 1FLRL 3AU1A 4TUJB 5C0EB 1EEZA 3WUWA 4GRWH 5DMKB 4I3RH 4NP4L 2E3VA 2Z9TA 3FZUD 4JJHA 3SGKC 3P9WB 3KLAA 5I1EL 2D03H 4F7EA 1XGPB 5F97E 4DOHB 1I4FB 3ZSTA 4MNGA 4LVNC 3CDGB 3OB0H 3BP6A 4YLQT 1O7SA 2F74B 2XA8L 2C5DC 4PD4J 3DUHA 1CVRA 2AV1A 1NEZB 4K94H 4NHCH 5I17A 4NQVB 4CADB 2IAND 2CK0L 2ZUVA 5GRJH 1HH6A 2JB5H 2EC9T 2X70A 1A2YA 5C6TH 4L5FL 1HOCA 5ANMB 1SJEA 3HR5B 3GHBL 2XPGA 3ZZ1A 4FFVC 1PJ9A 3T0WA 4JZJB 1KGCD 3O2DA 5D2NC 4LLDB 4C83B 1U95A 4RFNB 5I73B 3QO1A 3VCLB 1U2CA 1GSMA 3Q6GH 1IGMH 4GW5A 1GCFA 1CZ8L 5BS0D 1AHWB 1NUNB 1Y18A 3CFKA 1R24B 1TMCB 3RFZC 1RFDH 2VLRB 4JPVH 3O9WB 4UQ2A 3U4BH 4LLYA 1S78D 1NAMA 1XGYL 5C07D 3ZKMD 1MWAL 5LBSH 3ARBD 2YPVH 1RSFA 3QZWG 5BS0A 4U7KA 4IBLT 1GL4B 2D9CA 1NCNA 4P9HH 1QKZH 3H9ZA 4YR6B 5I76A 1J9CT 3P4MB 2C4FU 1SJHA 4PY8I 5E8NB 2YD6A 3IFPA 1JPFA 4GRWB 1OCWL 3IDMA 3IXAA 1CQKA 4NYLA 5DC9B 1VHPA 3NPZB 2NX5B 4B50A 5FM8A 3HI5H 3AS2A 1JTPA 2P45B 3MCLL 4M93B 3S98A 5K9QG 2AAVA 5IHUL 4ZYKA 1EVTC 1ZLVH 3MGOA 1EDQA 2W38A 5C0JA 2H1PL 4JHAH 1E4WH 3IJYA 4XP4L 3W9EB 4RAUB 1J0ZA 1MOEA 4PRDA 5DUBB 1MI5D 3ARYA 1JGVL 4MZ3A 3TT1L 1FRGL 4I3SH 4U1HB 4NO0D 1EEQA 2X89D 3NFSL 4JEGB 2WWMC 1T2XA 5DDHA 3EOAB 1EK3A 4V1DD 1QQDB 4ZTOL 5C0CB 3B83A 1PFCA 1SEBA 4FQ2L 1AH1A 3C5JA 3CX2A 4FZ8H 4NM8L 3MV7A 3T0ED 5CSGA 2X89A 3OGOE 2CRMA 1YY9D 5MEOA 1OOAA 3RVXC 2VDLL 4V1DA 2YOCA 4KVCL 3DRQA 1AGEB 1GJIA 5I8EA 1R3JB 5J3HD 3FT4A 3T0EA 3BH9A 3HE6C 4UNVA 5JHLL 1IGYA 3MQIA 1C7SA 1Z5LA 3TBYA 2QV2A 4RIRA 4OGZA 4MA8H 1ZLUK 1AP2A 2X9WA 2HJLB 5TDPB 1T1XA 1QBLL 4XNUH 4LASL 4H1LH 4KWUA 3DXAD 4LLVB 4MNQE 3AB0B 4JPWH 3DWTA 1YYMH 5HGDA 5FDWA 1MIEL 5CINH 1MEXH 1W72H 3TO4B 2FSEA 2QQNH 3FOMA 2JJWA 3DXAA 5FYKD 4PBXA 2X41A 3TH2T 3LPFA 1EHLL 5J8OA 2QHLA 4X4MA 2C1OA 4XMLL 2OSLB 2VSCA 4X98A 1AD9B 5CEYB 1UXWB 2VL4A 4MA1B 5DO2C 3SKMA 4XXDA 4LSUL 3BW9A 4Z7OE 2FIKA 1J1XL 4L29B 3QUXC 4R96B 3EOTL 3VRLE 3AAZA 3CZFA 4F2MA 4K23H 5SX5K 1L9MA 3PWNB 4WI2A 4HXAL 3S9DB 3MRGA 3TCLB 1UA6L 2MPAH 1NGZB 3L5WB 1XF3B 1YJDL 2BSSA 3RWHA 4OZHE 4IRJB 4OLYH 1X5FA 4G8GE 2FECL 1NSNL 2P44B 1OGTB 1YEDB 2HJKB 2IH3B 1A1OA 5SWSE 2R2EB 2CXGA 4MS8D 5I8OL 3KLDA 2NZIA 4PP2B 2AXGB 3NH7L 2Y06L 2BY0A 4XX1E 4HWZA 3VXOB 2MWCA 4L8BA 2BVTA 1E0OB 3GHEH 4H1LB 2OK0H 2ICES 4PB9H 3QWRD 4CVZB 1AJ7L 3G08B 2ADJB 2G5RA 5EN2A 5I1KH 1W72B 3DROB 5HI3C 2LTQC 4GLRH 3QWRA 4PRAA 3U1SH 1JNJA 1E4JA 1INDL 3OG6B 4A2MA 1RZJC 4YGAB 1HHGA 3FB8B 3P11L 4N8VG 4PG2C 1NGQH 3RNKA 3RWEB 3CFDA 2VDKL 4AYFA 2EZ0D 4MXWL 1MIML 1FAIL 4NC1C 1YUHA 3QDMD 1WCQA 3OKDB 4YFEA 1XF4A 5E9DA 5ID1B 4O2FA 5D6CB 3RA7L 5EIIA 2DWEA 1L7TL 3MRCA 3P9LB 3LRSB 2H32H 5C0BE 4PJFE 2A73A 2RCSH 1MELA 4MDJB 4KK5D 4L3CA 2Z93B 4XP9L 3VW3H 3SQOH 3T8XB 5L9DH 2YK1L 2YZ1A 3VXRE 4PJAB 3PDOA 1ZSDB 4NN6B 4DCQA 3KYNA 2P5WB 1NEZG 4BSJA 4XTRC 4ZUVB 2YMXH 2AI0L 4G7VH 5FO8B 4S2SB 1UKQA 3QUYD 1HIMH 5EWIH 1RJYB 3EBAA 4WFHE 1NC4D 1LWRA 3UTTD 1YNLL 5SX4I 5D2LA 4EDWL 4HMCA 4YFLI 3VFRA 4Z7VF 1U8MA 3QUYA 4RISH 4XRCA 1TDQA 4ZSOB 2NTFB 3T65A 1NC4A 2DQGL 3Q0HA 4OZGF 2F19H 3UTTA 5AZ2L 2R29H 5I8CB 2DQDL 1UH3A 4X5WB 5TGBA 2R0ZL 3ZYOA 2APWA 4M43L 5EBWA 4QHKI 3FO1A 4LPUA 1ETZB 2FL5A 4H8WL 1ZLSH 3DGGA 2AJXH 5EOCJ 5EUKB 5B3JF 1I8KA 5F89B 3OHXB 3ABZA 4OCSH 1JPSH 3SGEI 3LOWA 2Y6SD 3IDNA 4BA8A 3OKLB 1T7XA 1Q94B 2GJ6D 3IYLW 5C0AD 4NPYB 3VFWA 1VFBA 1I8MB 4RGNB 3KYOA 4Y8AA 2H3NB 2H32B 4EN3B 3F7YA 4X9IA 4FRWA 2GJ6A 2ZNWA 5C0AA 4PGDB 3JTSA 4LCWE 1YEJL 5KSAC 4HV8A 1W8OA 4XWGL 12E8L 3ILQD 3MFFB 1CFVL 4GW4B 2APTA 1X7QB 3KPOB 3DX9A 3QWOB 1AXTL 1EHXA 1WZ1H 2W07A 4YHYB 5HHXH 3QUZD 5HVGB 2FB4H 3ARDC 3T4YA 4QRRB 4P9ML 3UBXB 3BO8A 4XPBL 1QFWM 2DL9A 4MJIE 3LKNB 1MCLA 1VENA 5EUOE 3QUZA 4P2RE 4OD3L 3ZKND 3K74B 1MHEA 3K2UL 2R1XA 4H0HB 5ICZA 4CW1A 3I02B 2JCCA 2P5EE 5IMMB 1ZANH 1UJ3C 3KR3H 4I2XB 2EXYD 5DJ0B 3TBTB 4F15B 3UCRA 3KLSA 4JO3L 4PGZA 4KUCD 5EO9A 1XIWB 4UDTA 4HZLB 4M3KB 1A4KB 2DQUH 4YWGL 2NY1B 2FZ3A 3MV8B 3QCTL 5MHSE 2QADC 4PJDB 1EEYB 4P59L 2BNQE 3GMQB 3KPSD 2C3HA 4YDIH 4PJEB 4GQPH 4EOWH 5JDSA 1H15B 3WFHB 1OPGL 5HBBA 5IBTH 4EVNA 1AFVL 2XKNA 2ADFH 3GFUA 4MA7L 3K8KA 1WUNT 3TYFB 5ESVB 4WW1A 3KPSA 3VGGA 5DEGA 4JFPA 5DQJB 1XGQA 3QEHA 3UTQB 4Z77A 1RUKH 5F6IC 2VXTL 3V4VL 3BPNB 4EXKA 5J9PB 3ALWA 3BP4A 4YEEA 5CJ5A 2BSED 3I3EA 4MHHI 1RUQL 3OZ9L 5GJSL 4RZCB 4GKZA 3T0BA 4WFFD 2UWEF 5EU6E 4BQ9A 3JTTA 4ZUTB 4XZUA 3MJ8B 5IFHH 5IV2B 3B6SB 4LLQA 5ID0B 1FC1A 4YHZH 4RFEA 3PGDB 4YNYA 3K4DA 3KS0J 2QBWA 5DD3L 3FAXA 5GIRA 1JUFA 1B2WL 1AY1L 2DQCH 3VFPB 3MCKB 3K1DA 4LGPB 1B4RA 4GS7B 1BZ7A 1CL7I 1NC2B 3SO3C 5TE7L 4R7NA 1ZS8B 1FZJB 4C56E 4PRHB 3O6MH 1DQLL 3MRHB 3OKEB 4H1LG 1FBIL 1ZXQA 4MQ7B 5CAYB 4MZ2A 3UTZB 3MNWA 3RKPA 3C2SA 5EBLB 4N0FB 1OAQL 2IBGA 1KULA 1S78C 4NWTL 1G7HA 2OZ4L 4G6KL 4LGRB 1F3DJ 3ARBC 1QSFE 4OD1L 1JYNA 5IHLB 3U30C 2VMFA 4ISVA 5FYJL 5IROA 4EI6B 1FVEB 1GC1C 1MPAL 4HZAA 1BAFL 3JWOH 1Z3GH 2BSRA 2PXYB 5E2TH 4AG4L 1BHGA 2IMNA 3RVUD 2A6JB 1RHHB 3DGCR 3JWDL 2YSSB 1VGEH 4XCFH 1MVUB 4W68A 5BMFH 4UILH 1JNNH 3BT2L 1I1RA 5IMOA 2Q76B 4XBEH 5I1IH 5HGAB 1GGIL 4GMSH 3U7WL 3WIFA 2DKMA 3RZCB 4AIZB 5FB8B 2YC1A 5HHPA 5E2JA 4LBEA 2IAMD 4L4JA 2VERN 3H42L 3PL6B 5F1IA 4ODHL 1CICA 1WBYB 3LS4L 4L8SA 3AFLA 4WFEE 4F80A 5SV3A 1QVOB 3U6RA 2GJZA 5E7BA 1A0QH 5KJRH 4WEMB 2IAMA 2CRIA 4GJTB 2C9AA 3VXUE 3MLSL 2NPLX 1JBJA 4XC1H 3MRBA 4HIIA 3T0EC 3WHXB 1I75A 4JQXA 1YY9C 2G60H 4TUOA 3BEVB 1X4ZA 5HGHB 3DTXA 5DD1L 1IVLA 4PBVC 5JHDE 4E5XB 1IEHA 5J3HC 1EX0A 4PJBF 2B1AH 1XH3B 1KACB 5CHNA 5HVWA 3ECBB 4LSQL 1FN4B 3DHMA 43CAB 5FYJE 2R4RL 5F3HA 5JIPA 4WEBL 4YC2C 3TPKA 2HFFB 4L3ED 2M2DA 1A3RL 1JZ3A 1CE6B 2UZIH 1UG9A 2P8PA 1L7IL 3THMH 4B5EA 4IDLA 3CFBB 4U1KA 5DT1L 2AABH 3I9GL 4PY7A 3PV7A 1N64H 4L3EA 4BK5A 1J8KA 4I4WB 2DLGA 2CD0A 4TNVF 1EMTL 2I5YH 3JV0A 1D9KD 4Q0XL 2OS7A 1HI6A 3MC0A 3QA3A 4KI5F 4LPVA 3VDBA 3EOYG 5DJAB 4Q9RL 3BUYB 3T3MF 2FJHA 3QFJB 1N4XL 3D69A 2XA8H 2OXGA 4KKAD 1KXTB 4APQB 4F57L 3F58H 2RFXA 3RBGA 2BY2A 4QF1B 3F5WA 4JG1L 3V4UH 2NW3B 4HK0A 2ESVE 3VD4A 2H45A 4QRPE 5J1SC 4ACPA 1EZVY 3IU3A 4OCXH 4CJ1A 4G8GD 1YECL 2YPLB 3OKNB 4UV4L 3D18B 4JRXD 2CDGA 2FD6L 4OZHA 1KOAA 3OB0K 3NZ8A 4FG6D 1V3LA 1D5IL 4G8GA 3REWB 4J3VA 4FQXD 4QRTA 5SWSA 2COQA 1MRCL 1S8DA 4YHNB 1UGNA 1JGUL 4YBHA 4WI3A 2CKBL 2B2XH 3EYOB 4TNWF 3JV4A 1RHFA 3MREA 1MCHA 4BSVB 4UZGA 5H35B 3SDYL 1HSBB 2R0KH 3T0AA 2I07A 2JELL 2WWKT 1CXIA 1OCWH 2C3VB 4X6DB 3BAEH 3ULUL 3VG9B 1EBPA 4W81A 2HAZA 1KPVB 2HA1A 4KPHL 4BUHA 1HXMB 1WQVT 4RGOL 3R8BB 1NBZB 3LH2L 2G2RB 3G9AB 3RDTB 3P3YA 4UT7L 1P1ZA 4OD2A 2AQ2A 1I8IA 4CDHA 3TT1H 2AVGA 2UVEA 3OBAA 1Z9SA 2R0LH 5HJ3A 4Y4HD 4EBQL 3BKCH 2VISA 2CRZA 4DAGL 1CG9B 4HPYL 4XVTH 2XKUA 4EDXB 3FQRA 1ZOXA 1ZLVK 2DTML 4FQ2H 3T77B 3BPCB 3ARGD 3C6LB 1H3PH 4Y4HA 4QY8B 1RZKL 3HNTH 2J6EH 3E8UL 5CZXD 5C0BA 5KN5A 5L2KE 4J6RL 5DJ8A 3MRRB 5GRUH 3SKOA 3ARGA 1XGRB 2HYMA 4KK5C 1MY7A 3QWQB 5JHLH 3D39E 3L6FB 5FYLL 5IESL 1YEFL 2YWZA 1FGVL 1OARH 1RJZA 4OF6A 4WWKD 3VI4F 5I2IA 5ETUB 1S7QB 1GGBH 5ENWA 1FFPB 1BFVH 4MNQB 5CEXA 5IBLD 4WWKA 1IC7L 3QUYC 4G80B 4JKLA 1BLNB 3EUUA 4PFEA 3BXNA 2WBWB 1OAKL 1HHJA 1Q1JH 2VDQL 2VXQH 3ULUE 1SM3H 2R9HC 4XP5L 1GGYA 1DBJL 5D7LB 4I1NB 3O3BA 3FOLA 5HD8D 1FIEA 4ZFFB 4PGBA 3RX8A 5EC2A 1GZPA 4HKXB 4NKMB 3GI8L 3MO1B 3OAYH 4XCYB 2R15A 4KJWD 3AMLA 4GG6B 1PKQB 1I1CA 4FN0A 2JB6A 1TTFA 1AGCB 3DRTA 3H6JA 1UA6H 4JFHD 4GRLC 2WP3O 5D2NB 2IQAA 5I1JL 1UT9A 1YJDH 1NLBH 1NCCL 4Q9QH 2CO7B 4LCWD 4ONGH 6FABL 4JN2B 5JO5A 1JZ4A 1RVFL 5HYJD 3KXFB 3QQ9D 1FCCA 4UI2A 4Y5YA 2DMBA 2Y5TA 3MUHL 5E8DL 3MSPA 3P0YL 5K9KA 1F45A 4LCCB 3OJDA 4LCWA 3EO1A 5DJXB 4G6JH 4NUGL 5CJQH 5HYJA 4MD0A 1LO3H 3ILQC 2OJZH 4LAJH 1JGEA 2QJDA 4N8CH 1FPTH 4NFBA 1NBYA 3MRPA 5GS0C 3NCBB 1G7JB 5K9OB 3RGVD 3WS6A 3ULVF 4OCYH 5KVGL 1JFQL 3QUZC 3V0VA 2L4OA 3HNVH 2O93L 1M7XA 3EYVB 3V79C 3LKPB 3RGVA 4UIMB 5EUOA 2P5ED 4NCC1 2R1YA 1FNEB 4U1GC 3DSNA 1BWMA 3LS5H 3ZKNC 4UIKL 1MRFH 2P7TA 4X4YB 1JRHI 3FRPA 4F7MA 4NBYB 5IVXE 3L3GB 2LVEA 3P30H 2P5EA 4LAQH 2XRAL 4Z95H 2F54D 3BQUD 2JIXA 4W70A 4BQ6A 2XT1B 2EXYC 1UM6H 3KPMA 1PD6A 4QO1A 3D0VB 3V6ZB 1V3MA 2BNQD 4N0RA 2NYYD 2NR6D 15C8L 4X0KA 4ELMA 5FM4A 5GS3A 3IGAA 2F54A 3BQUA 1RD6A 2O61B 1RZGB 5IK3B 5KVMC 1PYWB 4EQ2A 1OTSC 2BNQA 2V7NB 5FV1L 1IM9B 5M7QA 4D3CL 1HHIB 1KYOK 4PJ7A 3WHE1 1U8NA 2CMRH 4D2NA 5CKGA 1XGTA 4U6YB 3TNMB 2EDEA 4DVBA 4PJFB 2HKHH 3QR2A 4W6WB 4FQHB 2FH8A 3HE6B 4AL8L 3HFMH 3KYKH 3FT2B 1YNKL 1KPRA 3VXRB 3NABL 1VFUA 3TIEB 2X4SA 2FJGB 2VIRB 3E6FB 2WBJD 2ZOLA 5EH1A 4YXKL 3B9DA 1BEYL 1MCEA 3FFCE 3HRZB 3ARQA 3BZDA 2A38A 3HS0A 2WBJA 1ACZA 4JFFB 2APBA 4HWNA 4LEOA 5EU6A 4FZEH 3ARWA 5FV2A 1MF2L 5BVPH 1X6LA 1QFWH 3O2WL 4ODUB 1KCRH 2X6MA 4Y19B 2H6PA 3QG6B 1MAML 2QHRH 4DTGH 2CLZB 4AZ8A 2W0LA 4C56D 3D85A 3BH8B 4ONHA 3BZEB 3MJ6A 3UYRL 5AEAA 2GITB 3E2HC 3KVQA 3DV4A 1TQCC 1N0LA 3I75B 4C56A 1JF6A 5EOTA 3QHZH 1QSFD 3BZFB 5IROC 1G7LA 3KDMA 2DJ4A 4G6FB 4KVNH 2OX5A 1S9YA 1N0XH 2FLBT 4KMQA 4ODXB 2CGRL 1I7RA 1BM3L 1OL0A 1FL5A 2F5BH 1QSFA 2NY3B 4HCRL 4NFCA 3SGJA 2GAZB 2J8OA 3ZT5A 3HMWL 4H25B 2HFTA 2DQTL 4XAWL 1CL7H 1H8SA 2YD4A 1YEJH 4MXVF 4IM8A 1JPTL 1TTUA 2DQFA 1DQJB 3IFNH 3WFEL 4J1UB 1KIPA 3RVUC 2ARJB 1CGSH 4NZUL 4HKZB 5K9JH 1Q0YL 4U7MA 4XC3H 3IB4A 2V5YA 1V3JA 1YNTB 4KJYB 2BY3A 2RGSA 4X5XA 4YDJA 2AQ3A 3NCJH 4X6CA 5LWYL 4JFQA 4MJIB 4R4ND 4L8SC 2R23A 2R56L 1KTDA 4AM0B 3OXRB 3C9NA 3D2UD 2IAMC 5IHZA 1MHHB 2H9GB 3CFJB 3VXUD 4BFIB 3AM8A 3CSGA 3WFCL 3I6KB 1TNMA 3MRJB 4QYOB 3C8HA 5F9JA 2ILLA 3D2UA 5C0RL 3MLPA 5FO9B 4JQXC 1N59A 2ORBH 3ZL4H 3VXUA 3P4NA 3HR6A 1QSEB 3QNZB 4K7FB 3SKUD 3JV5A 3MNVB 3P40A 2ZWLT 5JHDD 4JY6A 2XWBB 2VZ1A 1OSPH 3VFTA 3M8OH 4KGJA 5FO7A 2IEPA 1F90L 1N5AB 5FYJD 1RJLB 4I13B 8FABA 4WHDA 4J3UA 1X5LA 5JHDA 1BMGA 3L1OH 1FDLL 2OZ4A 1OPGH 4AEEA 4JQIL 1WZLA 4QHLB 4CN4A 1NFKA 1QFPA 2IADB 2F5AL 5I9QC 2ZP0T 1EO8H 1KCSH 1RZFH 1RIVH 4X80L 1MFBH 4ZQKB 5EULV 3G6JA 3GSWB 1YZZA 2VDOH 1NGWA 2VWEC 3FT3B 3QJHA 1S9WA 2ICWA 4JHBA 4OFPA 5DK0A 4G6AD 3V4PL 1I9IH 2W65B 3O6KH 2BVOA 4YHOL 4JFZL 3DBXA 3FCTA 2YHGA 5C9KA 1D9KC 5DK3A 3OZ9H 3PG2A 4K8RL 5KSBE 4X7TB 4LLUA 4DZ8B 3V8OA 1FIGL 3AS3A 5LGJA 2XWTA 4KKAC 1IBGL 3U46A 5ABDE 4AY0A 1HZHH 2FEEL 4WJ5A 3H3KA 5BQ7B 3MJ9H 2X4NB 3TT3L 3BRDA 4Z76A 5E5MA 3DYPA 2ESVA 5EIVA 1NCBL 5CZVL 3IU4L 5DQ9B 4F37K 1CYGA 1CFQB 5MEQA 5CEZL 4ERSH 4XX1G 1ITCA 4WDIB 1FG2B 3KLHD 1S7UA 4DN3L 5A40E 1FBIH 4P5KA 2BCKB 5H2BA 3MBXL 4QCIB 1TQBC 2VAAB 5DRZB 3MRDB 1MJUL 3OKOB 1HQ4B 3FB5B 4LRNH 4BSWB 2R69H 4FQXC 5E4EC 1K85A 3V5HB 2VC2H 3Q3GA 2WSKA 4IRSC 4U3HA 5EU4A 4XBGB 1VKXA 1AR2A 3HZMA 1D3CA 3BIAX 1U8HA 3WN5A 3BDBA 5KSAB 3BMVA 3QDGE 4PRPD 2HWZL 3NA9H 1B88A 4DN4H 4HG4K 1INEL 4GKOA 5BCAA 2DM3A 3SDXF 2HRPH 1A1MB 5EC1A 2XOTA 2XKSA 2VLKB 1T04B 1HNFA 1EH9A 3AXLB 2KPNA 4N0CD 4NQEE 1DFBH 4PRPA 5C0DA 5HHQB 4KK6D 4XP6L 1B0RB 2QSCL 5JNYA 3EFFB 3SJVE 3BMWA 4CU8A 4CMMA 3FO0L 1UWGL 3BD3A 4U49A 1FL6B 1X5KA 1YN6A 4GXVL 1NDMA 3PWLA 3MTRA 3GEWB 2YN3A 2XZAH 4JB9H 4ZFZA 5CBAA 3QBTB 1WT5C 5I0ZA 4KTEH 3ZDYF 5IVNA 3L3IA 4M03A 2G9HA 4XH2A 4Y4HC 2X09A 3QDJD 3UTOA 3VXNA 1NAKH 1JTOA 1C5BH 3VGHA 2DICA 3B4NA 1YEHL 5CEZE 3QNXA 2EC8A 2V5RA 5F6HI 1WFTA 4PJXE 3QDJA 4LU5L 5F70A 2J5LC 2D31B 1XR9B 1J1OH 1EFXB 3D39D 4PTUB 3UZVB 4P5TA 4XHJD 5CZXC 3UYOD 1MFEL 5IEKA 3ZHLA 4FNLL 4NWUH 3EDEA 1I1YB 2YN5A 3PWVB 3TZVB 4GMTL 4XCCL 1GZQA 3D39A 4M6MH 5IG7B 5C6PB 3QULA 4WEBH 1AXSB 4NHUB 1E4KA 1IC1A 5BXFB 2CKBA 3IVKA 3HPLA 3SOBH 4JFYA 4J3SA 5ERWA 5JW5A 5TDNA 5I1AB 2VZUA 1UFUA 4ODTL 2EYTB 2GTZB 4OZFA 5CSBA 1MJ7H 1D6VL 1T2QL 4L9LB 5IBLC 4PJHB 2UZYB 5IW3A 5I8KL 4G42B 1PKOA 4NBZB 5GRYA 5D7JD 1YC7A 2XV6B 5GHWL 4C4KT 2YD1A 4JM2B 4NQUA 3BI9X 2VXUL 1JHLH 2HRLA 3T04D 2W9DL 1OGAE 5D7JA 4YZFF 2AJVH 4KZDL 3ZTNL 4M8QB 4O4YH 4WO4B 2Q6WA 2ZCHH 1BFTA 1KFAL 1WAAF 2ZCKL 3UTSB 4WHYH 2FR4A 1FFOB 1JZ2A 3I6LE 4OM0L 2IANB 3F7VA 4KJWC 4QRPB 3W39B 2X1OA 4NIKB 2E5EA 4Y5YC 2JTDA 5TPWH 1SVCP 2ZNXA 3RRQA 4CJ0A 4U0RC 2NNAA 5D70H 5F9AC 4P48A 4QKXB 3MRFB 3RIAK 5DYOB 1E4XL 1YYLH 1V7NL 5FYLD 2Q8AH 4N9GA 3QQ9C 5E95B 1BD2D 2GSIA 3GRWL 3C8DA 4RQQB 3JUZA 1RI8A 4P46D 4PGEA 5ACZB 5K33A 4TTGA 3D6GA 5C07B 4Z9KB 4F9LC 1FJ1B 2BNUB 1DVFB 1MRCH 3MZGB 4KZEL 3ARBB 3GUTB 3U0TA 4WCYL 2MJWA 3U30B 1BVLA 5CJXA 1KT2A 4HUMB 5LAXA 2CKBH 4P46A 1ED3B 3FHQA 1KN4L 4LCUB 1IMHC 3L5HA 4JAMA 4LPYA 3IAPA 4NJ9H 2R1WB 3CCHB 3K2MC 1F4YH 4PP1D 3VE0A 2MHAB 1AQDB 5FHAL 3WNOA 2XZQH 1VEPA 3BHBA 4UUJB 5E94B 2E27L 3VFSB 2YS4A 3ULUH 5GGQL 1K3IA 4PJIF 2I9TA 2CDEB 5FYKH 5J12C 5TF1L 3W9DA 4U1MA 3CXDL 5FF6B 2HN7B 4OLVL 5CMAB 2J8HA 2NY4B 1U42A 1VGKB 1KG0B 3NCCB 3U0WH 4NNYB 4ZFOB 1ZT7A 4H8WC 5DHVA 4JDZA 1MREH 4ZS7L 1KIUA 3CLEL 5ITFA 1MI5B 2WBKA 3ARED 1N3NB 4EEEA 1C16B 1FZMA 1RURL 4MX7A 3SKJL 2PW2B 2NQCA 3VD5A 3ISWA 5JIKA 4NO0B 1FHGA 1UZ8B 2NYYC 3KGRA 1LEKA 4AK1A 2NR6C 2VDPL 3WD5H 4J3OC 5JR1L 1MFAH 4UDUA 3LVEA 4HUUA 2ZCLH 3QRGL 3WJJA 3DX6A 5MEPB 2ZUTA 4WUKL 5T5NF 1H5BA 4WW2A 2Y4SA 3NTCL 4NC0B 1G7MB 3S4SB 2OR8A 5DRXA 1EV2E 4ZD3H 3IF1B 3CPLA 3MLZL 1FYTD 4U1LA 5IBUB 3VWKD 5L2KB 3WV0A 3KPNA 2CIKB 3FQWB 4KV5E 4N0UE 1S3KL 3ESUF 4F58H 2EDRA 4DQOL 2DN7A 1RZIB 1ADQH 5AG8A 2MQ3A 1FYTA 5D7KD 3VWKA 5D8JL 2ED9A 4YC2B 4JKPL 3QQ4A 2WBJC 3CVIL 3HA0A 4FQCH 1JYXA 3L5IA 4XB8A 5E99H 2R2BB 4HUVB 4KRPC 3FFCA 4LSTH 1TZGL 5I1LA 3OGCA 3S3PA 3IDJB 4NGHL 3VFNA 2FEDD 4MLIA 2WINA 4PRNB 4HBCH 4ODSH 5FECA 1NFIB 4S0SD 4XP5H 4U4BA 5C0GA 1HDMA 1BQLL 2FECI 4U1NA 3BN3B 4TOYH 4S1RH 3CZFB 1T5WA 2Y1VA 2ZUWA 1Z2KA 4MJ2A 4OCNC 1K4CA 3UJIH 3GBMH 1M7IB 5C7XL 3EO0B 3MRGB 3UPAA 5DJYA 1HCFX 3QUML 4U2ZA 1EAJA 3OG4B 2BXZA 1XF2B 2AEIT 4BJLA 5I1JH 1TLKA 4I9WE 3TO2B 3ZYJA 1BQHA 1XEDA 1A3LL 1F02I 3RU8L 1TVBB 1X5JA 4JR9L 2Y23A 4HGWA 2KKQA 4ZDHB 4IMLB 5T33L 3OAYK 4Q2ZA 3DUUA 4TTDC 1CDIA 4ENED 2A9NL 3RUGB 1ZHKB 3W2DL 3MRMB 3ZTJH 2X4QA 4KRLB 5EA0H 3C60D 2MCPH 1MFCL 2CJUL 1B4JH 1ZHLA 3MJ7B 1FNGA 4MAYB 5KVGH 2LE9A 1JFQH 1A22B 3HHRB 1ZVSA 1IAOB 1UCBH 1UZ6E 3KWWB 5E6YA 3VFGL 5AD0A 4R4NC 3AM8C 4X7DC 3SCMB 3X12B 1RUPH 4XP1H 5I1DB 1F4XH 5B8CA 2HTLD 4WFGE 2ZG2A 2ATPA 1PEZA 3RNKB 1BJMA 3ULVL 3AROA 1H9VA 5IVXB 3WL9B 5CBEB 2WK2A 1MUJA 1A7OL 3M1BA 1MFDL 3BKJH 3OJMB 4M5ZL 3O0RL 5GGUB 2FX9H 4LDEB 2WQRA 4XT1C 1G9NL 2DIAA 2N7AA 4UT6L 1LEGB 1BQUA 15C8H 1JNHB 4D9QE 3OPZL 3BIKA 1MCWM 2X4PA 5F7DB 1DLHB 3QDMB 4Y4KC 2DWDB 1TCRB 4LFHG 3GIVB 1A6WL 4O58H 1D7FA 4KJPC 5SV4A 1ND0A 4FABL 3X13A 3V6FB 3GKWL 4RWYL 4HCRA 4OTXL 2VQUA 3IDGB 2AERT 4JFXB 5D7IE 2NY7L 1FNHA 3LEYL 4TQEL 3DURA 3KPQB 3RGHA 1BZQK 1Q9WB 5DA0B 1AGDB 3H7BA 2WIIB 5GS0H 5DRWA 4BZ2L 4XNYH 1DN0B 4XXCA 32C2A 1MCOH 4G6AC 2HKFH 2DBLH 3O41A 4JGJA 2AW2A 3UO1L 1F6AA 2H2SD 4UINH 1DQQB 1BECA 5KSBA 2GK2A 1BZ9A 3REVA 4IRZH 4G9FE 1GPOL 1QZ1A 1G7PA 5T3ZL 5ISZE 4P3DB 2HVJB 3GSNL 1HH9A 4HEPG 3V52H 1P7QD 2FL5B 1EHNA 1WBXB 2UVFA 4JFOB 2D7OA 4DFHA 1I8KB 5GZND 4S1QL 3K8MA 3BZ4A 4MNHA 5GGRA 5LQBH 3JUYA 4O51B 3VMOA 1N7MH 1S7SB 2F15A 4UNUA 1FO0H 3OX8B 3GMMA 3GI9H 1HHKA 5T1LD 3HB3D 1B0GA 3QQ3A 5FA3A 1P69B 1CDBA 1A14H 4KQ4H 3VXTB 3B9KB 4ZOEA 3U2SB 3NZHL 2J3SA 3WMSA 5BZDB 2QKIB 4GRLB 4EI5A 3DSFL 4ORGB 4HEME 3RIFF 1NMBL 5T1LA 3WYRA 2GCYA 5IJVB 4YGVA 3MMEB 3S88H 3QAZC 1KBGH 4HIHB 1OM3H 2FX8H 5EZOH 2Y07L 4YDVB 2P8LA 5JPNB 2Q7YB 1JNLL 3HMWH 5A2KH 5GGTL 1DANT 2KQMA 2VDML 1A7BA 5C86A 4NQED 4BUGA 4NKIH 4CN6A 3WFEH 3A6OA 5IW1A 1MJJB 1IGCL 1KTLA 2VLJE 4PJCB 5DI8B 1H8OA 4K8RD 3QEUA 2EKSA 4YX2H 3X3GL 3JZ7A 2V7HB 1CLZL 1W0WA 1EJOL 4N0CC 4NQEA 5TJWK 3W0WE 3QB7C 2VSDA 3WS3A 1JL8A 4KK6C 3KPPA 1OAXL 2VXSL 3V7AE 3WEXB 5D1QD 4P4KD 5B3NA 3SJVA 2ICEA 1LO4H 4LSSL 3UDWC 4ODVL 4Y7MA 1QSZA 5D7SH 1J8HE 1IFHH 4PS4H 3NIFF 2ADGB 3KPTA 3S4SG 2EYRA 5I19H 2ATKA 3BPLB 3EFDH 5D1QA 5E7FA 3RWCA 2AK1H 3HUJA 1ZT4B 2JLLA 1V7ML 5IBUG 4UDTB 4PTTB 4WTZG 3TWCH 1DBAH 3X14A 4DEPB 1AXIB 4X6FB 5DEZA 2UWEA 3WNLA 1FO0B 5ALCH 3CH1B 4MB4A 1G0DA 4K7PH 5AYUL 2PR4H 4PJXA 3GBNH 4M1DH 5FDYA 5IF0B 5CLTA 1BBJB 1T1YA 1WEJL 3TBSB 2X7LA 3LN9A 4XHJC 3WFDH 4XNZC 4JDVA 4NT6B 1E4KC 3IRZA 1LDPH 2D7QA 4RX4D 4HW6A 5JQ6H 3T2PA 4LQFH 5EOQH 5L6YL 3FRUB 4RNRB 1AGBB 2H8PA 2YKLL 4XPHL 3E6HB 3TH4T 3LZFL 4P3WA 2OQJA 1T3FB 1YEKL 3G5ZA 4YK4C 4RX4A 5GGVH 4DGIL 3MACL 2ITCB 4O02H 4I48A 3VJ6B 1VADB 4YPGB 4EUPH 1N5YL 4Z7WE 1EPFA 3E1F1 5DQDL 4QXGL 1UKSA 5HPMA 3VDCA 1MCPL 2P8MA 4XNMB 3HG1B 4XMKL 4ALAH 1YPZE 5T1MA 5INDA 4JFZH 5D7JC 1NJ9A 4LNRA 5T1DL 3BD5A 1Q72H 5DJ6A 1IT9L 1D5MB 1VPOH 1DZBA 1HSAA 3I6LD 4NSKB 4QTHB 2Y7QB 5F7MC 1OGAA 4U1SA 4AH2B 4R3SB 1IEAA 5DA4A 4MJ5A 3OTTA 4JY4B 4HJGA 2XQBH 3PHQA 3BE1L 3BKML 1RZKC 3VA6A 4MD5B 4IJ3C 4G9DB 2EDJA 5CEZH 5FA4A 5EORH 2XZCH 4HT1H 1TQCB 4HHAA 4NKDA 5EO0A 1AC6A 1QLEL 1FZOB 2DQHH 2A1WL 4GKSA 5I66B 3HC0B 1JI2A 5CJXC 3ZE1F 4U3XA 2HFEB 4OQTL 4P46C 4HC1L 4Y4FD 4Q6IB 4ZUWA 1UB6A 4ZO8A 1KLUB 2PYFB 4XNQA 4DVRL 2KBGA 3SDAA 3LEXA 3CMOL 4LARL 4Y4FA 1TETH 5D9SA 1G9MC 3QDGB 4M6AA 4ZUSB 4FQPA 3FQNB 2XQYG 1P6FA 4EUPB 2X1WL 2ZOKB 2BJMH 3RTQB 4G8EB 4HDIA 4CVXA 4PJBA 2DAVA 1G6RL 1CU4H 4L8CA 2I27N 1T20B 5CD3A 5D5ME 4HFUH 4N9OB 4WHTB 5CJOL 4XBPB 1TNNA 2KDGA 1ZVYA 1D5ZA 4JHWH 3OKKA 3X17A 1XCTB 2VN4A 5DK2B 5FEBA 3QIBD 4K3DH 3CJJA 3U36B 4ZOCA 1IC4H 4FQLL 4P5MA 1PG7W 5FM5M 3O3DA 5HVHB 4P2QE 2EIEA 3AREC 1T1WB 4RMSA 2A9ML 5AWNL 1OAYH 3QIBA 2ERJC 1CGYA 5E08L 3O81A 4D0CB 1FSKC 4PJDF 3U9UA 2V6HA 3SE9H 1PQZA 1NBVL 3MLTB 4NO3A 1LP9B 5GJTH 3TNNB 3ZTJG 2Z91A 5ESAA 3RWGB 4HFWB 2D7MA 4LU5H 5DRNB 4KHXH 1ACYH 3S3SA 1MWAB 3RVVD 3VXSE 4F7TB 5T3XH 3GRWA 3L3DB 3RPIB 2QEJA 3VWKC 1GOHA 3MV9D 3RWIB 1HXYB 2IGFL 3RWFB 5IMLA 25C8L 1KELL 3VGEA 4N0UA 1CXLA 2Z31B 5DTFB 4CU6A 1XF1A 5E6ZA 1U92A 4WGWB 2DLTA 3EYSL 2XXCB 3MV9A 1MAKA 1Q9LA 5I9QB 5IOPA 3T4AA 2VUOA 4E42A 1FH5L 3NN8A 1D6VH 4O9HL 4JJ5A 1KIRB 2RJMA 2ZPKL 4KXZH 1WC7A 2FLRT 1GOFA 5CIPA 5B21A 5JPMA 2FEDC 4DWHA 4ZAKD 3C08H 1D9KB 3H9HA 3ORJA 4OKVB 4GAGL 4J4PC 3HRPA 5DJCA 5E8OA 4GQ9L 4JFDE 4KMTL 2X1QA 3T1FB 2HG5B 4GAFB 4HUNB 1I9RL 3FMGL 5E2VL 4ZAKA 4M6NH 1JHKH 2QQKH 3RAJH 5C8JB 1CR9H 1GIGH 5TDOB 1KPUB 4BH8B 1LMKA 4I9WD 4HJJL 5D1XB 5L2JA 2QSVA 5F7EL 2Y36H 4ESKA 3QJFB 5F7LB 5LXGL 4O2CB 4JFEE 2VAJA 2DD8H 2FATL 3P9MA 3ALXA 3V5KA 2BC4B 1R0AL 1E4XH 4JRXB 3VFUA 3ZDZE 2GT9B 1N8ZA 1NANI 1TQBB 4QRUB 3WNMA 4XPFH 1JVKA 4OLWH 1V3KA 3OKYA 5KAQF 3A67H 4HJ0D 4NQDE 1FCGA 3GSOA 4FQXB 2FNBA 3OV6A 5E4EB 3QFDA 3G6DL 3O3EB 4IRSB 3PHOB 3NFPB 3C60C 2V2WA 2VL5B 1LK3H 1W0VB 4XWOC 5C0NC 2GUOA 2OYPA 1WLHA 2WANA 5B8CC 2MOVA 5FHAH 4HH9A 4OIIH 4I77L 1G84A 2MCG1 2GI7A 3PWJA 5HGBA 1H0DA 1KLFA 1BIIB 1HILA 4M9PA 5JQHC 2JCCF 4E0RA 4JHZA 2VQTA 2X4RA 2NY0D 1NMAL 4G5ZL 3EGSA 3OXSA 2YPKB 2ZSWA 2AEPH 4Q6YA 5D1ZD 3ILPA 5IM7A 1N6QH 5CKAA 1R3HB 1R3KA 3VGBA 3HMXL 5D93B 3BWUC 4FS0A 2BMKB 4KAQL 3WIHL 1L0XA 4OLEA 4OB5H 1HWGB 4Y2DC 4NNXB 1OWWA 1KJMB 5I1GL 5LG1A 1P4IH 2CDFA 3QUMA 4J12A 2VDPH 3TBWB 5IJKC 3Q1SL 5CUSH 4QRQB 5DJDA 1SBBA 1NL0H 2UV3A 5INCB 2J5LB 1GHFL 1TZHB 1A7PL 1YDPB 3R1GL 2X4UB 3TPUA 3ES6A 1B3JA 1KNOB 1U8IB 4IIQA 4ZTPH 1L9NA 2MTPA 5ENWB 1URLA 4XXCC 1LK2B 1S3KH 3D48R 5TFSH 5D7IA 1YMHB 1ZGLP 4F3FA 5HYIA 4A6YL 1MAJA 2NTSP 4TULH 1JN6A 1UQSA 1I3RA 4R0LC 3QEGL 1UXSB 2MNUA 1AKJB 5I18L 1CGVA 3MUZ1 1KJVA 3GKZA 2LQRA 4LCYA 1HKLH 4KROC 1NPUA 3MA9L 2H26B 4GBXD 2ZKHH 1IGJA 3ULVD 5A2IH 3IXTA 1ES0B 4PGCB 3GMLB 2Z8RA 5GSVA 4HIJA 1IEBB 5K93A 1U58B 5EZIH 2HMID 3PNWA 4QXTA 1I7ZA 4UQ3A 4GBXA 3U9PH 2J8UB 2VZSA 3MNZB 5H94A 2YEZA 4JO1H 5GZNC 1TJHL 5CP3A 1U3HD 1JWSA 1CFNA 1M6OA 2HTKD 5C71A 5L0QB 2ZUYA 4U2YA 4NUJB 1QP1A 1C08A 1D5XA 1QA9B 4OLUL 2DQIL 4YHIA 3PABA 1OTUD 3O11A 2BFVL 1E28B 1EGJL 4OZIB 3HB3C 5BRZE 1QD0A 1XZ0B 2DRUA 4Y5VA 3DVGB 3EHBD 3LHPL 4EUPG 4OJFH 4U0RB 1XAUA 1KIQA 3STBA 3VRIB 1Y0LA 3RX7A 3VXQB 3RU8H 3CFEB 4M61A 4BKLB 2XQYK 4XCEB 2QR0A 5EU7C 5KVFH 1N2RA 2BOBB 5EZLA 2GHWB 5FKAB 4P2OB 1RAMA 5IB5A 3KAAA 1CFSB 3LN4A 5FKPB 3OR6A 5FHBH 1IGTB 4OLZL 1MFCH 4K8RC 2BNRD 4QGTA 3E0GA 5HY9B 4PR5A 3RIAF 5T3ZD 3W0WA 2R39A 2JJTC 3KPRE 1KCUL 2IBZY 3IDIB 2BNRA 4P4KC 2IBBA 1K4DB 4I3RL 4OCMC 5J12B 4RDQG 4M4PA 2QSQA 3AS0A 3I6GA 3GSNA 2D03L 2ID5A 4PPTA 2XN9B 5A16B 4DOHE 4UT9H 1A7OH 4X0KB 1IM3A 5IR1B 3FFDA 2EDFA 4QT5B 4K94L 3NIDF 2V2TB 3MLVH 5LGHL 5AYQA 1MHCB 5GRJL 2JB5L 1INQA 2AK4B 1F3JB 5C6TL 5B39B 3CXHJ 3FB7B 2FO4A 5HYSA 4GRMB 4XPGH 5CSZB 1QLFB 1VEMA 3V0WH 3BIBX 1A6WH 2CIIA 2F8XC 3MRQA 5BZWA 3Q6GL 4QTIH 2P24A 1IGML 4UV7H 5DZLA 4PLKD 4H26A 2D0HA 2MKLC 2V2XB 1A9BA 5I0DA 1RFDL 5JOPD 2ZOLB 2VLRE 3U4BL 5GGTA 4OF0A 2W60B 4KK9D 2ADIB 3QT2A 1KCVH 2MFNA 4U1IA 3QIUD 2YPVL 4Z7WA 5EO1B 3BVNA 4IS6B 4BELD 1MRDH 4X6BB 4G43A 4JLRB 3HE7A 3C09C 4P9HL 1ZA3B 1QKZL 4RAVB 1YPZA 2UYLB 1KXQE 1WISA 4KRPB 3QIUA 5DURB 1ZTXL 3GJEA 1S9XB 4K3JH 4GRWE 5I16B 2IALA 5JOEA 3FN0H 4Z7OF 3BN9D 1VACA 4RRPG 4G9FB 2NX5E 3U7YH 3HI5L 1A6TB 3VRLF 3MRIA 5ISZB 2PW1B 1TIUA 3MR9A 4JHAL 1FFNA 1CK0H 1E4WL 3BP7A 3CSPA 1TJIL 2FCBA 5EU5A 4Y5XB 1MHPH 1NFDB 1IQDA 4G8IA 1BOGA 4OZHF 5EU3A 1G7LB 4XNXH 3QI9B 5FK9B 1BFOB 4I3SL 5DVMA 3GSVB 4L4TD 1OF2A 1T4KB 3ZE0E 2QQQA 5KZCD 4MJ6B 3BX7C 2MQCA 4Y4FC 4WENB 3TJEH 4L4TA 1FLTX 4KKNA 1YEGH 1CF8H 4FTVE 5EOCH 1NCAH 3F7PC 4DK6A 1YEIH 5IB4A 1BP3B 4YBLC 1FVDA 2F53D 1AC0A 3MODH 2NY6B 3SDDD 1U8OA 3MYJB 1CFTB 4X4XA 1PZ5B 2DLIA 2WP3T 3G6AA 2VQ1A 4QHUB 4MA8L 1F8TH 2F53A 3GGWB 5DEFA 3JBG7 2B5IC 4XNUL 3S6CA 3SDDA 5D5MA 3L95B 3HAEH 4JRYB 4JPWL 2G5BB 1YYML 3U0PB 4P2QD 4MDIA 2N4IA 5CINL 1MEXL 1P7KA 1QBAA 3MRKA 3GSRA 3CDCA 3QIBC 5KSUB 1W72L 1JF1A 1J8HB 5IVZA 3CSYB 4KI5C 4LKXB 1I1FA 2IPKA 1BX2A 5GISH 3VH8B 4P2QA 4TN9A 3D0LA 4Q58C 2GSGB 5CJBA 1V7MH 2WAHA 2Q86A 3DV6A 3L3KA 4MQXD 4QRSA 5GZOD 4FQ1H 1P53A 3LSOA 1DE4A 2PO6D 3B8YA 3CLFL 5FO7B 4MSWA 4XMPH 4QHNA 2SEBA 2O5XH 1ONQA 4U6HB 4K23L 3FL7A 2PO6A 4YHPA 3EOBB 3G04B 4P57B 1U93B 4NQXB 1NCWL 1QNZH 4KUZH 4Y4KB 1N26A 3Q48A 4JGUA 2UUDH 3DUSB 4M7ZC 4OQTA 4NZTL 2MPAL 4HC1A 5IIEA 3WNKA 3QISA 3CUPB 5CGMA 1D6EB 1ZHNB 4OLYL 5E5UB 1ZAGA 5EPMB 4DGIH 4XPAH 4D8PB 1BVKB 2BP3A 4WV1A 3R8QA 1G0XA 3O8XB 1W2KT 4F33A 1A8JH 2CQVA 4JFDD 3ROOB 1G6RA 1JWMA 1O0VA 3GHEL 4KGLA 1J05B 4ZAKC 3UTPD 2OK0L 3RWJB 4GAYA 1AD0B 4PB9L 1PGRB 3W81A 3HAEB 1E6OH 3QXVA 3K4AA 1EHAA 5F9OH 1DDHA 3L7EA 3NIGE 4JFDA 5I1KL 1I8LA 1NMCB 2A6IB 2BVQA 2EKJA 2D9QB 2ICCA 4KKCC 3QZWA 4PJ9D 3U1SL 5E6ID 2N7BA 1HHHB 3O4LD 5MERA 3BKMH 4MQSB 1S7TA 2DB8A 4ZUUA 2OJEB 4R97B 3Q2CA 1AIFB 3QEQB 1XR8B 4U33A 2VUYA 1NGXB 4YAQB 2FGWH 4OAWB 5E6IA 1NGQL 4JFEA 2FYYA 3MRNA 3IETB 4H88H 4NQDD 2EIZA 2XTJC 4YQXL 5DD6B 3PWUB 2PF6A 4CRPA 3KS0H 4FP8H 4YE4H 3MGTA 4JM4H 4U1JA 2JK5B 4Y16D 2O5YH 3UJJH 3CC5A 4HJ0C 2BY1A 5FOBA 4NQDA 1T6WA 3GMNB 3QAZB 1WIUA 1IAIM 2GTWB 3WE6A 2NXZB 4FXLA 5T1KD 2RR3A 3PGFH 3O6FD 1RZ8A 4Y16A 3B43A 2RCSL 5KTEH 3H9SE 1W0YT 5JUEH 3VW3L 3SQOL 5L9DL 5T1KA 5J6HA 3VGFA 1X5AA 3O6FA 3QXDB 5EUOF 3DVNB 3RHWK 3S34L 1J18A 1F3DH 2OMNA 4D9LH 1K8IA 5BO1H 2CK2A 4I0PC 3LV3A 4MD4B 2FH6A 4JE4B 1HIML 5B39G 2NY0C 1SYVB 2JJVA 5EWIL 1IKNA 5D1ZC 2FBOJ 1BGXH 1JPGA 3C2AH 4HX1A 1WICA 4YFDB 1KJ3H 5SWZD 1Q9OB 4BH7A 1Q9KB 4RISL 5GGSY 4Y1AD 1FP5A 3LN5A 2F19L 2MSPA 2R29L 3PJSA 3PQYE 4BFBD 1QEWB 3LRHA 5KVDH 2NZ9D 4IOFD 1T0NB 4PJ7F 2EYSB 4IIQC 3G5VA 4GG8B 1KB5H 4Y1AA 1ZLSL 3STLB 1PSKH 3B3IB 5DD5H 2EIDA 2AJXL 3FB6A 43C9A 3VXSB 4OCSL 1JPSL 4XNZB 3DYMA 4MCYA 4OIAA 3ZE2E 3MRLB 3ZHKA 1BFSA 2D7TH 1FZKB 3GM8A 2Z35B 4RGNE 3NCMA 3EYSH 5C09E 3EYQD 4PG9A 2XFXA 5ESQB 4YK4B 1SYSA 2KQNA 4HS6A 4UU9A 3TV3H 1HK6A 3TA3D 5F3BA 5HTSA 3ZMRA 1ZEAH 4GBXC 3I3DA 1IAMA 3ULVC 1WZ1L 4X6EA 3VXPA 1CT8A 3ARXA 3TA3A 4S1SH 3VFOA 4QWWC 1HQRA 3H7LA 4LSPH 2HMIC 3ROLA 5HHXL 2EO9A 2NW2A 2FB4L 3AVEA 2OL3H 2HT3C 4QRRE 2FR4B 3X11A 3PV6A 1REIA 1G9NC 3D1MC 3TVMB 2X42A 5D72H 3HMXA 1U3HC 3TBVB 1RIHH 5BRZD 5CGTA 3WIHA 4Y5VC 5F9WC 3H0TA 4J8RA 4MWFA 4YIQA 5SWQB 1EXUA 4PJIA 3S96A 3L3JB 1OTUC 1X5IA 1A6ZB 1G7QB 4HKJA 4HKBA 2FBJH 1OAZH 1ZANL 4M7LH 4IJ3B 5BRZA 2DKSA 3KR3L 2AS5M 3EHBC 5IQ7H 4HGKC 1KB5B 2QLVB 4NQTA 4CUCA 4JPIB 1BD2B 1G0YR 1SEQH 2DQUL 5DJZA 1U8QB 4OCRH 4P46B 4R7DB 3U4EB 4AJ0A 3L7FB 2FHCA 5L8LB 2DLHA 4NQCD 1LEIA 4N8VA 4QHMA 4YDIL 5JXED 1DUYB 2GK0A 2OTUA 1JV5B 3CVHH 4PJEE 1FL3B 4A6YA 3HI1B 4MA3A 4EOWL 4C4KO 5IBTL 3B2VH 2ADFL 5C0IB 2DS4A 4HS3A 3VH8G 4NQCA 4FQQB 2A77H 4X6CF 1EZVX 1F11B 4PD4K 1QG3A 3GSXB 3KYMA 2AQ1A 3QUKA 2KH2B 1A6AA 4PJ8B 5DS8A 2BVPA 1ZT1A 4HS8H 3B9EA 4MAUH 2Y25A 4TUJA 5C0EA 3SO5A 4KDWA 5DMKA 3LIZH 3Q5YA 2Q1EA 5HHMB 5IKCB 3NCEB 2OL3B 4I0CC 1OHQA 1QFUH 4HXBH 2BOCB 4TSBH 3HZYB 3JV6B 1XGPA 5E8EB 1I4FA 1MCQA 1CGTA 3HMXH 3CDGA 1J1PH 4AIXA 2XY1A 1IKFL 2F74A 2YD7A 3AREB 4D0DB 4YHZL 4AIOA 5LVEA 4Z8FH 1NEZA 2ERJB 4NQVA 5J1AB 4CADA 1EGJA 1FSKB 5IFAH 1I9EA 2DQCL 5GPRA 2R2CA 1GGCL 5ANMA 3ZYZA 3HR5A 3BGMB 3QXUA 1T7ZA 1EA9C 4OLXH 2D0GA 4JZJA 4LLDA 4YXLH 4C83A 5KS9E 3C5ZD 3VCLA 3O6ML 4OV5B 3JVGA 4PLKC 3CK0H 3HAEG 1AHWA 4G8FB 3LQAC 1R24A 5C2BL 2VLRA 3RZWA 1ZVHA 3O9WA 4KK9C 1BF2A 3CVHB 3SY0B 5AZEH 3SEPA 1UM4H 1HEZB 3QIUC 3UPRB 4WU7B 4LHUB 3QIWD 4PIRF 4CDGC 4BQ8A 3VFNB 2K9UA 4XVSH 3LY6A 4JM2F 1SY6L 2NX5D 1J12A 3JWOL 1HDMB 1U9KA 4N1CA 1Z3GL 4YR6A 1D5BB 3P4MA 1BVZA 3MA9H 5E2TL 1R3IH 5E8NA 3H3PH 2JJSA 1EVUA 4LVHB 3BN9C 4ODWB 1VGEL 3K1KC 4XCFL 4PGJA 2NX5A 5DVLA 5BMFL 4UILL 3GBLA 1AE6H 4OSUH 1JNNL 4XBEL 1A1NB 3FN9A 5I1IL 1JHTB 3OKMB 4HUWB 4GMSL 1YQVH 2OR9L 3SDCD 3W9EA 4RAUA 1P7HL 5DUBA 2BFVH 4G6MH 5C0CD 5J6GB 3MCG1 2VLLB 2D4DA 1A0QL 6CGTA 4U1HA 5JOFB 1A7RH 5KJRL 4OI8A 1NGPL 3LHPH 4L8DB 2AP2A 1X5HA 3EOAA 1WIPA 3TJHD 1QQDA 3HN3A 2BK8A 5C0CA 4UAOC 3VGDA 4U6XB 1CD1B 5E2WL 2GFBB 2G60L 3MA7B 2CPCA 3BRGC 4B41A 1AGEA 5F8QC 5DUPL 1ZVSB 1R3JA 2HLAB 3JWNC 4M48H 2B1AL 3SDDC 4NRXB 1I1AB 3C60B 5IFJB 3DI2B 2HJLA 4P2CG 1H3TA 4Y88A 5DJ2B 2UZIL 5TDPA 1HINH 5CP7B 3TO4D 1I3GH 4F7CB 4OUUB 3RY4A 3THML 3MROB 3WO4B 4LLVA 1QR4A 1GVIA 3KPRB 1CIDA 1KCUH 3IJSB 1IGIH 2AABL 3TLRA 4WY7H 35C8H 1N64L 3PWPE 1AR1D 2A0LD 3VMPA 3TO4A 3ARZA 2I5YL 2ZJSL 4RA0C 2I60H 1PLGH 4QOKE 4F7PB 4Z7VB 3H2WA 2BVUA 2OSLA 1R5VB 4MQXC 5GZOC 1A4JB 3QFJE 1AD9A 2PO6C 5CEYA 1UXWA 1EFQA 1FAKT 4OZGB 5FYKU 3F58L 4Y2DB 4L29A 1JZ7A 1RUMH 4R96A 5LGHH 3V4UL 3SQBA 2ZSVB 1GYAA 2P49B 4IRJD 3PWNA 4OCXL 1F4WH 1RPQA 2ARJQ 5F7NC 1DUZB 3TCLA 2C7UB 1MH5B 2YPLE 1NGZA 2XICA 1ROWA 1XF3A 4JKMA 1JZ5A 1ZHBB 1UWEH 4U7SA 1T83A 5E00B 5J13C 3I2CH 4IRJA 4S10A 4LLMB 3RKDD 4WVRA 1TITA 5GGSB 1OGTA 2D7NA 1YEDA 2HJKA 2IH3A 4N90E 1CE1H 3J7HA 4PV9B 1A6VL 2R2EA 4Y8DC 2EDXA 3ULUF 4R0LB 5J4MA 2DJUA 4PP2A 5FUCE 1QRNE 2AXGA 4JRWA 4WI4A 1BZ9B 3BWAB 4ONFH 3VXOA 2B2XL 1NCDH 1C8PA 2L0DA 5DHYA 4H1LA 3F7QA 4CVZA 4KROB 1ZTXH 4LRIA 4ZPVB 2R0KL 3G08A 5GS1B 2ADJA 1SBSH 4X6DE 3RI5K 1M71B 1U8LB 3BAEL 4ETQB 1GOGA 1W72A 3DROA 4PREB 2E7CA 3WCYA 4P4RB 2XIDA 3OL2A 3S5LB 2VO5A 4PJ9C 5E6IC 1P7QB 4HWBH 4DGVL 1M7DB 1RMFL 4XGZB 3SE8H 1TJIH 4RFOH 3QHFH 1M05B 4IOSD 4OFVA 3FB8A 1X3DA 4NO2B 2VZTA 3LPGA 3KG5A 2E7MA 2CRYA 1KLGB 1DQTA 3RWEA 2R0LL 1P4LB 3MV7D 5KVEH 3BKCL 4UNTA 1OB1B 2BRQA 4XVTL 2DF3A 5KSVB 4NQSB 4HWUA 4YHMH 4Y16C 2E7BA 3OKDA 1H3PL 3N1PC 4LMQI 1WBZB 4TRPH 5ID1A 4F8QA 3HNTL 4FTVB 2J6EL 5D6CA 2DI8A 3O6FC 5FGRA 3P9LA 3LRSA 1RULH 2YR3A 5GRUL 2P5WD 3GSQB 4MDJA 4MB5A 2Z93A 1PZUB 4FQJH 4XAKE 3FONB 3T8XA 1OARL 3KPPB 3VWJB 5LCVH 5E70A 4PJAA 1IKNC 1PAMA 1TCMA 3EYUH 5E2UH 3RNQB 1GGBL 2HVKB 4KJQD 1ZSDA 2P5WA 5MI0B 3X3FH 3QG7H 4KY1H 5GRVK 4ZUVA 1BFVL 2VJXA 4V2CB 5IVXF 4GT7A 5FO8A 3WFBH 1C5DB 1GGTA 4M62L 4S2SA 4MCZB 1Q0XH 2ATKB 2CUMA 4P4KB 5ICYB 3D25B 1RJYA 1LHZA 4D0BB 1WCBB 1Q1JL 1CCZA 2VXQL 4LOUD 1PBYA 1SM3L 1QLRB 3B2UD 4CNIB 2E7LC 5D7LE 3EYFB 1DQML 4ZSOA 2NTFA 1UCTA 3T2NH 4JN1H 3L3OB 4OCWH 5I8CA 3CLFH 4WW2F 4KDTC 2NZ9C 4IOFC 4LHUG 4Z7UE 1ETZA 1GAFH 4GG6E 1PKQE 4MGXA 5EUKA 2CSPA 3FQXB 5F89A 1NCWH 4RGND 3OHXA 5FUOH 1T89C 5BV7C 3OKLA 5DFVD 4NZTH 4WTWA 1Q94A 5D2NE 1NLBL 4Q9QL 4NPYA 1U8PB 4ONGL 1I8MA 1BJ1J 2J1KA 4W6XB 2QSTA 4N0YH 3KXFE 4NKOB 3G5XB 2E9IA 1QBBA 3EYQC 1WTGT 3TN0C 2DQJH 2H32A 2H3NA 4EN3A 3CGTA 1IAIH 5F7YC 2R4SH 4PGDA 2DIBA 1AO7B 1NGYB 3L3HB 4G6JL 3Q6FB 3F62A 5CJQL 4OKDA 1LO3L 2OJZL 3MFFA 4GW4A 1X7QA 3KPOA 4N8CL 1FPTL 3QWOA 2UUDK 2C26A 3SPVB 1X5XA 3D3VE 3W11C 4OCYL 1FNSH 2V17H 1JZ6A 3KHQA 3OR7B 4QRRA 1JP5A 3HNVL 3UBXA 1TVHB 4X7SH 2ARWA 3LKNA 1FV1B 4U3CA 3CFCH 4LPWA 5CILL 1R5IB 3D9AH 3LS5L 2PYEE 3MLUH 1MRFL 4POUB 1NDGB 1LE5B 4ZXBB 5IGXH 5HXMA 1MLCB 3I02A 3P30L 3NPSB 1XIWD 3OAUH 3CX5J 3MZTA 4H0GA 5IMMA 4FOMA 4LAQL 1DQDH 4Z95L 5D71H 4HLZH 2IH1B 4XVUC 2NY1D 3MV8D 4UTBL 1UM6L 4I2XA 5DJ0A 3TBTA 3LDBC 3WJLC 4N8PA 4PV8B 4YQXH 4LSRH 5E9DD 2EDWA 2MKWA 3ARSA 5GSRA 1XIWA 2F8OA 4HF5H 1F5WA 4K3EH 4HZLA 3S8WA 4S11A 1A4KA 3MV8A 3GNMH 4PJDA 4KKBD 3IJHB 5EDXA 1EEYA 3GMQA 1R5WB 4NN7C 4ETYA 1XCQB 5JXEC 3P0VH 4PJEA 1P84J 2CMRL 5IB2B 4YBLB 4LKCB 1H15A 3WFHA 3P4OB 1JGLH 4JPKH 3LQMA 3H9SB 2HKHL 5ESVA 1K5NB 5DQJA 4LK4A 2OCFD 3HFML 4B7LA 3KYKL 3CZJA 3IDYB 1KEMH 1L4IA 3FO2B 1PEWA 3S34H 3UTQA 4LL9A 4L1DA 1AGFB 2B5IB 5CD5D 2VABB 5J9PA 4KFZC 5TH2B 4DKEH 4M8VA 3LEVH 1IAKB 4ZPTB 4LLWB 1C7TA 3PIQB 4RZCA 1YEEL 4UOW0 4JFFE 3BJ91 2Z4QB 4FZEL 1JE6A 4FFYH 3MJ8A 5BVPL 5IV2A 1QFWL 3B6SA 3SGDI 4NC2B 5ID0A 1KCRL 4M6OH 3WLBB 1ZLWH 4YZFE 4Y19E 3PGDA 1U91B 2QHRL 5JZ7D 3PQYB 4DTGL 4RFNC 5F7FA 3JVGC 4PRHD 3VFPA 3MCKA 1AHWC 4O5LH 2BXYA 4WI5A 1K3ZA 3QH3B 1NC2A 5HVFB 1UYWH 1ZS8A 4OQ1A 1FZJA 3C5ZC 2I25N 4PRHA 2G75B 5M95B 2YBRB 3MRHA 1UWXH 2ICWJ 3OKEA 3QHZL 3N9GH 2M26A 3UTZA 3AY4A 4NRZB 5EBLA 1SVZA 4P23B 4KVNL 4N0FA 2VXVL 1L6ZA 1N0XL 2CLRB 3V0AC 4R4BB 1A7NL 3EDJA 5C09B 2PXYD 2F5BL 3QIWC 2JJSC 3S5LG 3RY6A 4JY5H 4EI6A 1FVEA 1CL7L 4R90H 5JLZB 1HYRC 5KSBF 5E1AB 5BJTB 1T21B 2PXYA 4LSDA 3IFNL 1YMMB 4AT6B 2P48B 1CGSL 2NY5C 2A6JA 1RHHA 1DJSA 5K9JL 4XC3L 3RZCD 2Y5EA 2YSSA 1MVUA 3DX8B 1K8DB 2Q76A 4KHTH 1FC2D 5HGAA 3NCJL 4K71C 3PL6D 1NKOA 1BQSA 4K94C 3SKNB 3RZCA 4AIZA 1CS6A 5FB8A 3SDCC 3LMJH 5ACMA 4Z0XB 1JJUA 2AJUH 1A5FH 4O00A 3PL6A 1WBYA 3BEWB 2E6QA 5TE4H 2EE6A 2P47B 1QVOA 2Z92B 3MXWH 4BFGA 4ELKB 5I1HH 1I7UB 2ORBL 3ZL4L 4NBXB 2ITDB 2AJZB 1X5ZA 3TJHC 2XTJB 1QSEE 1R3LB 1X5YA 3MUGB 1OSPL 4Z7QE 1KUMA 3LKRB 3M8OL 3WHXA 4NC1E 3BEVA 1QUNA 1ORSB 3K3QA 2FHBA 5HGHA 1J88A 4FFZH 4P9HC 2K3TA 5F93C 4E5XA 1BBDH 3L1OL 3DMMC 1ZGLB 3V95A 1XH3A 3C87A 2AXJA 3F12B 5IB1B 3ECBA 3AB0C 5B38B 4KDVA 1FN4A 43CAA 1MLBB 1T1ZB 2HFFA 2OM5A 2B0SH 1EO8L 1CE6A 1SY6A 1KCSL 1RZFL 3D5OF 1RIVL 1CDGA 2IG2H 3G9VA 1MFBL 1WTLA 3AC0A 3CFBA 4L4VB 2VDOL 1CGXA 4WUUB 1AR1C 1RZ7H 4I0PB 3HCVB 2A0LC 2XTLA 3FZUC 1I9IL 3O6KL 1S9VB 3QFJD 4I4WA 3ZKXB 2FJFB 3HUJF 4PJGE 2Z8SA 3QYCA 1S5HB 2R2HB 5D1ZB 5JORB 1J0KA 2HT2D 1W8NA 5DJAA 2Q7NA 3BUYA 3QFJA 1IKFH 3EJZD 3MBEB 4PJXF 4K9EH 4WNQB 3C6SB 2KZWA 1HZHL 4FXGB 4APQA 3C5SB 1OP9A 3MJ9L 1KB9J 4QF1A 2BSTB 2NW3A 3BPOC 1T83C 4NDMB 4RMVA 2NY2B 1GGCH 5DR5H 4IRJC 1MCSA 1S5IH 1JYWA 4ERSL 3WDHA 4NM4H 5KS9B 2B4CH 4N90D 3OKNA 3D18A 4P3CH 4AEHH 2DLFH 3RKDC 3BRFA 5C2BH 4U05A 4LRNL 3REWA 4W4OA 2R69L 4N5UA 2JJUA 5F1NB 3ZKMC 4S1DD 1M4KA 2YA2A 2VC2L 4YHNA 1UH4A 4IOIB 5EBGA 5HDQH 4X9FA 4I5BB 1P2CB 4HIJB 4AQ1B 1SY6H 3EYOA 3GSUB 3NA9L 4HUXB 4BSVA 4DN4L 5H35A 1HSBA 2EDLA 2HRPL 2C3VA 2VLKE 4X6DA 1HNGA 1SJVA 4XB7A 1DFBL 3RDTD 4X7FC 3LPWA 1B0WA 1CICD 4N5ED 3O11B 1KPVA 4ZO9A 2OI9C 2OR9H 1RK0B 1HXMA 1U3HB 4K3GA 2PCPB 1NBZA 1RQ5A 2G2RA 1J86A 4OZ4B 3RDTA 1U8JB 4AMKH 1LD9B 2XZAL 4JB9L 5CZKA 1P4BH 4KTEL 5ALBL 1SHMA 4Z7NE 3FQUB 3HC4H 3C6LD 5AUMB 4K7PX 1NGPH 3MLXH 1NAKL 1CG9A 3WKMH 4G7YL 4J3TA 1C5BL 1U6AH 4JZNB 4Z18A 4EDXA 5E0QA 3B9VA 3T77A 3BPCA 3CIQA 3C6LA 3DYOA 4QY8A 3ARUA 5FGCE 5E2WH 4PB0H 1J1OL 4AEIH 4PLJD 2X4OB 1NLDH 1OP5H 2V9TA 3LQAH 5HDBE 4NWUL 1LO2H 5DUPH 1G1CA 3MRRA 2GIYA 4E41B 1VDGA 1ORQB 1XGRA 2Q8BL 1G7IB 4MNQD 3R0MA 3L6FA 4M6ML 2QTEA 3INUH 4LHJB 1ZE3C 5BOZG 3V8CA 3P73B 4YO0B 2XNAB 1OSZB 5ETUA 4KJQC 1S7QA 4TVPE 4LEXH 3SOBL 1DL7H 1FFPA 1BJ8A 4MNQA 3U48A 1CTNA 3F8UB 1MJ7L 3CNKA 2I24N 4PJHE 4G80A 3PWPB 4HLZG 5D7LD 1BLNA 1O5DT 3L5XH 4LOUC 2ZJSH 3PGCB 3LKQB 3VD3A 3SGKA 2X4TA 3B2UC 4QOKB 4YDKL 4CGTA 5D7LA 1JHLL 4ZFOL 2NLJB 4ZFFA 4DKAA 2AJVL 4O4YL 4HKXA 2ZCHL 4GUPB 4NKMA 3MO1A 3UTSE 4FFVD 4XCYA 3BSZH 1IZJA 2IANE 3O45B 4GSDH 4GG6A 1PKQA 1BPVA 2D2OA 4KV5F 4M5YH 2C1PB 5TPWL 1A9BB 1AGCA 5DFVC 4AENB 2LU7A 1CXKA 1KGCE 3LQZB 5D70L 5D2NA 5SWSD 3NFNB 2VITB 1S7VB 1YYLL 4JN2A 2J6EA 1RU9H 3WBDA 2Q8AL 4X99B 3KXFA 4UMGA 1EJ6A 2WUBH 4IHOB 4PRBB 3VXMB 4TUKL 3BP5B 5C07E 1A6VH 4MS8C 4LCCA 5DSCB 5DJXA 4D9RE 3GJEB 5ITBH 4R4FL 2OTWB 5EZJB 1JYVA 1QRNB 4U31A 4YXHH 1A9EB 5F7WC 3NCYS 1G7JA 5K9OA 4BZ1H 4NJ9L 4ZO7A 3O3AB 1F4YL 5BVJB 1F2QA 2AJSH 2XZQL 1LVEA 4I18B 2IQ9L 5EIQA 3BP7B 4IDJH 3VD9A 4F9PA 3RWDB 2V9QA 1PDKA 3EYVA 3LKPA 1VSCA 4UIMA 5FYKL 2O5ZH 1FNEA 3O6LH 5M94B 4DGVH 1RMFH 4FMFA 4X4YA 1S7RB 3U0WL 1T5XB 1CD9B 1MREL 1XIWC 3L3GA 1J11A 4TPRH 4PJ5B 3WDJA 1F3RB 2WUCH 1MI5E 4O2EB 3QXAB 4WU5B 5B38G 3D0VA 3GO1H 3V6ZA 3FQTB 3DPBA 2EZ0C 1IM9D 3GMOB 3IRPX 3WD5L 3DNKA 1MFAL 3HZKB 1EAPB 5DHXB 4V1DE 2ZCLL 4ZOBA 5C0BD 3EO9H 2O61A 1RZGA 5IK3A 4WHCA 1PYWA 4URTB 4KKBC 5F96H 5C6WH 2V7NA 5DVNA 3T0EE 1IM9A 5IQ9B 1HHIA 1OD7A 4ZD3L 1SQ2N 2VDNH 3VXRD 2W1NA 1UZ6F 4U6YA 3TNMA 3I3BA 4PJFA 2F8VA 5IEHB 4FQHA 4F58L 3HE6A 1MQ8A 3FT2A 1ADQL 1QPPA 2J4WH 3AS1A 3VXRA 2CLVB 4HGMA 4WFHD 3TIEA 4YHLH 2FJGA 1KENH 2VIRA 3E6FA 4FQCL 1CBVH 5E99L 4OGXH 3TIDB 3DXAE 2DYPB 3HRZA 3KJ6H 4LSTL 4M62H 4DKFH 4X4ME 1WVZA 2Q86B 1ZA6B 4Y19D 3BDYH 1K2DB 4HBCL 4JFFA 4ODSL 5FYKE 5K59E 4B53A 4MYWB 4PLOB 2RB8A 4WWID 4ODUA 1J87A 1DQMH 4TOYL 2OP4H 4LVNB 4S1RL 4Y19A 5IB3B 3ZT7A 3QG6A 3QO0B 1KCKA 3VI3E 5JZ7C 2CLZA 3UJIL 3GBML 3BH8A 3BZEA 4Z7UB 2GITA 1AI1H 3GMPB 4G6FD 5J0BA 5SX4H 4PUBH 3N1GC 3I75A 1VA9A 2YWYA 5D7IF 4R6UA 1KN2H 2Y6SC 3VRJB 2NY3D 4NZRH 4H5SA 2R0WH 3RY6C 3R06B 3BZFA 3DECA 2EDKA 4GLRI 4HIXH 1U8KB 2WW8A 4ODXA 4HIEB 3P77B 1IZKA 2GAZA 4YHKH 1GH7A 1BREA 4H25A 5HGGS 3RUGE 1E27B 1X9QA 3GIZH 3RJQB 3FTGB 1DQJA 3SGEH 5EA0L 1DDHB 2MCPL 4KC3B 4J1UA 4MJID 2ARJA 1B4JL 4LHQB 3D3VB 4HKZA 3RZCC 5DMYA 3SDXB 4DGYH 1UCBL 4P2RD 1YNTA 1OAUH 4KJYA 2RHEA 1Y6MR 3N1MC 3E3QE 3MLYH 1CD0A 1MCRA 4MJIA 5IW6B 5T5FH 3VFMB 1RUPL 4XP1L 4AM0A 3OXRA