1C5TA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5tA02
1ZJDA 1WTGH 2VGCC 3SNCA 3S0NA 1VCWA 2ZU3A 5LPFA 3LGWA 2W5EA 1GHYH 2A31A 1S83A 2G8TA 4MVNA 1DDJA 3HKJB 3LH3A 6LPRA 1GMHG 2J94A 3N7OA 1QB9A 3B8JA 2XWAA 2XBXA 3E0PB 3RXKA 2C3SA 4D76A 2PUXB 1GI2A 3SU4A 1QR3E 3QZRA 2PHBA 2SGPE 2F9OA 1THRH 1TYNA 1O3GA 4R8TB 4H6SB 4BXWA 5SGAE 3A81A 4VGCC 4HFPB 4XSKU 4R0IA 4HZHA 1T4UH 1KDQA 2BDAA 1DSUA 4B2BA 3SU1A 2WV5A 3URCA 4K1TA 4H42U 1ZGVA 1HAXB 1TABE 5DPAA 2VVUA 2ZDAH 2ZU5A 2CHAC 2BDGA 4MG3A 1KSNA 4ABJA 2BY6X 4K2YA 4Y7BA 3U98H 3RXHA 1GJAB 2FMJA 3CP7A 4KGAA 1HAVB 2RCEA 3UTUH 2FX6A 1NFUA 4K8BA 4ZUHA 2ANWA 3AAVA 1ELBA 4F49A 3NPSA 1HBTH 2FZZA 1AE8H 2ZQ2A 4WH6A 1K22H 1S84A 1BTPA 5E8EH 4U30A 1EZSC 2AS9A 2FOCA 3SQEE 1ZSKA 1EPTC 2VB0A 1HAOH 1FAXA 5L6NH 1Z6EA 3QO6A 1AZ8A 3EDXB 3KL6A 1EB2A 2VVCA 1P11E 1GI1A 1ORFA 5T6GA 2Z6BD 5DKMA 1NRNH 4MNXA 3M5OA 1QURH 4GHQA 4X1NU 1ARBA 5DP5A 2QIQA 3BEUA 2G52A 3H5CB 4Y79A 1SBWA 4ZKSU 3A8DA 4NGAH 3RXDA 2VIQA 2ESTE 2R0KA 1QHRB 2ODPA 2OLGA 1FIZA 1X7AC 1A0JA 2Y5HA 4XBDA 1C5VA 1CGJE 3QDZB 4NA8A 3UPEA 1ABJH 5AF9H 3U1JB 2FX4A 1V2LT 4GVUA 1DXWA 1Z8RA 2Z94A 4A5TS 3SZNA 2CF8H 1MTNB 1BZXE 5DO4H 1W2KH 4GPGA 2KAIA 1H8DH 1QJ1B 1A3BH 1Z8IB 5EOKA 1O2OA 4K8YA 1P57B 1TNHA 1F0RA 2DE8A 1G3EA 4OS5A 4Y10E 3UWJH 1ZRBA 1XXFA 3NCLA 1NC6A 1FONA 3KQDA 4INHA 4Q7ZA 1GJ8B 4ZKOU 1V2TT 2QGRA 4UE7H 3UWIA 3TU7H 4CRGA 1HJ9A 3SI3H 2ILNA 1ELAA 3E90B 3SOSA 1E34B 1EX3A 1VITH 4CBOA 1EAWA 3TJOA 4MPXA 1QCPA 2D8WA 4I8LA 3A84A 1L1NA 3V12A 1TMBH 1SB1H 4I8HA 1GG6C 5HXFA 3D49H 3AASA 2BD3A 3T2NA 2ODQA 1AO5A 4JCNA 1CBWB 5C5OA 2ZTZA 5T6DA 1TX8A 2ZGBH 2PGBB 4NG9H 1LTOA 1QA0A 4TY7A 4ZHMU 3G01A 1QJ7B 4DIIH 1G3BA 2ZU2A 5EXLA 4NIWA 1F5KU 1S5SA 1RGQA 2A5IA 4BAOB 1KXCA 1BMNH 4NSVA 3E16B 3RXEA 3SGAE 1O3HA 1O2IA 1C1MA 2JH5D 1D6WA 1EP6A 3TGKE 1ZTJA 1K28D 1OSSA 1OWJA 3P95A 3MO6A 2UUFB 1K1NA 2BDBA 3JZ2B 1FIWA 1HXEH 4K69A 1PPHE 9ESTA 4E7NA 1O2JA 1ZRKA 1GDQA 2GCTB 1C4U2 3ZVFA 1SC8U 1H1BA 2VIVA 5A0CA 1AQ7A 1ZMJA 3LONA 1YP9A 1VGCB 5CHAC 1P02A 1V6DA 3R0FA 3RMLH 1THPB 4UFGH 1ETTH 1IQGA 1C1WH 1ZHPA 1TALA 1MCTA 1T4VH 1DVAH 1QGFA 2AYWA 3PWCA 3AVZA 1O2MA 2ZHWH 3GCOA 1DX5M 1ANEA 3T28A 1GI0A 3A7ZA 1LQDB 3L33A 4BAHB 4WY3A 1G3DA 4X6NA 2VIOA 2XW9A 3RXCA 3V7TA 4DOQA 2HPQH 3W95A 1OP2A 1TBRH 2BDCA 5GPIB 1TOCB 1Z6JH 3CS7A 1OP0A 1D3DB 1YBWA 3E8LA 2ZFFH 1BRCE 3ZZCA 1Z7KA 3ZZ3A 3GOVB 3TK5A 2ZEBA 2Y6TA 3SHCH 3V3MA 4YOIA 1EKBB 2ZZUH 1C5LH 1W13U 3SJKA 4A1XA 1GVKB 5GIBA 4TPIZ 1DXPA 3A7TA 3VEQB 4IC5A 3GYLB 2AH4X 3Q3YA 1BOQA 1G2LA 5GXPA 1ELFA 1K1IA 1IQLA 1TA2A 1KXFA 2FYRA 2YNBA 4THNH 4FU7A 1V2KT 1PYTD 3HK6B 3PLPA 3EYDA 1ELVA 5FAHA 1H8IH 2PSXA 3SU0A 3PYHA 4NIXA 1YPEH 3UOUA 3MH5A 3UNRA 3K6YA 1GGDB 4Z6AH 3ZZAA 2Y82A 1C5QA 3SV9A 3A8AA 1C5NH 3ZVDA 2K1QA 1V2QT 1HYLA 1C1PA 4ZAEA 4XBBA 4X2YA 1NPMA 3NWUA 2A4GA 1GCTB 1F5LA 1A5IA 3RU4D 4D8NA 1YPHC 4XFQA 3TGJE 2BY5X 4NWLA 1DSTA 1BRBE 1UHBA 4JZFH 4TWYA 1ELTA 4E05H 1SG8B 5FPSA 4XDEA 1CGIE 5FHTA 2ZFPH 1O3BA 2TIOA 1C2JA 3T25A 1AWHB 2GDDA 2O9QA 2ZC9H 1O2ZA 1MD8A 1BTZA 1LMWB 1O2HA 3RP2A 2ZTYA 4FVBA 1IQIA 2XC5A 1RIWB 2PSYA 2FI3E 1KLJH 1BMMH 1CQQA 3MNSA 2XTTB 2QN5T 5JPMH 1J8AA 3M36A 1PPBH 5JYIA 3QLPH 3T26A 1GMHF 1AVWA 3M7TA 3ZYDA 2FPZA 1GI6A 5A8XA 1GHBF 1DANH 1O3NA 2I6QA 1GL0E 3RXAA 2TGPZ 2BVSH 2D26C 2GCHG 1F2SE 3M61U 1KXBA 2ULLA 5H4IB 1LPZB 2AMPA 3LC5A 3MOCA 3SUFA 1AKSB 3SV7A 1ZHRA 1GCDA 1DWEH 1GHAF 2FI4E 4MPUA 4B2AA 1SQOA 4GAWA 2H1UA 2ZGCA 3GCTF 3STIA 2A2QH 3LJOA 1Q3XA 2AGGX 1SSXA 2A7HA 1V2ST 4ZH8A 3BIUH 4IGDA 4X8UH 5HM2A 2C8WB 3TGIE 4E7RG 3P6ZB 2Z3EA 4CR5A 2D2DA 2BB4A 1WYKA 2H9EH 2FM2A 4BAQB 2UWPA 1DLEA 3RXFA 1TB6H 2YOLA 2C93B 1O2GH 1C1SA 1C5TA 2W7SA 4D9QA 4DY7B 4TPYA 3A82A 1P9UA 2AERH 1XKBC 2OC8A 1B5GH 1KDQB 2BD4A 1Y3YA 4WJG2 3MNXA 3U8OH 1OYQA 4BTTB 1L4DA 2ODYB 3RXUA 1MAXA 1O2KA 2F3CE 4A1TA 4CH8B 4I31A 5EU8A 3K65B 3LKWA 1FZZA 3UNSA 4CRCA 2BM2A 1SGEE 1SGDE 3Q3XA 2QA9E 1ETSH 1ELGA 4ISOA 1CHGA 2ANYA 3A8BA 2BXUH 2BX4A 1UK2A 3M7QA 2ZF0H 4B76A 1P2KA 3M5MA 2ZTXA 1NU7B 2XYAA 2VWNA 1TAWA 2JETB 2WUBA 3TJNA 1G30B 4YM9A 2A7JA 3S7HB 1QL9A 4A92A 1NROH 4OS7A 3M5LA 2HVXA 4OS6A 1O3IA 1UMAH 2ZWLH 1SGRE 1MD7A 2H9HA 4X2XA 1ID5H 1UTPA 4J2YB 5EQSA 7GCHF 4I7YH 1UVOA 4WF8A 1GBAA 3DA9B 1C5RA 3MMGA 4KTSA 4NIVA 4X1RU 1UTQA 1TBZH 3AAUA 3UUZA 2G00A 4UDWH 1DWBH 2A2XH 3OY6U 3GY8A 1L4ZA 1HIAA 1SPJA 3ATKA 4FUCA 5BPEA 1JMOH 2BZAA 3K2UA 5E0HA 2HALA 2ALPA 1O3DA 4X2WA 3VXFH 3A7VA 5DP9A 3HKIB 3NXPA 4IMZA 2ZHEH 2OQ5A 1GJDB 1O2TA 1AB9C 2SGQE 2QC2A 3SNDA 3U9AH 1RD3B 1K1JA 1BMLA 1AFEH 4YOJA 5JBTA 3FP6E 4MNVA 4CRFA 5C1XA 3H7TA 2BLVA 1O2UA 1QL8A 3PLKA 1A7SA 4ABAA 2FXRA 4OGXA 5F8TA 3HGPA 1GI4A 2B7DH 4MNWA 2H2ZA 2ALVA 5EPNA 1UJ1A 1GL1A 2JH0D 5J4QA 2UUJB 1EASA 3RXOA 3PTNA 1MBMA 4I8KA 4Z0KA 1LHCH 1TFXA 2ZP0H 3DFLA 2PW8H 3SGBE 1OPHB 4K3JA 1ZR0A 1CGHA 1YGCH 4U01A 1DY9A 3SBKA 3H7OA 8GCHF 3RXTA 1OWDA 1V2MT 4KP0A 1TPOA 2EI7A 2EI6A 2OBQA 4BNRA 1J16A 1J15A 2VINA 4JYTA 1C1RA 1O5CB 1P2IA 2LPRA 1RFNA 1ZPBA 5IDKA 2J2UA 3L3TA 1LKAA 3L6PA 1A0LA 3P8NA 1IHTH 4MDSA 1AUTC 3Q77A 3KCGH 2C8XB 1TLDA 1EXFA 4OS2A 1KLTA 3Q76A 1AY6H 1QB1A 1F0SA 1NZQH 1P2OA 2H5CA 1MTWA 2BTCE 5JBCS 2BVRH 1QQUA 2B5TB 3ZVAA 2ZI2H 4RKOB 1DITH 1TGCA 2WPJS 5HM9A 3K6ZA 4O03A 3BF6H 1GJ7B 1L1GA 1BBRH 1QIXB 1GJ5H 1FY4A 2G4TA 2Y81A 2FOGA 2WYJA 3MI4A 3SNAA 1GHXH 1DOJA 1YPHE 5A0AE 2AIQA 1NT1A 3ITIA 1BJVA 2Y5FA 1QA7A 2I6SA 1E37B 1DT2A 1O2SA 1B7XB 3E1XB 1MU8B 3MH6A 1CSOE 3HATH 3BEFB 2A0QB 2HLCA 3ZZDA 1T8MA 5DP6A 3QTVH 1BDAA 2AEIH 1HFDA 5LPRA 3MYWA 2FS8A 1YYY1 1BT7A 1V2VT 4ZXXH 2C8YB 5CE1A 1GBJA 4JK5A 1O2LA 3LOXA 3A7XA 3C1KA 1UTMA 1SGQE 5BRRE 2ZHDA 3M35A 4GLYA 3D62A 1DUAA 1AE5A 2FWWA 1GBIA 3I77A 3MU1A 2W3IA 4F4OC 3IWMA 1PQ7A 4WVPE 5DP4A 3M3SA 1NRSH 3QUMP 2SNVA 1LHEH 2P3TB 1GDNA 3ELAH 3UQVA 2OINA 3LGTA 1GJ4H 1JOUB 4FUDA 4JZIA 3PB1E 2ZDNA 4AFQA 2WPLS 1XXDA 5G4BA 3EA8A 1D9IA 3RLYH 4DW2U 1ABIH 1O39A 1TNLA 5HGGA 1O5GH 5DP7A 1IQHA 1O2YA 4DIHH 1FY1A 1RTKA 4JYUH 1KXEA 1YPKH 3TH3H 5JB8S 2CV3A 5TCAA 1AFQB 1N1LA 5K0HA 1SFQB 2ZCHP 2NU1E 1C9TA 1SGCA 1O0DH 1F0TA 2NU3E 1WQSA 1FPHH 4INLA 2BQ7B 2LNCA 1C5WB 2XCNA 4NFEA 1ELEE 2A4RA 3B9FH 1TGNA 3ZZ4A 2ZKSA 1ZSLA 2AMQA 1ZLRA 1YLDA 3S9CA 1GBTA 1IAUA 5T6FA 1C2EA 2JKHA 1TNGA 4B1TA 2Y7ZA 2CF9H 1RJXB 1ZJKA 4JZEH 3UQOA 1P2JA 2VIDA 1Z8GA 5E2OA 3TH4H 1O3OA 2BMGB 1UTJA 1YCPM 4KTUA 1SGNE 1GMCG 1GPZA 5JBBS 2F91A 5DK1A 1GI8B 1A4WH 2ZNKH 5A2MH 2TPIZ 1EOJA 2VIPA 4O97A 2J38A 3PMHB 5IYTA 1O5DH 4WXIA 4JZ1A 4DT7B 1HJAC 2OUAA 4MLFB 2BDYA 3DT0H 3UFAA 3RC4A 1N8OB 3URDA 1Q2WA 2XBWA 3RXLA 2VH0A 1XVOA 5GJ4B 3MU0A 1VZQH 3QX5H 1JRSA 4UFEH 3RXIA 1SGPE 3RLWH 1IQFA 4I32A 1IHSH 3QTOH 4FU9A 4ESTE 1Y59T 2M5TA 5T3HA 3TK9A 2V6NA 1A3EH 1IQKA 2GD4B 3LDXH 5EQQA 1BRAA 1O2RA 3RC6A 1O2XA 1GMDF 4CREA 5F6MA 1IQNA 2B0FA 3MH7A 1LVYA 2PR3A 5PTPA 5A8ZA 1HAHH 5CMXH 1TNKA 2P95A 1Z1JA 1O3KA 1YPJH 5FBIA 5EW2H 2Y7XA 1O5BB 3EE0B 3D65E 3TJVA 1SQAA 1HGTH 2BDIA 2Z7FE 4MNYA 5L30H 1SGTA 1ZMNA 1VGCC 1L0ZA 1XVMA 1ARCA 2Z9KA 1LVMA 4BTIB 3VB3A 3OYPA 1O3PB 3FFGA 1PQ8A 2PV9B 2QAAA 1O2VA 1GJCB 4FUIA 3BN9A 1W10U 3SJ8A 3VB5A 2BQ6B 3ESTA 2ZFRH 2DE9A 2FOHA 2J92A 2F9VA 2H5DA 1UCYK 2P3FH 5C1YA 5C3NA 1OKXA 2ZGHA 1BCUH 1O5EH 2DUCA 3BTME 3PLBA 1UHBB 3OY5U 5FX6A 4GCHG 2FOMB 3GY6A 3LC3A 2CGAA 1P03A 1QRZA 4A6LA 1E35B 2P8OC 2PFEA 4ASHA 1AVGH 1SLXB 1J9CH 2QF3A 3SO3A 1O30A 1IOEA 1SOTA 2QF0A 3UNQA 4XBCA 1ZMLA 2Z9LA 4JK6A 1W0ZU 2BLQA 1FI8A 4ZKRU 2BDHA 5TCCA 1GGDC 4AB9A 3OU0A 4X6PA 3GY7A 4JZDH 4Y0YE 1T8OA 4B74A 3SV8A 2FLBH 1SR5C 3GDUA 4ABFA 5C1UA 1GI7B 3VGCB 3MU5A 1GHWH 2F9BH 2GP9B 1TRMA 4AZ2B 4Q80A 1E36B 1EZUC 1FAKH 2FODA 4YT7H 3M3TA 2HOBA 5EG4A 4GCHF 4Y71A 1SGYE 1GBEA 4INKA 1VR1H 1PPZA 1DM4B 3TH2H 1XM1A 5J4SA 1ANDA 1WBGB 3P8OA 4PROA 2ZECA 1MTUA 1TWXB 3ENSB 4Y0ZE 2GMTC 1P06A 5GWZA 1BHXB 2B9LA 2XWBI 1RTLA 2GCTC 1GJ9B 3MNBA 1V2UT 2O8UA 2NWNA 1HAVA 1Y5AT 2WPIS 3SNBA 3A87A 4DURA 1T8NA 3FZZA 1O37A 4IBLH 1NESE 2G81E 1S0RA 3O8CA 4YOGA 1NU9A 3RMMH 4BANB 1OX1A 5F8ZA 3ZVBA 3HPTB 4JMYA 1P2MA 2F83A 3SJOA 1XUGA 2F9PA 1ANCA 2Q6DA 2SNWA 3RXPA 1GBLA 2H6MA 1UK4A 2SGAA 1FPCH 2Z3DA 1JXPA 2IN2A 1MKXH 3ATIA 1PJPA 3PWBA 1QQ4A 1DLKB 1OS8A 1W3CA 3OSYA 4ISLA 2HGTH 2SFAA 4NCYA 4AG2A 1NFYA 3M37A 3UR9A 1FDPA 1AUJA 1TMUH 2GX4A 4FUJA 1EAXA 1FJSA 1C5ZB 1SGIB 2QXGA 1IQEA 4NZLA 4CBNA 3ZVCA 1S6FA 1BTHH 1Z1IA 3S69A 2Q6GA 2IJOB 1C4V2 3MO9A 3E3TA 5AFYH 1NO9H 1MKWH 3HGNA 3PMBB 1VITF 1BQYA 1VITG 1GMCF 3GCHB 3TIUA 5C5NA 3BTTE 2PTNA 1NRPH 1KY9A 4WMEA 1PFXC 1TGSZ 3OTJE 2UUYA 1HIAB 2BY7X 4ABIA 3ZV9A 2P94A 2EA3A 2XCFA 4BXSA 3D23A 2HNTC 1TPAE 1HJAB 3P17H 4WWYA 2TRMA 1PPCE 1DICA 1EB1H 3PMJA 2KAIB 1O32A 1SMFE 2J4IA 1XX9A 1F92A 1HUTH 1EJAA 1QRXA 1P9SA 4OS1A 1MCVA 1TE0A 4RKJB 4YZUA 3LU9B 5EODA 5FCKA 3CENA 1O33A 3U8TH 6ESTA 1HRTH 1CA0B 3IG6B 3ZZ7A 3F9EA 3MTYA 1HNEE 5GCHG 1O2NA 1W14U 2V3OH 1ESTA 1P01A 1GI5A 2IOTA 2OBOA 9LPRA 4ABBA 2RA3A 5B6OA 1AIXH 2WPMS 1P05A 2BD2A 2GDEH 1S6HA 3UR6A 3EA7A 1QJ6B 2VVVA 3P70B 1TPPA 2GZ9A 3QZQA 3VGCC 1XUJA 2BOKA 3R3GB 4I8JA 4RN6A 3LGVA 1AKSA 2FOFA 4H6TA 5TJXA 2R2WU 1S82A 1FN8A 3UOPA 2O8MA 2FOEA 3P8GA 3ZZ8A 1VCPA 1MQ5A 2ZFTA 1A1RA 1BMAA 1LO6A 1HAIH 5EQRA 2G51A 3RXQA 1H9IE 1EPTB 4X0WU 2W26A 3M7UA 1FY5A 1THSH 4HTCH 4XE4A 1BBRK 4QT8C 4ZKNU 1P10A 2OC0A 4M7GA 5DP3A 3DUXH 4DJZB 1ZTLA 4U2WA 5E0JA 4AORA 1HPGA 1GHVH 1O3CA 4ZROA 1TONA 1HAZB 5E2PA 4H4FA 4U32A 3AW0A 1MTVA 2QV1A 4Y6DA 3SUGA 3DFJA 4FUGA 4D7FA 1UTNA 3PTBA 1A5HA 1TMTH 2V35A 2GT7A 3ZZ6A 2OD3B 3KQBA 1XUHA 2G5VA 1UK3A 3FP8E 5CHAB 2ZHQH 1RTFB 1S81A 3TPIZ 2CMYA 6GCHF 1CVWH 3MH4A 2EC9H 1NFXA 1W8BH 1SGFA 5DGJA 1M9UA 1CA8B 2Z9IA 3TK6A 4LOYH 1MH0A 1CT0E 1GBMA 3BSQA 3T29A 3SHAH 1HAGE 1O5FH 1C5MD 4TY6A 4X8TH 1N6YA 1HAPH 2BHGA 1W12U 4MQAA 1O2WA 2GVFA 1K1MA 4K5ZA 2VWOA 3IITA 3RXGA 1K1PA 4AYVB 4WMDA 2ZO3H 2AIPA 2WPKS 1A2CH 1AD8H 2G4UA 3RUOA 3LJJA 1V2WT 1GMDG 1P2NA 1C2DA 2FEQH 2HNTF 2XC4A 1KLIH 4SGBE 4K1EA 1NRQH 4AGJA 3VXEH 1CE5A 4TWWA 4ISNA 3GY4A 6CHAC 4NA7A 1TGBA 1P12E 1W7GH 1D6RA 5LPEA 4HGCA 2BQWB 2QXJA 1A5GH 1B0EA 1OWEA 1K2I1 1EUFA 2XBYA 2TGTA 4CHAB 4RSPA 4X6MA 1CA0C 1A0HB 1VJAU 1C1NA 4UONA 2BZ6H 1LDTT 1P09A 3BG4C 2BLOA 2ZDKA 4MPVA 3PROA 4ZHAA 4A1VA 3NUMA 1FXYA 1W0YH 1CHOG 1MBQA 1QBVH 1RRKA 4MPWA 1DUEA 1C5SA 1S85A 1XKAC 2BY9X 3BTQE 2QXIA 1FV9A 4IN1A 2ZCLP 3W94A 1ACBE 3A7WA 1YCPH 3GDVA 1P0SH 1DY8A 4J1YA 2ZDMA 4BAKB 3ZYEA 4AFUA 1Y5BT 2EI8A 4AOQA 3Q00A 1UVPA 2V3HH 2TBSA 1P2QA 1ZGIA 2BY8X 3F68H 1SHYA 2WV4A 2FOBA 1BA8B 1C5UA 2FESH 4NSYA 2OC7A 5A09A 1C5YB 1XMNB 5FBEA 1ZSJA 3U69H 3O8BA 1QNJA 1ANBA 5I46H 5DG6A 2O8WA 6CHAB 3FVFB 2QY0B 2OCVB 3I29A 3ZZ9A 2TGAA 1TOMH 2ZIQH 1C5OH 4K60A 2FP7B 2GT8A 2V0BA 3E0NB 3NZIA 7KMEH 1C9PA 2CJIA 2D1JA 1GBHA 3KNXA 3STJA 3T5FH 2F9UA 2PKAB 1HAYB 2RDLA 1C2FA 2AGIX 1UTKA 2VGCB 4CRAA 2HWLB 2STAE 1EZXC 2PTCE 3NK8A 3LGYA 4WH8A 3F1SB 4GSOA 3VPKA 1SL3A 4Y8ZA 4I33A 1UO6A 4UEHH 4B2CA 4B71A 4LXBH 2NU2E 1GBFA 1TX7A 1ETRH 3SU2A 5EXNA 1K9OE 2ANMH 1YF4A 3RMOH 1S0QA 1ELCA 3GYMA 4JYVH 1O3JA 2BLWA 3A7YA 3FP7E 1L2EA 2G55A 1EPTA 1FUJA 1HDTH 4GUXA 4IMQA 2VH6A 1C1TA 1O3FA 1V2OT 1YPGH 2Q6FA 4HI3A 1DFPA 1F0UA 3KIDU 4X2VA 3SUDA 3SI4H 3BTKE 5C20A 2A5KA 1BRUP 1GI9B 3BTFE 1V2PT 1AGJA 4TYDA 8KME2 1O31A 3F9HA 2STBE 1P3EA 1CT2E 4X1QU 3EA9A 2IPHA 5LGOA 1C1OA 1GBDA 1UCYH 2W3KA 5EPYA 5AFZH 1LPKB 2BD9A 3GDSA 3GCTG 4SGAE 1LHGH 1TQ7B 4AX9H 5I25A 4ISHH 2O8TA 2GGVB 2R0LA 1YPMH 2P93A 1QB6A 7GCHG 4WXVA 1LVBA 2PKSC 4LZ1H 1IQMA 1YCPK 2R9PA 3ODDA 2SGDE 2A4OA 2UWLA 2G5NA 1NY22 1D3TB 2VWLA 2BD8A 4UFFH 1PYTC 2C90B 1MZAA 1TPSA 1PPFE 1WU1A 1C1QA 1DWCH 3GY3A 3ATLA 1Y5UT 1GHAG 2RA0A 1ZTKA 3BTDE 2XXLA 4AGKA 2ZHFH 1T31A 2FTLE 2FDAA 1A61H 2THFB 4BOHA 1PQAA 1HJ8A 3ATWA 4K1SA 1MQ6A 1UTLM 4D9RA 1JWTA 2JH6D 2ZDVH 5A8YA 4X1SU 1WUNH 1Y3UA 1YPLH 2OXSA 2OQUA 2A5AA 3MNCA 3BIVH 2WINI 1O2PA 2P3UB 4IS5A 1LVOA 3S9AA 3F9GA 5FCRA 2FS9A 1NFWA 4NZQA 3S9BA 2GTBA 4UD9H 8GCHG 4E06H 2PUQH 1ZZZA 3KGPA 1C2IA 2XNIA 4ABDA 4DCDA 3F9FA 2WPHS 3DD2H 2ZDLA 4KKDA 2PWXA 1MTSA 3RXMA 1BUIA 4CHAC 3QGJA 3ZZ5A 1BIOA 1W11U 3BV9B 1P04A 2BD5A 2ZPQA 1KYNA 4NA9H 3P92A 5ETXA 1MAYA 3UIRA 1J14A 1BJUA 1O36A 1SFIA 1EJNA 1GBCA 1D3QB 2ZPRA 2NU4E 1NM6A 1QL7A 3M5NA 1ZHMA 4YLQH 1QTFA 1QBNA 3EQ0H 3KN2A 1GG6B 3DHKH 2FIRH 1RIWC 1AI8H 2ZA5A 2O8LA 3MU4A 4NIYA 2BVXH 4AG1A 4YO9A 3QK1A 4ABHA 2J95A 3B23B 1CT4E 1T32A 2QXHA 3UY9A 1TQ0B 4CH2B 3A86A 4AFZA 1AMHA 1V2NT 2R2MB 1QFKH 3GICB 4FVDA 1L1JA 4O9VA 2QYIA 3RXSA 2UWOA 4IC6A 1NS3A 2AMDA 3LGIA 4GHTA 1DS2E 4X8SH 3A80A 2ZFSA 1FNIA 3ODFA 1SLVB 2BX3A 5K7RA 1VCQA 1J17T 4KELA 4MTBA 5L2YH 1FMGA 1LCYA 3KQCA 1C2LA 1G37A 1SI5H 1CHOF 1XUFA 3KQEA 4Y7AA 1O38A 4LZ4B 3PV4A 3Q3KA 8ESTE 1SOZA 2GV7A 1ESAA 3TNTA 1EAIA 3ZVEA 3V0XA 1DE7H 2AGEX 2ZPSA 2HPPH 1ELDE 3OX7U 1RS0A 4Y8XA 3BTHE 4UFDH 3NKKA 3T27A 2GMTB 1UVSH 2SGEE 2FYQA 1G36A 1BTUA 1O34A 1P3CA 3GY2A 5FPYA 2Z9GA 3KHVA 2GZ8A 3A85A 3QWCH 3MWIU 6GCHG 3FANA 1MU6B 4CRDA 1CBWC 1K21H 3LT3A 3U1IB 1OWKA 3QN7A 4DG4A 1Y8TA 4KTCA 5GDSH 1WV7H 1KXAA 1MKWK 5JB9S 1E0FD 1G2MA 2W7UA 1GWAA 4AFSA 1GI3A 1C5PA 3GCHC 1O3LA 1JIMA 1G9IE 3SU3A 3RU4T 4A7IB 4AYYB 1Y3VA 2FO9A 2H9TH 4FU8A 1KTSB 3SV6A 3PO1C 2XBVA 1PQ5A 5FPTA 1MKXK 2AFQB 4FXGH 1W7XH 1TX6A 7ESTE 2OC1A 1GHZA 1U6QA 2P59A 2ZFQH 2ZQ1A 3FAOA 1D4PB 5ESBA 3SORA 1AB9B 4YTAA 5AVDA 1Y3XA 3WY8A 4ISIH 3RXRA 2Y80A 2A45B 1AFQC 1D3PB 1Z71A 4B75A 3RM0H 4BAMB 1B0FA 1E38B 1O2QA 1EJMA 3RDZA 5E0GA 1AZZA 3O8DA 1JRTA 1TGTA 1Z8JB 1TA6A 2GCHF 1BB0B 1NTPA 4WMFA 2ZGXH 1V3XA 3SU6A 1G32B 2ZU4A 3E91A 2A4QA 3JZ1B 1V2RT 1N8OC 3EAJA 2C4FH 1CU1A 1PPEE 1AHTH 3VB7A 5DJ7A 1WTHD 1LHDH 1O5AB 1AVXA 2EEKA 3PO1B 5ESTE 1YM0A 1TIOA 1JBUH 1O3AA 1OWHA 3K9XB 1WSSH 5LH8A 3SJIA 3LIWA 1K1OA 5DP8A 5ABWA 4X1PU 3SJ9A 3HK3B 3MHWU 1GVLA 1TNJA 2ZGJA 3MO3A 3UREA 3ZZBA 3GY5A 2ZG0H 1OYTH 4X6OA 4CR9A 2FTMA 1EQ9A 3RXVA 3LPRA 1HB0B 2CHAB 1YLCA 1FY3A 1EOLA 3SN8A 1WAYB 2Y5GA 4I8GA 4DGJA 5FX5A 1C2MA 1TNIA 3F6UH 4X8VH 3U8RH 5AHGH 3AW1A 3MFJA 1FQ3A 3SQHE 1UCYE 1MZDA 3PMAB 3BTEE 1TRNA 1K1LA 3PM3A 1WOFA 4O3TA 3O8RA 2ASUB 3C27B 1BBRE 1NN6A 1UVTH 1Y3WA 4FUFA 2A32A 3A89A 1SVPA 1V2JT 2BXTH 4ABEA 4D7GA 1BTYA 1O35A 4CRBA 5HYOA 2WYGA 3KF2A 1IQJA 3TITA 3V13A 5F03A 1VJ9U 2J9NA 3GISB 4YESB 1BHXF 1YC0A 2FI5E 3TNSA 4ZMAH 1A46H 1KXDA 4Y76A 4Y8YA 3ATMA 1ZOMA 3FZDA 3T62A 1HXFH 1OXGA 2VWMA 3LH1A 4DVAU 1T8LA 3S7KB 1ZPCA 2PGQB 3CS0A 1ZPZA 1C2KA 5EXMA 1ZYOA 2OP9A 2WUCA 5EGMA 1TBQH 3RXJA 5F8XA 1QY6A 1OWIA 4BTUB 2ZCKP 1O3MA 2SGFE 3BTWE 1QRWA 5HMAA 2GV6A 3RXBA 2JETC 1SGFG 3QGNB 1SQTA 1MUEB 1AWFH 3SU5A 4AB8A 8LPRA 3A88A 3VB6A 1AN1E 2C8ZB 4NFFA 1GJ6A 1MTNC 2CN0H 2GKVE 1EZQA 1FLEE 1C1UH 2QCYA 4YT6H 1XUIA 3BG8A 3P8FA 2P8OB 3SGQE 1TRYA 2HRVA 1OOKB 1HLTH 1EAUA 1H9HE 3SV2H 1YKTA 3LGUA 4VGCB 3RMNH 1BTWA 1DWDH 4YLUA 4Q2KA 2B8OH 1SLUB 1JIRA 3ZV8A 2BD7A 2VNTA 1GDUA 2ZU1A 3A8CA 3VFEA 1OP8A 2XRCA 2FOAA 2NU0E 3E6PH 2Z9JA 5JDUB 1UTOA 1F7ZA 1BITA 4Q7YA 3TVJB 4OS4A 4ABGA 2VU8E 3BEIB 3A83A 1PPGE 4LK4A 1H4WA 1LKBA 2HNTE 5EW1H 1O3EA 3VB4A 1C2GA 3SW2B 2PLXA 1INCA 1LQEA 4FUEA 2TGDA 3M3VA 3ZVGA 5L2ZH 2GZ7A 1BTXA 1GBBA 2F9NA 1LHFH 1SHHB 3KEEA 3I78A 2R3YA 1DPOA 4FUBA 4ZHLU 4XOJA 2OTVA 1C1VH 2A7CA 3RM2H 2ANKH 3GCNA 1AU8A 2VIWA 4IN2A 2R3UA 3BTGE 1GCTC 1HCGA 2XC0A 3TJUA 1QBOA 2P16A 5C67A 4AN7A 7LPRA 5C2ZA 1EP5A 1HV7A 5GCHF 1C4Y2 1GVZA 1T7CA 3RC5A 1KTTB 1EATA 2RG3A 2YNAA 4Q7XA 4FUHA 4Y11E 3EGKH 1C5XB 3RU4E 1NRRH 2Z3CA 4IW4E 2UUKB 3BG4B 2BOHB 1N6XA 5FXLA 2Q1JA 1FN6A 3MU8A 1RXPA 1GHBG 1SLWB 1WQVH 1F5RA 1G3CA 2VJ1A 2CXVA 2PKSB 5JBAS 1KIGH 2J34A 1CO7E 1UVUH 1XUKA 4O3UA 2A1DB 1ESBA 1FY8E 3SUEA 4B73A 1LPGB 2PKAA 2BYAX 4NWKA 1GJBB 5A0BA 3TLOA 1H9LB 4OGYA 1MMJN 3SNEA 1P8VC 1C2HA 1WCZA 1Q31A 4ZXYH 2FLRH 1GBKA
chains in the Genus database with same CATH superfamily
1ZJDA 1WTGH 2KCOA 2VGCC 3SNCA 3S0NA 1VCWA 2ZU3A 5LPFA 3LGWA 2W5EA 1SQRA 3KYGA 1GHYH 2A31A 5HIZA 1S83A 2G8TA 4MVNA 2L6OA 1DDJA 3HKJB 3LH3A 6LPRA 1GMHG 2J94A 3N7OA 1QB9A 3B8JA 2XWAA 2XBXA 3E0PB 3RXKA 2C3SA 4D76A 5C17A 1WXRA 2PUXB 1GI2A 3SU4A 1QR3E 3QZRA 2PHBA 2SGPE 2F9OA 1THRH 1TYNA 1O3GA 2WZQA 4R8TB 4H6SB 4BXWA 5SGAE 3A81A 4VGCC 4HFPB 2K8IA 4XSKU 3OAAD 4R0IA 4HZHA 1T4UH 1KDQA 2BDAA 1DSUA 4B2BA 3SU1A 2WV5A 3URCA 4K1TA 4H42U 1ZGVA 1HAXB 1TABE 5DPAA 2VVUA 2ZDAH 2ZU5A 2RDEA 3PV2A 2CHAC 2BDGA 4MG3A 1KSNA 4ABJA 2BY6X 4K2YA 4Y7BA 3U98H 3RXHA 1GJAB 2FMJA 3CP7A 4KGAA 1HAVB 2RCEA 3UTUH 2FX6A 1NFUA 4K8BA 4ZUHA 2ANWA 3AAVA 1ELBA 4F49A 3NPSA 1HBTH 2FZZA 2J98A 1AE8H 2ZQ2A 4WH6A 1K22H 1S84A 1BTPA 5E8EH 4P00A 2KCAA 1EZSC 2AS9A 2FOCA 4U30A 3SQEE 5B6LA 1ZSKA 1EPTC 2VB0A 1HAOH 1FAXA 2WV9A 1Z6EA 5L6NH 3QO6A 1AZ8A 3EDXB 3KL6A 1EB2A 2VVCA 1P11E 1GI1A 1ORFA 5T6GA 2Z6BD 5DKMA 3NRLA 1NRNH 1NBME 4MNXA 3M5OA 1QURH 4GHQA 4X1NU 1ARBA 5DP5A 2QIQA 3BEUA 2G52A 3H5CB 4Y79A 1SBWA 4ZKSU 3A8DA 4NGAH 3RXDA 2VIQA 2ESTE 2R0KA 1QHRB 2ODPA 2OLGA 1FIZA 1X7AC 1A0JA 2Y5HA 4XBDA 1C5VA 1CGJE 3QDZB 4NA8A 3UPEA 1ABJH 5AF9H 3U1JB 2FX4A 1V2LT 4GVUA 1DXWA 1Z8RA 2Z94A 4A5TS 3SZNA 2CF8H 3F0PA 1MTNB 1BZXE 5DO4H 1W2KH 4GPGA 2KAIA 1H8DH 1QJ1B 1A3BH 1Z8IB 5EOKA 1O2OA 4K8YA 1P57B 1TNHA 1F0RA 2DE8A 1G3EA 4OS5A 4Y10E 3UWJH 1ZRBA 1XXFA 3NCLA 1NC6A 1FONA 3KQDA 4INHA 4Q7ZA 1GJ8B 4ZKOU 1V2TT 2QGRA 4UE7H 3UWIA 3TU7H 4CRGA 1HJ9A 3SI3H 2ILNA 1ELAA 3E90B 3SOSA 1E34B 1EX3A 1VITH 4CBOA 1EAWA 3TJOA 4MPXA 1QCPA 2D8WA 4I8LA 1OHHD 5EJZA 3A84A 1L1NA 3V12A 1TMBH 1SB1H 4I8HA 1GG6C 4FETA 3WWFA 5HXFA 3D49H 2PP6A 3AASA 2BD3A 3T2NA 2ODQA 1AO5A 4JCNA 1CBWB 5C5OA 2ZTZA 5T6DA 1TX8A 2W6JD 2PGBB 2ZGBH 4NG9H 1LTOA 1QA0A 4TY7A 4ZHMU 5KEDA 3G01A 1QJ7B 4DIIH 1G3BA 2ZU2A 5EXLA 4NIWA 1F5KU 1S5SA 1RGQA 2A5IA 4BAOB 1KXCA 1BMNH 4NSVA 3E16B 3RXEA 3SGAE 1O3HA 1O2IA 1C1MA 2JH5D 1D6WA 1EP6A 3TGKE 1ZTJA 1K28D 1OSSA 1OWJA 3P95A 3MO6A 2UUFB 1K1NA 2BDBA 3JZ2B 1FIWA 1HXEH 4K69A 1PPHE 9ESTA 4E7NA 1O2JA 1ZRKA 1GDQA 2GCTB 1C4U2 3ZVFA 1SC8U 1H1BA 2VIVA 5A0CA 1AQ7A 1ZMJA 3LONA 1YP9A 1VGCB 5CHAC 1P02A 1V6DA 3R0FA 3RMLH 1THPB 4UFGH 1ETTH 2OK5A 1IQGA 1C1WH 1ZHPA 1TALA 1MCTA 1T4VH 1DVAH 1QGFA 2AYWA 3PWCA 3AVZA 1O2MA 2ZHWH 3GCOA 1DX5M 1ANEA 3T28A 1GI0A 3A7ZA 1LQDB 3L33A 4BAHB 4WY3A 1G3DA 4X6NA 2VIOA 2XW9A 3RXCA 3V7TA 4DOQA 2HPQH 3W95A 1OP2A 1TBRH 2BDCA 5GPIB 1TOCB 1Z6JH 3CS7A 1OP0A 1D3DB 1YBWA 3E8LA 2ZFFH 1BRCE 3ZZCA 1Z7KA 5CHBA 3ZZ3A 3GOVB 3TK5A 2ZEBA 2Y6TA 3SHCH 3V3MA 3FOAA 4YOIA 4XD7D 1EKBB 2ZZUH 1C5LH 1W13U 3SJKA 4A1XA 3WWBA 3N7DA 1GVKB 5GIBA 4TPIZ 1DXPA 3A7TA 3VEQB 4IC5A 3GYLB 2AH4X 3Q3YA 1BOQA 1G2LA 5GXPA 1ELFA 1K1IA 1IQLA 1TA2A 1KXFA 2FYRA 2YNBA 4THNH 4FU7A 1V2KT 1PYTD 3HK6B 3PLPA 3EYDA 1ELVA 5FAHA 1H8IH 2PSXA 3SU0A 3PYHA 4NIXA 1YPEH 3UOUA 3MH5A 3UNRA 3K6YA 1GGDB 3F2GA 4Z6AH 3ZZAA 2Y82A 1C5QA 2QE7D 3SV9A 3A8AA 1C5NH 3ZVDA 2K1QA 1V2QT 1HYLA 1C1PA 4ZAEA 4XBBA 4X2YA 1NPMA 3NWUA 2A4GA 1GCTB 1F5LA 1A5IA 3RU4D 4D8NA 1YPHC 4XFQA 3TGJE 2BY5X 4NWLA 1DSTA 1BRBE 1UHBA 4JZFH 3EE7A 4TWYA 1ELTA 4E05H 1SG8B 2KR7A 4XDEA 5FPSA 1CGIE 5FHTA 2ZFPH 1O3BA 2TIOA 1C2JA 3T25A 1AWHB 2GDDA 2O9QA 2ZC9H 1O2ZA 1MD8A 2KZ4A 1BTZA 1LMWB 1O2HA 3RP2A 2ZTYA 4FVBA 1IQIA 2XC5A 2V3MA 1RIWB 2PSYA 2FI3E 1KLJH 1BMMH 1CQQA 3MNSA 2XTTB 2QN5T 5JPMH 1J8AA 3M36A 1PPBH 5JYIA 3QLPH 3T26A 1GMHF 1AVWA 3M7TA 3ZYDA 2FPZA 1GI6A 5A8XA 1GHBF 1DANH 1O3NA 2I6QA 1GL0E 3RXAA 2TGPZ 2BVSH 2D26C 2GCHG 1F2SE 3M61U 1KXBA 2ULLA 5H4IB 1LPZB 2AMPA 3LC5A 3MOCA 3SUFA 3UAIC 1AKSB 3SV7A 1ZHRA 1GCDA 1DWEH 1GHAF 2FI4E 4MPUA 4B2AA 1SQOA 4GAWA 2H1UA 2ZGCA 3GCTF 3STIA 3DSOA 2A2QH 3LJOA 1Q3XA 2AGGX 1SSXA 2A7HA 1V2ST 4ZH8A 3BIUH 4IGDA 4X8UH 5HM2A 5C94A 2C8WB 3TGIE 4E7RG 3P6ZB 2Z3EA 4CR5A 2D2DA 2BB4A 1WYKA 2H9EH 2FM2A 4HG6A 4BAQB 2UWPA 1DLEA 3RXFA 1TB6H 2YOLA 2C93B 1O2GH 1C1SA 1C5TA 2W7SA 4D9QA 4DY7B 4TPYA 3A82A 3U28C 1P9UA 2AERH 1XKBC 2KCPA 1B5GH 1KDQB 2BD4A 1Y3YA 2OC8A 4WJG2 3MNXA 3U8OH 1OYQA 4BTTB 1L4DA 2ODYB 3RXUA 3GS9A 1MAXA 1O2KA 2F3CE 4A1TA 4CH8B 1FX0B 4I31A 3PV5A 3K65B 5EU8A 3LKWA 1FZZA 3UNSA 4CRCA 2BM2A 1SGEE 1SGDE 3Q3XA 2QA9E 4I86A 1ETSH 1ELGA 4ISOA 1CHGA 2ANYA 1YLNA 3A8BA 2BXUH 2JIZD 2BX4A 1UK2A 3M7QA 2ZF0H 4B76A 1P2KA 3KQ5A 3M5MA 2ZTXA 1NU7B 2XYAA 2VWNA 1TAWA 2JETB 2WUBA 3TJNA 1G30B 4YM9A 2A7JA 3S7HB 1QL9A 4A92A 1NROH 4OS7A 3M5LA 2HVXA 4OS6A 2YMSB 1O3IA 1UMAH 2ZWLH 1SGRE 1MD7A 2H9HA 4X2XA 1ID5H 1UTPA 4J2YB 5EQSA 7GCHF 4I7YH 1UVOA 4WF8A 1GBAA 3DA9B 1C5RA 3F3BA 3MMGA 1K0HA 4KTSA 4NIVA 4X1RU 1UTQA 1TBZH 3AAUA 3UUZA 2G00A 4UDWH 1DWBH 2A2XH 3OY6U 3GY8A 1L4ZA 1HIAA 1SPJA 3ATKA 4FUCA 5BPEA 1JMOH 2BZAA 3CNRA 3K2UA 5E0HA 2HALA 2ALPA 1O3DA 5KGOA 4X2WA 2J5UA 1COWD 3VXFH 5IK2D 3A7VA 5DP9A 3HKIB 3NXPA 4IMZA 2ZHEH 2OQ5A 2IJD1 1GJDB 1O2TA 1AB9C 2SGQE 2QC2A 3SNDA 3U9AH 1RD3B 1K1JA 1BMLA 1AFEH 4YOJA 5JBTA 3FP6E 3H09A 4MNVA 4CRFA 2W6ID 3H7TA 2BLVA 5C1XA 1O2UA 1QL8A 3PLKA 1A7SA 4ABAA 2FXRA 4OGXA 5F8TA 3HGPA 5KECA 1GI4A 2B7DH 4MNWA 2H2ZA 2ALVA 5EPNA 1UJ1A 2KFWA 1GL1A 2JH0D 5HKKD 5J4QA 2UUJB 1EASA 3RXOA 3PTNA 1MBMA 4I8KA 4Z0KA 3SYJA 1LHCH 1TFXA 2ZP0H 3DFLA 2PW8H 3SGBE 1OPHB 4K3JA 1ZR0A 1CGHA 1YGCH 4U01A 1DY9A 4AC9A 3SBKA 3H7OA 8GCHF 3RXTA 4XRNA 1OWDA 1V2MT 4KP0A 1TPOA 2EI7A 2EI6A 2OBQA 4BNRA 1J16A 1J15A 2VINA 4JYTA 1C1RA 1O5CB 1P2IA 2LPRA 1RFNA 1ZPBA 5IDKA 2J2UA 3L3TA 1LKAA 3L6PA 1A0LA 3P8NA 1IHTH 4MDSA 1AUTC 3WW7A 3Q77A 3KCGH 2C8XB 1TLDA 1EXFA 4OS2A 1KLTA 3Q76A 1AY6H 1QB1A 1F0SA 1NZQH 1P2OA 2H5CA 1MTWA 2BTCE 5JBCS 2BVRH 1QQUA 2B5TB 3ZVAA 2ZI2H 4RKOB 1DITH 1TGCA 2WPJS 5HM9A 3K6ZA 4O03A 3BF6H 1GJ7B 1L1GA 1BBRH 1QIXB 1GJ5H 1FY4A 2G4TA 2Y81A 2FOGA 2WYJA 3MI4A 3SNAA 1GHXH 1DOJA 1YPHE 5A0AE 2AIQA 1NT1A 3ITIA 1BJVA 2Y5FA 1QA7A 2I6SA 1E37B 1DT2A 1O2SA 1B7XB 3E1XB 1MU8B 3MH6A 1CSOE 3HATH 3BEFB 2A0QB 2HLCA 3ZZDA 1T8MA 5DP6A 3QTVH 1BDAA 2AEIH 1HFDA 5LPRA 3MYWA 2FS8A 1YYY1 1BT7A 1V2VT 4ZXXH 2C8YB 5CE1A 1GBJA 4JK5A 4RI0A 1O2LA 3LOXA 3A7XA 3C1KA 1UTMA 1SGQE 5BRRE 2ZHDA 3M35A 4GLYA 3D62A 1DUAA 1AE5A 2FWWA 1GBIA 3I77A 1MABB 3MU1A 1VKYA 2W3IA 4F4OC 3IWMA 4ACAA 1PQ7A 4WVPE 5DP4A 3M3SA 1NRSH 3QUMP 2SNVA 2P3TB 1LHEH 1GDNA 3ELAH 3UQVA 2OINA 3LGTA 1GJ4H 1JOUB 4FUDA 4JZIA 3PB1E 2ZDNA 4AFQA 2WPLS 1XXDA 5G4BA 3EA8A 1D9IA 3RLYH 4DW2U 1ABIH 1O39A 1TNLA 5HGGA 1O5GH 5DP7A 1IQHA 2YMSD 1O2YA 4DIHH 1FY1A 1RTKA 4JYUH 1KXEA 1YPKH 3TH3H 5JB8S 2CV3A 5TCAA 1AFQB 1N1LA 2GJGA 5K0HA 5C0UA 1SFQB 2ZCHP 2NU1E 1C9TA 1SGCA 1O0DH 1F0TA 2NU3E 1WQSA 1FPHH 4INLA 4ACBA 2BQ7B 2LNCA 1C5WB 2XCNA 4NFEA 1ELEE 2A4RA 5EIYA 3B9FH 1KMHB 1TGNA 3ZZ4A 2ZKSA 1ZSLA 2AMQA 1ZLRA 2LELA 1YLDA 3S9CA 1GBTA 1IAUA 5T6FA 1C2EA 2JKHA 1TNGA 4B1TA 2Y7ZA 2CF9H 1RJXB 1ZJKA 4JZEH 3UQOA 1P2JA 2VIDA 1Z8GA 5E2OA 3TH4H 1O3OA 2BMGB 1UTJA 1YCPM 2XOKD 3SZEA 4KTUA 1SGNE 1GMCG 1GPZA 5JBBS 2F91A 5DK1A 1GI8B 1A4WH 2ZNKH 5A2MH 2TPIZ 1EOJA 2VIPA 4O97A 2J38A 3PMHB 5IYTA 1O5DH 4WXIA 4JZ1A 4DT7B 1HJAC 2OUAA 4MLFB 2BDYA 3DT0H 3UFAA 3RC4A 1N8OB 3URDA 1Q2WA 2XBWA 3RXLA 2VH0A 1XVOA 5GJ4B 3MU0A 1VZQH 3QX5H 1JRSA 4UFEH 3RXIA 1SGPE 3RLWH 1IQFA 4I32A 1IHSH 3QTOH 4FU9A 4ESTE 4F48B 1Y59T 2M5TA 5T3HA 3TK9A 2V6NA 1A3EH 1IQKA 2GD4B 3LDXH 5EQQA 1BRAA 1O2RA 3RC6A 1O2XA 1GMDF 4CREA 5F6MA 1IQNA 2B0FA 3MH7A 1LVYA 2PR3A 5PTPA 5A8ZA 1HAHH 5CMXH 1TNKA 3F0OA 2P95A 1Z1JA 4FOUC 1O3KA 1YPJH 5FBIA 5EW2H 2Y7XA 1O5BB 3EE0B 3D65E 3TJVA 1SQAA 1HGTH 2BDIA 2Z7FE 4MNYA 5L30H 1EFRD 2HVYB 1SGTA 1ZMNA 3UB0A 1VGCC 1L0ZA 4B6EA 1XVMA 1ARCA 2Z9KA 1LVMA 4BTIB 3VB3A 3OYPA 1O3PB 3FFGA 1PQ8A 2PV9B 2QAAA 1O2VA 1GJCB 4FUIA 3BN9A 1W10U 3SJ8A 3VB5A 2BQ6B 3ESTA 2ZFRH 2DE9A 2FOHA 2J92A 2F9VA 2H5DA 1UCYK 2P3FH 5C1YA 5C3NA 1OKXA 2ZGHA 1BCUH 1O5EH 2DUCA 3BTME 3PLBA 1UHBB 1BMFD 3OY5U 5FX6A 4GCHG 2FOMB 3GY6A 3LC3A 2CGAA 1P03A 1QRZA 4A6LA 2F4LA 1E35B 2P8OC 2PFEA 4ASHA 1AVGH 1SLXB 1J9CH 2QF3A 3SO3A 1O30A 1IOEA 1SOTA 2QF0A 3UNQA 4XBCA 1ZMLA 2Z9LA 4JK6A 4OM9A 1W0ZU 2BLQA 1FI8A 4ZKRU 2BDHA 4TT3D 5TCCA 1GGDC 4AB9A 4B6FA 3OU0A 4X6PA 3GY7A 4JZDH 4Y0YE 1T8OA 4ASUD 4B74A 3SV8A 2FLBH 1SR5C 3GDUA 4ABFA 5C1UA 1GI7B 3VGCB 3MU5A 1GHWH 2F9BH 4TSFD 2GP9B 1TRMA 4AZ2B 4Q80A 1E36B 1EZUC 1FAKH 2FODA 4YT7H 3M3TA 1YWUA 2HOBA 5EG4A 4GCHF 4Y71A 1SGYE 1GBEA 4INKA 1VR1H 1PPZA 1DM4B 3TH2H 1XM1A 5J4SA 1ANDA 1WBGB 3P8OA 5EJLA 4PROA 2ZECA 1MTUA 1TWXB 3ENSB 4Y0ZE 2GMTC 1P06A 5GWZA 1BHXB 2B9LA 2XWBI 1RTLA 2GCTC 2QF4A 1GJ9B 3MNBA 1V2UT 2O8UA 2NWNA 1HAVA 1Y5AT 2WPIS 2KCYA 3SNBA 3A87A 1W0JD 1T8NA 4DURA 3FZZA 1O37A 4IBLH 1NESE 2G81E 1S0RA 3O8CA 4YOGA 1NU9A 3RMMH 4BANB 1OX1A 5F8ZA 3ZVBA 3HPTB 4JMYA 1P2MA 2F83A 3SJOA 1XUGA 2F9PA 1ANCA 2Q6DA 2SNWA 3RXPA 1GBLA 2H6MA 1UK4A 2SGAA 1FPCH 2Z3DA 1JXPA 2KX4A 2IN2A 1MKXH 1E1QD 3ATIA 1PJPA 3PWBA 1QQ4A 1DLKB 1OS8A 1W3CA 3OSYA 4ISLA 2HGTH 2SFAA 4NCYA 4AG2A 1NFYA 3M37A 1W0KD 3UR9A 3OE7D 1FDPA 1AUJA 1TMUH 2GX4A 4FUJA 1EAXA 1FJSA 1C5ZB 2M2AA 1SGIB 2QXGA 1IQEA 4NZLA 4CBNA 3ZVCA 1S6FA 1BTHH 1Z1IA 3S69A 2Q6GA 2IJOB 1C4V2 3MO9A 3E3TA 5AFYH 1NO9H 1MKWH 3HGNA 3PMBB 1VITF 1BQYA 1VITG 1GMCF 3GCHB 3TIUA 5C5NA 3BTTE 2PTNA 1NRPH 1KY9A 4WMEA 1PFXC 1TGSZ 3OTJE 2UUYA 1HIAB 2BY7X 4ABIA 3ZV9A 2P94A 2EA3A 2XCFA 4BXSA 3D23A 2HNTC 1TPAE 1HJAB 3P17H 4WWYA 2TRMA 1PPCE 1DICA 1EB1H 1E79D 3PMJA 2KAIB 3AK5A 1O32A 1SMFE 2J4IA 1XX9A 1F92A 1HUTH 1EJAA 1QRXA 1P9SA 4OS1A 2V7QD 1MCVA 2JJ1D 1TE0A 4RKJB 4YZUA 3LU9B 5EODA 5FCKA 3CENA 1O33A 3U8TH 6ESTA 5CDFE 1HRTH 1CA0B 3IG6B 3ZZ7A 3F9EA 3MTYA 1HNEE 5GCHG 1O2NA 2WSSD 1W14U 2V3OH 1ESTA 1P01A 1GI5A 2IOTA 2OBOA 9LPRA 4ABBA 3VG8A 2RA3A 5B6OA 1AIXH 2WPMS 1P05A 2BD2A 2GDEH 1S6HA 3UR6A 3EA7A 1QJ6B 2VVVA 3P70B 1TPPA 2GZ9A 3QZQA 3VGCC 1XUJA 2BOKA 3R3GB 4I8JA 4RN6A 3LGVA 1AKSA 2FOFA 4H6TA 5TJXA 2R2WU 1S82A 1FN8A 3UOPA 2O8MA 2FOEA 3P8GA 3ZZ8A 1VCPA 1MQ5A 2ZFTA 1A1RA 1BMAA 1LO6A 1HAIH 5EQRA 2G51A 3RXQA 1H9IE 1EPTB 4X0WU 2W26A 2JJ2D 3M7UA 1FY5A 1THSH 4HTCH 4XE4A 1BBRK 4QT8C 4ZKNU 1P10A 2OC0A 4M7GA 5DP3A 3DUXH 4DJZB 1ZTLA 4U2WA 5E0JA 4AORA 1HPGA 1GHVH 1O3CA 4ZROA 1TONA 1HAZB 2JDID 5E2PA 4H4FA 4U32A 3AW0A 1MTVA 2QV1A 4Y6DA 3SUGA 3DFJA 4FUGA 4D7FA 1UTNA 3PTBA 1A5HA 1TMTH 2V35A 2GT7A 3ZZ6A 2OD3B 1WDIA 3KQBA 1XUHA 2G5VA 3DSPA 1UK3A 3FP8E 5CHAB 2ZHQH 2WPDD 1RTFB 1S81A 3TPIZ 2CMYA 6GCHF 1CVWH 3MH4A 2EC9H 1NFXA 1W8BH 1SGFA 5DGJA 1M9UA 1CA8B 2Z9IA 3TK6A 4LOYH 1MH0A 1CT0E 1GBMA 3BSQA 3T29A 3SHAH 1HAGE 1O5FH 1C5MD 4TY6A 4X8TH 1N6YA 2IPQX 1HAPH 2BHGA 1W12U 4MQAA 1O2WA 2GVFA 1K1MA 4K5ZA 2VWOA 3IITA 3RXGA 1K1PA 4AYVB 4WMDA 3FN8A 2ZO3H 2AIPA 1A2CH 1AD8H 2G4UA 2WPKS 3RUOA 4Q63A 3LJJA 1V2WT 1GMDG 1P2NA 1C2DA 2FEQH 2HNTF 2XC4A 1KLIH 4SGBE 4K1EA 1NRQH 4AGJA 3VXEH 1CE5A 4TWWA 4ISNA 3GY4A 6CHAC 4NA7A 1TGBA 1P12E 1W7GH 1D6RA 5LPEA 4HGCA 2BQWB 2QXJA 1A5GH 1B0EA 1OWEA 1K2I1 1EUFA 2XBYA 2TGTA 2J98B 4CHAB 4RSPA 4X6MA 1CA0C 1A0HB 1VJAU 1C1NA 4UONA 2BZ6H 1LDTT 1P09A 3BG4C 2BLOA 2ZDKA 4MPVA 3PROA 4ZHAA 4A1VA 3NUMA 1FXYA 5C0TA 1W0YH 1CHOG 1MBQA 1QBVH 1RRKA 4MPWA 1DUEA 1C5SA 1S85A 1XKAC 2BY9X 3BTQE 2QXIA 1FV9A 1S6LA 4IN1A 2ZCLP 3W94A 1ACBE 3A7WA 1YCPH 3GDVA 1P0SH 1DY8A 4J1YA 2ZDMA 4BAKB 3N7EA 3ZYEA 4AFUA 1Y5BT 2EI8A 4AOQA 3Q00A 1H8ED 1UVPA 2V3HH 2TBSA 1P2QA 1SKYE 1ZGIA 2BY8X 3F68H 1SHYA 2WV4A 2FOBA 1BA8B 1C5UA 2FESH 4NSYA 2OC7A 5A09A 1C5YB 1XMNB 5FBEA 1ZSJA 3U69H 3O8BA 1QNJA 1ANBA 5I46H 5DG6A 2O8WA 6CHAB 3FVFB 2QY0B 2OCVB 3I29A 3ZZ9A 2TGAA 1TOMH 2ZIQH 1C5OH 4K60A 2FP7B 2GT8A 2V0BA 3E0NB 3NZIA 7KMEH 1C9PA 2CJIA 2D1JA 1GBHA 3KNXA 3STJA 3T5FH 4Z1MD 2F9UA 2PKAB 1HAYB 2RDLA 1C2FA 2AGIX 1UTKA 2VGCB 1H8HD 4CRAA 2HWLB 2STAE 1EZXC 2PTCE 3NK8A 3LGYA 4WH8A 3F1SB 4M9FA 4GSOA 3VPKA 1SL3A 4Y8ZA 4I33A 1UO6A 4UEHH 4B2CA 5DSFA 4B71A 4LXBH 2NU2E 1GBFA 1TX7A 1ETRH 3SU2A 5EXNA 1K9OE 2ANMH 1YF4A 5HIYA 3RMOH 1S0QA 1ELCA 3GYMA 4JYVH 1O3JA 2BLWA 3A7YA 3FP7E 1L2EA 2G55A 1EPTA 1FUJA 1HDTH 4GUXA 4IMQA 2VH6A 1C1TA 2Q6FA 1O3FA 1V2OT 1YPGH 4HI3A 1DFPA 2CK3D 1F0UA 3KIDU 4X2VA 2LP6A 3SUDA 3SI4H 3BTKE 5C20A 2A5KA 1BRUP 1GI9B 3BTFE 1V2PT 1AGJA 4TYDA 8KME2 1YY3A 3DCLA 1O31A 3F9HA 2STBE 1P3EA 1CT2E 4X1QU 3EA9A 2IPHA 5LGOA 1C1OA 1GBDA 1UCYH 2W3KA 5EPYA 3DSGA 5AFZH 1LPKB 2BD9A 3GDSA 3GCTG 3OFND 4SGAE 1LHGH 1TQ7B 4AX9H 5I25A 4ISHH 2AHME 2O8TA 2GGVB 2R0LA 1YPMH 2P93A 5DN6D 1QB6A 7GCHG 4WXVA 1LVBA 2PKSC 4LZ1H 1IQMA 1YCPK 2R9PA 3ODDA 2SGDE 2A4OA 2UWLA 2G5NA 1NY22 1D3TB 2VWLA 2BD8A 4UFFH 1PYTC 2C90B 1MZAA 1TPSA 1PPFE 1WU1A 1C1QA 1DWCH 3GY3A 3ATLA 1Y5UT 1GHAG 2RA0A 1ZTKA 3BTDE 2XXLA 4AGKA 2ZHFH 1T31A 2FTLE 2FDAA 1A61H 2THFB 4BOHA 1PQAA 1HJ8A 3ATWA 4K1SA 1MQ6A 1UTLM 4D9RA 1JWTA 2JH6D 2ZDVH 5A8YA 4X1SU 1WUNH 1Y3UA 1YPLH 2OXSA 2OQUA 2A5AA 3MNCA 3BIVH 2WINI 1O2PA 2P3UB 4IS5A 1LVOA 3S9AA 3F9GA 5FCRA 2FS9A 1NFWA 4NZQA 3S9BA 2GTBA 3OEED 4UD9H 8GCHG 4E06H 2PUQH 1ZZZA 3KGPA 1C2IA 2XNIA 4ABDA 4DCDA 3F9FA 2WPHS 3DD2H 2ZDLA 4KKDA 2PWXA 1MTSA 2QF5A 3RXMA 1BUIA 4CHAC 2RFKC 3QGJA 3ZZ5A 1BIOA 1W11U 3BV9B 1P04A 2BD5A 2ZPQA 1KYNA 4NA9H 3P92A 5ETXA 1MAYA 3UIRA 1J14A 1BJUA 1O36A 1SFIA 1EJNA 1GBCA 1D3QB 2ZPRA 2NU4E 1NM6A 1QL7A 3M5NA 1ZHMA 4YLQH 1QTFA 1QBNA 3EQ0H 3KN2A 1GG6B 3DHKH 2FIRH 1RIWC 1AI8H 2ZA5A 2O8LA 3MU4A 4NIYA 2BVXH 4AG1A 4YO9A 3QK1A 4ABHA 2J95A 3B23B 1CT4E 1T32A 2QXHA 3UY9A 1TQ0B 4CH2B 3A86A 4AFZA 1AMHA 1V2NT 2R2MB 1QFKH 3GICB 4FVDA 1L1JA 4O9VA 2QYIA 3RXSA 2UWOA 4IC6A 1NS3A 2AMDA 3LGIA 4GHTA 1DS2E 4X8SH 3A80A 2ZFSA 1FNIA 3ODFA 1SLVB 2BX3A 5K7RA 1VCQA 1J17T 4KELA 4MTBA 5L2YH 1FMGA 1LCYA 3KQCA 1C2LA 1G37A 1SI5H 3PRDA 1CHOF 1XUFA 3KQEA 4Y7AA 1O38A 4LZ4B 3PV4A 2XNDD 3Q3KA 8ESTE 1SOZA 2GV7A 1ESAA 3TNTA 1EAIA 3ZVEA 3V0XA 1DE7H 2K0QA 2AGEX 2ZPSA 2HPPH 1ELDE 3OX7U 1RS0A 4Y8XA 3BTHE 4UFDH 3NKKA 3T27A 2GMTB 1UVSH 2SGEE 2FYQA 1G36A 1BTUA 1O34A 1P3CA 1QZ8A 3GY2A 5FPYA 2Z9GA 3KHVA 2GZ8A 2L74A 3A85A 3QWCH 3MWIU 6GCHG 3FANA 1MU6B 4CRDA 1CBWC 1K21H 3LT3A 3U1IB 1OWKA 3QN7A 4DG4A 1Y8TA 4KTCA 5GDSH 3F2FA 1WV7H 1KXAA 1MKWK 5JB9S 1E0FD 1G2MA 2W7UA 1GWAA 4AFSA 1GI3A 1C5PA 3GCHC 1O3LA 1JIMA 1G9IE 3SU3A 3RU4T 4A7IB 4AYYB 1Y3VA 2FO9A 2H9TH 4FU8A 1KTSB 5EJ1A 3SV6A 3PO1C 4P02A 3OTPA 2XBVA 1PQ5A 5FPTA 2KM0A 1MKXK 2AFQB 5F53A 4FXGH 1W7XH 1TX6A 7ESTE 2OC1A 1GHZA 1U6QA 2P59A 2ZFQH 2ZQ1A 3FAOA 1D4PB 5ESBA 3SORA 1AB9B 4YTAA 5AVDA 1Y3XA 3WY8A 4ISIH 3RXRA 2Y80A 2A45B 1AFQC 1D3PB 1Z71A 3KYFA 4B75A 3RM0H 4BAMB 1B0FA 1E38B 1O2QA 1EJMA 3RDZA 5T1VA 5E0GA 1AZZA 3O8DA 1JRTA 1TGTA 1Z8JB 1TA6A 2GCHF 1BB0B 1NTPA 4WMFA 2ZGXH 1V3XA 3SU6A 1G32B 2ZU4A 3E91A 2A4QA 3JZ1B 1V2RT 1N8OC 3EAJA 2C4FH 1CU1A 1PPEE 3F2HA 1AHTH 3VB7A 2HLDD 5DJ7A 1WTHD 2J97A 1LHDH 1O5AB 1AVXA 2EEKA 3PO1B 5ESTE 1YM0A 1TIOA 1JBUH 1O3AA 1OWHA 3K9XB 1WSSH 5LH8A 3SJIA 3LIWA 5FL7D 1K1OA 5DP8A 5ABWA 4X1PU 3SJ9A 3HK3B 3MHWU 1NBMD 1GVLA 1TNJA 2ZGJA 3MO3A 3UREA 3ZZBA 3GY5A 2ZG0H 1OYTH 4X6OA 4CR9A 2FTMA 1EQ9A 3RXVA 3LPRA 1HB0B 2CHAB 1YLCA 1FY3A 1EOLA 3SN8A 1WAYB 2Y5GA 3PRBA 4I8GA 4DGJA 5FX5A 1C2MA 1TNIA 3F6UH 4X8VH 3U8RH 3OEHD 3AW1A 5AHGH 3MFJA 1FQ3A 3SQHE 1UCYE 1MZDA 3PMAB 3BTEE 1TRNA 1K1LA 3PM3A 1WOFA 4DT4A 4O3TA 3O8RA 2ASUB 3C27B 1BBRE 1NN6A 1UVTH 1Y3WA 4FUFA 2A32A 3A89A 1SVPA 1V2JT 2BXTH 4ZCNA 2F43B 4ABEA 4D7GA 1BTYA 1O35A 4CRBA 5HYOA 2WYGA 3KF2A 1IQJA 3TITA 3V13A 5F03A 1VJ9U 2J9NA 3GISB 4YESB 1BHXF 1YC0A 2FI5E 3TNSA 4ZMAH 1A46H 1KXDA 4Y76A 4Y8YA 3ATMA 2VBCA 1ZOMA 3FZDA 3T62A 1HXFH 1OXGA 2VWMA 3LH1A 4DVAU 1T8LA 3S7KB 1ZPCA 2PGQB 1E1RD 3CS0A 1ZPZA 1C2KA 5EXMA 1ZYOA 2OP9A 2WUCA 5EGMA 1TBQH 3RXJA 5F8XA 1QY6A 1OWIA 4BTUB 2ZCKP 1O3MA 2SGFE 3BTWE 1QRWA 5HMAA 2GV6A 3RXBA 2JETC 1SGFG 3QGNB 1SQTA 1MUEB 1AWFH 3SU5A 4AB8A 8LPRA 3A88A 4RT1A 3VB6A 1AN1E 2C8ZB 4NFFA 1GJ6A 1MTNC 2CN0H 2GKVE 1EZQA 1FLEE 1C1UH 4RT0A 2QCYA 4YT6H 1XUIA 3BG8A 3P8FA 2P8OB 3SGQE 1TRYA 2HRVA 1OOKB 1HLTH 1EAUA 1H9HE 3SV2H 1YKTA 3LGUA 4VGCB 3RMNH 1BTWA 1DWDH 4YLUA 4Q2KA 2B8OH 1SLUB 2EQNA 1JIRA 3ZV8A 2BD7A 2VNTA 1GDUA 2ZU1A 3A8CA 3VFEA 1OP8A 2XRCA 2FOAA 2NU0E 3E6PH 2Z9JA 5JDUB 1UTOA 1F7ZA 5GNDA 1BITA 4Q7YA 3TVJB 4OS4A 4ABGA 2VU8E 3BEIB 3A83A 1PPGE 4LK4A 1H4WA 1LKBA 2HNTE 5EW1H 3MQKC 1O3EA 3VB4A 1C2GA 3SW2B 2PLXA 1INCA 1LQEA 4FUEA 2TGDA 3M3VA 3ZVGA 5L2ZH 2GZ7A 1BTXA 1GBBA 2F9NA 1LHFH 1SHHB 3FKSD 3KEEA 3I78A 2R3YA 1DPOA 4FUBA 4ZHLU 4XOJA 2OTVA 1C1VH 2A7CA 3RM2H 2ANKH 3GCNA 1AU8A 2VIWA 4IN2A 2R3UA 3BTGE 1GCTC 2EY4C 1HCGA 2XC0A 1UW7A 3TJUA 1QBOA 2P16A 5C67A 4AN7A 4YXWD 7LPRA 5C2ZA 3W1EA 1EP5A 1HV7A 3N99A 5GCHF 1C4Y2 1GVZA 1T7CA 3RC5A 1KTTB 1EATA 2RG3A 2YNAA 4Q7XA 4FUHA 4Y11E 3EGKH 1C5XB 3RU4E 1NRRH 2Z3CA 4IW4E 2UUKB 3BG4B 2BOHB 1N6XA 3ZIAD 5FXLA 2Q1JA 1FN6A 3MU8A 1RXPA 1GHBG 1SLWB 1WQVH 1F5RA 1G3CA 2VJ1A 2CXVA 2PKSB 5JBAS 1KIGH 2J34A 1CO7E 1UVUH 3FO8D 1XUKA 4O3UA 2A1DB 1ESBA 1FY8E 3SUEA 4B73A 1LPGB 2PKAA 2BYAX 4Q4LA 4NWKA 1GJBB 5A0BA 3TLOA 4F55A 1H9LB 4OGYA 1MMJN 3SNEA 1P8VC 1C2HA 1WCZA 2YMSC 1Q31A 4ZXYH 2WHXA 2FLRH 1GBKA
chains in the Genus database with same CATH topology
1ZJDA 1WTGH 2VGCC 3SNCA 3S0NA 1VCWA 2ZU3A 5LPFA 3LGWA 2W5EA 1GHYH 2A31A 1S83A 2G8TA 4MVNA 1DDJA 3HKJB 3LH3A 6LPRA 1GMHG 2J94A 3N7OA 1QB9A 3B8JA 2XWAA 2XBXA 3E0PB 3RXKA 2C3SA 4D76A 2PUXB 1GI2A 3SU4A 1QR3E 3QZRA 2PHBA 2SGPE 2F9OA 1THRH 1TYNA 1O3GA 4R8TB 4H6SB 4BXWA 5SGAE 3A81A 4VGCC 4HFPB 4XSKU 4R0IA 4HZHA 1T4UH 1KDQA 2BDAA 1DSUA 4B2BA 3SU1A 2WV5A 3URCA 4K1TA 4H42U 1ZGVA 1HAXB 1TABE 5DPAA 2VVUA 2ZDAH 2ZU5A 2CHAC 2BDGA 4MG3A 1KSNA 4ABJA 2BY6X 4K2YA 4Y7BA 3U98H 3RXHA 1GJAB 2FMJA 3CP7A 4KGAA 1HAVB 2RCEA 3UTUH 2FX6A 1NFUA 4K8BA 4ZUHA 2ANWA 3AAVA 1ELBA 4F49A 3NPSA 1HBTH 2FZZA 1AE8H 2ZQ2A 4WH6A 1K22H 1S84A 1BTPA 5E8EH 4U30A 1EZSC 2AS9A 2FOCA 3SQEE 1ZSKA 1EPTC 2VB0A 1HAOH 1FAXA 5L6NH 1Z6EA 3QO6A 1AZ8A 3EDXB 3KL6A 1EB2A 2VVCA 1P11E 1GI1A 1ORFA 5T6GA 2Z6BD 5DKMA 1NRNH 4MNXA 3M5OA 1QURH 4GHQA 4X1NU 1ARBA 5DP5A 2QIQA 3BEUA 2G52A 3H5CB 4Y79A 1SBWA 4ZKSU 3A8DA 4NGAH 3RXDA 2VIQA 2ESTE 2R0KA 1QHRB 2ODPA 2OLGA 1FIZA 1X7AC 1A0JA 2Y5HA 4XBDA 1C5VA 1CGJE 3QDZB 4NA8A 3UPEA 1ABJH 5AF9H 3U1JB 2FX4A 1V2LT 4GVUA 1DXWA 1Z8RA 2Z94A 4A5TS 3SZNA 2CF8H 1MTNB 1BZXE 5DO4H 1W2KH 4GPGA 2KAIA 1H8DH 1QJ1B 1A3BH 1Z8IB 5EOKA 1O2OA 4K8YA 1P57B 1TNHA 1F0RA 2DE8A 1G3EA 4OS5A 4Y10E 3UWJH 1ZRBA 1XXFA 3NCLA 1NC6A 1FONA 3KQDA 4INHA 4Q7ZA 1GJ8B 4ZKOU 1V2TT 2QGRA 4UE7H 3UWIA 3TU7H 4CRGA 1HJ9A 3SI3H 2ILNA 1ELAA 3E90B 3SOSA 1E34B 1EX3A 1VITH 4CBOA 1EAWA 3TJOA 4MPXA 1QCPA 2D8WA 4I8LA 3A84A 1L1NA 3V12A 1TMBH 1SB1H 4I8HA 1GG6C 5HXFA 3D49H 3AASA 2BD3A 3T2NA 2ODQA 1AO5A 4JCNA 1CBWB 5C5OA 2ZTZA 5T6DA 1TX8A 2ZGBH 2PGBB 4NG9H 1LTOA 1QA0A 4TY7A 4ZHMU 3G01A 1QJ7B 4DIIH 1G3BA 2ZU2A 5EXLA 4NIWA 1F5KU 1S5SA 1RGQA 2A5IA 4BAOB 1KXCA 1BMNH 4NSVA 3E16B 3RXEA 3SGAE 1O3HA 1O2IA 1C1MA 2JH5D 1D6WA 1EP6A 3TGKE 1ZTJA 1K28D 1OSSA 1OWJA 3P95A 3MO6A 2UUFB 1K1NA 2BDBA 3JZ2B 1FIWA 1HXEH 4K69A 1PPHE 9ESTA 4E7NA 1O2JA 1ZRKA 1GDQA 2GCTB 1C4U2 3ZVFA 1SC8U 1H1BA 2VIVA 5A0CA 1AQ7A 1ZMJA 3LONA 1YP9A 1VGCB 5CHAC 1P02A 1V6DA 3R0FA 3RMLH 1THPB 4UFGH 1ETTH 1IQGA 1C1WH 1ZHPA 1TALA 1MCTA 1T4VH 1DVAH 1QGFA 2AYWA 3PWCA 3AVZA 1O2MA 2ZHWH 3GCOA 1DX5M 1ANEA 3T28A 1GI0A 3A7ZA 1LQDB 3L33A 4BAHB 4WY3A 1G3DA 4X6NA 2VIOA 2XW9A 3RXCA 3V7TA 4DOQA 2HPQH 3W95A 1OP2A 1TBRH 2BDCA 5GPIB 1TOCB 1Z6JH 3CS7A 1OP0A 1D3DB 1YBWA 3E8LA 2ZFFH 1BRCE 3ZZCA 1Z7KA 3ZZ3A 3GOVB 3TK5A 2ZEBA 2Y6TA 3SHCH 3V3MA 4YOIA 1EKBB 2ZZUH 1C5LH 1W13U 3SJKA 4A1XA 1GVKB 5GIBA 4TPIZ 1DXPA 3A7TA 3VEQB 4IC5A 3GYLB 2AH4X 3Q3YA 1BOQA 1G2LA 5GXPA 1ELFA 1K1IA 1IQLA 1TA2A 1KXFA 2FYRA 2YNBA 4THNH 4FU7A 1V2KT 1PYTD 3HK6B 3PLPA 3EYDA 1ELVA 5FAHA 1H8IH 2PSXA 3SU0A 3PYHA 4NIXA 1YPEH 3UOUA 3MH5A 3UNRA 3K6YA 1GGDB 4Z6AH 3ZZAA 2Y82A 1C5QA 3SV9A 3A8AA 1C5NH 3ZVDA 2K1QA 1V2QT 1HYLA 1C1PA 4ZAEA 4XBBA 4X2YA 1NPMA 3NWUA 2A4GA 1GCTB 1F5LA 1A5IA 3RU4D 4D8NA 1YPHC 4XFQA 3TGJE 2BY5X 4NWLA 1DSTA 1BRBE 1UHBA 4JZFH 4TWYA 1ELTA 4E05H 1SG8B 5FPSA 4XDEA 1CGIE 5FHTA 2ZFPH 1O3BA 2TIOA 1C2JA 3T25A 1AWHB 2GDDA 2O9QA 2ZC9H 1O2ZA 1MD8A 1BTZA 1LMWB 1O2HA 3RP2A 2ZTYA 4FVBA 1IQIA 2XC5A 1RIWB 2PSYA 2FI3E 1KLJH 1BMMH 1CQQA 3MNSA 2XTTB 2QN5T 5JPMH 1J8AA 3M36A 1PPBH 5JYIA 3QLPH 3T26A 1GMHF 1AVWA 3M7TA 3ZYDA 2FPZA 1GI6A 5A8XA 1GHBF 1DANH 1O3NA 2I6QA 1GL0E 3RXAA 2TGPZ 2BVSH 2D26C 2GCHG 1F2SE 3M61U 1KXBA 2ULLA 5H4IB 1LPZB 2AMPA 3LC5A 3MOCA 3SUFA 1AKSB 3SV7A 1ZHRA 1GCDA 1DWEH 1GHAF 2FI4E 4MPUA 4B2AA 1SQOA 4GAWA 2H1UA 2ZGCA 3GCTF 3STIA 2A2QH 3LJOA 1Q3XA 2AGGX 1SSXA 2A7HA 1V2ST 4ZH8A 3BIUH 4IGDA 4X8UH 5HM2A 2C8WB 3TGIE 4E7RG 3P6ZB 2Z3EA 4CR5A 2D2DA 2BB4A 1WYKA 2H9EH 2FM2A 4BAQB 2UWPA 1DLEA 3RXFA 1TB6H 2YOLA 2C93B 1O2GH 1C1SA 1C5TA 2W7SA 4D9QA 4DY7B 4TPYA 3A82A 1P9UA 2AERH 1XKBC 2OC8A 1B5GH 1KDQB 2BD4A 1Y3YA 4WJG2 3MNXA 3U8OH 1OYQA 4BTTB 1L4DA 2ODYB 3RXUA 1MAXA 1O2KA 2F3CE 4A1TA 4CH8B 4I31A 5EU8A 3K65B 3LKWA 1FZZA 3UNSA 4CRCA 2BM2A 1SGEE 1SGDE 3Q3XA 2QA9E 1ETSH 1ELGA 4ISOA 1CHGA 2ANYA 3A8BA 2BXUH 2BX4A 1UK2A 3M7QA 2ZF0H 4B76A 1P2KA 3M5MA 2ZTXA 1NU7B 2XYAA 2VWNA 1TAWA 2JETB 2WUBA 3TJNA 1G30B 4YM9A 2A7JA 3S7HB 1QL9A 4A92A 1NROH 4OS7A 3M5LA 2HVXA 4OS6A 1O3IA 1UMAH 2ZWLH 1SGRE 1MD7A 2H9HA 4X2XA 1ID5H 1UTPA 4J2YB 5EQSA 7GCHF 4I7YH 1UVOA 4WF8A 1GBAA 3DA9B 1C5RA 3MMGA 4KTSA 4NIVA 4X1RU 1UTQA 1TBZH 3AAUA 3UUZA 2G00A 4UDWH 1DWBH 2A2XH 3OY6U 3GY8A 1L4ZA 1HIAA 1SPJA 3ATKA 4FUCA 5BPEA 1JMOH 2BZAA 3K2UA 5E0HA 2HALA 2ALPA 1O3DA 4X2WA 3VXFH 3A7VA 5DP9A 3HKIB 3NXPA 4IMZA 2ZHEH 2OQ5A 1GJDB 1O2TA 1AB9C 2SGQE 2QC2A 3SNDA 3U9AH 1RD3B 1K1JA 1BMLA 1AFEH 4YOJA 5JBTA 3FP6E 4MNVA 4CRFA 5C1XA 3H7TA 2BLVA 1O2UA 1QL8A 3PLKA 1A7SA 4ABAA 2FXRA 4OGXA 5F8TA 3HGPA 1GI4A 2B7DH 4MNWA 2H2ZA 2ALVA 5EPNA 1UJ1A 1GL1A 2JH0D 5J4QA 2UUJB 1EASA 3RXOA 3PTNA 1MBMA 4I8KA 4Z0KA 1LHCH 1TFXA 2ZP0H 3DFLA 2PW8H 3SGBE 1OPHB 4K3JA 1ZR0A 1CGHA 1YGCH 4U01A 1DY9A 3SBKA 3H7OA 8GCHF 3RXTA 1OWDA 1V2MT 4KP0A 1TPOA 2EI7A 2EI6A 2OBQA 4BNRA 1J16A 1J15A 2VINA 4JYTA 1C1RA 1O5CB 1P2IA 2LPRA 1RFNA 1ZPBA 5IDKA 2J2UA 3L3TA 1LKAA 3L6PA 1A0LA 3P8NA 1IHTH 4MDSA 1AUTC 3Q77A 3KCGH 2C8XB 1TLDA 1EXFA 4OS2A 1KLTA 3Q76A 1AY6H 1QB1A 1F0SA 1NZQH 1P2OA 2H5CA 1MTWA 2BTCE 5JBCS 2BVRH 1QQUA 2B5TB 3ZVAA 2ZI2H 4RKOB 1DITH 1TGCA 2WPJS 5HM9A 3K6ZA 4O03A 3BF6H 1GJ7B 1L1GA 1BBRH 1QIXB 1GJ5H 1FY4A 2G4TA 2Y81A 2FOGA 2WYJA 3MI4A 3SNAA 1GHXH 1DOJA 1YPHE 5A0AE 2AIQA 1NT1A 3ITIA 1BJVA 2Y5FA 1QA7A 2I6SA 1E37B 1DT2A 1O2SA 1B7XB 3E1XB 1MU8B 3MH6A 1CSOE 3HATH 3BEFB 2A0QB 2HLCA 3ZZDA 1T8MA 5DP6A 3QTVH 1BDAA 2AEIH 1HFDA 5LPRA 3MYWA 2FS8A 1YYY1 1BT7A 1V2VT 4ZXXH 2C8YB 5CE1A 1GBJA 4JK5A 1O2LA 3LOXA 3A7XA 3C1KA 1UTMA 1SGQE 5BRRE 2ZHDA 3M35A 4GLYA 3D62A 1DUAA 1AE5A 2FWWA 1GBIA 3I77A 3MU1A 2W3IA 4F4OC 3IWMA 1PQ7A 4WVPE 5DP4A 3M3SA 1NRSH 3QUMP 2SNVA 1LHEH 2P3TB 1GDNA 3ELAH 3UQVA 2OINA 3LGTA 1GJ4H 1JOUB 4FUDA 4JZIA 3PB1E 2ZDNA 4AFQA 2WPLS 1XXDA 5G4BA 3EA8A 1D9IA 3RLYH 4DW2U 1ABIH 1O39A 1TNLA 5HGGA 1O5GH 5DP7A 1IQHA 1O2YA 4DIHH 1FY1A 1RTKA 4JYUH 1KXEA 1YPKH 3TH3H 5JB8S 2CV3A 5TCAA 1AFQB 1N1LA 5K0HA 1SFQB 2ZCHP 2NU1E 1C9TA 1SGCA 1O0DH 1F0TA 2NU3E 1WQSA 1FPHH 4INLA 2BQ7B 2LNCA 1C5WB 2XCNA 4NFEA 1ELEE 2A4RA 3B9FH 1TGNA 3ZZ4A 2ZKSA 1ZSLA 2AMQA 1ZLRA 1YLDA 3S9CA 1GBTA 1IAUA 5T6FA 1C2EA 2JKHA 1TNGA 4B1TA 2Y7ZA 2CF9H 1RJXB 1ZJKA 4JZEH 3UQOA 1P2JA 2VIDA 1Z8GA 5E2OA 3TH4H 1O3OA 2BMGB 1UTJA 1YCPM 4KTUA 1SGNE 1GMCG 1GPZA 5JBBS 2F91A 5DK1A 1GI8B 1A4WH 2ZNKH 5A2MH 2TPIZ 1EOJA 2VIPA 4O97A 2J38A 3PMHB 5IYTA 1O5DH 4WXIA 4JZ1A 4DT7B 1HJAC 2OUAA 4MLFB 2BDYA 3DT0H 3UFAA 3RC4A 1N8OB 3URDA 1Q2WA 2XBWA 3RXLA 2VH0A 1XVOA 5GJ4B 3MU0A 1VZQH 3QX5H 1JRSA 4UFEH 3RXIA 1SGPE 3RLWH 1IQFA 4I32A 1IHSH 3QTOH 4FU9A 4ESTE 1Y59T 2M5TA 5T3HA 3TK9A 2V6NA 1A3EH 1IQKA 2GD4B 3LDXH 5EQQA 1BRAA 1O2RA 3RC6A 1O2XA 1GMDF 4CREA 5F6MA 1IQNA 2B0FA 3MH7A 1LVYA 2PR3A 5PTPA 5A8ZA 1HAHH 5CMXH 1TNKA 2P95A 1Z1JA 1O3KA 1YPJH 5FBIA 5EW2H 2Y7XA 1O5BB 3EE0B 3D65E 3TJVA 1SQAA 1HGTH 2BDIA 2Z7FE 4MNYA 5L30H 1SGTA 1ZMNA 1VGCC 1L0ZA 1XVMA 1ARCA 2Z9KA 1LVMA 4BTIB 3VB3A 3OYPA 1O3PB 3FFGA 1PQ8A 2PV9B 2QAAA 1O2VA 1GJCB 4FUIA 3BN9A 1W10U 3SJ8A 3VB5A 2BQ6B 3ESTA 2ZFRH 2DE9A 2FOHA 2J92A 2F9VA 2H5DA 1UCYK 2P3FH 5C1YA 5C3NA 1OKXA 2ZGHA 1BCUH 1O5EH 2DUCA 3BTME 3PLBA 1UHBB 3OY5U 5FX6A 4GCHG 2FOMB 3GY6A 3LC3A 2CGAA 1P03A 1QRZA 4A6LA 1E35B 2P8OC 2PFEA 4ASHA 1AVGH 1SLXB 1J9CH 2QF3A 3SO3A 1O30A 1IOEA 1SOTA 2QF0A 3UNQA 4XBCA 1ZMLA 2Z9LA 4JK6A 1W0ZU 2BLQA 1FI8A 4ZKRU 2BDHA 5TCCA 1GGDC 4AB9A 3OU0A 4X6PA 3GY7A 4JZDH 4Y0YE 1T8OA 4B74A 3SV8A 2FLBH 1SR5C 3GDUA 4ABFA 5C1UA 1GI7B 3VGCB 3MU5A 1GHWH 2F9BH 2GP9B 1TRMA 4AZ2B 4Q80A 1E36B 1EZUC 1FAKH 2FODA 4YT7H 3M3TA 2HOBA 5EG4A 4GCHF 4Y71A 1SGYE 1GBEA 4INKA 1VR1H 1PPZA 1DM4B 3TH2H 1XM1A 5J4SA 1ANDA 1WBGB 3P8OA 4PROA 2ZECA 1MTUA 1TWXB 3ENSB 4Y0ZE 2GMTC 1P06A 5GWZA 1BHXB 2B9LA 2XWBI 1RTLA 2GCTC 1GJ9B 3MNBA 1V2UT 2O8UA 2NWNA 1HAVA 1Y5AT 2WPIS 3SNBA 3A87A 4DURA 1T8NA 3FZZA 1O37A 4IBLH 1NESE 2G81E 1S0RA 3O8CA 4YOGA 1NU9A 3RMMH 4BANB 1OX1A 5F8ZA 3ZVBA 3HPTB 4JMYA 1P2MA 2F83A 3SJOA 1XUGA 2F9PA 1ANCA 2Q6DA