1C5CH

Decarboxylase catalytic antibody 21d8-hapten complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
QVQLLEPGTELVKPGASVKLSCRASGYSFTSYWMHWVKQRPGQGLEWIGLIDPSNGRTNFNDKFKSRATLTVDTSSSTAYMQLSSLTSEDSAVYYCVRIAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHIMERIC DECARBOXYLASE ANTIBODY 21D8
publication title Catalysis of decarboxylation by a preorganized heterogeneous microenvironment: crystal structures of abzyme 21D8.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 41
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1999-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5cH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5cH02
2AV1B 5D93C 5KG9A 1ZT4A 1JWSA 3C2AL 1D5MB 4JPVH 2ATKA 4MDIA 1KN2H 5SX5K 4BELD 4H25A 4DGIH 3CH1A 5JXAL 3VW3H 3GSQB 5I0DA 1XF2A 3KR3L 4ZO7A 3FFDB 1B90A 3HAEB 3ME0A 5MENA 1MRDH 1DDHA 1MFCH 2DMKA 2V2XA 2FL5A 3ARRA 1CQKA 4MJ2A 4RGNE 4U1NA 3EFFB 5IFAL 5BQ7B 3LAFA 3QDJB 2HLFC 1CCZA 4PJAE 3QWRA 3U0WH 1MQKL 5JORA 3ZE0F 1MREH 3H9SD 3QNXB 3U2SB 5H35B 4YFEA 4MS8C 1AC6A 4NQEE 5CJ5A 1T04A 4R90L 1U2HA 3D2UA 4NQEA 2FBJH 3IJHB 4PJ5D 4S1DD 1I9JL 4TVPH 4L9DA 3S4SB 3P9LB 5DJ0A 4K94H 3X3GL 4ZS7L 5IB2A 4ZOEA 5CZXC 1FO0A 5D1ZD 3B5TA 2BNQB 5L2JB 2E6JA 4TUJA 4LLQA 1MF2L 2APFA 3B5GA 2FH8A 1CXIA 1FVDA 3HC3H 2VQ1A 2MNUA 5E7FA 4GW4B 4FRWA 5IW3A 2FECI 2HMID 4KKCD 1KBGH 4JDZA 1HH9A 3HE7D 4ZUWB 1RFDL 3ARUA 2VMFA 1QBMH 3VXUE 4HWZB 3V52H 3QXDB 1JF6A 4UIKH 4YXKH 4PGCA 1M7IB 2G2RB 2R0ZH 4P23D 1A6ZA 4LFHG 3FO2A 4QHNB 4OLYH 1IZKA 1MFEH 3WHE0 4AIZB 5FYJU 5D8JL 2EH8H 4U33A 4JGUA 4G6FB 4KMQA 4JFEB 3ARWA 2F19H 5TDNA 2YD8A 2YUXA 2F53A 2AJUL 4YO0A 1C16B 1B0GB 4QCIB 3TNNA 3FFCE 1S7TA 4MNQB 5GZOC 5IP4A 2IH1A 2D31B 2YPKB 3O6MH 3O0RH 4FTVD 1XIWC 5FKPA 3RA7H 5L88L 4F15C 3V7MA 2P8PB 1T4KA 4WTXA 5JOPE 1YJDL 4PGBB 4X8JB 5JW4R 5HYSA 5GRVL 1G9EA 5FYLD 1UM6H 3Q1SL 5FA3B 1QLFA 5I19H 2Y4SA 3FT3B 5CJBA 1UB5A 2XN9B 4JLRA 1P2CB 4GQ9L 5I17B 1Z5LA 3TBSB 3WS3A 5JW5B 1HSBB 4ZAKD 1ED3B 1F4WL 2PR4L 1LE9B 1JUFA 1U3ZA 1FYTE 2E7CA 3HAEH 1NCWL 1QLEL 4KDVA 2W9DH 3P73B 3B3IB 4RQQA 5IB1B 3O2VH 5F3BA 2H6PB 1FV1A 1MHPH 3FQNB 3DMMB 1UXWA 4DK3A 2DLIA 4P5TB 4O51A 4OCRH 3JWNC 3NA4A 3TO2A 3FL7A 2Q3ZA 5F1IA 5LWYH 3OGCA 1WZKA 4ERSH 5ADPL 1UENA 4D9QE 4NT6A 2YD6A 3LB6D 5F7EL 1FQ9C 3CFJB 2MCPH 5JHLL 3MCKA 3N85H 1HE7A 1P4BH 2ICEA 3HB3D 4WU5A 2AERT 1DBML 5AYUH 4NQSA 2J8UE 1CN4A 5HHOE 4HWBH 2ZZUT 1ZS8B 3TFKD 5INCA 4NKDA 1S8DB 4LCWA 4O2FB 2BC4A 3L3DB 2R29L 4PLJD 3VFMA 2F9BT 3OV6A 3MZGB 1K3ZA 3GK8H 2FEDC 2J8HA 3HRPA 3WL9A 2FBOJ 5ERWA 4OZIA 4U7MA 4Z0BL 4N8PA 1NC4B 3FB8B 3FRPA 4HEPG 5DWUL 5SV3A 1IGTA 4U1SB 1HQ4B 1RZIB 3L6FB 5HGGS 1KLGA 1CGWA 1UEMA 1VGKB 3IU4H 1DQMH 1FG2A 2X7LA 4R96A 1DSFL 5EFIB 5JIHA 5TE4L 4D9RE 5DRZB 1PSKL 2GJZB 3EFDL 4GRLD 1O5DT 4H26A 4OM0H 4WFHE 5CGYD 1VFBA 4MNHA 4M7KH 1V3KA 2RQ8A 1LP9F 3W0WE 4QRRB 4KDTC 5JMRA 2X40A 4JN1L 3CD4A 1LEGB 2Q86B 2LABA 3D39D 3V6OC 5DRXA 5I1HL 5DJXA 3CSBA 3SDXA 1HHJB 3KGRA 2ZUSA 4IDLA 5ICXB 4LHUD 3TEUA 4LCIH 4KHTH 4ODHL 5EIVA 3U4BH 1TETH 4K7PY 3S36H 4XAKD 3OAUH 4KHXL 1MCSA 4WI2A 4RNRA 4X6EB 4ZXBD 3NFSL 3EYQC 2NCMA 2HWZL 1ZEAL 2NY6C 1CGVA 4PY8J 3U0TA 1L6ZA 5FUZL 1K8IB 3ARPA 4I18B 2G60L 4LARL 3U1SL 3SO3C 2G9HA 1QEWA 3BEVA 3Q6FB 2CMRL 4AEFA 1FFNA 2Y5EA 4KY1L 3DIFB 4X4YA 4KDTA 1KPUB 5ANME 3ZYJA 3V6OA 2Q7YB 3FOLB 4TOYH 4R2GD 1J0KA 5KVDL 5T1LA 4NC1E 4BSVB 3DSFH 1ZVSB 3KXFA 3UROR 3NABL 4Y0GA 1ES0B 1A7NL 3JV0A 3C5ZD 1H3PH 4ELME 4PRPE 1WZLA 2DWEB 3BKCL 1FFRA 4XBEL 3ZDZE 5BV7H 3HMXL 5KSAB 4PY7A 5FOBA 5B3JF 3RGHA 1QSED 3PNWB 4HKJA 5DUML 3VFRA 5I1IL 4JFFE 5E99H 2XXMB 1FPTL 1EXUA 1EGJL 2VLJA 4H88L 4FQCL 2H2SC 5ETUA 3NIGE 3OHXB 4L3CA 3ARFD 4JFFA 2CUHA 3ALXA 2ADJA 1VCAA 1YC8A 3DX8A 3IYLW 2HG5A 1MNUL 2R1XA 2N7AA 5KSBA 4B50A 1HINL 2H2PC 2LAAA 3WS6C 5I1GL 1CICB 1KPVA 3QQNA 4JRXE 2J88L 4WCYL 2XKSA 3WLBB 4X7FC 3LEYL 5DUBA 3WEXA 5A3ID 1YQ2A 3FQWA 1NKRA 4U3XA 1IGFH 4OBRA 4JRXA 3CDFA 4O2CB 3T2NH 3RNQA 5C9JA 1MIEL 4FMFA 3UXFA 3MFFA 1H0DB 4MAYD 4WUUD 3LCYA 1WBZA 1KLUB 3FQUA 4L4TA 4RGOH 5C0BE 4KK9C 5CINH 5FO7B 5I1KL 3UYRH 3JV6A 3CU1A 2Y36L 1AGBA 1QFUL 4YXHH 3TPUA 1OP5K 3DYOA 3IFOB 4U6YA 1GZPB 4X99A 4PV9B 3GSVB 4HH9B 1RZJC 3QI9B 3SKMA 1NBVH 3TWCL 1D6EA 3C5SB 3UAJD 1DN0B 4B7LA 5ID1A 5DI8B 5D2LF 4YDKH 2JIXA 5D5MF 2YA1A 4ODTL 2KH2B 4K7PL 3CXHJ 4HUNB 4F7EA 2DIAA 4APQD 1PBYA 3TZVB 3IT8D 5A16A 3CX5J 5I74B 5IIEB 1AE6L 3F7YA 4C56B 4Z76B 1UZ6F 2ID5A 4UV4H 3I85A 2ADFL 4OAWA 3BHBB 3MR9B 4PJXE 3BD3A 3WO4B 5EC2B 2Z92A 5ISZB 4PFEA 5D7JA 4K94C 1S7XA 1TZHB 4HJ0D 3X11B 1HCVA 1WBYB 4BSJA 3PHOA 2J4WL 5DZNA 1CFQB 1TVDA 4NQVA 1OD9A 3EO1B 1AO7D 4HPYH 3NH7L 2X4PA 5HDLA 5HHMB 1BZ7A 5ALBL 3MV9A 1CXLA 3C9NA 4DUXA 3QUXD 1IQWH 4V1DD 4EDXA 4H20H 1WLHA 4M6MH 2A9NH 5CWSA 4UNVA 4K71B 2WBWB 3V4UL 3MRGA 1GIGH 3O11B 4YGVA 1JIBA 4GG8A 1NAMB 1ZHNA 4HKBB 1T2XA 4JHWH 1U2CA 1L7TL 5CP7B 2CUMA 1R3IL 1J88A 2YUWA 1I1AC 2QV2A 1JBJA 1KCSL 1T1ZA 5GRYA 3CVHB 3WYRA 2C1OA 1AFVL 4QT5B 3TIEA 3FT2A 3PP3H 2X89A 1X5HA 1IM3A 4LPYA 2F5BH 4U1KA 3RZCC 3QCUH 4R4ND 3DX6A 3PDDA 1JPFB 2R2EA 1S9YA 4NC2B 3BP6B 5DJCB 5H37H 2A6JB 1EEZA 2AK4B 1QQDA 2FYYB 4FN0A 4PJ7B 4L4VE 3AU1B 2X5PA 1NUNB 1F5WA 1MRFH 3BGMB 1NL0H 5I30L 5SX5H 4AIOA 2A0LC 4LLUA 1QR1B 5E8PB 2LU7A 3AAZB 4LVOC 2L0DA 5DO2C 2CDFA 2NY7L 5ESQB 4L1DA 5J0BA 1I1AA 5I1AA 5LBSL 3HS0A 3ROLB 3MOQA 4O5LL 1WQVT 4WV1C 2AJXH 1GC1L 4LCYB 3BW9B 2R0WH 4PRNA 1FFPB 12E8H 4GKNB 4A6YL 1KCLA 4PB9L 1I7TA 5GRUH 4MDJA 5IBLC 2C7UA 4LVHB 2EE6A 5M95B 1FORL 1CT8B 3BRGC 4I4WA 2YN3A 4ZUTA 9CGTA 4EEEA 4QOKA 3ZKMD 1TVBB 4YHNB 1YMMA 3LPFA 3VXME 4X5LA 5EU5A 3MGAA 4NNYA 3F7VB 4F58L 2IFGA 4WV1A 5C2BH 3ZSTA 2XTJD 2VDMH 2X70B 2AV1A 2F5AH 1D5MA 2NTFB 2PCPB 8FABB 3T0BA 3C8DA 3GSQA 1KCRL 4PS4L 1HZHH 4CGTA 2IQ9L 4JRYD 5CFHA 5FUOH 3FFDA 3HAEA 4HG4K 3I50H 5JA9A 1MFDH 5F88A 1IZJA 2WINA 4OUUB 3EFFA 5BQ7A 3EOBB 1UQSB 3QDJA 4KI5F 4M6OL 5L9DL 1JZ3A 4FZ8H 2B8OT 2XKUA 4YUEL 3IDUA 5K9JH 4M48H 1L9NA 3QNXA 4GKSB 3S3JA 1FDLH 5H35A 1FL5A 2E7BA 2QADD 3DWTA 3IFNL 3UTSD 1KB5H 3TF7C 1IGYB 1FVCB 4HWBA 4IRZL 1J10A 1QA9B 3IJHA 3ILPB 4XP4L 3ULUE 3GGWB 4NN6B 3S4SA 3P9LA 1AKJB 3OR7B 4NM4L 4XC1L 2PTUA 3KPOA 5EU7C 2ICWB 3VJ6B 5I8KH 3GM8A 4FABH 1BWWA 2PF6A 5EG6C 2BNQA 2ED9A 5L2JA 1P9MC 3OJDB 4IRJD 3L5WB 2FX9L 3B4NA 4N90D 1OTSC 3EDEA 2C3VB 1N5YL 4Q2ZB 3TBYB 5JXEC 1G84A 1DVFB 1ZV5A 2VTFA 4GW4A 2X4QB 1I9IL 4NBZB 1PG7H 1B0RB 2HFEB 4JFYB 1JN6B 1G9ML 1P7QB 4V2BA 4ZUWA 1ZLSH 1CFBA 5EU7E 4HWZA 1BFVH 2PXYC 5EZJA 5BVJB 1A5FH 1AQDB 3QXDA 5DS8B 4UILL 3MJ7B 5F1SA 3O6FC 1PAMA 4TNWF 1M7IA 1OTTC 4ZPTB 2G2RA 3D25B 1PZ5B 2AQ2A 4OV5B 1HKLL 4PJHB 4QHNA 1P9MA 5H2BB 2R0LL 5CZKA 4AIZA 3C6SB 3FO1B 2FH6A 3OWEA 4JFEA 5E8EA 2BZDA 5JXEA 1K6QL 4ZDHB 3BMVA 1E4XL 1C16A 1B0GA 4WU7B 4ZO9A 4QCIA 3P11H 1NMAL 4P57B 4MNQA 2JJTC 1Z2KA 3W9DB 2D31A 1QYGL 1KIUA 3DMMC 1CE1L 3UPAA 1N7MH 1WZ1H 2V5RA 4J6RL 4P5TC 5C0RH 4MD5B 2P8PA 2P8LB 4K55A 2ZUTA 4HXAH 5KTEL 2DQFB 4X8JA 1C5CH 4PGBA 5CEXB 3WE6B 5F7KC 5E2UH 1SVCP 3SDCB 5IJKC 3P0VL 4X7TB 1I8MB 3FT3A 1ZHKB 2XN9A 4CADB 4M9OA 1CGTA 1P2CA 2JB6B 5I17A 4FFYH 4G8GD 1CXHA 3TBSA 5JW5A 3LS5L 3L5XH 3EJZC 4C54A 1ED3A 1LE9A 3I2CL 3BN3B 5IQ9B 5AUMB 1PLGL 3BSZH 3KYOB 5F6IC 3P73A 2JJTA 3B3IA 1J1XL 4Q9BA 5IB1A 3VFUB 4FNLH 5CHNB 2H6PA 1NBZB 3FQNA 3A6BL 3DMMA 5T5NG 3U7AA 3ZYZA 2RB8A 4PJBB 5FA4B 4P5TA 1SY6H 3KPRE 2NLJB 4PG9B 3IDIB 1F97A 3MV7B 3MUGB 3L3HB 2VABB 3L3JB 2DKSA 4OZ4B 5C0AB 2I5YH 5F93C 3EKCA 5IJKA 5BZDA 4NM8H 1S9KC 3RJQB 3BQUD 4F33A 1ZS8A 3OMZA 1JRHH 1S8DA 3WFDL 3ETBF 1BM3H 5CEZD 4IRSB 4O2FA 3L3DA 4YX2H 2KQNA 1EFQA 1OSPH 4IDJL 2CSPA 2H32B 35C8H 3PXJA 4LSSH 1HXYB 3PABB 4X80L 3L3KB 1GGBH 3D9AH 3WJJC 1R5WB 4YXLH 1NC4A 2LQRA 3FB8A 4U1SA 1HQ4A 1R6VA 1RZIA 2OSLB 1MPAL 3OKDB 4OCMC 5EFIA 3TNMB 4UINL 4PLNC 5DRZA 5DR5L 2AEQL 4I18C 4JFPB 4QRRE 1T89C 5FM5M 1RAMA 1F3RB 5SWZB 5F1NB 2Q7NA 3BPNB 1RZ7H 1EBAA 5T1DL 1K4DA 4HC1A 1LEGA 2Q86A 4MMXC 3RDTD 5IBUG 3HI5H 3B2VL 1HHJA 4GSDH 2AXGB 4FQLH 4XT1C 5ICXA 3KPPB 3WJJA 4N9GB 2C1PB 4JQIL 1T03H 4YWGL 4X6EA 4DEPB 3MV8D 3I6LD 1AH1A 3MLYH 4FG6D 1UM4H 2B4CL 5KSAC 2FO1A 4OD3H 1B2WH 1L4IA 2R4SH 2YKLH 5A2FA 1ZANL 2Y5TB 1V7NH 1KUMA 3IDXH 4I18A 4OGYH 2OP4H 1T89A 4MHHI 3HNTL 3A0OA 1KC5H 2M1KA 4KVCH 3WJLC 5LXGL 3CMOL 3DIFA 1K9TA 1KPUA 2OJEB 2VDNL 2ZJSH 3B83A 1INDH 1JYXA 3CVIL 2Q7YA 3FOLA 1MCFA 4JM2F 2IPKA 3UP1A 4BSVA 1ZVSA 2EDKA 2IG2H 1J7VR 1CICC 5C7XL 2FHBA 1ES0A 3QUYD 2DWEA 3NCYP 4JO3L 1DTUA 3K8KA 5KSAA 5JW4Q 3ZDXF 4LSTH 4WHCA 3PNWA 1UWGL 3ARDB 4JHBA 2LVCA 1URLA 5HI4C 4PJGB 3STLB 5IFHH 5ICYB 4Z7WF 2OR9H 3WJLA 3JV4B 1R5VB 2OX5A 4M6NH 4ODVL 3T4YB 3EUUA 1LP9E 3RQ3A 5MEND 5LGKA 2WWMD 1SJHB 1LO3L 2PW2B 4XVSL 5DMGD 1A7PL 1TLKA 5C0DB 4X6DB 1CICA 2HFTA 3P4NB 1UCBH 5HSFA 3WLBA 4G8EA 1EFXB 5AG8A 3KNBB 3QWRD 2OZ4L 5C2UB 4K3DL 4RGND 1MQKH 1B6DA 1N2RB 3TZVC 2D0FA 4O2CA 5I74C 4I3RL 1H0DA 1KLUA 1MY7A 3D2UD 5FO7A 3UMTA 2XXCB 5EZIL 3ZKNC 1Q9WB 4L8CA 1ONQB 1KV3A 4NQED 5TE6L 3WO4C 1I9JH 3IFOA 1GZPA 4ZS6C 4OF3A 3X3GH 3GSVA 4ZS7H 4ZFFB 4LAQL 4HH9A 3QI9A 5GPRA 5CZVL 2EECA 1NDGB 3C5SA 5A2JH 1DN0A 1DBKH 2BNRB 2XQBH 2HLFD 5I1JL 6FABL 1MF2H 5DI8A 5T5NF 3O6KL 4Q74A 2VXVL 1OAQL 5I8OL 3TZVA 1CE6A 4K71C 4C56A 4LDLB 5B3JE 4MS8D 3OKOB 3QUKB 2ARWA 4Z76A 5L6YL 4DWHA 3BHBA 2XYCA 4EI6B 1JGDB 3LQZB 3MR9A 4MJ4A 4M1DL 5EC2A 5ISZA 1QO3B 5CIPB 3GMOB 4GRWB 3X11A 1WBYA 1JZ5A 1U8KB 1CFQA 4BQBA 2FGWL 4NOBA 3EO1A 3QEQB 5CZXD 2IANE 4MD4B 5EN2B 4NPYB 2C4XA 32C2B 1U58B 5KANG 4J3TA 4KJYB 4I77L 1H8NA 3JTTB 1IC5L 1NLDL 5DD1H 1IGCH 1NGPH 2F53D 2Y06H 3OGOE 2AJUH 4B53A 3O11A 2EDFA 1UGNA 4TSBL 5CEYB 1NAMA 2EDTA 2VL5B 4HKBA 3OR6B 5ILTL 4KQ4H 4UQ3B 3AROA 1BECA 5CP7A 3IFPB 5L88H 1TVHB 4HPOL 3K1KC 3MRRB 2VH5L 2R1YB 1YJDH 3EO0B 3O3UN 3T4AB 4J8RB 3VCLB 3CVHA 2R4RL 4QT5A 1KYOJ 1E0OB 3Q1SH 3DV6B 4NOFA 3QIBB 4LVHC 5D2LE 4JPWL 5D5ME 1MAMH 4IMKC 4QLRA 1JPFA 3AXLB 4Y4HB 5DJZA 5EZOH 1F4WH 2PR4H 3SGDI 5DJCA 2A6JA 2AK4A 2W65B 4CVZB 4F2MB 2FYYA 4PJ7A 1NCWH 1QLEH 5T3XD 5GZOD 2FX7L 3AU1A 2DBJA 3BGMA 3FTGB 3IFLL 1XIWD 1UZ6E 1QR1A 5E8PA 3AAZA 4NBXB 5IESL 3LKQB 1UYWL 5ESQA 2DQCL 2BVEA 3CMGA 5KVFH 3ROLA 5GGTL 4LCYA 5EU4B 3BW9A 5ADPH 3QDGB 4UOW1 1B3JA 1FFPA 4PGDB 4GKNA 5JHLH 5TF1L 4JB9H 5BS0E 5F3HB 3BWUC 5JA8B 3GUTB 1U3YA 1MCKA 4X7DC 4IMKA 4TUOB 4HMEA 1BOGB 1CT8A 4LCWD 3QG7L 1J12A 4TULL 4GMSL 2R29H 1TVBA 4G7VH 2MQCA 4YHNA 4J3XA 3SDDB 3F7VA 5E8DL 4HQQH 3T2PA 5DWUH 3I84A 4H5SB 2H8PB 3VGFA 4NIKB 3KS0J 2GY5A 5E9DB 2XRAH 4WENB 2X70A 3HNVL 1DSFH 5TE4H 4ZNEA 2PCPA 8FABA 1PSKH 3EFDH 2YRZA 2BOBA 3MLSH 1I8LC 4CVXB 4XNZB 1GPOH 1DBAL 3VH8B 2F54B 5IBUB 1AC0A 1D5ZA 2JCCF 3QFJD 4JN1H 3W81A 4HWEL 1CYGA 1KT2A 5IVZB 1MELA 5I1HH 1T21B 3GKWL 3MODL 3BKML 1DQTA 2FEDD 1I9RL 2GK2A 2WBJB 4OUUA 3RBSA 2NY3C 3EOBA 1UQSA 5FYKH 1NFDA 4ODHH 2WNGA 1RZGB 2RBLA 2VXTL 2FR4B 1DUYB 3MLZH 3AS3A 4IHOB 3NFSH 3O2DL 1DVFC 3RPIB 4GKSA 1OT1A 4EQ3A 4XCCL 1ZEAH 3HFML 3GRWA 2DD8L 5FUZH 2G60H 3LDBB 5C0JB 1I8LA 1YECL 1IGYA 1FVCA 1UKSA 4YHZH 1QA9A 3ILPA 4KY1H 3T04D 2GJ6B 1AKJA 3OR7A 1J8HE 4LLMB 1M7XA 2ICWA 3VJ6A 4IS6B 2EIZB 5T1LD 4MD0B 1QSVA 4KJWC 3KXFD 3OJDA 1LQSR 3L5WA 2WWKO 1JZ6A 4NO0B 2NXYB 3BKCH 2C3VA 5JOEA 3EYQD 3TBYA 2ZOKB 1DVFA 3EYOA 2NY6D 2X4QA 1IGJB 3OX8B 5EUKB 2NW3B 4KZDL 1EBPA 4R4BA 3VG9B 1A9EB 2IADB 4JFYA 1JN6A 2X4OB 3EDFA 2BVQB 2APWA 5I1IH 1P7QA 2BSED 2VLJD 1FPTH 4XP5L 1UFUA 4FQCH 3NCBB 1MEXL 1AQDA 3OG4B 1T7YA 4I0KA 4UT9L 1AR2A 5AD0B 1RUQH 4R97B 3VGBA 2BJML 2NX5E 3VFVB 1EV2E 3WUZA 4ZPTA 3D25A 1PZ5A 1MNUH 4OV5A 3CDGB 4PJHA 4DW2L 2W0PA 1HINH 1W72L 3OQ3B 3T2OA 4UNTA 3C6SA 5I1GH 3FO1A 4LSPH 3WBDA 2AW2A 4CN1A 2J88H 4WCYH 4JFOB 1VA9A 4HFWB 3LEYH 2BVPB 4KI5E 3OAZK 4JRXD 1TITA 3EO9L 4ZDHA 4WEMB 4ZG1A 1V5JA 3BEWB 4WU7A 1F6AB 1MIEH 4P57A 3QDMB 2CR3A 3W9DA 2IBZY 4L4TD 4XXDB 2H2SD 2AXJA 3L3OB 3IF1B 5I1KH 4MD5A 4HD9A 5L7XL 5I73B 1BBDL 2Y36H 2DQFA 1JP5A 1QFUH 5CEXA 4LOUC 2EKSB 3REWA 3S98A 4WHYG 2H2PD 3QH3B 5F1OB 3SDCA 3RHWF 4U1JB 2EDNA 4R8WL 4IBLT 1CG9B 1WWCA 4PJDF 4PJCF 1I8MA 3G08B 1ZHKA 4CADA 2JB6A 4HX1B 2JIXD 5CLTA 4U7SA 4ODTH 3VA6A 5IQ9A 4K7PH 4H0IA 5AUMA 4IRSC 4HZLB 5E1AB 3KYOA 2ZPKL 1LHZA 3UBXG 2E3VA 1A4JA 2Y23A 3VFUA 4S2SB 1IARB 4KK9D 3ZHDA 5M94B 5CBEB 3CFCL 3OG6B 5LQBL 2Y9RT 4PJBA 5FA4A 5J1AA 2ADFH 4NRZB 4Y5XC 5C0AE 1ADQH 4KXZH 3IDIA 2J6EL 4PG9A 3MV7A 4DZ8B 3MUGA 3L3HA 4GKOA 2VABA 3L3JA 2AXHA 4OZ4A 1AXTL 4EVNB 2VIRB 1T7WA 5I1CL 1MCCA 1XT5A 4Y7MA 4GS7C 3GSXB 5AEAA 3SGKC 3MV9D 2CK0L 5JHDE 3JBG7 2OCFD 4QF1B 3VI3F 5E00B 3BPNC 2VUYA 4AQ1B 2ESVB 1F2XK 5GJTL 1PDKA 1XCTB 4IRSA 2IC2A 3QPXL 3TIDB 3V4UH 2H32A 5CKGA 1IAIL 1NEUA 3PABA 1QOKA 4NGHL 6CGTA 3RWGB 3MRFB 2HA1A 2F8VA 4Y5XA 4D94A 2EDHA 1L7TH 2WUCL 2CD0A 3WSQH 2CJUL 1R3IH 3HZMB 3UCRA 1A6VL 3OKDA 4K3JL 5SWZE 3TNMA 2IBZX 4JFPA 5CMAB 2FJGB 4DKDC 1Q0YL 3SGKA 3EOTH 1VERA 5F1NA 3VXSB 4JQXC 1BREA 5F44A 2X89D 1M1SA 4HS8L 5FGCE 4G6ML 3SCMB 3IKKA 4EUPG 2OBGA 2AGJH 4MJIE 4HV8B 4PJDB 4PJCB 1DP0A 4LGPB 2VLKE 3KPPA 2P4AB 4N9GA 2C1PA 5MHSE 5I30H 4F37F 3GNML 3ARSA 1S5IL 5DA4A 3LEXB 2MQ3A 2C3GA 2BRQA 1I1AD 2NY7H 3IETB 4OQTL 1YJDC 5LBSH 2Y5TA 4O5LH 3ARDC 4E5XB 1GC1H 3LN4B 1J05B 4M7LL 4JQXA 4PB9H 4Z6AT 2HJLB 3B9VA 5DVNA 3KYMA 3RZCD 2OJEA 1CDGA 1OP9A 4PJEA 1FORH 3PWVA 3R1GL 2DWDB 4QOKD 2AJYL 5C09E 1YMMD 2BY2A 4MQXC 5KZCD 2A0LD 4G42B 5GS1C 1VHPA 3SJVE 5DO2D 2GEEA 4XMKL 1UKTA 3BUTA 4BM7A 1RZFL 4F58H 4NCC1 1RU9L 4WGWB 1N6QL 3ARDA 1A3RH 4MAUL 4KDWA 4PJGA 1T2QL 3DGCR 3STLA 4KKAC 5ICYA 4Z7UA 2HRPH 3JV4A 1R5VA 4LSRL 5IBLD 3ELAT 3T4YA 1KCRH 4GMTL 2VLME 2DM2A 5T1KB 4U2ZA 4M7JH 1SJHA 4OI8A 4O9HL 4YDIL 2PW2A 2VSCA 3L3GB 5C0DA 1HXMB 4X6DA 1H3VA 3K8MA 3P4NA 4WGVB 1CLCA 3F62A 1I3UA 4X5WB 2Y25A 3QDJD 1EFXA 1G9NH 5GS1A 3KNBA 2YK1H 4M6OH 5L9DH 3K0WA 1LVEA 1OW0C 2JJWA 1N2RA 4OGXL 4TSAL 5TPWL 4Q9RL 4U6VL 3F6LA 5E56A 3K2UH 4JG0H 5JNYB 1JZ2A 1DQJB 3WNPA 2RGSA 3KDMB 3IFNH 1Q9WA 3HCVB 4LDOB 1KXVC 4WFGE 1TJIL 5C6TL 1ONQA 4IRZH 3CSGA 2R1WB 4XP4H 1FSKB 2P5WE 5IGXL 4DN3L 4NM4H 4PJ5B 4DN4L 5E2TL 4XC3H 3UYOD 4ZFFA 2VO5A 2BNQD 1ITBB 5F7WC 1MJ8L 4LCUB 3CAFA 1NDGA 4QRPB 1JZ7A 2BNRA 4AIXA 1KEGL 4NZJA 5D1ZB 2FX9H 5FV1L 1MUJB 1I75A 1Y18B 1OW0A 3VD3A 4UBDC 1N5YH 2VN7A 5HDQL 4WNQB 3U30B 3OKOA 3ZDXE 3QUKA 1I9IH 4XNYL 4EI6A 1JGDA 3LQZA 2VDOH 2MHAB 4Z7WE 1GJIA 3T77B 1AXSB 1QO3A 2Z8WC 5CIPA 5IB4B 3DHMA 3GMOA 3QCTL 4UILH 1U8KA 5HGAB 3QEQA 3TVMB 5A2LH 1R3KB 4MD4A 2P5EE 5EN2A 4P4RB 4DVRL 4NPYA 32C2A 1U58A 4UZGA 4KJYA 3N9GH 1BIIB 3JTTA 4G6FD 4NN7B 5I18L 1OTSD 2JB5L 3QIBC 4JFED 1MCOH 1CDUA 3VGEA 5JXED 5DGQA 1K6QH 5IK3B 3EGSA 2R56H 1E4XH 4TTGA 4MNQD 1CDYA 5CEYA 1XF3B 2VL5A 4L3EE 3OR6A 1IQDB 4UQ3A 1AHWC 1AGCB 1QYGH 2PXYD 3VRLF 1QFWI 3IFPA 5J6HB 4J6RH 1TVHA 4CU8A 4KTEL 3O6FD 3RVUC 1T0MB 4OZHF 4YIQB 3WNOA 3MRRA 2R1YA 1X5AA 1C5DB 1OTTD 4QO1A 3EO0A 1OVZA 3T4AA 1FLTX 4J8RA 3VCLA 1RV6X 3ROOB 3WNLA 2M2DA 3AMKA 1T83C 5DHXB 3P0VH 5DHYB 4G3YL 4LBEB 4U49A 5TDPB 3DV6A 3WIHA 2XN9D 3QIBA 4MA7L 1KIRB 3GBNH 1U8LA 3QXAB 4PRAB 1KXTB 3UBXB 4Y4HA 3LS5H 3AXLA 1DBBH 3GSNB 3WHXB 3I2CH 1CZ8H 3PWUB 4CVZA 4F2MA 1YQVH 2DQIH 3O3DB 5FHBL 5J3HC 3SQOL 1J1XH 4UUJB 4JPKL 3QISA 3FTGA 4P99A 3O4OC 3DMMD 2P7TB 3G04B 1MAKA 1IC1A 3A6BH 3GDBA 5IR1B 4P5TD 1FGNH 3LKQA 1CLYL 3TN0B 1V3MA 5E1HB 1AI1L 1RZKC 5EU4A 3VFGH 3DRTB 3QDGA 1KCUH 3VXRE 3LPGA 1T83A 4PGDA 5TGBB 1U8QB 2IMMA 3SE9L 1JYWA 5F3HA 3EYUL 4XNZC 3GUTA 3TO4B 4P9ML 3RTQB 1XF5B 3CXDL 3EJZD 3CSYA 4TUOA 4Y4FB 1BOGA 4MQSB 2RCSL 3G5VB 4IDJH 1MJ7L 1DEEB 4OB5L 4HUUB 2W0KA 2FDBP 5J7CC 1E6OL 4X80H 5LCVL 1RIUH 4GKZB 1NC4D 4OJFL 3SDDA 4Y88A 4KK6C 1INEL 3CJJA 1F11B 2IEPA 4X8XA 4H5SA 1MRCH 2H8PA 1WZMA 1ZLVK 5E9DA 1MPAH 4NQDB 3MLXH 4UINH 1DUZB 5DR5H 3ZTJG 2F54E 2AEQH 3LDBC 4HLZH 4X5XB 4OZHB 1E4XI 1ZAGA 1ZSDB 2BRRL 2C9AA 5HDBF 2EDRA 3ESVF 3VH8A 4EUPB 2F54A 3WO3B 3OB0K 1H8OA 1SMAA 1EHAA 2DJUA 2VXUL 5IVZA 4RFEB 5FV2A 2VXQL 1T21A 2P49B 2XNAB 3B2VH 4L9LB 1R24B 3D39B 1KTKE 1MH5B 2WBJA 4PTUA 4HG4J 4F9PC 5GGUB 2IAMB 1ADQA 2XZCL 1RZGA 2NXYC 2FR4A 2GQHA 4XVTL 3BAEL 4R4FH 1DUYA 4I48B 4YWGH 1P53A 1HHKB 4IHOA 2HVKB 1S7SB 3RPIA 2B4CH 1CFSB 1Z3GL 4ESKA 4NRXB 1T7ZA 1F13A 3VG9C 2YBRB 3RWFB 3KPNB 3FZUC 2GJ6E 5C0JA 4PUBH 1J0YA 2FATL 2GTWB 4JY6B 3CMOH 3WHE1 2GJ6A 4LLMA 2VDNH 3FQTB 4HFUH 1CL7L 3CVIH 3SOBL 1KB9K 4IS6A 4WHYH 3X13B 2EIZA 4MD0A 4MB3A 5ACLA 3RVWC 4WRLA 1XR8B 4S1QH 4R9HA 4F9PA 5C7XH 4NO0A 3SY0A 4BH7B 3IXAB 2XKNB 1SYVB 2JTDA 3JWOH 5KSAD 2ZOKA 3SGEI 4GXUM 5D7SH 3OX8A 5EUKA 2NW3A 4HK3J 1ZA3A 2AKRB 3IAGC 3GSNH 1A9EA 1UWGH 2X4OA 2BVQA 2XV6B 3OXRB 2V5TA 4UT7L 5J89A 1IFHH 1L0XA 1U91B 4HIHA 1GHFL 5AD0A 4KGJA 5I73C 3VFVA 1WFTA 2JCCE 3VU2A 1INQB 4JR9H 3VD9A 3MCLL 1LO3H 1K85A 1A7PH 1CICD 2VR4A 5DJDB 4HIEB 1NCCH 4JFOA 4HFWA 2WQRA 2BVPA 2DKMA 4OZFH 4QEGA 5IROC 2OZ4H 4Y1AD 1JPST 4I3GA 3S97C 3BEWA 3X14B 1F6AA 5BW7C 4Y16C 3QDMA 3QUML 3HG1B 4I3RH 5HI4D 3AB0B 5F72S 1W8NA 5KVMC 4XGZB 4XXDA 1NBQA 3ARXA 3HUJB 3CDYA 3L3OA 4N9OB 5EZIH 3IF1A 1ZGLA 1BJMA 3T65B 5TE6H 5I8EB 5B39G 2B5IB 4OFDA 3S37X 5HJ3B 3LMJH 3VD5A 3ULVL 3QH3A 4NBYB 5E6YA 1XH3B 4LAQH 4Q97A 4Z7VB 1CG9A 5CJXC 1G9NC 3DVNB 2GIYA 3G08A 2AJVH 4HX1A 5I1JH 3GHBL 6FABH 5IROA 3O6KH 3PQYE 2VXVH 1OAQH 4X6CF 5GGRY 4EUPH 3LIZH 3TZVD 5I8OH 4HZLA 5D70L 5E1AA 3GBML 4C56D 5BW7A 1X5XA 2Q3AA 5TQ2L 1CGYA 1CFVL 4S2SA 4YK4B 5L6YH 5CBEA 3ZKND 4GBXB 4NRZA 5ISZD 1PZUB 1S3KL 4DZ8A 1V05A 2V2TA 1UC6A 3BPOB 4UT6L 2PW1B 4HEME 4EVNA 2VIRA 4ZS6D 3V0WL 2FGWH 1R3HB 4FQ1L 2VL4A 3GSXA 3MLWH 4POUB 5HHMD 1O0VA 1L7IL 5CJXA 2E6QA 4QF1A 5E00A 4I77H 3F58H 2ESVA 3LOWA 1IC5H 1R5IB 1XCTA 3SCMC 3MOAL 1CGUA 5GGSB 3UX9B 1FE8L 3TIDA 1W0VB 2CQVA 1FBIH 3SBWC 4N0YL 4TSBH 3WUWG 3RWGA 4F7CB 1CI5A 2FB4L 3MRFA 3V0AC 1RMFH 3HZMA 2ATPB 4HPOH 1YZZA 5FYKU 2VH5H 4OFVA 3HC0B 5DGRA 5CMAA 5J12B 3S3PA 3U9PL 4E41E 2R4RH 3VXSA 2ED8A 1J11A 4MXQC 3UJJL 4KUZH 4PJDE 4PJCE 4U2YA 2R69L 3SCMA 1Q94B 3MUZ1 2RJMA 2X05A 3DNKA 4JPWH 1WBXB 4AZ8A 4JAMB 3ARVA 4HV8A 4PJCA 4XHJC 3SBWA 2AK4D 4ZFZB 1HKFA 4RRPG 1KCKA 5IHUL 1JFQL 2FX7H 4NHUA 4ELKA 3DGGB 5F9OL 3S5LG 2H1PL 3IFLH 3QEUA 3LEXA 1UYWH 1NCAL 3IETA 4OCSL 4FFVC 3O4LB 5D7KE 2GFBB 1WJ3A 5GGTH 4KZEH 3OAYK 1M71B 2ZG1A 2OXHA 4E5XA 2I60L 3LN4A 4OT1L 2D9QB 1J05A 3M8OL 1I1RA 3GEWB 2DDQH 2V5SA 2B0SL 4UAOC 3ZO0A 2HJLA 2YPLB 1WFNA 1G0YR 4NN5B 4PP2B 2EC9U 3ZZ1A 1VFAB 3C09C 3GIZL 3C6LC 2HJFB 4BFBD 3MBEB 3VWKB 3QG7H 4YHOL 4FQJL 2DWDA 4GMSH 4TULH 3VGDA 4UV7L 4Z8FL 1PY4A 3CK0H 4G42A 3JTSB 1P84J 5SWSB 5IMKB 4P2CG 5E8DH 1BQHB 1RIVL 5DMIL 4PP1C 4XXCC 5FKAB 1OAYL 4ZD3L 3HNVH 2CRMA 4PRDB 2Y07L 5FYLL 1DBAH 1RULH 1XAUA 1FSKC 5T1KA 3STZB 1JGVL 2UVFA 4HWEH 3FT4B 3L3GA 2VDQL 5BMFL 4Y19B 1UT9A 2EC8A 2HTLC 1HXMA 2AAVA 2ILLA 3MODH 4BZ1L 2W91A 4X5WA 4HF5L 4RMQA 5AG9A 5HYJB 3MGOB 2Z91B 3MRQB 3NBNA 2R23B 4FQIL 2VXTH 1OCWL 1X3DA 4Z7NF 2EEAA 3H9SE 1RK0B 3SKOB 2Y6SC 3GMNB 1MCRA 3O2DH 3K74B 4XCCH 3U30C 3DBXB 3HFMH 5JNYA 1DQJA 2DD8H 3KDMA 2F8XC 1FN4B 3HCVA 1YECH 3NAAL 4H8WL 4PJ5E 2N56A 2DBLL 5DA0B 2R1WA 3OKKB 3F6IA 2ARJB 3QB7C 2F74B 4U0RB 1AKJD 5EO1B 1MI5B 3OJVC 2JJVA 5D6DC 3MYZA 3TVMC 4DGVL 1T66C 4MNGB 4RMTA 4GXUN 2FIKB 2J8OA 4LCUA 1GGTA 2NY3D 4QRPA 3EBAA 4GG6B 4XBPB 5K9KB 5D1ZA 1U95B 4NN7C 4DAGL 1MUJA 3I3BA 4Y5YB 1Y18A 4OD2B 2YUZA 1VGEL 3ARGC 4HXBL 4DOHE 4RAHA 5IMOB 1DVFD 4ZPVB 4MXWH 4RMWA 3NN8B 1EO5A 3CDCA 1IILE 1P7QD 2MHAA 5B4MC 4KH2A 4XP5H 3T77A 1AXSA 3BMWA 5IB4A 3DO7B 3FO9A 5D7LD 1MEXH 2XICA 4UT9H 4OIAA 3ZT6A 5HGAA 3RP1A 3V5KB 2BJMH 1UVQB 5D6DA 3TVMA 1XGRB 1R3KA 4KJWD 4P4RA 4DW2H 5E5RB 3S88L 4P2QB 5JIPA 1AGEB 3JWOC 2QSQA 3ARGA 4PGEB 1X5YA 5FO9B 4XMLL 3EO9H 1ETZB 1ZTXH 4K3EH 4M5YL 3RI5K 2ZOLB 1NBYB 3SGJC 4YFDB 1IQDA 1B4JL 3JXAA 1AGCA 4PJIF 4JZOA 5B39B 4ZTOH 5DQ9B 5GGQL 1NANI 1T0MA 3TN0C 1N3NB 4YIQA 1BBDH 4HIIA 4GAFB 4Q9QL 1C5DA 4QY8B 2E9JA 4NKOB 1KF9B 4WI6A 1FIGH 2DKUA 3ILQC 5FYLE 5DHYA 4LBEA 4R8WH 3K80A 5D72L 5K9QG 1MVFA 3BZEB 5TDPA 1KULA 3BVNB 1R0AL 1KIRA 4JM4L 3TO4C 3RTQC 3TT3L 3QXAA 3UJTL 4G5ZL 4PRAA 3BDYH 3UBXA 4Y4FC 3CX5K 1JNNL 3GSNA 4JFHD 3WHXA 4L8DB 1NDMB 3PWUA 2EDXA 1ZLVH 3O3DA 5GGVY 5CILL 2UVEA 4UUJA 2YXFA 2K7QA 2P7TA 2EDEA 3G04A 3IS1X 5LQBH 1OD7A 5IR1A 3MV7D 1BQLL 2VQTA 3TN0A 2CRZA 2A2QT 2J6EH 3OB0H 4LOUD 2QQNL 4D9LH 3DRTA 1AXTH 1VKXB 5I1CH 3NCEB 5TGBA 3MYJB 1U8QA 4R6UA 2EXYC 1T0NB 4X4XB 5HHVL 2CK0H 1KSRA 5DJAB 4OKDA 3TO4A 3RTQA 1XF5A 4Y4FA 1E4WL 4MYWB 5GJTH 3BQUB 1FVEB 4IRSD 3QHTC 3FJTA 2EDQA 4HK0B 3WUWB 2DQGL 3V8OA 5C0CB 1DEEA 2HRLA 4HUUA 1IAIH 4LSQL 1JI1A 4NGHH 2IAMC 4GKZA 3VFSB 1NGQL 1F11A 3VRLE 1CR9L 5E8OB 5F8RC 2WUCH 3NACH 4NFDA 1PYWB 4NQDA 1A6VH 4OZHE 2X10A 2OMBA 4MQ7B 1DUZA 3U46B 2VDPL 4X5XA 4OZHA 3LKNB 5CGMA 2EICA 4EUPA 4X4ZA 4X6FB 4HS8H 4JJHA 4G6MH 5ESAB 5J57B 3D39E 4RFEA 3LS4L 1WISA 1DQQA 2XNAA 5L8KB 1MH5A 3X12B 3FO0H 3OKEB 5GGUA 2IAMA 3LQAL 4XAKE 4NC0B 4U4BA 4I48A 3GNMH 4LIQL 1S5IH 1GOHA 2HVKA 2EIEA 1UJ3B 1CFSA 4OQTH 2BVUA 4NRXA 2EZ0C 2YBRA 3RWFA 3KPNA 1YNKL 3P0GB 1QP1A 4KAQL 1I9EA 3VD7A 1DEDA 4M7LH 4ODXB 1BGXL 3BIAX 1KEMH 2GTWA 4GQPH 1S7WB 1Q9OB 3V8CA 3FQTA 3QXVA 3VFNB 4OUOA 3X13A 4M3JA 2X2YA 3LEVL 3R1GH 4O02H 4XCNB 3UTTB 3AGVA 1XR8A 1HYSC 2AJYH 3S34H 2NY1B 1G6VK 3RVXC 4W70A 5GGVL 4BH7A 3IXAA 3ORJA 2IBGA 4K23L 1A8JH 2JLLA 2GT9B 2XKNA 1SYVA 3QUYB 5I1DB 1QSEE 2AKRA 1RZFH 4LNVA 3ARDD 2IPTL 1N6QH 3DXAB 2C4FU 1J8KA 2DLFL 1P4IL 3OXRA 4MAUH 3AB0C 3BGFB 4AJ0A 1T2QH 1A7RL 1OTUC 1H5BC 3KYNB 2D7QA 3S7GA 5HDBE 1RUKH 2XTLA 4Y89A 1IAII 1INQA 5EDXA 4RZCB 5FECB 1Q72L 5I6XB 4R7NB 1NPUA 4MQXD 3AS1A 2PNDA 4NO3B 2VB5A 5CP3H 2M26A 4OBSA 4HIEA 1EFXD 3KPLB 4O4YL 5E4EB 3UDWC 4GO6B 2IWGA 4GRMB 1MCWM 1CK0L 3X14A 5TPWH 4Q9RH 1E4JA 4U6VH 2W92A 3HG1A 3P40A 4WUUE 4KKAD 4MB5A 1BMGA 3HI1B 4XGZA 1OAXL 3CC5B 1H5BA 1F3DJ 3HUJA 4DQOL 3GMQB 4GBXC 2DQUL 4G9FB 3T65A 5C6TH 1QFPA 5I8EA 1BF2A 5FO8B 4ODBD 5C8JB 1IJ9A 2WQ8A 4Y8DC 5IGXH 5I15L 4AEEA 3DROB 4DN4H 5E2TH 1XH3A 5ITBH 4Z7VA 1OHQA 3DVNA 2BNRD 5E4IA 1BZQK 1FG9C 2HJKB 2YZ1A 1KEGH 4JO1L 1G6RL 1UM5L 1CVRA 3UDWA 4NDMB 2V9QA 1BVKA 1EO7A 1OAUL 1BJ1H 3LKOB 1MCPL 4QXTB 1XGYL 5C6PB 2X1OA 1DCLA 4KMLB 1OT2A 1HIML 2VDRH 4LIQE 4XNUL 3LV3B 2NYYC 4G6KH 1DQDL 4GBXA 4XNMB 5IF0B 3VXNB 1HH9B 3U0PB 1BJ8A 2PW1A 3QYCA 1ZE3C 5CJ8A 3QEQD 4FQQB 1AO7E 4EQ2A 4QXGL 1R3HA 4NWTL 2BX5A 5FYKD 2GK0B 4UTAL 4ZYKB 2AV7B 1VESA 4OFYA 4V1DE 3NOIA 2X4SB 3WXWL 1FL6B 1WGOA 1R5IA 5I18H 2DQJH 2JB5H 3DARA 4UBDD 5DT1L 2UZIL 5GGSA 1H3UA 3O2DA 4KRPC 3WIFB 3NGBC 4FMKA 1W0VA 4HGWB 1CTOA 4DK6A 5D6CB 3RUGB 2P8MB 3OAYH 4OZIF 4OTXL 1U41A 1W2KT 4F7CA 3TNNB 1S5HB 1IBGL 15C8H 1YN7B 2IBBA 3RWEB 5MEOB 4OZGF 2IH1B 2I07A 1GZQB 1QRNA 3J8F7 4XVJL 5F96L 4KTEH 5TH2A 4XI5C 2ATPA 1YUHB 5FUCC 3HC0A 1UH3A 2ZSVB 4ZMAT 3RGVC 5JPMB 1F2QA 3QIBD 2VZVA 1Q94A 3PGCB 4I3SL 4MA7H 4NN5C 4OF5A 5SX4H 4Y4HD 4K9EL 1OLLA 3SDXF 1WBXA 2BOCB 5CJOH 1UB5B 4JAMA 4X6CE 1WFOA 3MBEC 3VWKC 4ZFZA 4TTDC 3PWNA 1KENL 3DRQB 4Q0XL 5FHBH 3SQOH 4ZQKB 3DGGA 1OB1A 3BGAA 3RVUD 1XIWB 3O4LA 2GFBA 1TZIB 1AI1H 3QDGD 1M71A 2AJSH 1F4AA 2YPLE 5F1IB 5M7QA 3L7FB 3OGCB 1YNTB 1OSZA 3EDKA 4Q7DA 3UZQA 2YPLA 3EYUH 4HIJB 4P9MH 1JVKA 4PP2A 2GJJA 1VFAA 1HEZB 2HJFA 3IXTB 2EIBA 3MBEA 3VWKA 3P0YH 5KAQF 3O8XB 1LEKB 5INCB 5J3HD 3QIUB 4LCWB 2RCSH 5SWSE 4OB5H 1RJCA 3KLAB 3JTSA 1VFMA 3EOYG 3IDJB 2K7PA 5LAXA 3D1MC 3KJ6L 3D69B 4OJFH 5IMKA 5SWSA 2MTPA 1INEH 1BFSA 1BQHA 3PGFL 4OZIB 3HZVB 5E9DD 2DJSA 5MEPB 2XTJE 5FKAA 1WICA 1X5JA 3GMLB 4OZGB 5IVXF 4NRYB 3GHEL 1FG2B 4PRDA 4JRYE 2BRRH 2JF1A 3P30L 2F54D 4U0RC 3STZA 4I9WD 1NGZB 5KSBF 4GAYB 2VXUH 3RNKB 3FT4A 4YZFF 4Y19A 2BHUA 3PDOB 4MB4A 4NO5A 5KVGH 3QFJB 5HYJA 2YOCA 4N1EA 3MGOA 5HHXL 1MFBL 2Z91A 3HAEG 3MRQA 4KK6D 2R23A 4Y5YC 2XZCH 2J6EA 2JK5A 4XVTH 3BAEH 2B7DT 3GI8H 1P7HL 1RK0A 3SKOA 3GMNA 1MWAB 1Z3GH 5SX4I 3QHZL 4F80A 2D0GA 5E08H 3UTSE 4NJAL 5T33H 2L7UA 3BZDA 2ARJA 2GJ6D 2F74A 4XCEB 5EO1A 3QNYB 2N7BA 5FM8A 2OJZH 4W68A 1MI5A 1CL7H 4Y2OA 3SOBH 4P2OB 3MNZB 4ZFOB 1WEJH 4MNGA 5CEZL 5AAMA 2FIKA 5F7DB 4GG6A 4XBPA 1J1PL 4JHAH 5DDHA 4TQEL 5K9KA 5J1SC 4NO0D 1U95A 2NXYD 3RX5A 4N90E 4Y5YA 3NCCB 4OD2A 4LSDA 1WIPA 4JG1L 4PGZA 2OR7A 5IMOA 4OLUH 4NNPL 4ZPVA 2DM7A 4EBQL 5GS3A 1WF5A 4OF7A 5IKCB 3NN8A 2VWEE 4PY7B 3FZUD 2NY6B 3HA0A 2Z4QB 3VFRB 3PP4H 1JHTA 4OSUL 1GHFH 3DO7A 1OARL 4GW1B 1B6UA 5IVXB 5TQ0L 3MRNB 1QFOA 3V5KA 1UVQA 3AFLA 3EDJA 1JTOA 1XGRA 2A9ML 3SDYL 4PD4J 3RVWD 3K3QA 4M93B 1HOCB 1UWEH 3LQMA 4OCYH 4P2QA 4OLVL 1AGEA 4PYHA 4PGEA 2RHEA 2VKWA 4OQTA 5FO9A 1J0ZA 1ETZA 4JDTL 4Z7NE 2NPLX 4KKLC 3DURB 4CBPA 1GGCH 3QDMD 2ZOLA 1NBYA 2L7JA 4N0UB 4P2RB 5B39A 3T0EB 5DD0H 3C08L 4CVWA 2UV3A 3FQUB 4CUCA 5DQ9A 4DZBB 1N3NA 1DR9A 1MAJA 3JV6B 4QY8A 5ACMA 2KKQA 4NKOA 4AMKL 5FAAA 5DFWH 3BISA 2K9UA 4W6XB 3ULVH 3PHQB 4K8RC 5AZEL 5MP6H 4LPXA 2CLVB 3BZEA 3BVNA 1Q0XH 4HAFA 4G8GE 4IOSD 1EMTL 1JPGB 3AVEA 4L8DA 4ODUB 3W9EB 3LKSB 1NDMA 5GRJH 2JIXB 5BO1L 5D70H 4Y16D 3GBMH 1FCGA 5TQ2H 1CFVH 4LLWB 5D71H 2PO6B 3IB4A 5CBAB 5IQ7L 2VZUA 1Y6MR 3ZLQC 5DEFA 1ZGLM 1CDJA 4R26H 3LN9A 4OAWB 5JOFB 4JKKA 1SJVA 1VKXA 1S7XB 3V0WH 1WC7B 4FQPA 1JMXA 5DMJB 4J23A 1L0YA 5CP3A 4JFDB 4NQVB 4YPGB 2DLEA 1L7IH 1T0NA 4KPHL 4X4XA 3S35L 5DJAA 5I2IB 3VE0B 3F7PC 1D5IL 1NSNL 1YEEH 2ESVD 1HQRB 1RURL 1FVEA 5CEZE 2Z9TA 4HK0A 1A7OH 1FE8H 3WUWA 4HK3N 3TJEL 4LHJB 5C0CA 3BWAB 3VMPA 4N0YH 3PUCA 4LQFL 1MCQA 2EEBA 4JJ5B 1XEDA 3IS0X 1CVSC 3MRGB 1MHEB 4W81A 2FB4H 5E2VH 4PJIE 5EUOB 3VFSA 1YDPB 2AVGA 5E8OA 1TCMA 1PYWA 1UJ3C 4YAQB 5T5FL 4ALAL 4HIXL 2Q8AL 3HN3A 3B9KB 4DVBB 2PYFB 3U46A 3LKNA 1FO0L 3VXSD 5IBTL 1YY9C 4KKBC 3UJJH 4HUXB 4LLDB 3SCMD 4WY7L 1RD6A 5ESAA 1F3JB 5CAYB 4RRPA 4R3SB 1IM3B 1ZHBB 4YEEA 1ZVYA 3H9HB 3QDHA 3DX6B 3NZ8B 4GXVL 5BRZB 4YHPB 3X12A 2NY1C 3BDBA 3OKEA 5IHUH 1JFQH 1LMKA 3T1FB 3QO0B 5F7YC 3NMEA 5F9OH 2H1PH 3ZKXB 4DTGL 4RMUA 1FH5H 1AD9B 3MV8E 3I6LE 4S10A 1UJ3A 2D03L 4OCSH 3MBXL 1RQ5A 2VITA 4HBQA 1BIHA 4RSVA 5I1AB 4YQXL 2I60H 4OT1H 5FCUH 2QHLA 1QSZA 4UB0L 4KGLA 4MXQD 3THML 5MEQB 1YEFL 4ODXA 1RHFA 2DQDL 1KN4L 2X9YA 3G5ZB 2ZNWA 4MA8H 3NA9L 2HFGL 1Q9OA 3VFNA 4XHJD 3NFNB 5GS2D 3RZCB 4YHOH 4XCNA 3UTTA 3EZ8A 4Z8FH 1LO4L 1I8KB 2EC9T 3E3QE 2OR8A 2YMXH 3MJ9A 2GT9A 4DKAA 1CS6A 5E4EC 3SKJL 3QUYA 4LVOB 4FFVD 3SHSA 5CCKL 1RIVH 5DRWB 3O9WB 1I3GL 3DXAA 2BSSB 2C5DC 4ZD3H 2FCBA 4BQ8A 1MIML 4LKXB 1OL0A 5BJTB 3KYNA 2YD4A 3IGAB 5T1KD 3C6LD 5MENE 1JGVH 4RZCA 4YDJB 5FECA 1OF2B 1JTTA 2BSRB 4R7NA 3AY4C 5BMFH 1ORSB 5I76B 4M62L 2QHRL 4NO3A 2QTEA 1PGRB 4OIIH 4BZ1H 2Z8VC 4JCMA 4HF5H 5F88B 3FN3A 5H37G 5T3XL 1PD6A 3WMSA 3KPLA 5CSBA 2WINB 5TFSH 1IE5A 4AYFA 4GRMA 4EDWL 1LILA 1OCWH 2BP3A 4MZ2A 4UQ2B 3QDAA 4PP1D 4H1LB 3HI1A 2VYRE 3CC5A 3GMQA 1FL5B 3BJ91 3WNMA 4G9FA 3NAAH 3QJHB 3AMLA 1JGUL 3FQRB 1FFOB 4RWHA 4H8WH 4EJ1C 3V7AG 2DBLH 5FO8A 5KN5B 1G7QA 5C8JA 4JQVC 4KRMB 1FGVH 1T20A 4QTIL 3DROA 1XZ0B 4XNXL 3AY4A 1IT9H 4DUWA 2HTLD 1EX0A 3T1WA 1XF1A 5A43C 4DGVH 4U1IB 1NCDL 5CUSL 3KPOB 3S3SA 2VLLB 4QRPD 2DQTL 2HJKA 2FX8L 1RUAL 5DVMA 4J12A 4DAGH 4NDMA 4LKCB 4BZYA 3LKOA 3DHJA 4HXBH 2ZP0T 2Y6SD 4QXTA 3TA3B 2VAJA 4G6JL 2EEDA 3P4LA 4XZUB 3B9EA 1LDPL 4Z78B 4ORGA 3LV3A 4HAGA 4Z0XB 2W1NA 4XNMA 3VXNA 5IF0A 3U0PA 1OM3L 1TZGL 4JQVA 1IKFL 3C60B 5ALCL 4W6WB 5EZJB 4FQQA 4BSWB 2HYMA 4JREB 3TVMD 1XCQB 3L1OL 1T66D 2Z31B 4R7DA 5E24E 4AEHL 2GK0A 4ZYKA 2AV7A 3EW3B 4OLWH 3OKLB 3DETC 5F6HJ 3WKML 3AS0A 2UWEB 3S88H 2X4SA 1FL6A 3ARGD 3OPZL 2F53E 3PV6B 3WIFA 1NLBH 4XMLH 3PE9A 2P42B 5E8EB 1L0QA 4HGWA 5SV4A 5IB5B 3DUUB 5D6CA 3RUGA 2P8MA 2PTVA 3GSWB 4M5ZL 5B4MD 1YEIL 3FKUS 1S5HA 5MEOA 1YN7A 2H9GB 3RWEA 2EDLA 1GZQA 2XG4A 5GGQH 3B6SB 2PXYB 3QRGL 1YUHA 4JO2L 4Q9QH 1BJ1J 1U8PB 3O6FB 4PRHD 1VFUA 3NTCH 1C7TA 3WXVL 4LU5H 2ZSVA 4TNVF 3UTQB 4I5BB 2PUQT 5JPMA 1D5XB 3VGHA 4LRNH 3PGCA 5JTWA 4JM4H 3UJTH 3OJ2C 2BOCA 4TN9A 5BV7B 1JNNH 3O8XC 5TE7L 3EJYC 3RIAF 3PF2A 3RIFF 5T3XE 3DRQA 1RVFH 3QIUC 2VOTA 3AM8C 1QRKA 4ZQKA 1S7RB 4LGSB 3KYKL 3W11C 3DVIA 4AL8H 3TBTA 3WNKA 5BOZG 1QG3A 4YBHA 3HPLB 1MJUL 4D2NA 4F7TB 3TCLB 3TN0D 1XIWA 1BQLH 3L5JA 4K2UL 3W39B 1TZIA 1I85C 5F9WC 3ULVC 4JHZA 2VLRB 3ILQD 1A6TB 3L7FA 1A1OA 4P4KB 1YNTA 4H1LH 2IFFL 4M4RA 3UTPD 1XGTB 3I9GL 2WM0A 1BFOB 3TO4D 3RTQD 1SBSL 5BZDB 3HI6L 4HIJA 4FFZL 1MLBB 1PKQB 4Y4FD 4LCWE 1E4WH 1HEZA 2YUVA 3IXTA 3UC0L 4F33B 2F8OA 3O8XA 2D7OA 1LEKA 2YD7A 1TJHH 3QIUA 1JZ8A 2DQGH 5F6IB 1FNFA 3KLAA 3IDJA 4OZIE 3MQIA 3FRUA 1KGCD 3D69A 4UI2A 2B2XL 4OLEA 2P47B 1NGQH 1PG7W 2O5ZL 1CR9H 3HZVA 1I85A 4X9GA 4A2LA 5MEPA 4NQDD 4WVRA 3MV01 3GMLA 4OZGA 1RJZB 3WFZA 4NRYA 5FHAL 2EXYD 3E1F1 5JR1L 2VDPH 5HI3C 4FXGB 3WFEL 4RWYL 2CRYA 3QFJE 1EJOH 2UZXB 1NGZA 4FQHA 3SKNB 1JV5B 4GAYA 4M6AA 3RNKA 3SDXE 3CU7A 1T5XB 5D1QB 2NY5H 4P2OC 3PDOA 1K4DB 3LS4H 1MLCB 3RWJB 1FNSL 5EOQL 3QFJA 5LKNA 1RJYB 4Z9KB 4MHHG 5D9SB 4KVNL 2IAMD 3SQBA 3LQAH 5DZOA 5DYOB 2YR3A 1MWAA 4J3OC 4RAVB 3UPRB 2AS5M 4LRIC 1RZJL 5DK0B 4MCZB 5EBLB 4QYOB 1BGXH 5K9OB 1H3GA 4XCEA 4Y5VB 3QNYA 2JELL 2XZAL 2PKDA 3FAWA 2VXSL 3RU8L 4P3WA 3V6OE 2DQEL 4ORZC 4P2OA 3MNZA 4NQXB 4ZFOA 3VDCA 4WI3A 1C8PA 3DX9B 3LEVH 3KXFE 5F7DA 2JJSC 4M93C 2DAVA 4OLZL 3ZT5A 1PEZA 4YEFA 3QQ9C 1UA6L 2APTA 2IPKB 4K23H 4GAGH 1QR4A 2ICCA 2FBJL 4KTDH 3U4AA 4K94L 1IAMA 5IKCA 3MZTA 1CU4L 2EZ0D 5C1MB 1PQZB 1LK3L 5DFVC 3X3FL 1KXQE 2DLFH 1P4IH 1BX2B 2VLJE 4LRIA 5IVXE 3SE3C 4BZ2L 2Z4QA 2AEWA 2E9WA 4OFPA 5J56B 3T0EC 3NIDF 3Q5OA 4GW1A 5IVXA 2KUTA 2C4FT 5FCSH 3MRNA 3Q0HA 3M17B 3CGTA 5KSBE 4YZFE 2V7HB 4HS3B 1HYSD 2JJSA 1HOCA 3RVXD 4NP4L 3I6KB 2GY7B 3ZSSA 2ZUXA 1J0IA 4M00A 5IB3B 4O4YH 3RWHB 4G8EB 4QRSB 5D7IB 3MNWB 3DURA 1CK0H 1YEGL 4N0CC 2UY6A 4Y1AB 3HG1D 1IEBB 4L4TE 5IHZB 4N0UA 1D5BB 1CIDA 4P2RA 2PO6C 1OTUD 3RAJH 3SE3A 4O58L 1MFEL 1OAXH 4OGAC 1H9VA 3BZ4A 4WWKC 2WMPA 3T0EA 2EH8L 5EO9A 4DQOH 3T3MF 3S6CA 1JGLH 4YDVB 4Z95L 4DZBA 2B1AH 4L8CB 2ED7A 5I15H 2FGZA 3PHQA 3MRKB 5C07B 2CLVA 4WJ5B 3V2AR 1YYLH 3NCFB 4PYGA 4G9DB 3O6ML 5T3ZH 3WS6A 4PJ8B 1CXKA 1GCFA 3RA7L 4JO1H 1G6RH 1JPSL 1JPGA 4POYA 2NY2B 4ODUA 1A6UH 3LKSA 3W9EA 1FZKB 1OAUH 1QFHA 4PJ7F 5IWLC 1WVZA 1XGYH 2IF7A 4XBGB 4LLWA 2PO6A 1CE6B 5CBAA 3NCJH 4GAJL 4WWKA 1HIMH 4KI1A 4B5EA 4GBXD 1YN6B 1DQDH 5D96B 4NFBA 5L2KB 4OKVB 5JOFA 1NC2B 4AEIL 3IVKB 3WD5H 1F90L 4LPUA 1WC7A 3B9KC 1AD0A 4LPTA 3ES6B 2W9DL 1NCNA 2BVTA 4JFDA 4QXGH 3MV9E 2V5YA 4YPGA 4ZNCD 1MHPL 4OFYD 4KMTH 5I2IA 3VE0A 2OK0L 2BMKB 2CLRB 1X6NA 1HQRA 4XAWH 4OCRL 5DT1H 1BOYA 2NZ9C 3PWLB 1Q9KA 1T3FB 3K7UA 5DJ6B 5IWLA 2A83B 4ERSL 1OGAA 3BWAA 2JKXA 4JJ5A 2NYYD 1MHEA 4PG2C 3N85L 4OTXH 3VWJB 2IGFL 5EUOA 1KB5B 5BXFB 3ZKXC 4JKWA 1IBGH 3GMMB 5AYUL 4LEXH 3MACL 1YDPA 1QRND 3N06B 4YAQA 3QG6B 4XVJH 5F96H 4RDQG 3VI4F 2J3SA 1A0QL 2MJWA 4F7MB 1KACB 2IALB 3B9KA 2N1KA 4JDVB 4U05A 2PYFA 4XP1H 4DVBA 3MSPA 3ULUL 3GK8L 2D0HA 1ODAA 5KJRH 4HUXA 4LLDA 4ZOAA 2IMNA 2BDNH 1QTYT 4KRPD 4I3SH 1F3JA 4MVBC 4K9EH 2ZG3A 4NJ9L 4R3SA 5DXWA 5FYJH 1A02N 1ZHBA 3KS0H 1DQML 3KPMB 3H9HA 5BRZA 3NZ8A 5DJZB 4YHPA 3EYFB 3QEGH 4GH7B 1NFDF 4OM0L 5ADOH 4PG2A 3S36X 4Q0XH 1G1CA 3T1FA 2YA0A 3QO0A 4FQXB 4L29B 4M7KL 1AD9A 1TTFA 5I66B 4D0DB 4XI5D 1F58H 3O4LD 1PVHA 2DB8A 3O9WC 2C3WA 1Z0MA 3VXQA 4HS6B 5MEQA 4DGYH 3RGVD 4KHTL 2YPLD 3G5ZA 1IC4L 1NJ9B 4PJAF 4YBLC 3MBED 3VWKD 3NFNA 3RZCA 4TTDD 4QOKE 2NY0B 1YMME 2FRGP 4UTBL 5K93A 1X9QA 1I8KA 2EDYA 4X4MA 5GRVK 2FZ3B 4LCCB 4HDIB 1FC1A 5SWSD 3KJ6H 1J9CT 2AEIT 3K81A 2J12B 4HMCA 1DLHA 3PGFH 5DRWA 5EA0L 1B0WA 1QBBA 3O9WA 3PWPB 3BH9B 3HC4L 4FOMA 5A1AA 3KPSB 2BSSA 2XIDA 4LKXA 3O3AB 5BJTA 3GHEH 3PJSB 4AM0B 1IGIL 1H3PL 2H26B 4HBCL 3IGAA 2BOBB 2ZUQB 4PBWD 4D0CB 4YDJA 4GJTB 1OF2A 1ZXQA 3A67L 4PJHF 2BSRA 4Y19D 1D5ZB 1ORSA 5I76A 2P48B 1KT2B 5HYJD 5HI5C 1OLZA 3MRPB 3QDJE 1QFWL 1T22B 4PR5A 3QCVL 1MFBH 3F5WB 2GCYB 3R8BB 2W07A 5DSCB 1NFDB 4UQ2A 3CNKA 3QQ3B 3TA3C 5JQ6H 5EULV 4CNIB 5EOTB 4H1LA 4MWFB 3EOAB 1TTGA 3QHZH 1MCDA 1YC7A 4ONOA 5H8DA 2ZUWA 4HSQA 3QJHA 3FQRA 3MLRL 1FFOA 4CAGA 4HJGB 1JK8B 5KN5A 2QSTA 1IGFL 1CIUA 1MI5D 3C60C 4OCLC 2NY5C 4ETQB 5JUEH 4JREC 4WO4B 1XZ0A 1X5GA 2Z31C 2BNQE 4U1IA 4KROB 4PJAB 2VLLA 3P4OB 2XA8L 1GAFL 1MCLA 1J1PH 1NGWB 2CH8A 2J5LB 3MJGX 4TQEH 2YEZB 1LD9A 4U7KA 4U6HB 1KIPA 5I0ZA 3UYRL 4IM8A 2NY3B 4LKCA 2YWZA 4JG1H 3TA3A 4NNPH 4YXHL 2FEEI 2HT4C 4H0HB 4XZUA 4PJBF 3EYOB 4Z78A 4R4BB 1EAJA 4LASL 4Z0XA 2W9EL 3FN0L 2XA3A 1SVZA 2GSIB 1CD9B 1H3XA 5JDSB 4L5FL 4YDKL 4OSUH 3C60A 4OFIA 5TQ0H 4XP9H 4BSWA 1XCQA 4HC1L 2Z31A 2F15A 4J3WA 5D7LB 3HE6B 2A9MH 3SDYH 3U7YL 1GYAA 2VZ1A 2GUOB 1IAIM 3OKLA 1BZ9B 4P2QD 1U8HB 2UWEA 4JFEE 4FXKB 4OCNC 4OLVH 1O7SA 3PV6A 1BQSA 3MA9L 4X7CC 4J4PC 5BV7C 4NZDA 4FA8A 5ENWB 4MNQE 3VXUB 5IB5A 4JVWA 3DUUA 3ZE0E 1UZ8B 3GSWA 4HPYL 2O93L 1Z9LA 2CKBB 4ODSL 2H9GA 3NCYS 1I7UB 3I75B 4KJPC 4H20L 3B6SA 2PXYA 4M6ML 2ITDB 1U8PA 2EDWA 3BT2L 3O6FA 2JE8A 4U1GB 2A6KB 4AMKH 4P4KC 5AZEH 2BHYA 1U8IB 3UTQA 3REWB 4I5BA 1D5XA 2XN9E 2YRPA 3FCTB 1LK2B 1X4YA 1CBVH 1EMTH 4CVUA 4J4PA 4KKLD 4Z7QF 5BO1H 3W2DL 1S7RA 2XQYK 1A4JB 5E5UB 3HPLA 3BIBX 4F7TA 3TCLA 2XWTA 3W39A 5J1AB 2A73B 1KTLB 4YNYB 1JNHB 2CO6B 3AUVA 2VLRA 1A6TA 4K8RD 4S0TD 4P4KA 2XWBB 1A64A 1KFAL 1XGTA 4GLRI 3TYGH 5ID0B 5E70A 4KPHH 3S35H 3ZL4L 1BFOA 2Z8SA 1CWVA 3ZE2F 1MLBA 4PJEF 1PKQA 1NGXB 2WZPD 2XQYG 4TRPL 2YZ8A 3P3YA 5F9JB 4MGXA 2O26U 5I1EL 5D1QC 5IMLB 5C0CD 4XPAH 2R0WL 4PTTB 1Q38A 4LQFH 2V6HA 12E8L 4AENA 3QIWB 2D7TL 5DHVB 1A7BA 5GRUL 2GITB 1JWUB 3H6JA 3TH2T 2WSKA 4KQ3L 1NUGA 2GAZB 4Y5XB 4LSUL 2FD6L 5T5FH 3RJDA 5HYFA 4PJGF 4ALAH 3UO1L 1UXSB 3MNVB 1TIUA 1FLRL 1RJZA 4Z7UF 1GH7A 2J8UB 5HHOB 4L4JA 4YH6A 1QSFD 1FO0H 4FXGA 4GS7B 2LU3A 5IBTH 2GSGB 1ZHLB 3UJIL 3G5YB 4Y5VC 4G7YL 1G7LB 3SKNA 3F8UB 2NXZB 1JV5A 4M02A 1T5XA 5D1QA 4X6DF 3T08A 1MLCA 3RWJA 1RJYA 2VDML 3MO1B 3VH8G 3T8XB 2OI9B 5D9SA 3HPJB 1DFBH 2QEJA 2WLZA 1YEKL 2KL6A 5E2WL 4YHML 4YE4H 4NZTH 3R0NA 4DTGH 1CDHA 5DYOA 3OKYA 4MXVF 2D03H 5E0QA 3TJHC 1I3VA 3MBXH 4RAVA 3UPRA 2WIMA 3W0WB 2WLYA 4S11A 4YQXH 1X4XA 1YY9D 4UB0H 4KKBD 5DK0A 4MCZA 1J5OL 5EBLA 1YEFH 4QYOA 2CKBH 1KN4H 2QQLH 1RJLB 5K9OA 4Y5VA 3NA9H 3Q6GL 4K9EC 5I16B 5J06A 2HFGH 1N0LA 4YC2C 4M48L 3KYMB 1UKQA 4NQXA 3ZDYF 1FDLL 3UTTD 2RAMA 3DX9A 2NY1D 4PJEB 3MUHL 3PWVB 5C0FB 5F7HA 5GISH 1GRWA 1P84K 1LO4H 1NAML 5C70A 4BKLB 3EJJX 5HPOA 1WUNT 1U36A 4WI8A 3SKJH 1PG7X 4B7IA 1VADB 5CCKH 1GL4B 1A6PA 5J9PB 5I8KL 1A2YB 3DXAD 1PQZA 4FABL 1I3GH 3RX7A 4QHUB 1VPOL 5ANMB 1BX2A 2DQHH 1MIMH 1K5NA 3TLRA 3CVHL 1WWAX 4GRWF 2BNUB 4X9IA 3C2AH 4XP6L 4Z7UB 3T09A 2E5EA 5JXAH 4BFGA 3M17A 4Z77B 1SBBA 4LF3B 2P44B 1FCCA 3LKRB 4ELMB 2V7HA 3KR3H 4HS3A 1PG7L 4BYHA 5CD5C 3IAQA 1FIEA 3I6KA 1TDQA 1AGDB 1RY7B 3I6GB 4PJ8C 5T3XH 1ZLSL 4QHLB 1BFVL 5IB3A 4Y1AE 3RWHA 5IFAH 2NY2C 5GS1B 4QRSA 5D7IA 4EDWH 3MNWA 2E7MA 4U1HA 4Y1AA 2K3TA 1IEBA 4EN3C 1K4CB 5IHZA 1D5BA 4WDIB 4RMSA 3UYPA 1CD1B 4XX1G 1AQKL 5EO0A 5DD3L 1QKZL 4G9FD 3RY5A 3OJMB 4YDVA 5DHVH 5D96C 5E6IB 4R90H 1EK3A 2R15A 5B38G 3SGDH 5L0QC 1S7QB 4Y4KB 4QTIH 5J4MA 4XNXH 5JW3L 3MRKA 4QRUB 4YHIB 3B9AA 5C07A 4IEFB 1NCDH 4WJ5A 2HN7B 5CUSH 5TF0A 5C0NC 1KG0B 4KV5F 4NKQB 4G9DA 4PJ8A 2DQTH 1WZ1L 5AWNL 2MQ0A 2FX8H 1RUAH 5C0RL 4KJQC 1FZKA 1N6UA 4C56E 5C0BB 4HXAL 4G6JH 2PYEA 4XBGA 4EN3A 2XWJB 5EU3B 5KW9L 4JKMA 1F8TL 5J13B 1LDPH 1VFOA 3INUL 1RUPL 1LO5B 1YN6A 3VWJC 5ISZE 5EOCL 1F4YL 5L2KA 4OKVA 1NC2A 3NIDE 4FFYL 1OM3H 1TZGH 1I7ZB 1RFDH 3IVKA 1IKFH 5ALCH 3MXVL 3BSZL 3ES6A 3L1OH 1YEHL 5HHME 3WNNA 3IAPA 1A7QL 2VISB 2G5RA 2ADIB 3WKMH 2BMKA 5MI0B 2CLRA 1MVUB 2DI9A 5D8JH 3PWLA 3WDJA 5LG1A 2EDJA 1CFTB 1T3FA 5DJ6A 3RKDC 2A83A 1ORQB 1HCFX 4XMPL 2I5YL 4PJXB 1CGXA 3EGSB 3V4PL 1LO0L 1KCVL 3GRWL 4NM8L 3VWJA 1YEIH 2AK1L 1KB5A 3D0LB 4FQXC 5BXFA 3GMMA 4LPWA 4DJMA 3T3ME 2BY0A 1SEBB 3QG6A 4F7MA 3QRGH 4WW2B 2IALA 3Q3GB 4JO2H 4OI9A 5DQJB 4JDVA 4YX2L 2XI9A 4RBPH 3MJ6A 1E27B 3WXVH 5LJYH 3DETD 1A6WL 5DJYB 4WEBL 3H42L 5DEZA 5T1MB 3HZYB 4L3AA 1SYSB 2AK4E 1U8LB 4GQ9H 3KPMA 4PJ7E 4NO2B 5TE7H 1MOEA 2NY0C 3EYFA 3QJFB 5EWIL 3LRSB 2APXA 1CF8L 3AS2A 3KYKH 4FQXA 4L29A 4LCCC 4NSKA 5I66A 1AHWB 1MJUH 4D0DA 2UYLB 3D18B 3LKPB 4JZNB 4K2UH 2CDGB 4EOWL 4FP8L 5IW1B 3O45A 2EO1A 2P46B 1Q9LB 1BD2D 4HS6A 1PX3A 3R0MA 2IFFH 2H3NB 3I9GH 2I9LB 3TH3T 5F7EH 1NJ9A 1T03L 4OF6A 5FK9B 2ZUQC 3HI6H 4FFZH 3GB7B 3VRIA 4PJFF 4L4VB 1DBMH 4PIRF 3O8XD 3UC0H 3EJYD 1B2WL 3L5IA 3RVVC 3CSYB 4U1LB 3QIUD 3IDXL 5HGBB 3W11D 4Q6IC 2AQ3A 4P3DB 2FZ3A 4LCCA 4HDIA 4KVCL 3O4OB 2G5BB 5D4QA 2B2XH 3GSRB 5ACZB 1WFUA 5J11B 2O5ZH 4HKXA 4Z0BH 1C5BL 1WTGT 1NMCB 3BH9A 3PWPA 3ULVD 3VI4E 4ZNEE 1Z9MA 3IKCB 3KPSA 3L9RB 3O3AA 1XMWA 4L8SB 1DE4A 2IG2L 4LP4A 2CO7B 3PJSA 5JR1H 1XGQB 4AM0A 2H26A 2AI0L 4BUHA 4D0CA 4RWYH 1QD0A 3VXMB 2CR6A 2Q6WB 1FZJB 4WO4C 4WI9A 5DD6B 4LSTL 1QZ1A 1QHPA 4KROC 5EOQH 2D9CA 5CLWA 1NFDE 3MRPA 5IFHL 4KVNH 1T22A 2J5LC 2OR9L 2BERA 2ICES 3F5WA 4PTUB 2GCYA 3BKYL 4M6NL 1SY6A 5DSCA 4RFNB 3QQ3A 3QO1A 1T6VN 2WWKT 4KHXH 3QP3A 2RFXB 3P9WB 5EOTA 2ZCLL 4CNIA 3CLFL 2VSDA 4WFED 4MWFA 3EOAA 1U8NB 2HWZH 2VNCA 4NUGL 4V2CB 5HI3D 4LVNB 1UCBL 5FM5O 1RZJH 4RAUB 4LARH 3U1SH 4HJGA 1JK8A 1W0YT 2JELH 2CMRH 2UY7A 2XZAH 1I8IB 2VXSH 3RU8H 4ETQA 4WO4A 4HUWB 2DQEH 4P2OD 2NR6C 2FO4B 5IJVA 4OCXL 1N0XL 2YWYA 3HE6C 2CXGA 4PJAA 3HHRB 3P4OA 4XPTL 1DLFL 1N64L 4PJFB 4ONFL 1QPXA 4OLZH 1NGWA 3DTXB 4HMDA 5KVDH 2YEZA 1UA6H 4U6HA 4IIQB 4WTWA 2V2WB 3NABH 2C26A 2Z0BA 3DX7B 3G6DL 3RFZC 3SY0B 1A7NH 1HSAB 2DMBA 3VFOB 2CGRL 3LY6A 5CJQL 3R8QA 4XBEH 3QQ4B 1KTDB 1CU4H 1ZWIB 3HMXH 1LK3H 1ZA3B 3D85B 4MMZC 3X3FH 3MXWL 4BZ2H 5DUMH 1DBKL 2GSIA 2XQBL 5JDSA 5D7LE 1EGJH 3MRCB 4HLZG 1M6OB 4H88H 4HIHB 5EBWB 1ZOXA 5D7LA 3HE6A 4PJHE 4U1GC 1JYNA 1A1NB 2GUOA 3CPLB 3QQ9D 4D8PB 1BZ9A 3LSOB 4NP4H 1U8HA 4Q58C 4FXKA 3P2TA 2ZCHL 3J7HA 1EH9A 5ENWA 2LVEA 3VXUA 3E0GA 1YEGH 1HI6B 5DFVD 5JW4M 1UZ8A 2ZUUA 4P2RD 2VAAA 3BH8B 3ALWA 2CKBA 1CD0A 4O58H 1NCTA 4LNRB 3T0ED 1I7UA 1YYML 3I75A 4A6YB 5B38B 1U8JB 4JN2A 4Z95H 5KS9F 5BZWB 2ITDA 1ZGLB 5A40E 5DD1L 1IGCL 1NGPL 2ORBL 2Y06L 3BPLB 2FHFA 2A6KA 4K3HA 4PRIB 2NY4B 3D48R 4BUGA 1U8IA 2EYSB 3LN5B 4KQ4L 3FCTA 1NCBL 1LK2A 3G6AB 3TWCH 3FFCA 1JPSH 4JFHE 2X4TB 1U8OA 4N0CD 4YBQC 1GOGA 4OD1L 4TPRL 3H3PL 1S9VB 2PO6D 3D3VB 2EDOA 1JE6A 3QR2A 4PJBE 2OS7A 4OGAD 4WWKD 4Y16B 1AE6H 3GZKA 3QIWC 4GAJH 2X1WL 1WIUA 3MV7E 5HYEA 2A73A 1IAKB 1KTLA 4YNYA 4AEIH 1MAML 3MOBL 1JNHA 5EZOL 3CX2A 3C8KB 4UDTA 1F90H 1P4LB 4NKMA 2V2TB 3MREB 4JFDD 2XWBA 4C57C 2J4WH 2IJ0C 1IRAY 2BFVL 4P49A 5ID0A 1UH2A 1UJTA 1N8ZB 1FYTA 3NH7H 2W0FB 3D0VB 4RA3A 1NGXA 2OK0H 4BQ9A 5ALBH 1QLRA 2NXZC 5F9JA 4BQ6A 4P3CL 4P46B 3V6FB 5KVFL 1IM9B 4OZFG 5IEKB 5IMLA 4U3CA 1OGAD 3KPRB 4PTTA 2OI9C 1UWXH 1KJMB 2CK2A 2AJ3B 3QIWA 4UOJA 5E6ZA 5DHVA 2DIBA 2LTQB 4X7EC 4JB9L 3E8UL 2GITA 3OBAA 2IGFH 5F1KC 2BVOB 1JWUA 4LVEA 1C08B 1VEMA 3MACH 2GAZA 3B43A 4DKEL 4TVPD 3NIFF 1QBLL 3WDIA 1A0QH 3NPSC 3B9KD 1UXSA 3MNVA 4CDHA 2J8UA 4YHYB 1J0HA 5HHOA 4G7VL 5KS9B 1KCSH 3ULUH 4N68A 4EIZC 1GOFA 2GSGA 3LPWA 1ZHLA 3ZE1F 3G5YA 4FZEL 4OM1L 3U9UB 1AFVH 1G7LA 2NZ9D 4HQQL 4KUCD 4U0QB 3CH8A 4H0GA 1XGUB 4NJ9H 5FGRA 2XRAL 5BRZD 3MO1A 3T8XA 4Z7QE 3HPJA 1EHNA 4UNUA 1EEYA 3MLSL 3MLTB 1WITA 3VXPB 4NQCB 4NFCA 1GPOL 4NHUB 4ELKB 2WK2A 4CJ0A 4YDLB 3QEUB 5GZNC 4NQTA 2HH0L 2ITCB 3W0WA 3CZJA 3SDAB 4MSWA 3CFIC 2QL1A 3DUSB 5FYKL 1CLOL 1RJLA 4N8VG 4P9HL 1IC4H 2HT3C 5I16A 4A6YH 3ZE2E 1HDMB 4MVBD 4HULB 4PJEE 4NC1C 1LO2L 4PB0L 3PWJB 3MLZL 1RI8A 1WCQA 1FFQA 3K46A 2HFFB 3PIQB 4CJ1A 4UTBH 5C0FA 4I13B 4I2XB 2O5XL 2XPGB 4BKLA 4YHZL 3T3PF 2ARJQ 1R3LB 3MLVL 1H3TA 1SHMA 1VADA 4C83B 2DTSA 3O9WD 5J9PA 3KVQA 5EA0H 1A2YA 1XGPB 4PJGE 4QHUA 3C5JB 3HC4H 2R9HC 5ANMA 5J8OA 4Z7UE 4M9PA 4EXKA 1KJ2L 2BNUA 4I0PB 1IGIH 3MRJB 4HBCH 5E6IC 4LEOB 4UAOB 3WIHL 4IOFC 4N1CA 1T80A 4Z18A 4PS4H 4Z77A 2IQ9H 4LF3A 5FOJA 2FSEB 3A67H 3LKRA 4PRPA 4ELMA 4Y4KC 3C09B 4X6DE 3C6LB 2X09A 1MFAL 3JZ7A 3K2MC 1AGDA 3I6GA 1JL8A 1QFWH 3RY4A 3WIIL 1KIQB 4QHLA 3KPQB 3QCVH 5I9QB 4GOSA 1VEPA 3DECA 1RUQL 2VC2L 3N1GC 4MXVE 1RSFA 4YUEH 1K4CA 5K59F 4WDIA 3TV3L 1CD1A 5J13C 1LP9B 3RX8A 3S8WA 2EE9A 4LSPL 5JPNB 1CDBA 5E6IA 3MLRH 4WFFD 5DZLA 4Y2DB 4YJZL 1S7QA 3V4VL 3R4DA 3EDDA 4Y4KA 1PKOA 3ZDYE 5C71A 4QRUA 4YHIA 5HI5D 4XC1H 1FNHA 2HN7A 1KG0A 2BNRE 2XA8H 2NZIA 1A47A 1GAFH 4PJ9B 4YR6B 4K7PX 5MI0C 2P45B 3ECBB 3TA3D 1J87A 5C0BA 5C3LD 5D7JC 1KJ3L 2CIKA 2MOVA 2XWJA 5DFTA 5DD5L 5EU3A 1RZKL 3HR6A 1SM3L 2E7LC 2AJZB 1LO5A 5EBGA 3QRFM 5F97E 3V0VB 4LASH 2W9EH 2HKHL 3FN0H 4GRWE 1G9MH 4L5FH 2HKFL 1I7ZA 3C60D 3E2HC 2EXWC 1IGML 3QEQE 3W82A 4PD4K 4WW2C 2Z31D 3FO9B 3P77B 5DC0A 4HC1H 5FYKE 3FAXA 3U7YH 2VISA 5D1XB 2ADIA 4XPBL 5JW4N 2CPCA 1HKLH 1MVUA 4TNWK 2R0LH 3H9YA 1ADQL 1CFTA 1KPRB 3MTRA 3MA9H 1ORQA 2HT4D 2VDLL 3ARGB 3H7BB 1T5WA 4PJXA 2FWOB 4LMQE 5DUPL 2E7LA 2WW8A 4LLYB 1BEYL 4J3VA 5IUSA 3D0LA 1NMAH 3PGDB 4ODSH 4F8QA 4HZAA 4JZOB 1SEBA 2IANB 1CE1H 5IFJB 4WW2A 3Q3GA 5DQJA 2ZNXA 3BT2H 4HIIB 1NUDA 1E27A 5KTEH 4K3GA 4J3UA 2MCG1 1HILB 5DJYA 2I25N 3UZVB 3FHAA 4PRHB 4KV5E 4E0RB 5T1MA 4RIRB 3HZYA 1GVIA 4J4PD 3WSQL 1SYSA 3HMXA 1RK1B 4XNQB 4NO2A 4CU6A 1BBJA 3IDNB 3QJFA 1T1XB 3LRSA 4W6YB 3W2DH 2VRAA 1PLGH 3EOTL 3KJ4B 3KG5A 2R8SL 1DJSA 1EGJA 3QUZB 4KJPD 1AHWA 2D7PA 2UYLA 3D18A 2BK8A 1ITCA 3LKPA 4LLVA 4JZNA 5J11C 1NGYB 4P2YA 2CDGA 3QDGE 3VFPB 1NMCC 2AGJL 2VLRD 5IW1A 3QA3B 4P4KD 1Q9LA 3BDXA 4L8SC 5D2LB 2KZ1B 5IW6B 5D5MB 1KFAH 2H3NA 2I9LA 1HHHB 3ZL4H 5GHWL 5FK9A 3SGEH 3GB7A 4OZFB 4EKXA 3MGTB 4L4VA 4TRPH 3NCMA