1C5UA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5uA02
1M9UA 3ZZ3A 2F91A 4Q7XA 2HRVA 4UEHH 4ZKSU 5LPRA 1O2KA 3VXEH 5GJ4B 1THSH 2BD3A 1YLCA 5EQSA 3SU0A 5JBAS 5L30H 2UWOA 1HAHH 1UVSH 1WV7H 1MKXH 1W14U 3B8JA 1MMJN 2ALVA 4DVAU 2BVRH 3UNRA 4FUHA 4ISOA 1GMDF 1O2ZA 4XOJA 2PKSB 1AZZA 1BRAA 1C1OA 2FOAA 3T28A 3QO6A 4BAKB 2ZQ2A 1SQAA 2G4TA 4GPGA 3ZVEA 5DO4H 1GI0A 2GTBA 3GY2A 2GCHF 1RTLA 3NKKA 5PTPA 1BJUA 3PMAB 4WMEA 1SGFG 1CA0C 1T31A 3QK1A 3ELAH 1IQJA 2Y5HA 1C5OH 3RU4D 4KKDA 4I8GA 1C5QA 4B76A 3CS0A 1ANBA 2OBOA 4MNWA 1A7SA 2FOCA 4U32A 1AU8A 1AVXA 1C5VA 1K2I1 3HK3B 3BSQA 4TYDA 3DFJA 4MNXA 2BVXH 2RG3A 3PTBA 1GBAA 1BHXB 1B7XB 1ELDE 1OP2A 5DP3A 3SGBE 1AY6H 3TH3H 3GCHC 2ZDLA 1DSTA 3Q77A 2FX4A 5GPIB 1BRBE 2AH4X 4I31A 5EGMA 1DY9A 1RJXB 3FVFB 1GG6B 3L33A 1Z6JH 3TIUA 3ZYDA 1ELCA 1F0UA 1ETTH 3SO3A 3ZVAA 1D4PB 2OQ5A 1IQIA 3PWCA 1GVKB 1IAUA 3QGJA 3SV2H 2THFB 1GL1A 3PYHA 5DGJA 4YT6H 2STAE 3M5MA 1ZMJA 2DUCA 2A7JA 2HOBA 1GJ5H 2C8WB 2P59A 4BTUB 1P2JA 3BEIB 1KSNA 1KXEA 4AYYB 1O3MA 3ZVFA 5ESTE 4OS6A 1DY8A 2VIWA 2Q6GA 4NWKA 4O03A 1Y59T 1QL9A 1O2PA 1W8BH 1VZQH 4KELA 1O3PB 3GY4A 3RC5A 4ZXXH 2B9LA 2XXLA 2ZG0H 3TJNA 4D7GA 2GZ7A 1INCA 2O9QA 2HWLB 1LHDH 1QB6A 1AWHB 1QJ6B 4NIXA 1FY8E 1Q2WA 1V2LT 1ZTJA 3FP6E 1A3EH 2I6SA 1J15A 1ZTLA 2ANWA 1GJ8B 1SR5C 1G3DA 3MU0A 2B5TB 1GJCB 2STBE 1IQEA 4TWYA 5AHGH 2H5CA 2ASUB 2TGPZ 4YESB 3T5FH 3FP7E 1TQ0B 1UCYE 2VGCB 2A4GA 1F0SA 1Y3VA 2XC5A 4Y76A 1JRTA 1ELEE 3VB5A 1O5GH 3TJOA 5HM9A 2GMTB 4IBLH 4MQAA 1AGJA 3JZ2B 1GGDC 1EJMA 1ANEA 1D6WA 1THPB 1HGTH 5J4SA 5TCCA 4M7GA 4YOJA 2BTCE 2NWNA 2JH5D 4I32A 5K7RA 4D9RA 2R3UA 1XKBC 1O3EA 2JKHA 1GCTB 3FZZA 4DOQA 1CE5A 2SNWA 7KMEH 4YLQH 1O2JA 2GDEH 2G81E 4X8TH 4IC5A 1SHYA 1HIAB 1T7CA 4A7IB 1C1UH 3OX7U 1HBTH 1Z7KA 2F3CE 3LGIA 2GP9B 3AASA 3M3VA 4NSVA 4B2CA 2C90B 1LDTT 4J2YB 1ZZZA 2BY6X 4BTIB 2Z9IA 1GI7B 1UTJA 3SOSA 2J4IA 4XBBA 5C20A 2G55A 1DLEA 1EQ9A 1P2OA 5ABWA 1S6HA 5AF9H 1VCQA 2CGAA 4YOIA 3SNEA 1LO6A 4GUXA 4I33A 5LGOA 2BDIA 4Q7ZA 1D3TB 2QAAA 4CRCA 1H4WA 5DK1A 4GCHG 1CA8B 2D26C 2BDHA 1ZPBA 1UJ1A 3M37A 4OS1A 4UFFH 1ZSLA 4ZROA 3E0NB 4H42U 1CT2E 1WCZA 1XUIA 3ZZ9A 1A4WH 2CMYA 2GDDA 1GCDA 3LGTA 1O2HA 1OOKB 3KN2A 1TYNA 2F9PA 4VGCC 3P95A 3RMMH 1ANDA 2A45B 2HPQH 1D3PB 1C2IA 5A8ZA 1P57B 4IMQA 5DJ7A 2Z9JA 4FUEA 4GHQA 2ZGBH 4NWLA 1W3CA 2J34A 3MO9A 4WMDA 2G52A 1VITF 1VGCB 5A0CA 1TA2A 1TE0A 1AE8H 1IQNA 2QF0A 4GVUA 1ELBA 4AFQA 1DWDH 3S9BA 1EXFA 2BY9X 4B1TA 1LKAA 2R9PA 3SU2A 1NTPA 1BBRH 5EPYA 1KDQB 3HKJB 2ZGHA 4TY6A 4I8KA 1TGBA 2P94A 4NA7A 2ZDVH 1W11U 1YP9A 4ZHAA 1TX6A 1WBGB 4FUJA 2PW8H 3HKIB 2FI4E 1W0YH 1FY4A 3RXRA 3VEQB 3OTJE 1GJ9B 1W10U 4TPIZ 6GCHF 3A7VA 2BDYA 2FPZA 1TFXA 2QXIA 3SV6A 1CSOE 1NESE 3TGJE 3SV7A 1WTHD 2ILNA 1AVWA 3SU6A 3ENSB 3I77A 3QTOH 1SSXA 1H9HE 1LVYA 1OP0A 1QQ4A 6CHAB 4K3JA 1BJVA 5EW2H 1WU1A 4MPXA 3BTGE 1F5LA 1Z8GA 5JDUB 2J95A 2RCEA 1JIRA 5HYOA 4ZUHA 2A2QH 4CH2B 4X2WA 3FANA 3ZVDA 4ABBA 2VNTA 4LK4A 2BDCA 2ZHDA 3ZV9A 2R2MB 1FAXA 1O2SA 3S9CA 2ZDKA 2BZAA 3P8OA 3ATIA 2BY7X 2CF9H 1OWDA 1T8OA 4Y8ZA 3M7TA 1OKXA 3QN7A 1VGCC 1GHAF 2PLXA 2Z94A 1BITA 3E0PB 4WJG2 3SGQE 2IPHA 1GBEA 1SFIA 1O2YA 4RSPA 2UWLA 1XM1A 2VINA 1B0EA 4VGCB 3A83A 1DFPA 2V3HH 3A7WA 2PFEA 4X8UH 2J2UA 2B0FA 1LVBA 2ZHEH 3BN9A 8KME2 3RXGA 2P3FH 1E36B 5EXMA 4DIHH 2AFQB 4BAOB 2TBSA 1BCUH 1SI5H 3S7KB 3VB4A 2QC2A 2XBYA 1ZMLA 1HNEE 1C2JA 2PKSC 1DUEA 1T32A 1WYKA 1ZRKA 3HK6B 2GV7A 7GCHG 1GJ7B 4IGDA 1GHWH 2Z7FE 3G01A 2YNAA 1C1QA 3EYDA 2G5VA 3RXDA 1B5GH 1T4VH 1HAOH 3BG4C 4JCNA 4HI3A 2BY8X 1WAYB 2DE9A 2ZGCA 2V0BA 4JZDH 3ZZ5A 5TCAA 4OGXA 5FAHA 1LHFH 4Y7AA 1RIWB 1HJAB 4BNRA 1GHBF 1IHSH 1ZMNA 4Y7BA 1MTSA 3SV9A 1PPGE 1OYQA 2NU4E 1GL0E 5EW1H 3URCA 3QDZB 3RXSA 1MTNB 1FLEE 1GCTC 1W12U 1SLWB 2W5EA 5EXNA 1NM6A 3SUDA 4LZ1H 1IQGA 1YPJH 3LH1A 1ZSJA 2FOFA 3V13A 1KTSB 1C5PA 1P06A 4BANB 4JYVH 1O3JA 3NUMA 2ZHQH 3RUOA 1O3OA 1RTKA 4A92A 1F0TA 1HJ9A 5I46H 1ZR0A 2IN2A 8GCHG 3SNCA 3A8CA 1O3DA 1VCWA 5L6NH 4KTSA 1O3LA 2ZFSA 2WV4A 4Z6AH 1KTTB 4ISHH 4BAMB 3T25A 1FONA 1CBWC 3ITIA 5FPTA 3AAUA 2DE8A 2WPMS 3EQ0H 2OTVA 4K2YA 3HPTB 3E6PH 1O2UA 1UTMA 1XUJA 1KDQA 1P02A 1O3GA 2R0KA 1EAUA 5JPMH 3FP8E 1J14A 3SJOA 2ZGXH 1BB0B 2ZI2H 4OGYA 2FOBA 4WH6A 1Z8IB 2WUBA 2NU2E 2Z9LA 1BQYA 2OCVB 4O3TA 2OXSA 3RLWH 1BTUA 1O3IA 1GVZA 1ELFA 1YYY1 1MQ6A 2BHGA 4F49A 1RS0A 4X2VA 1FY1A 2H5DA 2J9NA 1YCPH 1NC6A 5EXLA 2B7DH 1W13U 1GMHF 1EB1H 2OINA 1V2JT 2FOGA 8GCHF 1TLDA 4MPWA 4WMFA 1EAWA 5E8EH 5A0BA 4JZIA 5BRRE 3NK8A 2C93B 1OPHB 3GISB 1MAYA 2VB0A 1TB6H 1BA8B 1K22H 3ATMA 1O35A 1GI5A 5FXLA 3LGYA 1EASA 5C1YA 3GCTF 3CS7A 1TGSZ 1CVWH 1L0ZA 2ZFTA 1EPTC 3B9FH 5DP7A 3RXEA 3KCGH 1O5EH 3P92A 3LIWA 1Z8RA 1QA0A 2ZQ1A 3SORA 5LPFA 1F5KU 4D8NA 1FZZA 1G37A 1GJ6A 3EGKH 1ZYOA 2FI5E 1XVOA 4FUCA 4B2AA 3U69H 1O31A 1C2FA 3SZNA 2Q6DA 1EPTA 4ZKNU 2FWWA 1GI1A 4AFZA 1WQSA 2LNCA 3RP2A 3ZZBA 1E35B 4KTCA 4ISIH 1C5NH 2ANKH 1UTQA 4MG3A 2SFAA 3M5LA 1Z8JB 3GYMA 1DXWA 3CENA 1J17T 2C8ZB 1S0QA 4R0IA 1H1BA 1E0FD 2O8UA 3E3TA 1J16A 1THRH 1P03A 3S69A 1OP8A 1MKXK 1V2WT 3KGPA 1QR3E 1GHAG 1ARBA 1SPJA 4F4OC 1KLJH 5FX6A 1BIOA 1AKSA 2XBWA 5C5OA 2BOHB 4ABIA 5AFYH 3RXQA 4I8HA 1A1RA 1TGCA 1XXFA 3PM3A 1TX7A 3VB7A 3A85A 2OD3B 3M3SA 3BTFE 1SGRE 1EPTB 3UR9A 3KQEA 3KF2A 1AFQB 4YT7H 2VIOA 1TGTA 3TNTA 4NG9H 3T26A 1SG8B 1NPMA 3L3TA 2BLOA 5G4BA 3KQCA 1HUTH 1TPOA 1EAIA 3MMGA 1IQHA 1XUFA 1IQLA 3P8FA 2FDAA 1FN6A 1W7XH 1QJ7B 1L1GA 3CP7A 1D3QB 3LC5A 4Y79A 1P11E 3UPEA 3U1IB 2XBXA 3GDVA 3PLPA 4WY3A 1F5RA 5C2ZA 2PV9B 1P2KA 3LGWA 1HCGA 3H5CB 2ZTZA 2Y82A 1TBZH 4D7FA 2HNTE 2LPRA 2ZU1A 4SGBE 3GY6A 2JETB 5K0HA 3S9AA 1CGIE 1K1LA 3HGPA 3GCTG 1NU9A 4INKA 3SNBA 1GMDG 5GDSH 2XW9A 1TOCB 1TWXB 1ESAA 1DANH 1UTPA 8LPRA 2Z3DA 1EB2A 1MZAA 4UE7H 1C2LA 2P8OC 1UCYH 2H6MA 5FX5A 1L4DA 2FTLE 5C5NA 2UUKB 4BAHB 2RDLA 4J1YA 4MLFB 1RFNA 2QCYA 3OY6U 2G8TA 2FEQH 5CHAB 4BTTB 1W2KH 4YOGA 4H6SB 2HLCA 1Z1IA 4AFUA 1UTNA 2W3KA 1P8VC 1RGQA 1HXFH 2BD4A 2J94A 1SGPE 3AVZA 1TRMA 1TNGA 1MUEB 1C1VH 2GD4B 1OS8A 3ZVCA 2NU1E 1OX1A 4ZMAH 1FDPA 2Z9KA 1VCPA 5EQQA 1AQ7A 4X6MA 2OLGA 1CU1A 1ZHMA 3O8CA 4I8JA 4K8YA 3O8DA 1EATA 1ARCA 2VIVA 1JBUH 7LPRA 3T27A 1FPHH 3UUZA 2EI6A 4NFEA 4ASHA 4X1SU 1S82A 3RU4T 1YM0A 5HXFA 1LPKB 1OXGA 1H8IH 4ABAA 1UVOA 1GVLA 1EUFA 2ALPA 4NGAH 2EA3A 3UIRA 1UO6A 4A6LA 3HGNA 1CHOG 1V2KT 1P3EA 1A5HA 2O8WA 3E8LA 5AVDA 3RC4A 3RXFA 1AFQC 2F9BH 2F9VA 1K28D 1IQFA 3PMHB 2C3SA 3M36A 1TA6A 4X8VH 2AIPA 1N6XA 5FCRA 1LPZB 4X1RU 4AB9A 2P16A 4FUFA 3ZVBA 4CH8B 3ATLA 2ZU4A 1NU7B 1O3FA 3PO1B 2A32A 3W94A 5A09A 3QX5H 3AAVA 3RDZA 1GPZA 1AKSB 4ESTE 3GCNA 3SUGA 3UNSA 4CR5A 2PTNA 3GY3A 2C4FH 2QXHA 2Z3CA 1ESBA 2WINI 4ZXYH 2VVVA 1EP5A 2SGDE 3U8OH 3VB6A 1SL3A 2FX6A 3VGCC 2VIPA 1HAPH 4YZUA 1EKBB 1T8MA 1MQ5A 2PKAB 1DWCH 1TIOA 3SI3H 3Q00A 1QURH 3EA9A 4X8SH 3H7OA 3OU0A 1DE7H 2J92A 4DIIH 1EZUC 1K1MA 1XVMA 2BYAX 2WYGA 1TRYA 1MTVA 2VVCA 3MH4A 2P3UB 3QLPH 5EODA 1HDTH 4K1EA 1C2MA 1LPGB 1N8OB 2ZKSA 2V3OH 4HZHA 1HXEH 1TMBH 1HPGA 1KIGH 3UY9A 2BMGB 5EOKA 1ELTA 4FU9A 3RXBA 1JWTA 1V2VT 1KY9A 3ATWA 1O5CB 2ZDMA 6ESTA 1GJBB 3LOXA 3BIUH 3LKWA 1GI2A 4Q80A 3MO3A 3RXTA 2JH6D 5C3NA 1A2CH 4DURA 1NROH 1YPLH 1A0HB 1BBRE 3MH6A 4FUIA 5GCHF 1OSSA 1GJDB 1P0SH 1TX8A 2A5AA 5H4IB 4NSYA 4CBOA 2ZCLP 4WWYA 2AMPA 1P9SA 1P04A 3F9FA 1GI3A 1YPHE 1ZPCA 1RTFB 3MNBA 1AFEH 1JXPA 1BMMH 1PQ7A 1DITH 3BV9B 5C67A 2G00A 1WQVH 2Y80A 4AX9H 2H9TH 5E0GA 3NCLA 8ESTE 1C5LH 3RLYH 2PTCE 1D9IA 1IHTH 2F9OA 3MNSA 1CBWB 1CA0B 3MOCA 4TY7A 3K9XB 1TBRH 3R0FA 4Y6DA 3SJ9A 5DKMA 4Y0ZE 1GDNA 4UONA 3ZYEA 1A5IA 4DT7B 1NFXA 2W7SA 1TBQH 3BTHE 1ZRBA 3U8TH 1SBWA 2H1UA 1B0FA 2BXUH 1AE5A 1O2IA 4OS7A 3RXHA 4INHA 1SLXB 1O38A 4AG2A 2BM2A 1NRQH 2HVXA 3P70B 4Y0YE 1TNHA 2A7HA 1FN8A 4U30A 3SHAH 1GDQA 2HALA 3F9EA 2W26A 2PUQH 1HJAC 3NZIA 1YLDA 3UREA 2VWLA 4AGKA 4ABJA 2FESH 2BLWA 4AZ2B 2BX4A 1TNIA 5HMAA 1K1JA 2AS9A 3BTTE 2OC1A 1Y3WA 3K2UA 1O5FH 1MKWH 3T62A 4ABHA 1P2NA 5F03A 3TJVA 5LH8A 2WUCA 2AMDA 3ZZ4A 1U6QA 2ZDNA 3DUXH 1ZSKA 1FMGA 4WVPE 3BTDE 4ABDA 1OWHA 1VJAU 4Y8YA 5DG6A 2FTMA 2GMTC 2C8YB 4B71A 4BOHA 3LONA 3BTWE 5A2MH 1A61H 1VITG 2Y5FA 1TQ7B 1ESTA 1MU6B 2TGDA 2A31A 4HTCH 4D76A 5SGAE 1Y5UT 1SGYE 1ANCA 2ZCKP 2ZHFH 3D65E 2FOMB 4ISLA 1NN6A 4DG4A 3SQEE 2BLQA 3A8AA 5TJXA 3LJOA 5L2YH 1SQOA 2BD9A 1C1PA 3FAOA 1BTYA 1PPCE 1P9UA 1VR1H 3GDUA 1QBNA 1GI9B 1SGNE 3C27B 3M5NA 1O3BA 1A0LA 1MCVA 3A84A 1PJPA 1SOTA 1T8NA 1BOQA 2BX3A 1MU8B 3DHKH 1EZQA 4GAWA 3UOUA 3U1JB 1BTHH 4ZKOU 4IS5A 1YC0A 4K8BA 3T2NA 2M5TA 1ZPZA 3TGKE 1GDUA 2W3IA 5FPSA 6CHAC 3MU1A 5HGGA 1Y3YA 3Q3KA 3TU7H 1WSSH 3V3MA 1KXDA 3SU3A 1DWBH 1KXCA 2CJIA 2ZC9H 1QFKH 3SGAE 2ZFRH 4UFGH 5DPAA 1LTOA 1ABJH 3RXVA 1UVTH 3SJKA 1N8OC 1QRXA 3A7XA 3A81A 1DWEH 3GYLB 3QZQA 3KQDA 5JB9S 3S0NA 2FIRH 4NIWA 2PKAA 1Y5AT 5FHTA 2YNBA 3QWCH 2BD8A 3RXPA 1DPOA 4E06H 4MTBA 1MD7A 1UK4A 1ZHRA 2QGRA 3OY5U 3STIA 1F2SE 1CQQA 1ACBE 2Y5GA 3PV4A 1EZSC 1UMAH 4X0WU 1SC8U 3HATH 1DICA 1BTWA 1UK3A 2IJOB 2HNTC 2ZDAH 3AW0A 2BVSH 4CBNA 3EDXB 1GI6A 2PGQB 1NFUA 4X6OA 4JK5A 2XC4A 1SOZA 2P95A 1QIXB 1SHHB 4ZKRU 1HFDA 5DP5A 2SGEE 1LHCH 1LVOA 3Q3YA 4X2YA 4QT8C 5T6FA 1P09A 3V7TA 1S0RA 3SBKA 2ZNKH 1C5ZB 2FYQA 1ELVA 2ODQA 1EJNA 3KL6A 3A8DA 3BG8A 7GCHF 1EJAA 2CN0H 1ZJDA 1AUTC 2AIQA 1C4U2 4ABGA 5DP6A 1YF4A 2ZZUH 2BDGA 3F9HA 1BHXF 1GHVH 2A2XH 1YCPK 1E34B 3SU4A 4O97A 2A4OA 1AD8H 1BMLA 1DM4B 5T6GA 4XE4A 4K1TA 1QRWA 3SUEA 3A7TA 2ZGJA 4AB8A 3SQHE 1UVUH 1Z6EA 1W0ZU 4OS2A 2GX4A 2ZA5A 4ABFA 1QJ1B 2ZF0H 3MNCA 1NRRH 4X2XA 4Q7YA 1C5XB 4K69A 1FQ3A 4IW4E 1G3BA 4NFFA 3ZV8A 1FV9A 4AORA 1QRZA 2H9EH 1RIWC 3NPSA 2Q1JA 4CRDA 1OWKA 1N6YA 2EI7A 1QL8A 1HLTH 3QUMP 1C5SA 2EEKA 1YKTA 3P17H 4FU8A 1L1JA 3A7ZA 1PPFE 4DCDA 5HM2A 3BG4B 1GMHG 5I25A 1OYTH 3TH4H 1O2RA 4OS4A 4CHAB 1O2VA 1V2QT 3I78A 4NIYA 1XMNB 1QTFA 3SV8A 1HAGE 3K65B 2ZU3A 3SU5A 3MWIU 2ZEBA 2CV3A 1C5TA 2AGIX 3E1XB 4K60A 1C9TA 1XXDA 2FYRA 1K21H 3M5OA 1GBTA 1AIXH 4TPYA 2VGCC 1IQKA 4NA9H 4LXBH 1UHBA 3M3TA 3EE0B 2QYIA 1NZQH 1TGNA 5A0AE 4UD9H 1V6DA 1C2KA 1C9PA 2JETC 1UTLM 4NZLA 2I6QA 2CF8H 3IWMA 1V2RT 1SFQB 2ANMH 3F1SB 4E05H 1UCYK 3BF6H 2OUAA 1DDJA 2Q6FA 3TNSA 1T8LA 3WY8A 2R0LA 1V2UT 1DUAA 3QTVH 2O8MA 3A89A 2QY0B 1Y3UA 3H7TA 3A80A 4MVNA 3EAJA 3F68H 1V2PT 1ORFA 4X6NA 4O9VA 4NZQA 2TGAA 1AMHA 1NRPH 1O2OA 1UK2A 1EOLA 1GBFA 1LHGH 2ZPQA 3UNQA 1P2MA 6LPRA 2D2DA 2NU3E 3UQOA 1QY6A 1YPKH 1YPMH 2WPLS 3P6ZB 1W7GH 4B73A 3AW1A 3EA8A 1HAYB 3BTME 1DXPA 4FUGA 2Z6BD 1O0DH 3KNXA 1NS3A 1MZDA 4X6PA 3RXCA 3E90B 1O37A 1S84A 2ZECA 2AMQA 4XBDA 1HJ8A 3QGNB 3TITA 2VWMA 2SGQE 1HB0B 4AGJA 1P12E 4JZEH 4BXSA 3SJ8A 1QB1A 2QA9E 5C1UA 2PSYA 1KLIH 1C5UA 1TALA 5FBIA 2PR3A 2XCFA 3B23B 1NO9H 5FCKA 3P8NA 2GT8A 3A8BA 2QV1A 4HGCA 3MH5A 3OYPA 1LKBA 2FOEA 1G36A 3BTQE 1YPEH 1HYLA 2Y7ZA 1TMTH 3S7HB 1GBHA 1ZLRA 1C2EA 1VITH 1QCPA 3I29A 1K1PA 1UTOA 2XWAA 3E16B 1BT7A 1C4V2 1O33A 2FOHA 1ZGVA 1EP6A 4K5ZA 3OSYA 3ODDA 1LHEH 3RXJA 1GHZA 1TNJA 4KGAA 4AYVB 3MO6A 2H9HA 3ODFA 1OWIA 3VB3A 2BD2A 1NFYA 5F8ZA 4FUBA 3VFEA 1C5WB 3F6UH 1FY3A 2B8OH 3BTEE 1A5GH 1WTGH 1CO7E 1PQ5A 1XUHA 1F92A 2FI3E 1S83A 4B75A 1F0RA 1K9OE 1HV7A 3MH7A 4JZ1A 1SGIB 3O8RA 1NRSH 3BTKE 2FS9A 4NCYA 5JBTA 2VVUA 5JYIA 2ZP0H 2UWPA 3RMOH 1C1MA 5FPYA 1P2IA 1O5AB 1G2LA 4UFEH 2XRCA 4CHAC 3URDA 4HFPB 3LPRA 1O32A 2BXTH 3PMBB 3RXLA 3ZZDA 1QB9A 2BQWB 2SGPE 1XKAC 2WPHS 4D9QA 4IC6A 4RN6A 4UFDH 4B2BA 3UR6A 1O30A 1HAXB 2R2WU 1AI8H 3RXMA 1BUIA 3ZVGA 2KAIB 2A5IA 2OP9A 2ESTE 1KXFA 1GBDA 5CMXH 2CHAB 3JZ1B 4YO9A 4B74A 3PLKA 2AEIH 2VU8E 1CGHA 1TONA 1Y3XA 2ZFQH 2XTTB 1PPEE 5BPEA 3MU4A 1P05A 4A1TA 4X1QU 4CREA 2VJ1A 1AN1E 2UUYA 4Y71A 4YM9A 4PROA 3E91A 1GBIA 2V35A 1GJAB 5A8YA 2ZCHP 2SNVA 1SQTA 1SGDE 5ETXA 1FY5A 1S5SA 3MYWA 3KIDU 1C5MD 1YBWA 1QBVH 1IQMA 2KAIA 3VPKA 4I7YH 3TK9A 4H4FA 2O8LA 3O8BA 3KHVA 2AERH 2P3TB 5GWZA 1ZJKA 2J38A 1TABE 2F9UA 2P8OB 1SVPA 4AOQA 4LZ4B 3BIVH 1O2MA 1TOMH 4RKOB 1YPGH 3MU8A 1L1NA 1KYNA 4XFQA 1O34A 2QF3A 3LGUA 5F8TA 1GMCG 1NY22 1BTZA 1Z71A 1MD8A 4WH8A 4CRFA 1C2GA 1CGJE 2RA0A 1CT0E 3GOVB 4GSOA 3BEFB 1E37B 3UTUH 5E0JA 5T6DA 4CRGA 1TMUH 1C1TA 1KXBA 2BOKA 4K1SA 1E38B 3A88A 5FBEA 9LPRA 4I8LA 2GCHG 1V2NT 2WV5A 3MHWU 4TWWA 1YGCH 1BRCE 1O2QA 3RM0H 1V3XA 4UDWH 1P2QA 3M7UA 5IDKA 4E7NA 4AG1A 2BDBA 1GHYH 1MCTA 1P3CA 1HIAA 3ZZ7A 1C2DA 1KLTA 3RXAA 1HAZB 7ESTE 2G5NA 1GJ4H 1JMOH 1Z1JA 2BLVA 2F9NA 1AUJA 1YPHC 2NU0E 4FXGH 1PQAA 2RA3A 5E2OA 3U8RH 5JBCS 2BDAA 3A7YA 4JZFH 2BQ7B 1FPCH 1GHBG 4Y11E 3U98H 1FNIA 1C1NA 2FP7B 4MNVA 2BD5A 4GCHF 1O3KA 4O3UA 1C4Y2 3ZZAA 1PYTC 3ESTA 1DVAH 2TRMA 3UOPA 1AO5A 4YTAA 5JB8S 3GCHB 4CRAA 2Y6TA 2FZZA 1GBBA 1QBOA 2FO9A 3SW2B 2G4UA 4WF8A 4CRBA 1JOUB 2FLRH 1Q3XA 4JMYA 1K1IA 3VGCB 2VH0A 5T3HA 3IITA 2HGTH 3RC6A 1DS2E 5EPNA 5DP4A 5EQRA 2PGBB 2PSXA 2A5KA 1TPPA 4FU7A 5L2ZH 4MDSA 3GY8A 1O2TA 4BAQB 3SHCH 3RU4E 2W7UA 1SGEE 1JRSA 3PTNA 2ZU5A 3A86A 1MKWK 2GV6A 2IOTA 2WYJA 1PPHE 2AGGX 3GICB 3NWUA 2A7CA 1NRNH 4A5TS 2ZWLH 1NT1A 2G51A 1TPSA 1PYTD 1GBMA 1XX9A 3KQBA 1D6RA 1SGFA 2BZ6H 1QHRB 5DP8A 1LQDB 4U2WA 5EG4A 1V2MT 1X7AC 5F6MA 1BTXA 1G30B 1XUKA 6GCHG 2CXVA 4INLA 1FI8A 1H9IE 3LDXH 4MPVA 4XSKU 1LVMA 1DSUA 3W95A 5GXPA 5DP9A 3LJJA 1L2EA 1OWJA 3DT0H 5E2PA 2ULLA 1IOEA 2FMJA 4WXIA 2R3YA 1MAXA 2VWOA 2OBQA 3ZZ6A 1C1SA 3A87A 1K1OA 2XC0A 2GGVB 2ZU2A 2A4RA 4OS5A 2A4QA 2QXGA 4GHTA 2UUJB 1UVPA 1EZXC 2D8WA 1FIZA 1O2XA 1V2ST 1G3EA 2EC9H 3GDSA 3FFGA 3RXKA 1A0JA 4Y8XA 3T29A 1TRNA 1DX5M 1O2WA 4R8TB 1EX3A 1BBRK 3M7QA 2Z3EA 4Y10E 1TPAE 5B6OA 2ZTXA 1BTPA 1ELGA 2ZIQH 2WPIS 1DOJA 4JK6A 4DJZB 1PPBH 3RXIA 1GWAA 1O2LA 1SMFE 1JIMA 3TPIZ 1O2GH 3RXUA 5CE1A 3U9AH 1GI8B 1AB9B 1J8AA 4A1XA 3SJIA 1GI4A 2FM2A 2TPIZ 4ZH8A 1AWFH 2QN5T 4RKJB 2XCNA 1MTUA 2F83A 4X1PU 4NA8A 1K1NA 2HPPH 1UTKA 1FIWA 3D23A 3STJA 2ODPA 2PUXB 1GMCF 4IN1A 3K6ZA 1QA7A 3L6PA 5F8XA 4E7RG 2CHAC 1BMNH 2PHBA 3P8GA 3TJUA 1ELAA 3F9GA 4ABEA 4JYUH 1C5RA 5EU8A 2D1JA 3TGIE 1LCYA 3TH2H 3PB1E 3V12A 1AZ8A 3GCOA 2WPJS 3K6YA 2AGEX 4IN2A 1AHTH 2OC0A 2XYAA 2Y7XA 1KXAA 3LU9B 1S81A 3GY7A 2BB4A 1CT4E 2TGTA 1BRUP 1Y5BT 3RM2H 3A82A 2QXJA 1GGDB 3SU1A 4FUDA 5J4QA 3N7OA 2SGFE 3KEEA 3TK5A 4XBCA 3C1KA 2FS8A 3TK6A 2EI8A 2GCTB 1F7ZA 3LT3A 1QNJA 4Q2KA 2H2ZA 3UWIA 1TNKA 4JYTA 4SGAE 4YLUA 1G32B 4H6TA 5AFZH 3LGVA 1BMAA 2GT7A 1O3NA 1XUGA 3MU5A 4WXVA 1ZHPA 1FJSA 1RRKA 2UUFB 4AN7A 2A0QB 1C2HA 2PWXA 3BEUA 3Q76A 1GHXH 4ZHLU 1O3HA 1SB1H 1S85A 1RXPA 3RMLH 1G3CA 1A3BH 2AYWA 1MTWA 2ZTYA 2V6NA 3PWBA 1DT2A 5E0HA 1BZXE 1WOFA 2VIQA 2ZHWH 5GCHG 1CHOF 2FODA 1L4ZA 3SNAA 4FVDA 3PO1C 3R3GB 2BD7A 4MPUA 1ID5H 1ETSH 2ZFPH 4ISNA 2BY5X 2GCTC 3SI4H 1P01A 1HAVB 3TLOA 1ETRH 1Y8TA 1BDAA 4Z0KA 1O39A 2ZPRA 3VXFH 2XWBI 1O5DH 4AFSA 2GZ8A 1CHGA 1PFXC 3IG6B 2YOLA 1J9CH 1O5BB 3PMJA 2FLBH 2JH0D 3ATKA 1A46H 1ZGIA 4IMZA 4GLYA 3GY5A 2GKVE 5IYTA 2Y81A 1H8DH 1TAWA 1OWEA 1Q31A 3PROA 4ZHMU 2WPKS 3DFLA 3ZZ8A 1FUJA 2OQUA 3MFJA 1QQUA 1GG6C 1O2NA 1C1WH 1ZOMA 2ZO3H 1G2MA 1VJ9U 1HAIH 3EA7A 1O3AA 1SGCA 3UFAA 1EOJA 1H9LB 2TIOA 1RD3B 1GBKA 2OC7A 3DD2H 4U01A 1NFWA 2C8XB 1LQEA 2VIDA 3SN8A 2HNTF 1P10A 2ZFFH 4BXWA 1HRTH 1MBMA 2ODYB 4NIVA 4KP0A 3LC3A 5GIBA 1O3CA 1O36A 4KTUA 4FVBA 3MNXA 1V2TT 1TNLA 3RMNH 1SLVB 3TVJB 3V0XA 1ZTKA 1AB9C 3LH3A 4MNYA 1N1LA 4ZAEA 2QIQA 4A1VA 1C5YB 1GBJA 1QGFA 1C1RA 2XNIA 3D62A 3UWJH 3Q3XA 2P93A 1T4UH 3QZRA 5ESBA 2A1DB 1S6FA 5CHAC 4THNH 9ESTA 5A8XA 2OC8A 4XDEA 1SLUB 2FXRA 3ZZCA 1GBLA 1WUNH 3DA9B 3FZDA 1PQ8A 2BQ6B 2ANYA 3NXPA 2O8TA 1HAVA 1UHBB 2VH6A 2XBVA 4DY7B 5C1XA 1LMWB 3RXOA 1PPZA 1YCPM 3SUFA 3MI4A 1FAKH 1DLKB 2K1QA 3SNDA 1SGQE 4LOYH 1FXYA 2GZ9A 2ZPSA 2SGAA 3PLBA 4DW2U 1GBCA 3MTYA 3M61U 1G9IE 5LPEA 1AVGH 1MTNC 3UQVA 4CR9A 1EAXA 3D49H 1MH0A 4DGJA 3M35A 1V2OT 2VWNA 1QL7A 2Z9GA 1SGTA 5JBBS 1ABIH 1D3DB 1MBQA 4X1NU 2GVFA
chains in the Genus database with same CATH superfamily
2HLDD 1M9UA 3ZZ3A 2F91A 4Q7XA 2HRVA 4UEHH 4ZKSU 5LPRA 1WXRA 1O2KA 3VXEH 5GJ4B 1THSH 2BD3A 1YLCA 5EQSA 3SU0A 5JBAS 5L30H 2UWOA 1HAHH 1UVSH 1WV7H 1MKXH 1W14U 3B8JA 1MMJN 1E79D 2ALVA 4DVAU 2BVRH 3UNRA 4FUHA 4ISOA 1GMDF 1O2ZA 4XOJA 2PKSB 1AZZA 1BRAA 1C1OA 2FOAA 3T28A 3QO6A 4BAKB 2ZQ2A 1SQAA 2G4TA 4GPGA 3ZVEA 5DO4H 1GI0A 2GTBA 3GY2A 2GCHF 1RTLA 3NKKA 5PTPA 1BJUA 3MQKC 3PMAB 4WMEA 1SGFG 1CA0C 1T31A 3QK1A 3ELAH 1IQJA 3U28C 2Y5HA 1C5OH 3RU4D 4KKDA 4I8GA 1C5QA 4B76A 3CS0A 1ANBA 2OBOA 4MNWA 1A7SA 2FOCA 4U32A 1AU8A 1AVXA 1C5VA 1K2I1 3HK3B 4F48B 3BSQA 4TYDA 3DFJA 4MNXA 2BVXH 2RG3A 1VKYA 3PTBA 1GBAA 1BHXB 1B7XB 1ELDE 1OHHD 1OP2A 5DP3A 3SGBE 1AY6H 3TH3H 3GCHC 2ZDLA 1DSTA 3Q77A 2FX4A 5GPIB 1BRBE 2AH4X 4I31A 5EGMA 1DY9A 1RJXB 3FVFB 1GG6B 3L33A 1Z6JH 3TIUA 3ZYDA 1ELCA 1F0UA 4Z1MD 1ETTH 3SO3A 3ZVAA 1D4PB 2OQ5A 3F2GA 1IQIA 3PWCA 1GVKB 1IAUA 3QGJA 3SV2H 2THFB 1GL1A 3PYHA 5DGJA 4YT6H 2STAE 3M5MA 1ZMJA 1KMHB 1SKYE 2A7JA 2DUCA 2HOBA 1GJ5H 2C8WB 2P59A 4BTUB 1P2JA 3BEIB 1KSNA 2KCYA 1KXEA 4AYYB 1O3MA 3ZVFA 5ESTE 4OS6A 1DY8A 2VIWA 2WPDD 2Q6GA 4NWKA 4O03A 1Y59T 1QL9A 1O2PA 1W8BH 1VZQH 4KELA 1O3PB 3GY4A 2KCAA 4OM9A 3RC5A 3W1EA 4ZXXH 2B9LA 2XXLA 2ZG0H 3TJNA 4D7GA 2GZ7A 3FN8A 1INCA 2O9QA 2HWLB 1LHDH 1QB6A 1AWHB 1QJ6B 4NIXA 1FY8E 1Q2WA 1V2LT 1ZTJA 3FP6E 1A3EH 2I6SA 1J15A 1ZTLA 2ANWA 1GJ8B 1SR5C 1G3DA 3MU0A 2B5TB 1GJCB 2STBE 1IQEA 4TWYA 5AHGH 2H5CA 2ASUB 2TGPZ 4YESB 3T5FH 3FP7E 1TQ0B 1UCYE 2VGCB 2A4GA 3OEED 1F0SA 1Y3VA 2XC5A 4Y76A 1JRTA 1ELEE 3VB5A 1O5GH 3TJOA 5HM9A 2GMTB 4IBLH 4MQAA 1AGJA 3JZ2B 1NBMD 1GGDC 1EJMA 1ANEA 1D6WA 1THPB 1HGTH 5J4SA 5TCCA 2EQNA 4M7GA 4YOJA 2BTCE 2NWNA 2JH5D 4I32A 5K7RA 4D9RA 2R3UA 1XKBC 1O3EA 2JKHA 1GCTB 3FZZA 4DOQA 1CE5A 2SNWA 7KMEH 4YLQH 3OFND 1O2JA 2GDEH 3OAAD 2G81E 4X8TH 4IC5A 1SHYA 1HIAB 1T7CA 4A7IB 1C1UH 3OX7U 1HBTH 1Z7KA 2F3CE 1WDIA 3LGIA 2GP9B 3AASA 4AC9A 3M3VA 4NSVA 4B2CA 2C90B 1LDTT 4J2YB 1ZZZA 2BY6X 4BTIB 2Z9IA 1GI7B 1UTJA 3SOSA 2J4IA 4FOUC 4XBBA 5C20A 2G55A 1DLEA 1EQ9A 1P2OA 5ABWA 1S6HA 5T1VA 5AF9H 1VCQA 2CGAA 4YOIA 3SNEA 1LO6A 4GUXA 4I33A 5LGOA 2BDIA 4Q7ZA 1D3TB 2QAAA 4CRCA 1H4WA 5DK1A 5EJZA 4GCHG 3UAIC 1CA8B 2D26C 2BDHA 1ZPBA 1UJ1A 3M37A 2LP6A 4OS1A 1ZSLA 4UFFH 4TSFD 4ZROA 3E0NB 4H42U 1CT2E 1WCZA 1XUIA 3ZZ9A 1A4WH 2CMYA 2GDDA 1GCDA 3LGTA 1O2HA 1OOKB 3KN2A 1TYNA 2F9PA 4VGCC 3P95A 3RMMH 1ANDA 2A45B 2HPQH 1D3PB 1C2IA 5A8ZA 1P57B 4IMQA 5DJ7A 2Z9JA 4FUEA 4GHQA 3F0PA 2ZGBH 4NWLA 1W3CA 2J34A 3MO9A 4WMDA 2G52A 1VITF 1VGCB 5A0CA 1TA2A 1TE0A 1AE8H 1IQNA 2QF0A 4GVUA 1ELBA 4AFQA 1DWDH 2GJGA 3S9BA 1EXFA 2BY9X 4B1TA 1LKAA 2R9PA 3SU2A 1NTPA 1BBRH 5EPYA 1KDQB 3HKJB 2ZGHA 4TY6A 4I8KA 1TGBA 2P94A 4NA7A 2ZDVH 1W11U 1YP9A 2RFKC 4ZHAA 1TX6A 1WBGB 4FUJA 2PW8H 3HKIB 2FI4E 1W0YH 1FY4A 2KFWA 3RXRA 3VEQB 3OTJE 1GJ9B 1W10U 4TPIZ 6GCHF 3A7VA 2BDYA 2FPZA 1TFXA 2QXIA 3SV6A 1CSOE 1NESE 3TGJE 3SV7A 1WTHD 2ILNA 4DT4A 1AVWA 3SU6A 3ENSB 3I77A 3QTOH 1SSXA 1H9HE 2QF5A 1LVYA 1OP0A 1QQ4A 6CHAB 4K3JA 1BJVA 5EW2H 1WU1A 4MPXA 3BTGE 1F5LA 1Z8GA 5JDUB 2J95A 2RCEA 1JIRA 5HYOA 2IPQX 4ZUHA 2A2QH 4CH2B 4X2WA 3FANA 3ZVDA 4ABBA 2VNTA 4LK4A 2BDCA 2ZHDA 3ZV9A 3WWBA 2R2MB 1FAXA 1O2SA 3S9CA 2ZDKA 5DN6D 2BZAA 3P8OA 3ATIA 2BY7X 2CF9H 1OWDA 1T8OA 4Y8ZA 3M7TA 1OKXA 3QN7A 1VGCC 1GHAF 2PLXA 2Z94A 1BITA 3E0PB 4WJG2 3SGQE 2IPHA 1GBEA 1SFIA 1O2YA 3PV2A 4RSPA 2UWLA 1XM1A 2VINA 1B0EA 4VGCB 3A83A 1DFPA 2V3HH 3A7WA 2PFEA 4X8UH 2J2UA 2B0FA 3OTPA 1LVBA 2ZHEH 3BN9A 8KME2 3RXGA 2P3FH 2F43B 1E36B 5EXMA 4DIHH 2AFQB 4BAOB 2TBSA 1BCUH 1SI5H 3S7KB 3VB4A 2QC2A 2XBYA 1ZMLA 1HNEE 1C2JA 2PKSC 1DUEA 1T32A 1WYKA 1ZRKA 3HK6B 2GV7A 7GCHG 1GJ7B 4IGDA 1GHWH 2Z7FE 3G01A 2YNAA 1C1QA 3EYDA 2G5VA 3RXDA 1B5GH 1T4VH 1HAOH 3BG4C 4JCNA 4HI3A 2BY8X 1WAYB 2DE9A 2ZGCA 2V0BA 4JZDH 3ZZ5A 5TCAA 4OGXA 5FAHA 1LHFH 4Y7AA 1RIWB 1HJAB 2OK5A 4BNRA 1GHBF 1IHSH 3DSGA 1ZMNA 4Y7BA 1MTSA 3SV9A 1PPGE 1OYQA 2NU4E 1GL0E 5EW1H 3URCA 3QDZB 3RXSA 1MTNB 1FLEE 1GCTC 1W12U 1SLWB 2W5EA 2XNDD 5EXNA 1NM6A 3SUDA 4LZ1H 1IQGA 1YPJH 3LH1A 1ZSJA 2FOFA 3V13A 1KTSB 1C5PA 5DSFA 1P06A 4BANB 4JYVH 1O3JA 3NUMA 2ZHQH 3RUOA 1O3OA 1RTKA 4A92A 1F0TA 1HJ9A 5I46H 1ZR0A 2IN2A 8GCHG 3SNCA 3A8CA 1O3DA 1VCWA 4F55A 5L6NH 4KTSA 1O3LA 2ZFSA 2WV4A 4Z6AH 1KTTB 4ISHH 4BAMB 3T25A 1FONA 1CBWC 3ITIA 5FPTA 3AAUA 2DE8A 2WPMS 3EQ0H 2OTVA 4K2YA 3HPTB 3E6PH 1NBME 1O2UA 1UTMA 1XUJA 1YLNA 1KDQA 1P02A 1O3GA 2R0KA 2K8IA 1EAUA 2KCPA 5JPMH 3FP8E 1J14A 3SJOA 2ZGXH 1BB0B 2ZI2H 4OGYA 4B6EA 2FOBA 4WH6A 1Z8IB 2WUBA 2NU2E 2Z9LA 1BQYA 2OCVB 4O3TA 2OXSA 3RLWH 1BTUA 2JJ2D 1O3IA 1GVZA 1ELFA 1YYY1 1MQ6A 2BHGA 4F49A 1RS0A 5KGOA 4X2VA 1FY1A 2H5DA 2J9NA 1YCPH 1NC6A 5EXLA 2B7DH 1BMFD 1W13U 5KEDA 1GMHF 1EB1H 2OINA 1V2JT 2FOGA 8GCHF 1TLDA 4MPWA 4WMFA 4XRNA 1EAWA 5E8EH 5A0BA 4JZIA 5BRRE 3NK8A 2C93B 1OPHB 3GISB 1MAYA 2VB0A 1TB6H 1BA8B 1K22H 3ATMA 1O35A 1GI5A 1YY3A 5FXLA 3LGYA 1EASA 5C1YA 3GCTF 3CS7A 3WWFA 1TGSZ 1CVWH 1L0ZA 2ZFTA 1EPTC 3B9FH 5DP7A 3RXEA 3KCGH 1O5EH 3P92A 3LIWA 1Z8RA 1QA0A 2ZQ1A 3SORA 5LPFA 1F5KU 2IJD1 4D8NA 1FZZA 1G37A 1GJ6A 3EGKH 1ZYOA 2FI5E 1XVOA 4RT0A 4FUCA 4B2AA 3U69H 1O31A 1C2FA 2L74A 3SZNA 2Q6DA 1EPTA 4ZKNU 2FWWA 1GI1A 4AFZA 1WQSA 2LNCA 3RP2A 3ZZBA 1E35B 3WW7A 4KTCA 4ISIH 1C5NH 2ANKH 1UTQA 4MG3A 2SFAA 3M5LA 1Z8JB 3GYMA 1DXWA 3CENA 1J17T 2C8ZB 1S0QA 4R0IA 1H1BA 1E0FD 2O8UA 3E3TA 1J16A 1THRH 1P03A 3S69A 3VG8A 1OP8A 1MKXK 1V2WT 3KGPA 1QR3E 3F2HA 1GHAG 1ARBA 1SPJA 4F4OC 1KLJH 4P00A 5FX6A 1BIOA 1AKSA 2XBWA 5C5OA 2BOHB 4ABIA 5AFYH 3RXQA 4I8HA 1A1RA 1TGCA 1XXFA 3PM3A 1TX7A 3VB7A 3A85A 2OD3B 3M3SA 3BTFE 1SGRE 1EPTB 3UR9A 3KQEA 3KF2A 1AFQB 4YT7H 2VIOA 1TGTA 2QF4A 3TNTA 4NG9H 3T26A 1SG8B 1NPMA 3L3TA 2BLOA 5G4BA 3KQCA 1HUTH 1TPOA 1EAIA 3MMGA 5F53A 1IQHA 1XUFA 1IQLA 3P8FA 2FDAA 1FN6A 4FETA 1W7XH 1QJ7B 1L1GA 5GNDA 3CP7A 1D3QB 3LC5A 4Y79A 1P11E 3UPEA 3U1IB 2XBXA 3GDVA 3UB0A 3OE7D 3PLPA 4WY3A 1F5RA 5C2ZA 2PV9B 1P2KA 3LGWA 1HCGA 3H5CB 2ZTZA 2Y82A 1TBZH 4D7FA 2HNTE 2WSSD 2LPRA 2ZU1A 4SGBE 3GY6A 2JETB 5K0HA 3CNRA 3S9AA 1CGIE 1K1LA 3HGPA 3GCTG 1NU9A 4INKA 3SNBA 1GMDG 5GDSH 2XW9A 1TOCB 1TWXB 1ESAA 1DANH 1UTPA 2KM0A 8LPRA 2Z3DA 1EB2A 1MZAA 2JDID 4UE7H 1C2LA 2P8OC 1UCYH 2H6MA 5FX5A 1L4DA 2FTLE 5C5NA 2UUKB 4BAHB 2RDLA 4J1YA 4MLFB 1RFNA 2QCYA 3OY6U 2G8TA 2FEQH 5CHAB 4BTTB 1W2KH 4YOGA 4H6SB 2HLCA 1Z1IA 2WV9A 4AFUA 1UTNA 2W3KA 1P8VC 1RGQA 1HXFH 2BD4A 2J94A 1SGPE 3AVZA 1TRMA 1SQRA 1TNGA 2KX4A 1MUEB 1C1VH 2CK3D 2GD4B 1OS8A 3ZVCA 2NU1E 1OX1A 4ZMAH 1FDPA 2Z9KA 1VCPA 5EQQA 1AQ7A 4X6MA 2OLGA 1CU1A 1ZHMA 3O8CA 4I8JA 4M9FA 4K8YA 3O8DA 1EATA 1ARCA 1H8HD 2VIVA 1JBUH 3PV5A 7LPRA 3T27A 1FPHH 3UUZA 2EI6A 4NFEA 4ASHA 4X1SU 1S82A 3RU4T 1YM0A 5HXFA 1LPKB 1OXGA 1H8IH 4ABAA 1UVOA 1GVLA 1EUFA 2ALPA 4NGAH 2EA3A 3UIRA 1UO6A 4A6LA 3HGNA 1CHOG 1V2KT 1P3EA 1A5HA 2O8WA 3E8LA 5AVDA 3RC4A 3RXFA 1AFQC 2F9BH 2F9VA 1K28D 1IQFA 3PMHB 2C3SA 3M36A 1TA6A 4X8VH 2AIPA 1N6XA 5FCRA 4XD7D 1LPZB 4X1RU 4AB9A 2P16A 4FUFA 3ZVBA 4CH8B 3ATLA 2ZU4A 1NU7B 1O3FA 3PO1B 2A32A 3W94A 5A09A 3QX5H 3AAVA 3RDZA 1GPZA 1AKSB 4ESTE 3GCNA 3SUGA 3UNSA 4CR5A 2PTNA 3GY3A 2C4FH 2QXHA 2Z3CA 1ESBA 2WINI 4ZXYH 2VVVA 1EP5A 2SGDE 3U8OH 3VB6A 1SL3A 2FX6A 3VGCC 2VIPA 1HAPH 4YZUA 1EKBB 1T8MA 1MQ5A 2PKAB 1DWCH 1TIOA 3SI3H 3Q00A 1QURH 3EA9A 4X8SH 3H7OA 3OU0A 1DE7H 2J92A 4DIIH 1EZUC 1K1MA 1XVMA 2BYAX 2WYGA 1TRYA 1MTVA 2VVCA 3MH4A 2KCOA 2P3UB 3QLPH 5EODA 1HDTH 4K1EA 1C2MA 1LPGB 1N8OB 2ZKSA 2V3OH 4HZHA 1HXEH 1TMBH 1HPGA 3SZEA 1KIGH 3UY9A 2BMGB 5EOKA 1ELTA 4FU9A 3RXBA 1JWTA 1V2VT 2AHME 1KY9A 3ATWA 2WZQA 1O5CB 2ZDMA 6ESTA 1GJBB 3LOXA 3BIUH 3LKWA 1GI2A 4Q80A 3KQ5A 3MO3A 3RXTA 2JH6D 5C3NA 1A2CH 4DURA 1NROH 1YPLH 1A0HB 1BBRE 3MH6A 4FUIA 5GCHF 1OSSA 1GJDB 1P0SH 1TX8A 2A5AA 5H4IB 4NSYA 4CBOA 2ZCLP 4WWYA 2AMPA 1W0KD 1P9SA 1P04A 3F9FA 1GI3A 1YPHE 1ZPCA 1RTFB 3MNBA 1AFEH 1JXPA 1BMMH 1PQ7A 1DITH 3BV9B 5C67A 2G00A 1WQVH 3NRLA 2Y80A 4AX9H 2H9TH 5E0GA 3NCLA 8ESTE 1C5LH 3RLYH 2PTCE 1D9IA 2KZ4A 1IHTH 2F9OA 3MNSA 1CBWB 1CA0B 4RI0A 3MOCA 4TY7A 3K9XB 1TBRH 3R0FA 4Y6DA 3SJ9A 5DKMA 4RT1A 1GDNA 4Y0ZE 4UONA 3ZYEA 1A5IA 4DT7B 1NFXA 2W7SA 1TBQH 3BTHE 5KECA 1ZRBA 3KYFA 3U8TH 1SBWA 2H1UA 1B0FA 2BXUH 2XOKD 1AE5A 2WHXA 1O2IA 4OS7A 3RXHA 4INHA 1SLXB 1O38A 4AG2A 2BM2A 1NRQH 2HVXA 3P70B 4Y0YE 1TNHA 2A7HA 1FN8A 4U30A 3SHAH 1GDQA 2HALA 3F9EA 2W26A 2PUQH 1HJAC 3NZIA 1YLDA 3UREA 2VWLA 4AGKA 4ABJA 2FESH 2L6OA 2BLWA 4AZ2B 2BX4A 1TNIA 5HMAA 1K1JA 2AS9A 3BTTE 2OC1A 1Y3WA 3K2UA 1O5FH 1MKWH 3T62A 4ABHA 1P2NA 5F03A 3TJVA 3DSOA 5LH8A 2WUCA 2AMDA 3ZZ4A 1U6QA 2ZDNA 3DUXH 1ZSKA 1FMGA 2JIZD 4WVPE 3BTDE 4ABDA 1OWHA 1VJAU 4Y8YA 2VBCA 5DG6A 2FTMA 2GMTC 2C8YB 4B71A 4BOHA 3LONA 3BTWE 5A2MH 1A61H 1VITG 2Y5FA 1TQ7B 1ESTA 1MU6B 2TGDA 2A31A 4HTCH 4D76A 5SGAE 1Y5UT 1SGYE 1ANCA 2ZCKP 2ZHFH 3D65E 2FOMB 4ISLA 1NN6A 4DG4A 3SQEE 2BLQA 3A8AA 5TJXA 5FL7D 3LJOA 5L2YH 1SQOA 2BD9A 1C1PA 3FAOA 1BTYA 1PPCE 1P9UA 1VR1H 3GDUA 1QBNA 1GI9B 1SGNE 3C27B 3M5NA 1O3BA 1A0LA 1MCVA 3A84A 1PJPA 1SOTA 1T8NA 1BOQA 2BX3A 1MU8B 3DHKH 2HVYB 1EZQA 4GAWA 3UOUA 3U1JB 1BTHH 4ZKOU 4IS5A 1YC0A 4K8BA 3T2NA 2M5TA 1ZPZA 3TGKE 1GDUA 2W3IA 5FPSA 6CHAC 3MU1A 5HGGA 1Y3YA 3Q3KA 3TU7H 1WSSH 3GS9A 3V3MA 1KXDA 3SU3A 4Q4LA 2J97A 1DWBH 1KXCA 2CJIA 2ZC9H 1QFKH 3SGAE 2ZFRH 4UFGH 5DPAA 1LTOA 1ABJH 3RXVA 5HIYA 1UVTH 3SJKA 1N8OC 1QRXA 3A7XA 3A81A 1DWEH 3GYLB 3QZQA 3KQDA 5JB9S 3S0NA 2FIRH 4NIWA 2PKAA 1Y5AT 5FHTA 2YNBA 3QWCH 2BD8A 3RXPA 1DPOA 5HIZA 4E06H 4MTBA 1MD7A 1UK4A 1ZHRA 2QGRA 3OY5U 3STIA 1F2SE 1CQQA 1ACBE 2Y5GA 3PV4A 1EZSC 1UMAH 4X0WU 1SC8U 3HATH 1DICA 1BTWA 1UK3A 2IJOB 2HNTC 2ZDAH 3AW0A 2BVSH 4CBNA 3EDXB 1GI6A 2PGQB 1NFUA 4X6OA 4JK5A 2XC4A 1SOZA 2P95A 1QIXB 1SHHB 4ZKRU 1HFDA 5DP5A 2SGEE 1LHCH 1LVOA 3Q3YA 4X2YA 4QT8C 5T6FA 1P09A 3PRDA 2RDEA 5C17A 3V7TA 1S0RA 3SBKA 2ZNKH 1C5ZB 2FYQA 4B6FA 1ELVA 2ODQA 2V3MA 1EJNA 3KL6A 3A8DA 3BG8A 7GCHF 1EJAA 2CN0H 1ZJDA 1AUTC 2AIQA 1C4U2 4ABGA 5DP6A 1YF4A 2ZZUH 3PRBA 2BDGA 3F9HA 1BHXF 1GHVH 2A2XH 1YCPK 1E34B 3SU4A 4O97A 2A4OA 1AD8H 1BMLA 1S6LA 1DM4B 4ZCNA 5T6GA 4XE4A 4K1TA 4ACAA 1QRWA 3SUEA 3A7TA 2ZGJA 4AB8A 3SQHE 1UVUH 1Z6EA 1W0ZU 4OS2A 2GX4A 2ZA5A 4ABFA 3DSPA 1QJ1B 2ZF0H 3MNCA 1NRRH 4X2XA 4Q7YA 1C5XB 4K69A 1FQ3A 4IW4E 1G3BA 4NFFA 3ZV8A 1FV9A 4AORA 1QRZA 2H9EH 1RIWC 3NPSA 2Q1JA 4CRDA 1OWKA 1N6YA 2EI7A 1QL8A 1HLTH 3QUMP 1C5SA 2EEKA 1YKTA 3P17H 4FU8A 3SYJA 1L1JA 3A7ZA 1PPFE 4DCDA 5HM2A 3BG4B 1GMHG 5I25A 1OYTH 3TH4H 1O2RA 4OS4A 4CHAB 1O2VA 1V2QT 3I78A 4P02A 4NIYA 1XMNB 1QTFA 3SV8A 1HAGE 3EE7A 3K65B 2ZU3A 3SU5A 3MWIU 2ZEBA 2CV3A 1C5TA 3AK5A 2AGIX 3E1XB 4K60A 1C9TA 1XXDA 2FYRA 1K21H 3M5OA 1GBTA 1AIXH 4TPYA 2VGCC 1IQKA 5C0TA 4NA9H 4LXBH 1UHBA 3M3TA 3EE0B 2QYIA 1NZQH 1TGNA 5A0AE 4UD9H 1V6DA 1COWD 1C2KA 1C9PA 2JETC 1UTLM 4NZLA 2I6QA 2CF8H 3IWMA 1V2RT 1SFQB 2ANMH 3F1SB 4E05H 1UCYK 1FX0B 3BF6H 2OUAA 1DDJA 2Q6FA 3TNSA 1T8LA 3WY8A 2R0LA 1V2UT 1DUAA 3QTVH 2O8MA 3A89A 2QY0B 1Y3UA 3H7TA 3A80A 4MVNA 3EAJA 3F68H 1V2PT 1ORFA 4X6NA 4O9VA 4NZQA 2TGAA 1AMHA 1NRPH 1O2OA 1UK2A 1EOLA 1GBFA 1LHGH 2ZPQA 3UNQA 1P2MA 6LPRA 2D2DA 2NU3E 3UQOA 5EJ1A 1QY6A 1YPKH 1YPMH 2WPLS 3P6ZB 1W7GH 4B73A 3AW1A 3EA8A 1HAYB 3BTME 1DXPA 4FUGA 2Z6BD 1O0DH 3KNXA 2PP6A 1NS3A 1MZDA 4X6PA 3RXCA 3E90B 1O37A 4Q63A 1S84A 2ZECA 2AMQA 4XBDA 1HJ8A 3QGNB 3TITA 2VWMA 2SGQE 1HB0B 4AGJA 1P12E 4JZEH 4BXSA 3SJ8A 1QB1A 2QA9E 5C1UA 2PSYA 1KLIH 1C5UA 1TALA 5FBIA 2PR3A 2XCFA 3B23B 1NO9H 5FCKA 3P8NA 2GT8A 3A8BA 2QV1A 4HGCA 3MH5A 3OYPA 1LKBA 2FOEA 1G36A 3BTQE 1YPEH 1HYLA 2Y7ZA 1TMTH 3S7HB 1GBHA 1ZLRA 1C2EA 1VITH 1QCPA 3I29A 1K1PA 1UTOA 2XWAA 3E16B 1BT7A 1C4V2 1H8ED 1O33A 2FOHA 1ZGVA 1EP6A 4K5ZA 3OSYA 3ODDA 1LHEH 3RXJA 1GHZA 1TNJA 4KGAA 4AYVB 3MO6A 2H9HA 3ODFA 1OWIA 3VB3A 2BD2A 1NFYA 5F8ZA 4FUBA 3VFEA 1C5WB 3F6UH 1FY3A 2B8OH 3BTEE 1A5GH 1WTGH 1CO7E 1XUHA 1PQ5A 1F92A 2FI3E 1S83A 4B75A 1F0RA 1K9OE 1HV7A 3MH7A 4JZ1A 1SGIB 3O8RA 1NRSH 3BTKE 2FS9A 4NCYA 5JBTA 2VVUA 5JYIA 2ZP0H 1K0HA 2UWPA 3RMOH 1C1MA 5FPYA 1P2IA 1O5AB 1G2LA 4UFEH 2XRCA 4CHAC 3URDA 4HFPB 3LPRA 1O32A 2BXTH 3PMBB 3RXLA 3ZZDA 1QB9A 2BQWB 2SGPE 1XKAC 2WPHS 4D9QA 4IC6A 4RN6A 4UFDH 4B2BA 3UR6A 5EIYA 1O30A 1HAXB 2R2WU 1AI8H 3RXMA 1BUIA 3ZVGA 2KAIB 2A5IA 2OP9A 2ESTE 1KXFA 1GBDA 5CMXH 2CHAB 3JZ1B 4YO9A 4B74A 3PLKA 2AEIH 2VU8E 1CGHA 1TONA 1Y3XA 2ZFQH 2XTTB 1PPEE 5BPEA 3MU4A 1P05A 4A1TA 4X1QU 4CREA 2VJ1A 1AN1E 2UUYA 3H09A 4Y71A 4YM9A 4PROA 3E91A 1GBIA 2V35A 1GJAB 5A8YA 2ZCHP 2SNVA 1SQTA 1SGDE 2J98B 5ETXA 2YMSB 1FY5A 1S5SA 3MYWA 3KIDU 1C5MD 1YBWA 1QBVH 1IQMA 2KAIA 3VPKA 4I7YH 3TK9A 4H4FA 4YXWD 2O8LA 3O8BA 3KHVA 2AERH 2P3TB 2EY4C 5GWZA 1ZJKA 4ASUD 2J38A 1TABE 2F9UA 2P8OB 1SVPA 4AOQA 4LZ4B 3BIVH 1O2MA 1TOMH 4RKOB 1YPGH 3MU8A 1L1NA 1KYNA 1QZ8A 3F0OA 4XFQA 1O34A 2QF3A 3LGUA 5F8TA 1GMCG 1NY22 1BTZA 1Z71A 1MD8A 4WH8A 4CRFA 1C2GA 1CGJE 2RA0A 1CT0E 3GOVB 4GSOA 3BEFB 1E37B 3UTUH 5E0JA 1E1QD 3FKSD 5T6DA 5C94A 4CRGA 1TMUH 1C1TA 1KXBA 2BOKA 4K1SA 1E38B 3A88A 5FBEA 9LPRA 4I8LA 2GCHG 1V2NT 2WV5A 3MHWU 4TWWA 1YGCH 1BRCE 1O2QA 3RM0H 1V3XA 4UDWH 1P2QA 3M7UA 5IDKA 3DCLA 4AG1A 4E7NA 2BDBA 1GHYH 1MCTA 1P3CA 1HIAA 3ZZ7A 1C2DA 1KLTA 3RXAA 1HAZB 7ESTE 2G5NA 1GJ4H 1JMOH 1Z1JA 2BLVA 2F9NA 1AUJA 1YPHC 2NU0E 4FXGH 2JJ1D 1PQAA 2RA3A 5E2OA 3U8RH 5JBCS 2BDAA 3A7YA 4JZFH 2BQ7B 1FPCH 1GHBG 4Y11E 3U98H 1FNIA 1C1NA 2FP7B 4MNVA 2BD5A 4GCHF 1O3KA 4O3UA 4TT3D 5C0UA 1C4Y2 3ZZAA 1PYTC 3ESTA 1DVAH 2TRMA 3UOPA 1AO5A 4YTAA 5JB8S 3GCHB 4CRAA 2Y6TA 2FZZA 1GBBA 1QBOA 2FO9A 3SW2B 2G4UA 4WF8A 4CRBA 1JOUB 2FLRH 1Q3XA 4JMYA 1K1IA 3VGCB 2VH0A 5T3HA 3IITA 2HGTH 3RC6A 3FOAA 1DS2E 5EPNA 5DP4A 5EQRA 2PGBB 2PSXA 2A5KA 1TPPA 4FU7A 5L2ZH 4MDSA 3GY8A 1O2TA 4BAQB 3SHCH 3RU4E 2W7UA 1SGEE 1JRSA 3PTNA 2ZU5A 3A86A 1MKWK 2GV6A 2IOTA 2WYJA 1PPHE 2AGGX 3GICB 3NWUA 2A7CA 1NRNH 4A5TS 2ZWLH 1NT1A 2G51A 1TPSA 1PYTD 1GBMA 1XX9A 3KQBA 1D6RA 1SGFA 2BZ6H 1QHRB 5DP8A 1LQDB 4U2WA 5EG4A 1V2MT 1X7AC 5F6MA 1BTXA 1G30B 1XUKA 6GCHG 2CXVA 4INLA 1FI8A 1H9IE 3LDXH 4MPVA 4XSKU 1LVMA 1DSUA 3W95A 5GXPA 5DP9A 3LJJA 1L2EA 1OWJA 3DT0H 5E2PA 2ULLA 1IOEA 2FMJA 4WXIA 2R3YA 1MAXA 2VWOA 5CDFE 2OBQA 3ZZ6A 1C1SA 3A87A 1K1OA 2XC0A 2GGVB 3KYGA 2ZU2A 2A4RA 4OS5A 2A4QA 2QXGA 4GHTA 2UUJB 1UVPA 1EZXC 3FO8D 2D8WA 1FIZA 1O2XA 1V2ST 1UW7A 1MABB 1G3EA 2EC9H 3GDSA 3FFGA 3RXKA 1A0JA 4Y8XA 3T29A 1TRNA 1DX5M 1O2WA 4R8TB 1EX3A 1BBRK 3M7QA 2Z3EA 4Y10E 1TPAE 5B6OA 2ZTXA 1BTPA 1ELGA 2ZIQH 2WPIS 1DOJA 4JK6A 4DJZB 2KR7A 1PPBH 3RXIA 1GWAA 1O2LA 1SMFE 1JIMA 3TPIZ 4ACBA 1O2GH 3RXUA 5CE1A 2M2AA 3U9AH 1GI8B 2YMSC 1AB9B 1J8AA 4A1XA 3SJIA 1GI4A 2FM2A 2TPIZ 4ZH8A 1AWFH 2QN5T 2LELA 4RKJB 2XCNA 1MTUA 2F83A 4X1PU 4NA8A 1K1NA 2HPPH 1UTKA 1FIWA 3D23A 3STJA 2ODPA 2PUXB 1GMCF 4IN1A 3K6ZA 1E1RD 1QA7A 3L6PA 5F8XA 4E7RG 2CHAC 1BMNH 2PHBA 3P8GA 3TJUA 1ELAA 3F9GA 4ABEA 4JYUH 1C5RA 5EU8A 2D1JA 5B6LA 3TGIE 1LCYA 3TH2H 3PB1E 3V12A 1AZ8A 3GCOA 2WPJS 3K6YA 2AGEX 4IN2A 1AHTH 2F4LA 2OC0A 2XYAA 2Y7XA 1KXAA 3LU9B 1S81A 2J5UA 3GY7A 2BB4A 1CT4E 2TGTA 1BRUP 1Y5BT 3RM2H 3A82A 2QXJA 2J98A 1GGDB 3SU1A 4FUDA 5J4QA 3N7OA 2SGFE 3KEEA 3TK5A 4XBCA 3C1KA 2FS8A 3TK6A 1YWUA 2EI8A 2GCTB 3F3BA 1F7ZA 3LT3A 1QNJA 4Q2KA 2H2ZA 3UWIA 1TNKA 4JYTA 3N99A 4SGAE 4YLUA 1G32B 4H6TA 5AFZH 3LGVA 5IK2D 1BMAA 2GT7A 1O3NA 1XUGA 3MU5A 4WXVA 1ZHPA 1FJSA 1RRKA 2UUFB 3F2FA 4AN7A 2A0QB 1C2HA 2PWXA 3BEUA 3Q76A 1GHXH 4ZHLU 1O3HA 1SB1H 1S85A 1RXPA 3RMLH 1G3CA 1A3BH 2AYWA 1MTWA 4I86A 2ZTYA 2V6NA 3PWBA 1DT2A 5E0HA 1BZXE 1WOFA 2VIQA 2ZHWH 5GCHG 1CHOF 2FODA 1L4ZA 3SNAA 4FVDA 3PO1C 3R3GB 2BD7A 4MPUA 1ID5H 1ETSH 2ZFPH 4ISNA 2BY5X 2GCTC 3SI4H 1P01A 1HAVB 3TLOA 1ETRH 1Y8TA 3ZIAD 1BDAA 4Z0KA 1O39A 2ZPRA 3VXFH 2XWBI 1O5DH 4AFSA 2GZ8A 1CHGA 1PFXC 3IG6B 2YOLA 1J9CH 1O5BB 3PMJA 2FLBH 2JH0D 3ATKA 1A46H 1ZGIA 4IMZA 4GLYA 5EJLA 3GY5A 2GKVE 5IYTA 2Y81A 2YMSD 1H8DH 1TAWA 1OWEA 1Q31A 3PROA 4ZHMU 2WPKS 3DFLA 3ZZ8A 1FUJA 2OQUA 3MFJA 1QQUA 1GG6C 2QE7D 1O2NA 1C1WH 1ZOMA 2ZO3H 2V7QD 1G2MA 1VJ9U 1HAIH 3OEHD 3EA7A 1O3AA 1SGCA 3UFAA 1EFRD 1EOJA 1H9LB 2TIOA 1RD3B 1GBKA 2OC7A 3DD2H 4U01A 1NFWA 2C8XB 1LQEA 2VIDA 3SN8A 2HNTF 1P10A 2ZFFH 4BXWA 1HRTH 1MBMA 2ODYB 4NIVA 4KP0A 3LC3A 5GIBA 1O3CA 1O36A 5HKKD 4KTUA 4FVBA 3MNXA 1V2TT 1TNLA 3RMNH 1SLVB 3TVJB 3V0XA 1ZTKA 1AB9C 3LH3A 4MNYA 1N1LA 4ZAEA 2QIQA 4A1VA 1C5YB 2W6JD 1GBJA 1QGFA 1C1RA 2XNIA 3D62A 5CHBA 3UWJH 3Q3XA 2P93A 1T4UH 3QZRA 5ESBA 2A1DB 1S6FA 5CHAC 4THNH 9ESTA 5A8XA 2OC8A 4XDEA 1SLUB 2FXRA 3ZZCA 1GBLA 1WUNH 3DA9B 3FZDA 1PQ8A 2BQ6B 2ANYA 3NXPA 2O8TA 1HAVA 3N7EA 4HG6A 1UHBB 1W0JD 2W6ID 2VH6A 2XBVA 3N7DA 4DY7B 5C1XA 1LMWB 3RXOA 1PPZA 1YCPM 3SUFA 3MI4A 1FAKH 1DLKB 2K1QA 3SNDA 1SGQE 4LOYH 1FXYA 2GZ9A 2ZPSA 2SGAA 3PLBA 4DW2U 1GBCA 3MTYA 3M61U 1G9IE 5LPEA 1AVGH 1MTNC 3UQVA 4CR9A 1EAXA 3D49H 1MH0A 4DGJA 3M35A 1V2OT 2VWNA 1QL7A 2Z9GA 1SGTA 5JBBS 1ABIH 2K0QA 1D3DB 1MBQA 4X1NU 2GVFA
chains in the Genus database with same CATH topology
1M9UA 3ZZ3A 2F91A 4Q7XA 2HRVA 4UEHH 4ZKSU 5LPRA 1O2KA 3VXEH 5GJ4B 1THSH 2BD3A 1YLCA 5EQSA 3SU0A 5JBAS 5L30H 2UWOA 1HAHH 1UVSH 1WV7H 1MKXH 1W14U 3B8JA 1MMJN 2ALVA 4DVAU 2BVRH 3UNRA 4FUHA 4ISOA 1GMDF 1O2ZA 4XOJA 2PKSB 1AZZA 1BRAA 1C1OA 2FOAA 3T28A 3QO6A 4BAKB 2ZQ2A 1SQAA 2G4TA 4GPGA 3ZVEA 5DO4H 1GI0A 2GTBA 3GY2A 2GCHF 1RTLA 3NKKA 5PTPA 1BJUA 3PMAB 4WMEA 1SGFG 1CA0C 1T31A 3QK1A 3ELAH 1IQJA 2Y5HA 1C5OH 3RU4D 4KKDA 4I8GA 1C5QA 4B76A 3CS0A 1ANBA 2OBOA 4MNWA 1A7SA 2FOCA 4U32A 1AU8A 1AVXA 1C5VA 1K2I1 3HK3B 3BSQA 4TYDA 3DFJA 4MNXA 2BVXH 2RG3A 3PTBA 1GBAA 1BHXB 1B7XB 1ELDE 1OP2A 5DP3A 3SGBE 1AY6H 3TH3H 3GCHC 2ZDLA 1DSTA 3Q77A 2FX4A 5GPIB 1BRBE 2AH4X 4I31A 5EGMA 1DY9A 1RJXB 3FVFB 1GG6B 3L33A 1Z6JH 3TIUA 3ZYDA 1ELCA 1F0UA 1ETTH 3SO3A 3ZVAA 1D4PB 2OQ5A 1IQIA 3PWCA 1GVKB 1IAUA 3QGJA 3SV2H 2THFB 1GL1A 3PYHA 5DGJA 4YT6H 2STAE 3M5MA 1ZMJA 2DUCA 2A7JA 2HOBA 1GJ5H 2C8WB 2P59A 4BTUB 1P2JA 3BEIB 1KSNA 1KXEA 4AYYB 1O3MA 3ZVFA 5ESTE 4OS6A 1DY8A 2VIWA 2Q6GA 4NWKA 4O03A 1Y59T 1QL9A 1O2PA 1W8BH 1VZQH 4KELA 1O3PB 3GY4A 3RC5A 4ZXXH 2B9LA 2XXLA 2ZG0H 3TJNA 4D7GA 2GZ7A 1INCA 2O9QA 2HWLB 1LHDH 1QB6A 1AWHB 1QJ6B 4NIXA 1FY8E 1Q2WA 1V2LT 1ZTJA 3FP6E 1A3EH 2I6SA 1J15A 1ZTLA 2ANWA 1GJ8B 1SR5C 1G3DA 3MU0A 2B5TB 1GJCB 2STBE 1IQEA 4TWYA 5AHGH 2H5CA 2ASUB 2TGPZ 4YESB 3T5FH 3FP7E 1TQ0B 1UCYE 2VGCB 2A4GA 1F0SA 1Y3VA 2XC5A 4Y76A 1JRTA 1ELEE 3VB5A 1O5GH 3TJOA 5HM9A 2GMTB 4IBLH 4MQAA 1AGJA 3JZ2B 1GGDC 1EJMA 1ANEA 1D6WA 1THPB 1HGTH 5J4SA 5TCCA 4M7GA 4YOJA 2BTCE 2NWNA 2JH5D 4I32A 5K7RA 4D9RA 2R3UA 1XKBC 1O3EA 2JKHA 1GCTB 3FZZA 4DOQA 1CE5A 2SNWA 7KMEH 4YLQH 1O2JA 2GDEH 2G81E 4X8TH 4IC5A 1SHYA 1HIAB 1T7CA 4A7IB 1C1UH 3OX7U 1HBTH 1Z7KA 2F3CE 3LGIA 2GP9B 3AASA 3M3VA 4NSVA 4B2CA 2C90B 1LDTT 4J2YB 1ZZZA 2BY6X 4BTIB 2Z9IA 1GI7B 1UTJA 3SOSA 2J4IA 4XBBA 5C20A 2G55A 1DLEA 1EQ9A 1P2OA 5ABWA 1S6HA 5AF9H 1VCQA 2CGAA 4YOIA 3SNEA 1LO6A 4GUXA 4I33A 5LGOA 2BDIA 4Q7ZA 1D3TB 2QAAA 4CRCA 1H4WA 5DK1A 4GCHG 1CA8B 2D26C 2BDHA 1ZPBA 1UJ1A 3M37A 4OS1A 4UFFH 1ZSLA 4ZROA 3E0NB 4H42U 1CT2E 1WCZA 1XUIA 3ZZ9A 1A4WH 2CMYA 2GDDA 1GCDA 3LGTA 1O2HA 1OOKB 3KN2A 1TYNA 2F9PA 4VGCC 3P95A 3RMMH 1ANDA 2A45B 2HPQH 1D3PB 1C2IA 5A8ZA 1P57B 4IMQA 5DJ7A 2Z9JA 4FUEA 4GHQA 2ZGBH 4NWLA 1W3CA 2J34A 3MO9A 4WMDA 2G52A 1VITF 1VGCB 5A0CA 1TA2A 1TE0A 1AE8H 1IQNA 2QF0A 4GVUA 1ELBA 4AFQA 1DWDH 3S9BA 1EXFA 2BY9X 4B1TA 1LKAA 2R9PA 3SU2A 1NTPA 1BBRH 5EPYA 1KDQB 3HKJB 2ZGHA 4TY6A 4I8KA 1TGBA 2P94A 4NA7A 2ZDVH 1W11U 1YP9A 4ZHAA 1TX6A 1WBGB 4FUJA 2PW8H 3HKIB 2FI4E 1W0YH 1FY4A 3RXRA 3VEQB 3OTJE 1GJ9B 1W10U 4TPIZ 6GCHF 3A7VA 2BDYA 2FPZA 1TFXA 2QXIA 3SV6A 1CSOE 1NESE 3TGJE 3SV7A 1WTHD 2ILNA 1AVWA 3SU6A 3ENSB 3I77A 3QTOH 1SSXA 1H9HE 1LVYA 1OP0A 1QQ4A 6CHAB 4K3JA 1BJVA 5EW2H 1WU1A 4MPXA 3BTGE 1F5LA 1Z8GA 5JDUB 2J95A 2RCEA 1JIRA 5HYOA 4ZUHA 2A2QH 4CH2B 4X2WA 3FANA 3ZVDA 4ABBA 2VNTA 4LK4A 2BDCA 2ZHDA 3ZV9A 2R2MB 1FAXA 1O2SA 3S9CA 2ZDKA 2BZAA 3P8OA 3ATIA 2BY7X 2CF9H 1OWDA 1T8OA 4Y8ZA 3M7TA 1OKXA 3QN7A 1VGCC 1GHAF 2PLXA 2Z94A 1BITA 3E0PB 4WJG2 3SGQE 2IPHA 1GBEA 1SFIA 1O2YA 4RSPA 2UWLA 1XM1A 2VINA 1B0EA 4VGCB 3A83A 1DFPA 2V3HH 3A7WA 2PFEA 4X8UH 2J2UA 2B0FA 1LVBA 2ZHEH 3BN9A 8KME2 3RXGA 2P3FH 1E36B 5EXMA 4DIHH 2AFQB 4BAOB 2TBSA 1BCUH 1SI5H 3S7KB 3VB4A 2QC2A 2XBYA 1ZMLA 1HNEE 1C2JA 2PKSC 1DUEA 1T32A 1WYKA 1ZRKA 3HK6B 2GV7A 7GCHG 1GJ7B 4IGDA 1GHWH 2Z7FE 3G01A 2YNAA 1C1QA 3EYDA 2G5VA 3RXDA 1B5GH 1T4VH 1HAOH 3BG4C 4JCNA 4HI3A 2BY8X 1WAYB 2DE9A 2ZGCA 2V0BA 4JZDH 3ZZ5A 5TCAA 4OGXA 5FAHA 1LHFH 4Y7AA 1RIWB 1HJAB 4BNRA 1GHBF 1IHSH 1ZMNA 4Y7BA 1MTSA 3SV9A 1PPGE 1OYQA 2NU4E 1GL0E 5EW1H 3URCA 3QDZB 3RXSA 1MTNB 1FLEE 1GCTC 1W12U 1SLWB 2W5EA 5EXNA 1NM6A 3SUDA 4LZ1H 1IQGA 1YPJH 3LH1A 1ZSJA 2FOFA 3V13A 1KTSB 1C5PA 1P06A 4BANB 4JYVH 1O3JA 3NUMA 2ZHQH 3RUOA 1O3OA 1RTKA 4A92A 1F0TA 1HJ9A 5I46H 1ZR0A 2IN2A 8GCHG 3SNCA 3A8CA 1O3DA 1VCWA 5L6NH 4KTSA 1O3LA 2ZFSA 2WV4A 4Z6AH 1KTTB 4ISHH 4BAMB 3T25A 1FONA 1CBWC 3ITIA 5FPTA 3AAUA 2DE8A 2WPMS 3EQ0H 2OTVA 4K2YA 3HPTB 3E6PH 1O2UA 1UTMA 1XUJA 1KDQA 1P02A 1O3GA 2R0KA 1EAUA 5JPMH 3FP8E 1J14A 3SJOA 2ZGXH 1BB0B 2ZI2H 4OGYA 2FOBA 4WH6A 1Z8IB 2WUBA 2NU2E 2Z9LA 1BQYA 2OCVB 4O3TA 2OXSA 3RLWH 1BTUA 1O3IA 1GVZA 1ELFA 1YYY1 1MQ6A 2BHGA 4F49A 1RS0A 4X2VA 1FY1A 2H5DA 2J9NA 1YCPH 1NC6A 5EXLA 2B7DH 1W13U 1GMHF 1EB1H 2OINA 1V2JT 2FOGA 8GCHF 1TLDA 4MPWA 4WMFA 1EAWA 5E8EH 5A0BA 4JZIA 5BRRE 3NK8A 2C93B 1OPHB 3GISB 1MAYA 2VB0A 1TB6H 1BA8B 1K22H 3ATMA 1O35A 1GI5A 5FXLA 3LGYA 1EASA 5C1YA 3GCTF 3CS7A 1TGSZ 1CVWH 1L0ZA 2ZFTA 1EPTC 3B9FH 5DP7A 3RXEA 3KCGH 1O5EH 3P92A 3LIWA 1Z8RA 1QA0A 2ZQ1A 3SORA 5LPFA 1F5KU 4D8NA 1FZZA 1G37A 1GJ6A 3EGKH 1ZYOA 2FI5E 1XVOA 4FUCA 4B2AA 3U69H 1O31A 1C2FA 3SZNA 2Q6DA 1EPTA 4ZKNU 2FWWA 1GI1A 4AFZA 1WQSA 2LNCA 3RP2A 3ZZBA 1E35B 4KTCA 4ISIH 1C5NH 2ANKH 1UTQA 4MG3A 2SFAA 3M5LA 1Z8JB 3GYMA 1DXWA 3CENA 1J17T 2C8ZB 1S0QA 4R0IA 1H1BA 1E0FD 2O8UA 3E3TA 1J16A 1THRH 1P03A 3S69A 1OP8A 1MKXK 1V2WT 3KGPA 1QR3E 1GHAG 1ARBA 1SPJA 4F4OC 1KLJH 5FX6A 1BIOA 1AKSA 2XBWA 5C5OA 2BOHB 4ABIA 5AFYH 3RXQA 4I8HA 1A1RA 1TGCA 1XXFA 3PM3A 1TX7A 3VB7A 3A85A 2OD3B 3M3SA 3BTFE 1SGRE 1EPTB 3UR9A 3KQEA 3KF2A 1AFQB 4YT7H 2VIOA 1TGTA 3TNTA 4NG9H 3T26A 1SG8B 1NPMA 3L3TA 2BLOA 5G4BA 3KQCA 1HUTH 1TPOA 1EAIA 3MMGA 1IQHA 1XUFA 1IQLA 3P8FA 2FDAA 1FN6A 1W7XH 1QJ7B 1L1GA 3CP7A 1D3QB 3LC5A 4Y79A 1P11E 3UPEA 3U1IB 2XBXA 3GDVA 3PLPA 4WY3A 1F5RA 5C2ZA 2PV9B 1P2KA 3LGWA 1HCGA 3H5CB 2ZTZA 2Y82A 1TBZH 4D7FA 2HNTE 2LPRA 2ZU1A 4SGBE 3GY6A 2JETB 5K0HA 3S9AA 1CGIE 1K1LA 3HGPA 3GCTG 1NU9A 4INKA 3SNBA 1GMDG 5GDSH 2XW9A 1TOCB 1TWXB 1ESAA 1DANH 1UTPA 8LPRA 2Z3DA 1EB2A 1MZAA 4UE7H 1C2LA 2P8OC 1UCYH 2H6MA 5FX5A 1L4DA 2FTLE 5C5NA 2UUKB 4BAHB 2RDLA 4J1YA 4MLFB 1RFNA 2QCYA 3OY6U 2G8TA 2FEQH 5CHAB 4BTTB 1W2KH 4YOGA 4H6SB 2HLCA 1Z1IA 4AFUA 1UTNA 2W3KA 1P8VC 1RGQA 1HXFH 2BD4A 2J94A 1SGPE 3AVZA 1TRMA 1TNGA 1MUEB 1C1VH 2GD4B 1OS8A 3ZVCA 2NU1E 1OX1A 4ZMAH 1FDPA 2Z9KA 1VCPA 5EQQA 1AQ7A 4X6MA 2OLGA 1CU1A 1ZHMA 3O8CA 4I8JA 4K8YA 3O8DA 1EATA 1ARCA 2VIVA 1JBUH 7LPRA 3T27A 1FPHH 3UUZA 2EI6A 4NFEA 4ASHA 4X1SU 1S82A 3RU4T 1YM0A 5HXFA 1LPKB 1OXGA 1H8IH 4ABAA 1UVOA 1GVLA 1EUFA 2ALPA 4NGAH 2EA3A 3UIRA 1UO6A 4A6LA 3HGNA 1CHOG 1V2KT 1P3EA 1A5HA 2O8WA 3E8LA 5AVDA 3RC4A 3RXFA 1AFQC 2F9BH 2F9VA 1K28D 1IQFA 3PMHB 2C3SA 3M36A 1TA6A 4X8VH 2AIPA 1N6XA 5FCRA 1LPZB 4X1RU 4AB9A 2P16A 4FUFA 3ZVBA 4CH8B 3ATLA 2ZU4A 1NU7B 1O3FA 3PO1B 2A32A 3W94A 5A09A 3QX5H 3AAVA 3RDZA 1GPZA 1AKSB 4ESTE 3GCNA 3SUGA 3UNSA 4CR5A 2PTNA 3GY3A 2C4FH 2QXHA 2Z3CA 1ESBA 2WINI 4ZXYH 2VVVA 1EP5A 2SGDE 3U8OH 3VB6A 1SL3A 2FX6A 3VGCC 2VIPA 1HAPH 4YZUA 1EKBB 1T8MA 1MQ5A 2PKAB 1DWCH 1TIOA 3SI3H 3Q00A 1QURH 3EA9A 4X8SH 3H7OA 3OU0A 1DE7H 2J92A 4DIIH 1EZUC 1K1MA 1XVMA 2BYAX 2WYGA 1TRYA 1MTVA 2VVCA 3MH4A 2P3UB 3QLPH 5EODA 1HDTH 4K1EA 1C2MA 1LPGB 1N8OB 2ZKSA 2V3OH 4HZHA 1HXEH 1TMBH 1HPGA 1KIGH 3UY9A 2BMGB 5EOKA 1ELTA 4FU9A 3RXBA 1JWTA 1V2VT 1KY9A 3ATWA 1O5CB 2ZDMA 6ESTA 1GJBB 3LOXA 3BIUH 3LKWA 1GI2A 4Q80A 3MO3A 3RXTA 2JH6D 5C3NA 1A2CH 4DURA 1NROH 1YPLH 1A0HB 1BBRE 3MH6A 4FUIA 5GCHF 1OSSA 1GJDB 1P0SH 1TX8A 2A5AA 5H4IB 4NSYA 4CBOA 2ZCLP 4WWYA 2AMPA 1P9SA 1P04A 3F9FA 1GI3A 1YPHE 1ZPCA 1RTFB 3MNBA 1AFEH 1JXPA 1BMMH 1PQ7A 1DITH 3BV9B 5C67A 2G00A 1WQVH 2Y80A 4AX9H 2H9TH 5E0GA 3NCLA 8ESTE 1C5LH 3RLYH 2PTCE 1D9IA 1IHTH 2F9OA 3MNSA 1CBWB 1CA0B 3MOCA 4TY7A 3K9XB 1TBRH 3R0FA 4Y6DA 3SJ9A 5DKMA 4Y0ZE 1GDNA 4UONA 3ZYEA 1A5IA 4DT7B 1NFXA 2W7SA 1TBQH 3BTHE 1ZRBA 3U8TH 1SBWA 2H1UA 1B0FA 2BXUH 1AE5A 1O2IA 4OS7A 3RXHA 4INHA 1SLXB 1O38A 4AG2A 2BM2A 1NRQH 2HVXA 3P70B 4Y0YE 1TNHA 2A7HA 1FN8A 4U30A 3SHAH 1GDQA 2HALA 3F9EA 2W26A 2PUQH 1HJAC 3NZIA 1YLDA 3UREA 2VWLA 4AGKA 4ABJA 2FESH 2BLWA 4AZ2B 2BX4A 1TNIA 5HMAA 1K1JA 2AS9A 3BTTE 2OC1A 1Y3WA 3K2UA 1O5FH 1MKWH 3T62A 4ABHA 1P2NA 5F03A 3TJVA 5LH8A 2WUCA 2AMDA 3ZZ4A 1U6QA 2ZDNA 3DUXH 1ZSKA 1FMGA 4WVPE 3BTDE 4ABDA 1OWHA 1VJAU 4Y8YA 5DG6A 2FTMA 2GMTC 2C8YB 4B71A 4BOHA