1C5ZB

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UROKINASE-TYPE PLASMINOGEN ACTIVATOR)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 52
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5zB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5zB01
1V6DA 3ZVAA 2SGQE 3VEQB 1K1NA 1IQGA 4BAKB 1AWHB 1AHTH 1KXCA 1O36A 2AYWA 1TYNA 2A5KA 1NRPH 2AMDA 1F5LA 2FTLE 3E3TA 1EZSC 1LHCH 4Y6DA 2BQ6B 3TK9A 5EQSA 5JBAS 1A5HA 3SV6A 2A4OA 1SG8B 2EEKA 1GCTB 2OINA 2BXUH 2NU0E 1TFXA 1VGCB 2TGPZ 2TIOA 3ENSB 2UUKB 2GZ7A 1SPJA 2ZGXH 1V2UT 5FCKA 1TOCB 3G01A 2HGTH 1YC0A 3A84A 3W95A 4IN2A 2ZFSA 1XUFA 1S84A 2VIDA 3RC6A 2BLWA 2FEQH 1HAYB 1ELAA 1C5SA 3SW2B 3PWCA 5HXFA 1A5IA 1TALA 5BPEA 5DP3A 2ANKH 2Q6FA 1V2PT 1Z1IA 1VJ9U 5HYOA 3TPIZ 1O38A 1TMBH 2BDHA 2G5NA 4R0IA 1KXBA 2C8XB 2ZDMA 2JH0D 1P09A 3VGCB 1X7AC 5I46H 1O2TA 4JMYA 2BD3A 3A8CA 4CH2B 1TRYA 1Q3XA 1E34B 1V2VT 1SL3A 2ZU2A 3A7VA 2CV3A 5HGGA 1BT7A 1G2MA 2F91A 1F92A 4JYUH 2HRVA 5DP6A 4HGCA 1GMDG 1XXFA 4B1TA 2FYRA 1YCPH 5JDUB 5DGJA 1QY6A 1TQ0B 4ESTE 1C2IA 2BM2A 4KTCA 1QBNA 3D65E 4U2WA 4ZROA 1K9OE 1ELBA 4YESB 1LO6A 4CRGA 1UK2A 1BMAA 5DKMA 1CA0B 2STAE 1QJ1B 2Y5FA 2SGFE 1GMHF 3FP7E 1TWXB 4JK6A 1NT1A 2XRCA 1H9LB 4B75A 8GCHF 1YPMH 1C5ZB 2QV1A 1XUGA 1GL1A 3GY2A 4GAWA 4Y11E 1P04A 2AIQA 1RJXB 1Z6EA 3LH1A 2B9LA 4FU8A 2VJ1A 2BQWB 5CHAB 1NRQH 4CBOA 1EXFA 3GY3A 3U9AH 3T29A 3KN2A 2ANYA 1TX8A 2J92A 1P05A 3LPRA 1PQAA 3Q3KA 3E1XB 3SV7A 1LDTT 1TNKA 4A1XA 4IW4E 1O2PA 2CN0H 3P8FA 1O39A 2ZFFH 3UUZA 3LJOA 3DFJA 5A8ZA 2PW8H 4AB8A 2Z9JA 1LHGH 1O37A 3Q3YA 1DLKB 2A2XH 5AVDA 3H7TA 3RDZA 1ZYOA 2W7UA 1P2MA 3MMGA 3OSYA 4BTIB 1MTWA 1GG6B 1OYTH 3BEUA 3V3MA 3IITA 1HLTH 1UVTH 1K2I1 3F68H 4MVNA 1G3BA 3RXJA 1Y5AT 1F2SE 1BRAA 2GDDA 4BNRA 1KDQB 3PMAB 1QA7A 4FUCA 2O8WA 4I33A 1MKWK 2R9PA 4IMZA 1UTLM 1INCA 3ZZ4A 2CXVA 1A7SA 2R3UA 3KHVA 4XE4A 5L2ZH 1SQOA 1WTGH 2K1QA 1WSSH 1P01A 1Z8RA 1IQIA 3VXEH 4M7GA 2C8WB 3MWIU 1HGTH 2SFAA 3RLWH 1LHFH 1A1RA 1D3QB 2ZP0H 4DW2U 4JYTA 1TNLA 1WCZA 3ZYEA 1XM1A 4FUEA 1QNJA 4Y7BA 1LVOA 2VVCA 3KNXA 1GHAG 2AMPA 2ODQA 4NIWA 3MO9A 1G3CA 3I29A 1O3NA 1S6HA 1V2TT 2XCFA 1O5FH 2SNVA 2A4RA 1HXFH 3BG8A 1K28D 1T8LA 7ESTE 2A7CA 1ID5H 2XC5A 2Z3CA 1OWDA 2J94A 4OS6A 1GJAB 1OS8A 1GBLA 1YCPM 1OSSA 2QIQA 3BN9A 1UTPA 1LTOA 4GSOA 2KAIA 2VIPA 4I8JA 1ZHMA 3RXOA 1WOFA 3UWIA 2FI4E 2HWLB 2PSXA 7LPRA 4O3UA 2AH4X 3MH6A 4KTSA 4AORA 4ABBA 2O8LA 4AGKA 2Z7FE 3U8TH 1JBUH 2FOMB 2ZCHP 1VITG 4O9VA 2FESH 1SMFE 1C2KA 3GYLB 2AMQA 1D6RA 5A0AE 4D9RA 1OX1A 7KMEH 2FZZA 2G5VA 2GZ9A 4X1RU 1ESBA 2BOHB 2RCEA 2WYGA 1JIMA 1SGPE 3SI3H 1V2LT 1SGTA 1FJSA 3SU6A 2FLRH 4ABAA 2Z3DA 3BTHE 2ZECA 3PO1C 4MNXA 3QZQA 1BZXE 3AAUA 3P8GA 3TK6A 1KDQA 4IMQA 1P57B 3TNTA 4FU7A 1AFQB 1GI1A 1OWEA 1IHSH 2FI3E 1F0TA 3BG4C 4GCHG 5L2YH 1AD8H 4LOYH 5E0GA 1KXDA 4Z6AH 3CENA 1GMDF 5ESBA 4E7RG 1MTUA 1HAVB 1P8VC 1GBKA 3RXSA 3RC5A 4YLQH 1SGEE 3BTFE 1WAYB 2W7SA 3AW1A 1K1IA 1O32A 3PB1E 2WPJS 1BHXB 3M61U 1C9TA 1L4ZA 2PTCE 1CA8B 4BAOB 4QT8C 3Q3XA 4OS2A 1PPBH 4B73A 1O35A 1O2JA 3TLOA 5EPNA 2VU8E 3LOXA 4INHA 1CHOG 2A45B 4Y0YE 1ZZZA 1E35B 1K1LA 2LPRA 3RXQA 3BTGE 4NZLA 1Y3XA 1UK3A 1G3DA 1GHZA 3FVFB 1LKAA 5FCRA 4AZ2B 3V7TA 4FVDA 3HGPA 1ACBE 3NXPA 1GHVH 1S85A 1BOQA 2FDAA 1MKWH 3A7TA 2BD5A 1LVYA 1O2ZA 5EODA 2FODA 1W0YH 1V3XA 4MDSA 3GY7A 3SQHE 2ZHEH 5DG6A 4ZH8A 3SV9A 2B7DH 1AVGH 3RXTA 5DP5A 3SNBA 4MLFB 3GCHB 2BY9X 3Q76A 2NU2E 2IJOB 2PV9B 1AGJA 1N8OC 2ZPRA 3VFEA 1V2OT 1UTJA 2UUJB 4OS7A 5CMXH 2ZNKH 3P92A 3BSQA 2GTBA 1AO5A 3LH3A 2OXSA 2P95A 1F0RA 2R3YA 2D1JA 3SNEA 2H9HA 1TGBA 3MTYA 5DP8A 1BTPA 1W8BH 3SQEE 1EJNA 4Z0KA 4Q7YA 4YTAA 1Z6JH 3RUOA 2NWNA 2W3KA 5GPIB 1AZZA 2Z9GA 2ULLA 4NG9H 1P03A 3GISB 1BTWA 3GCOA 3M36A 1PPGE 4AG1A 4I8KA 4BANB 2QN5T 3RU4D 1A5GH 5FX5A 1YPJH 3B8JA 1D3PB 2R2WU 5A0CA 1O3OA 1C5OH 3SGQE 4DIIH 1D9IA 2NU3E 2PKSC 2BHGA 3E16B 4FUIA 1BRUP 1GHAF 4Q7XA 4DJZB 3SGBE 4AFUA 1O33A 1EPTA 1O2RA 1TX6A 3QDZB 2G4UA 4CRDA 3ZZ8A 3D62A 2XBXA 2VIVA 1QJ7B 3A82A 2QY0B 2OBQA 1O3LA 5LGOA 2A2QH 4YM9A 4X1PU 3I77A 3UFAA 1AKSA 1C5VA 4HFPB 2A31A 1RTFB 1O2LA 2ZHDA 1CHGA 1GWAA 2V35A 3RM0H 1YLDA 4J2YB 1G37A 3KQDA 1ETRH 2BY6X 1VJAU 3PV4A 4Y76A 2I6QA 1CQQA 5LH8A 1O3BA 1EUFA 1NRRH 2W5EA 1NROH 3P8OA 1AFEH 2AGGX 3KGPA 3MHWU 1VITF 3SUGA 1IQKA 1MQ6A 5FHTA 4X6PA 4ZKSU 2PKAB 1NO9H 3RXKA 5EXNA 2JETC 2WV4A 1SGNE 1EAUA 3UIRA 2PUQH 4FUHA 1AUJA 4CR5A 4CBNA 3CP7A 1GMHG 1ZOMA 3M3VA 1S81A 3QN7A 2BD4A 2BY7X 4JZIA 1BBRE 2XBYA 1C5QA 3MYWA 1V2MT 2AGEX 3SNDA 4TWWA 5EXMA 1IHTH 4ZHLU 3OY6U 4AOQA 4E7NA 1QTFA 4YOJA 1YP9A 3R3GB 1EOLA 2VINA 3D49H 3SV2H 1P2OA 2QXIA 2BD9A 1GI7B 1QBVH 3M5LA 2NU4E 5F8ZA 3RU4T 2AFQB 3FP6E 4FUJA 1GPZA 3NPSA 5IDKA 1V2KT 3GY8A 1C5LH 3E6PH 2ZF0H 4GPGA 1FAXA 2PGBB 2GCHF 4SGAE 2BQ7B 1AB9B 2C8YB 3RU4E 3UY9A 1Y8TA 2H1UA 1HJ8A 3K9XB 1CT4E 1MBQA 2FOGA 5FBIA 1C1PA 1W11U 4K69A 4WXIA 1T4VH 2J95A 2PGQB 3MH4A 2P8OB 1GJ7B 1CHOF 3ZZ7A 2WPHS 4GHTA 2GT7A 2Z6BD 2BD8A 3BTKE 4WF8A 2WUBA 2HVXA 1VCQA 3ZZDA 2TGTA 2ZU4A 1EAXA 4HZHA 1OKXA 2GV6A 3BTME 1GBJA 2F83A 3HK3B 1ZGVA 1C1WH 2RA0A 2J2UA 3DT0H 1UHBB 4FVBA 1GJBB 1XMNB 3SNCA 1TMTH 5DJ7A 4ZKNU 1EJAA 5C20A 1Y3UA 4A92A 1ABJH 3K65B 2H5DA 1VCPA 2IPHA 3M7QA 5TCCA 4LXBH 4YT6H 1TIOA 1AZ8A 2P94A 1BQYA 2EI7A 4I31A 1O2HA 4KKDA 1H4WA 4UE7H 2VGCB 3A7YA 1W10U 1T31A 3D23A 4RKOB 9LPRA 4ZMAH 2EI6A 4K2YA 1TAWA 3PMHB 5JPMH 1P2QA 3LGIA 4UFGH 2ODPA 2J34A 4ZAEA 3LC3A 4AG2A 1THRH 1QL8A 1C1TA 3QO6A 2G8TA 4H6TA 1LQDB 3ATLA 5EPYA 1H9HE 4YO9A 1MCVA 3ZZ3A 6ESTA 2ZFQH 3UPEA 1GJCB 3RMNH 5EW2H 1SGDE 2BDYA 2XC0A 3Q77A 4K60A 4WVPE 1GL0E 1OPHB 3MU8A 1Z8IB 2Z94A 2QA9E 1HV7A 1DE7H 3S69A 4IGDA 1CBWB 2B8OH 5F6MA 3T2NA 3VXFH 2FMJA 5TCAA 1XVOA 2A4QA 2F9UA 1K1OA 1MAXA 3LONA 3WY8A 1C5PA 4X6MA 2O9QA 1MTNC 1CGIE 2OUAA 3K6ZA 2C3SA 4INLA 4CRAA 1O5BB 1O2XA 1YPLH 3S9BA 1GI6A 4NFFA 4IC5A 1JRSA 3BEFB 2ZU5A 1PPFE 2FOBA 2XWBI 3AAVA 2XXLA 2OQ5A 2RG3A 4CREA 1SOTA 1SFIA 1WQVH 1ETTH 2ZGCA 1IQMA 3SZNA 3UTUH 1Z71A 3ZVCA 1SGQE 3R0FA 1O2QA 1CT0E 1S0RA 2EC9H 2BY8X 1Y5UT 1QR3E 1O5CB 1F5KU 4K1SA 3UOPA 2ZC9H 2ALPA 4OS4A 3F9EA 3PLBA 2VWLA 4AGJA 2WUCA 3M5OA 1HYLA 1F7ZA 2TRMA 1O5GH 1D6WA 1JWTA 3SUDA 4X0WU 3EE0B 4TY7A 4CRFA 4WH6A 1GGDB 1DOJA 5ABWA 1W2KH 1A0HB 1QFKH 4UFEH 3ATWA 2FOFA 2V0BA 5JBCS 4MG3A 1SLXB 3QK1A 4VGCB 1HB0B 1NRNH 3RXAA 3MNSA 1C2LA 5JYIA 5LPFA 1RD3B 3HK6B 1MUEB 3Q00A 4A6LA 3RXLA 3F6UH 1GMCG 1FY1A 3EYDA 3BTQE 1ZHRA 3RM2H 1SGYE 1FAKH 2EI8A 3P17H 1G2LA 1LHEH 3MO6A 4D9QA 1DWEH 2F3CE 9ESTA 1TE0A 5A8XA 4CHAC 4AN7A 3LU9B 1C1QA 1GI0A 1C1RA 5G4BA 5A09A 1C2HA 5ESTE 2GCTB 3UNRA 1DUAA 1O3IA 1L1NA 1HBTH 4ISHH 5AF9H 1C2MA 4RN6A 3KL6A 1FQ3A 3SNAA 1T8NA 1IQJA 2FTMA 1NU7B 1DSUA 4WMFA 2ANMH 3ZZBA 2XNIA 2HPPH 1GCTC 4KGAA 1LPGB 1WYKA 1VGCC 2QXJA 2QCYA 1TGSZ 2HALA 3GOVB 2P3FH 1ZTKA 4X8TH 5FXLA 3O8BA 4U30A 1ZPBA 3LIWA 2V6NA 1SLVB 1T7CA 3RXMA 1UTKA 1QRXA 2UUYA 1MH0A 1J16A 2PFEA 1ZMNA 3SI4H 3VB6A 1ZPZA 3PWBA 3S7KB 1ZSLA 1O5AB 1DX5M 4A1VA 5A8YA 2D8WA 2GP9B 3TH4H 2CHAB 4BTTB 2BDAA 5C67A 3JZ1B 1XKBC 1L0ZA 1K1PA 1GJDB 2Y5GA 4ABEA 3GY4A 4YOGA 3RXHA 1AWFH 3DFLA 1ZJKA 2DUCA 5AHGH 2WPLS 2C93B 3VGCC 4ABFA 1FIZA 1TNJA 2WINI 2ZGBH 4FUGA 2GD4B 1P10A 2GMTC 1KSNA 1ELVA 4GUXA 4AFSA 3E91A 5LPEA 3UWJH 1YBWA 3A83A 1EASA 1QGFA 4MNYA 1N8OB 3UREA 4TPIZ 4JZDH 3NWUA 1UTMA 5EXLA 2VH6A 2FWWA 4ISNA 1THSH 3FANA 2G4TA 1L4DA 3TU7H 5L6NH 2ZQ2A 1A46H 1NM6A 2BDBA 4H6SB 1P2KA 1W0ZU 3EAJA 3VB7A 4ZXYH 1L2EA 4F4OC 4X2WA 1GVLA 2XTTB 3FP8E 4LZ4B 4TYDA 1CO7E 1NN6A 4JK5A 4DG4A 1AVXA 2FS9A 3E90B 1C2DA 4XFQA 1H1BA 1S6FA 3GY6A 1QRZA 4ABDA 1DXPA 1TRMA 3SJ9A 2WV5A 2XC4A 2AEIH 5C1UA 3MNCA 2BB4A 3OYPA 1O3HA 1HIAB 2CGAA 2P3UB 2ZA5A 4MPVA 3ZVDA 4MNWA 3LGWA 4LK4A 2Z9LA 4DOQA 1V2ST 3BF6H 2ILNA 1IQEA 4FUDA 4X2VA 4JZEH 1P3EA 5F03A 3O8RA 2PKSB 4NA9H 1FPCH 6CHAC 2ZO3H 4K8BA 3A8AA 1GHBG 5CHAC 1FY5A 1B0FA 2ZEBA 2BVXH 1O2IA 1ZHPA 4AB9A 3ZZ5A 2OC7A 1Z1JA 1CGJE 3ZYDA 1BMMH 1FIWA 2CF9H 2ZQ1A 1EKBB 4OS5A 1LKBA 1ANDA 2P93A 5C5NA 1QJ6B 3ZVEA 3O8CA 3QGNB 2ODYB 2GCHG 1CE5A 1HJAC 1GI8B 1ZPCA 1FUJA 1QA0A 2BZ6H 4ABHA 1O2WA 2H9EH 2R0LA 1BTYA 5AFYH 2Q6GA 1NY22 8KME2 1IQNA 1SQAA 2PUXB 4WMEA 1ARBA 3ATIA 4FU9A 3M5NA 1WUNH 2PR3A 5GIBA 3PTBA 3ELAH 1GBMA 1HAGE 1MKXK 4WXVA 2FOEA 3S7HB 1FNIA 2FX4A 3QUMP 1YKTA 2GZ8A 1HAOH 1C1NA 1O31A 1E36B 4NWKA 1CVWH 1C2FA 3BTTE 2JETB 4NSYA 1W7GH 1AE8H 2V3OH 1J15A 1GBIA 1ZTJA 4Y10E 1C2JA 1XUHA 2BX3A 4CR9A 5C1XA 3HGNA 2O8UA 1VR1H 3NZIA 1IQFA 1A0LA 1DXWA 2VH0A 4ISOA 1JRTA 1XX9A 2SGDE 3URDA 3P6ZB 1UTOA 3A81A 3H7OA 3SGAE 1TNGA 2B5TB 1AY6H 1QURH 5J4QA 1HUTH 4AYYB 1JIRA 1Y3WA 3SN8A 1QL7A 1GMCF 2BX4A 2VIOA 6LPRA 1HFDA 3LJJA 4X1NU 1DUEA 1N1LA 2R2MB 1SQTA 1MAYA 5GXPA 1ANCA 2Y81A 4IC6A 2V3HH 1PPHE 2ESTE 4YZUA 2FP7B 2OQUA 1QB1A 3GICB 3RXDA 2UWLA 1KTSB 4UFFH 3QGJA 3QZRA 8LPRA 5IYTA 2LNCA 5GCHG 1TX7A 2ZU1A 4MQAA 5JBTA 2C90B 1NESE 1DDJA 1P2JA 1Y59T 4DCDA 1DWBH 1UO6A 3RMOH 3ZZ9A 2G81E 1P02A 3A88A 2BDCA 1LPKB 5AFZH 1PJPA 3RP2A 4B71A 1OP2A 2O8MA 1BTZA 1GCDA 1GDQA 1JXPA 1WU1A 2SGPE 1C4U2 1YM0A 4I32A 4NWLA 1HNEE 2VIQA 4YT7H 1GI2A 1T8MA 1HAVA 1BIOA 2A7JA 3RXEA 2SNWA 1C5TA 3LGTA 1QHRB 1RTKA 2HOBA 1UTNA 1TRNA 1A0JA 1RFNA 1ESAA 4BXSA 1SSXA 1ZSKA 1FN6A 2YOLA 3NKKA 2BVSH 2QC2A 1G3EA 4BAHB 4B76A 2ZKSA 6GCHG 1ELCA 2FM2A 2F9VA 3T27A 5E0JA 4GLYA 2BMGB 1GJ5H 4UEHH 3L33A 4HTCH 3HATH 3KCGH 3MNBA 1TGTA 1QCPA 1RGQA 4TPYA 3MFJA 7GCHG 3A8BA 2ZZUH 3CS0A 3MU4A 1D4PB 4RKJB 3VB4A 1ELGA 1K1MA 2XBVA 1FXYA 4DT7B 2G52A 1NFYA 1BITA 1O2KA 3NK8A 3A89A 1EX3A 4JYVH 1MCTA 3SV8A 3I78A 2PWXA 1V2QT 1AU8A 1EPTC 1HCGA 2Y80A 2PSYA 2ZDVH 4NGAH 3K6YA 4CH8B 1SFQB 2PHBA 1N6YA 2HNTC 3OY5U 2VVUA 1TBZH 3S9CA 1FI8A 3U8OH 3DA9B 1BUIA 2XWAA 1A2CH 1QIXB 1NZQH 4X6OA 1MKXH 1O3DA 1UJ1A 4ZHMU 4ZKRU 2Y7ZA 3STJA 1EATA 1OWIA 1ZSJA 1FY3A 1GHBF 1D3TB 3SU0A 1DY9A 4AFQA 2WPIS 3RMMH 1BHXF 3QLPH 1SB1H 2GX4A 3A86A 3LGUA 1GBDA 2HNTF 3HPTB 1J17T 1P2NA 1QQUA 1ZR0A 4GHQA 1Q2WA 2STBE 1O2SA 1DITH 1P2IA 3UR9A 3BTDE 1GVKB 2F9PA 1DSTA 2C4FH 3RXVA 1EB2A 1G9IE 4TWYA 1GDUA 1MQ5A 1MMJN 1O5DH 1H8DH 3RXRA 2TPIZ 1GHWH 1YCPK 1C5UA 4U01A 5LPRA 3HKJB 1GI5A 1FZZA 2I6SA 1EZXC 3LGYA 1SLUB 2FYQA 4AFZA 5HM2A 1NFWA 1QQ4A 3BIUH 5ETXA 2G00A 4ASHA 2BY5X 4X8VH 1ELFA 1RIWC 2O8TA 1TBRH 3RC4A 4IBLH 4B74A 5C2ZA 1GI3A 3TH2H 3ZZCA 1Z8JB 3QTOH 4NFEA 1O3PB 1DS2E 5C5OA 3TITA 1TOMH 5GDSH 1TMUH 1FPHH 2ZDNA 1MU8B 1KXFA 2ZPQA 4NIXA 3E0NB 2GKVE 3ODFA 2HNTE 1KXAA 3KEEA 1NFUA 3RXBA 3S9AA 2VWOA 2PKAA 3M3TA 3QTVH 2TGDA 1P11E 1UTQA 3MO3A 5T6FA 1EJMA 1EP6A 3A7WA 1GI4A 4D7FA 1LQEA 3AW0A 3SOSA 3A7ZA 4FUFA 1U6QA 4X1SU 3TJNA 1O5EH 5DO4H 3SUEA 2OD3B 1Y3VA 2FOAA 5FPTA 3A7XA 4GVUA 3ITIA 4MTBA 5GCHF 1GHXH 1HJ9A 2WPMS 3NUMA 3SU3A 3PM3A 1AUTC 3RXFA 1EB1H 1SOZA 1GI9B 2Y82A 1TA2A 1HAIH 2XW9A 4CHAB 1G30B 3MH5A 1THPB 4SGBE 2F9NA 2YNBA 2ZG0H 3GY5A 1ZJDA 5EU8A 2P59A 3ESTA 4O03A 1BMNH 1C5NH 3VPKA 1C2EA 3ATKA 2PLXA 1ZRKA 1WBGB 3SHAH 1O2UA 1H9IE 5E0HA 1V2NT 1P06A 1GJ9B 1A61H 4UONA 3M7TA 1QB6A 2J4IA 1TA6A 3BEIB 2YNAA 1BJUA 1BMLA 1C5XB 1CSOE 2ZDAH 2VB0A 1EQ9A 1P12E 4E05H 2FPZA 4ISIH 3TK5A 1RTLA 2FOCA 4XOJA 6GCHF 1HAPH 3FFGA 1C1OA 1BBRK 2P16A 3RXUA 1ZTLA 1UVUH 2A32A 3UNQA 2FLBH 1AE5A 1DVAH 1HRTH 1PPCE 5FPSA 4XDEA 1RS0A 3SU5A 1H8IH 1FN8A 3UQVA 1C2GA 4WMDA 1T8OA 2R0KA 1S5SA 3SUFA 4F49A 1DANH 3UQOA 3VB5A 4DVAU 2GT8A 1EOJA 1NC6A 7GCHF 5EGMA 4H42U 5EQQA 1J14A 1SHHB 1DICA 1O2GH 1EZQA 2DE9A 1O3EA 1ORFA 2GMTB 1UHBA 1YPHC 1FY4A 3PYHA 3U1JB 1O2YA 1OXGA 3ZV9A 1GBTA 1AB9C 1LVBA 1TPOA 3SHCH 1J9CH 2UWPA 2ZU3A 3KF2A 1KLJH 5FPYA 3VB3A 5HM9A 1P3CA 3OU0A 3DD2H 2F9OA 2FXRA 1FLEE 3EQ0H 1QL9A 4KP0A 2B0FA 1AIXH 3SJOA 3PMJA 3BTEE 1KLIH 2P8OC 2CF8H 1C5RA 2QF0A 1AQ7A 2BXTH 2ZIQH 1BTHH 4Q80A 3PROA 2ZHFH 2PTNA 4ABIA 1CGHA 3U8RH 4Q2KA 5SGAE 1OWHA 2IN2A 2FS8A 1HDTH 4O3TA 1KTTB 4E06H 2QYIA 1DFPA 3DHKH 3F9GA 4X2YA 4R8TB 1C5WB 3RMLH 3ZVGA 1L1GA 3MH7A 4NIVA 4IS5A 2GDEH 1O3JA 3A8DA 2H9TH 1MZDA 1LCYA 1PQ8A 2BZAA 4ISLA 3AASA 5CE1A 1B0EA 6CHAB 3JZ2B 3PO1B 2FOHA 3NCLA 3S0NA 4OS1A 1G36A 4PROA 5EOKA 2KAIB 3M35A 1OP0A 2THFB 1DM4B 1UMAH 1K21H 3C27B 2ANWA 1UVOA 2ZPSA 3BG4B 2VGCC 1O2VA 2P3TB 1ZMJA 4WY3A 3GYMA 5H4IB 1V2RT 4NZQA 2VNTA 1HJAB 1QBOA 1W12U 2C8ZB 1SGIB 5JB9S 1P0SH 1MTSA 1F0SA 1F5RA 1YPHE 5EW1H 1NPMA 1TQ7B 3W94A 8ESTE 2A4GA 1FY8E 1YPGH 4YLUA 2XBWA 2Y6TA 1SR5C 4UD9H 3T26A 1FMGA 2ZHWH 1UK4A 5DP7A 2Y7XA 1B5GH 1C1VH 2W26A 5B6OA 1TNHA 2J9NA 1FV9A 2BDIA 1CU1A 3PTNA 3DUXH 2OC0A 3T25A 4BAMB 2TBSA 3SJ8A 1W7XH 3L3TA 4NCYA 3GDUA 1LPZB 3LKWA 4NA8A 1OWKA 2WYJA 4ABGA 1O3CA 1AVWA 1CBWC 4DIHH 3A80A 3RXGA 4K1TA 1TB6H 3SU4A 1UCYE 2ZTYA 4AYVB 1IAUA 1S0QA 4U32A 1K22H 1XXDA 1E38B 4X8SH 1C5YB 1GBBA 1XKAC 1TONA 1ZGIA 2AERH 3KQEA 4BTUB 1MU6B 1S83A 2VWMA 4BOHA 1GBFA 1Z8GA 4Y79A 2JKHA 3QWCH 2BLQA 3P70B 4THNH 5C1YA 1O3AA 1BBRH 2UWOA 1E37B 1EAIA 2A5IA 3L6PA 3OTJE 2XCNA 3ZVBA 1O34A 2UUFB 4Y8YA 1YYY1 3EA7A 2G55A 1S82A 4MNVA 5DP4A 4I7YH 3PLPA 1XUIA 2RDLA 3P8NA 1HPGA 1PYTD 1PPZA 1YLCA 3ZZ6A 4KELA 1LMWB 4XBBA 4OGXA 2Z9IA 3RLYH 1CA0C 2GGVB 3EDXB 5JBBS 2DE8A 2H2ZA 1ZRBA 1ABIH 4I8HA 5DP9A 3QX5H 1VITH 3T28A 2JH5D 2ZCKP 2EA3A 4H4FA 1EP5A 2H5CA 5DPAA 4A7IB 1O30A 3FZDA 3E0PB 2BTCE 4I8GA 1OOKB 3M7UA 1GGDC 2A7HA 2H6MA 5PTPA 1O0DH 4BXWA 1UVSH 1BA8B 1BJVA 1BDAA 1O3GA 2M5TA 4JZ1A 3TGIE 3CS7A 3V12A 4ZXXH 4DURA 1PYTC 4VGCC 1MD8A 1M9UA 4ZHAA 3KQCA 3SBKA 1CT2E 1GBEA 3UOUA 4X8UH 4DGJA 1HAXB 5T6DA 4XBCA 1KY9A 1ANBA 1DWDH 4IN1A 3B9FH 1W14U 3ODDA 4MPWA 3GCTG 2ZTXA 3A85A 1C5MD 2ALVA 2J38A 3V13A 2GCTC 1GG6C 1FDPA 1XUKA 2BLOA 3MU5A 4KTUA 4RSPA 3N7OA 4WWYA 3MU1A 4Y71A 2G51A 1TPAE 1HXEH 3SU1A 5EQRA 1G32B 1NRSH 5BRRE 1EPTB 4D76A 1W13U 1V2JT 5A2MH 1TGCA 2ZFTA 1C9PA 3IG6B 4JZFH 3GCNA 1MBMA 3GDSA 1QB9A 4XSKU 1PFXC 5F8TA 1K1JA 1HAZB 5E2OA 1BTUA 1J8AA 1SHYA 2JH6D 2ZHQH 1AKSB 5GJ4B 1MD7A 3V0XA 3UNSA 5T3HA 1O3FA 1O3MA 1EZUC 2F9BH 1C1UH 2CHAC 1TPSA 3LC5A 2Y5HA 4NA7A 4OGYA 4D8NA 4DY7B 3U1IB 1W3CA 1PQ5A 1HAHH 1HIAA 1SC8U 1UCYK 3LT3A 1F0UA 5T6GA 1BTXA 4YOIA 3C1KA 1C4Y2 2VIWA 1BCUH 1OYQA 3SU2A 4J1YA 2QXGA 1FONA 4ABJA 4Y8XA 1RRKA 2OBOA 1SGFG 2BLVA 1JOUB 1O3KA 1DPOA 1A3EH 4CRCA 2AIPA 2ASUB 5E2PA 3TVJB 2GVFA 1P9UA 2OC8A 1WQSA 2XYAA 4K3JA 3T5FH 5FAHA 2AS9A 5DK1A 4CRBA 3A87A 1V2WT 3TIUA 2HLCA 4D7GA 1C4V2 3M5MA 4A1TA 5GWZA 1MZAA 2NU1E 2FIRH 1RIWB 4X6NA 1ZMLA 1A4WH 3T62A 1BRBE 2A5AA 3MNXA 1YPEH 5K0HA 1O2OA 2TGAA 2ZCLP 3ATMA 5E8EH 2Z3EA 2ZDLA 3U98H 1AI8H 2ZWLH 3KQBA 1KIGH 4MPUA 1JMOH 1DT2A 2OP9A 1YGCH 2OTVA 2D26C 3EGKH 4B2BA 1TABE 2QXHA 1ESTA 4A5TS 4Y7AA 3AVZA 1GBAA 5FX6A 1TPPA 1VZQH 3SORA 1P9SA 3TNSA 3K2UA 4WH8A 1AFQC 1AN1E 1GVZA 4B2AA 4BAQB 1ELEE 1BRCE 4X2XA 5C3NA 2BD2A 3E8LA 4JCNA 1NU9A 1NFXA 5A0BA 1IQHA 3TH3H 4UFDH 1C1MA 1N6XA 1D3DB 1VCWA 1QRWA 2FX6A 3STIA 1IQLA 1YPKH 4FUBA 2ZDKA 5TJXA 3GDVA 1MTVA 2FI5E 1GBHA 2ZGJA 3LGVA 2OCVB 3BV9B 5EG4A 3BIVH 1SBWA 3EA8A 1WV7H 4XBDA 5F8XA 1GHYH 2Z9KA 3F1SB 1ANEA 2VWNA 3O8DA 2ZFPH 5K7RA 1EAWA 1YF4A 3KIDU 1XUJA 1RXPA 5I25A 3RXIA 1NTPA 3B23B 1XVMA 1SLWB 3F9HA 2Q1JA 3ZVFA 3URCA 3FAOA 2QF3A 3TGKE 2BOKA 1TGNA 2HPQH 1Z7KA 4WJG2 8GCHG 2A1DB 1GJ4H 1DLEA 1MTNB 3TJOA 2RA3A 1O2MA 1OWJA 1ETSH 4NIYA 3HKIB 3H5CB 1UVPA 2IOTA 4INKA 2VVVA 1WTHD 2OLGA 1IOEA 1GBCA 2SGEE 3PMBB 4Q7ZA 1GDNA 2BDGA 1PPEE 3GCHC 3M3SA 2SGAA 4Y0ZE 1TBQH 2Q6DA 3RXCA 1SGCA 1DWCH 1SGFA 2CJIA 3GCTF 4ZUHA 3SJIA 3ZZAA 1TLDA 4GCHF 4B2CA 2ZI2H 1Y3YA 2A0QB 1B7XB 1E0FD 2WPKS 1LVMA 1TNIA 1KLTA 4TY6A 1KYNA 1ZLRA 3MI4A 2FO9A 1KXEA 1SVPA 1UCYH 1C1SA 2ZFRH 1Y5BT 3F9FA 3SO3A 5L30H 2QGRA 4K8YA 4I8LA 2BD7A 2W3IA 3M37A 4Y8ZA 3P95A 1T32A 3OX7U 2GV7A 1T4UH 1GJ8B 1Q31A 3TJUA 4AX9H 2BYAX 2OC1A 1A3BH 2ZGHA 3IWMA 3SJKA 2CMYA 3MU0A 2ZTZA 3MOCA 1SGRE 1ELTA 1ELDE 4UDWH 2AGIX 3TJVA 3EA9A 4X1QU 3RXPA 3UR6A 3BTWE 4HI3A 4FXGH 4K5ZA 2BVRH 4ZKOU 1AMHA 3TGJE 1PQ7A 2D2DA 1SI5H 4MPXA 1OP8A 1DY8A 4NSVA 4K1EA 5FBEA 1ARCA 2QAAA 5JB8S 1LHDH 3U69H 1GJ6A 3FZZA 5J4SA 1BB0B 1NS3A 3PLKA 1L1JA 3LDXH 4O97A 4LZ1H 5HMAA 3ZV8A 1O2NA
chains in the Genus database with same CATH superfamily
1V6DA 3ZVAA 2SGQE 3VEQB 1K1NA 1IQGA 4BAKB 1AWHB 1AHTH 1KXCA 1O36A 2AYWA 1TYNA 2A5KA 1NRPH 2AMDA 1F5LA 2FTLE 3E3TA 1EZSC 1LHCH 4Y6DA 2BQ6B 3TK9A 5EQSA 5JBAS 2RFKC 1A5HA 3SV6A 2A4OA 1SG8B 2EEKA 1GCTB 2J97A 2OINA 2BXUH 2NU0E 1TFXA 1VGCB 2TGPZ 2TIOA 3ENSB 2UUKB 2GZ7A 1SPJA 2ZGXH 1V2UT 5FCKA 1TOCB 3G01A 2HGTH 1YC0A 3A84A 3OFND 3W95A 4IN2A 2ZFSA 1XUFA 1S84A 2VIDA 3RC6A 3KQ5A 2BLWA 2FEQH 1HAYB 3F2HA 1ELAA 1C5SA 3SW2B 3PWCA 5HXFA 1A5IA 1TALA 5BPEA 5DP3A 2ANKH 2Q6FA 1V2PT 1Z1IA 1VJ9U 5HYOA 3TPIZ 1O38A 1TMBH 2BDHA 2G5NA 4R0IA 1KXBA 2C8XB 2ZDMA 2JH0D 1P09A 3VGCB 2LELA 1X7AC 5I46H 1O2TA 4JMYA 2BD3A 3A8CA 4CH2B 1TRYA 1Q3XA 1E34B 1V2VT 1SL3A 2ZU2A 3A7VA 2CV3A 5HGGA 1BT7A 1G2MA 2F91A 1F92A 4JYUH 2HRVA 5DP6A 4HGCA 1GMDG 5FL7D 1XXFA 4B1TA 2FYRA 1YCPH 5JDUB 5DGJA 1QY6A 1TQ0B 4ESTE 1C2IA 4TSFD 2BM2A 4KTCA 1QBNA 3D65E 4U2WA 4ZROA 1K9OE 1ELBA 4YESB 4XRNA 1LO6A 2XNDD 4CRGA 1UK2A 1BMAA 5DKMA 1CA0B 2STAE 1QJ1B 2Y5FA 2SGFE 1GMHF 3FP7E 1TWXB 4JK6A 1NT1A 2XRCA 1H9LB 4B75A 8GCHF 1YPMH 1C5ZB 2QV1A 1XUGA 1GL1A 3GY2A 4GAWA 4Y11E 1P04A 2AIQA 1RJXB 1Z6EA 3LH1A 2B9LA 2J5UA 4FU8A 2VJ1A 2BQWB 5CHAB 1NRQH 4CBOA 1EXFA 3GY3A 3U9AH 3T29A 3KN2A 2ANYA 1TX8A 2J92A 5EJZA 3WW7A 1P05A 3LPRA 1PQAA 3Q3KA 3E1XB 3SV7A 1LDTT 1TNKA 4A1XA 1KMHB 4IW4E 1O2PA 2CN0H 3P8FA 1O39A 2ZFFH 3UUZA 3LJOA 3DFJA 5A8ZA 1E79D 2PW8H 5C0TA 4AB8A 2Z9JA 1LHGH 1O37A 3Q3YA 1DLKB 2A2XH 3FKSD 5AVDA 3H7TA 3RDZA 1ZYOA 2W7UA 1P2MA 1K0HA 3MMGA 3OSYA 4BTIB 1MTWA 3F2FA 1GG6B 1OYTH 3BEUA 3V3MA 3IITA 1HLTH 1UVTH 1K2I1 3F68H 4MVNA 1G3BA 2EY4C 3RXJA 1Y5AT 1F2SE 1BRAA 2GDDA 5T1VA 4BNRA 4F48B 1KDQB 3PMAB 1QA7A 4FUCA 2O8WA 4I33A 1MKWK 2R9PA 4IMZA 1UTLM 1INCA 3ZZ4A 2CXVA 1A7SA 2R3UA 3KHVA 4XE4A 5L2ZH 1SQOA 1WTGH 2K1QA 1WSSH 1P01A 1Z8RA 1IQIA 3VXEH 4M7GA 2C8WB 3MWIU 1HGTH 2SFAA 3RLWH 1LHFH 1A1RA 1D3QB 2ZP0H 4DW2U 4JYTA 1TNLA 1WCZA 3ZYEA 1XM1A 4FUEA 1QNJA 4Y7BA 1LVOA 2VVCA 3KNXA 1GHAG 3OE7D 2AMPA 2ODQA 4NIWA 5C0UA 3MO9A 1G3CA 3I29A 1O3NA 1S6HA 1V2TT 2XCFA 1O5FH 2SNVA 2A4RA 1HXFH 3BG8A 1K28D 1T8LA 7ESTE 2A7CA 4Z1MD 1ID5H 2XC5A 2Z3CA 1OWDA 2J94A 4OS6A 1GJAB 1OS8A 1GBLA 1YCPM 1OSSA 2QIQA 3BN9A 1UTPA 1LTOA 4GSOA 2KAIA 2VIPA 4I8JA 1ZHMA 3RXOA 1WOFA 3UWIA 2FI4E 2HWLB 2PSXA 7LPRA 4O3UA 3WWBA 2AH4X 3MH6A 4KTSA 2WSSD 4ABBA 4AORA 2O8LA 4AGKA 2Z7FE 3U8TH 2V7QD 1JBUH 2FOMB 2ZCHP 1VITG 2RDEA 4O9VA 2FESH 1SMFE 1C2KA 3GYLB 2AMQA 1D6RA 5A0AE 4D9RA 1OX1A 7KMEH 2FZZA 2G5VA 2GZ9A 4X1RU 1ESBA 2BOHB 2RCEA 2WYGA 1JIMA 1SGPE 3SI3H 1V2LT 1SGTA 1YY3A 1FJSA 3SU6A 2FLRH 4ABAA 2Z3DA 3PRDA 2GJGA 3BTHE 4I86A 2ZECA 3PO1C 4MNXA 3QZQA 1BZXE 3AAUA 4FOUC 3P8GA 3TK6A 2IPQX 1KDQA 4IMQA 1P57B 3TNTA 4FU7A 1AFQB 1GI1A 1OWEA 1IHSH 2FI3E 1F0TA 3BG4C 4GCHG 5L2YH 1AD8H 4LOYH 5E0GA 1KXDA 4Z6AH 3CENA 1GMDF 5ESBA 4E7RG 1MTUA 1HAVB 1P8VC 1GBKA 3RXSA 3RC5A 4YLQH 1SGEE 3BTFE 1WAYB 2W7SA 3AW1A 1K1IA 1O32A 3PB1E 2WPJS 1BHXB 3M61U 1C9TA 1L4ZA 2PTCE 1CA8B 3FO8D 4BAOB 4QT8C 3Q3XA 4OS2A 1PPBH 4B73A 1O35A 1O2JA 3TLOA 5EPNA 2VU8E 3LOXA 4INHA 1CHOG 2A45B 4RT1A 4Y0YE 1ZZZA 1E35B 1K1LA 2LPRA 3RXQA 3BTGE 4NZLA 1Y3XA 1UK3A 1G3DA 1GHZA 3FVFB 1LKAA 5FCRA 4AZ2B 3V7TA 4FVDA 3HGPA 1ACBE 3NXPA 1GHVH 1S85A 1BOQA 2FDAA 1MKWH 3A7TA 2BD5A 1LVYA 1O2ZA 5EODA 2FODA 1W0YH 1V3XA 1YWUA 4MDSA 3GY7A 3SQHE 2ZHEH 5DG6A 4ZH8A 3SV9A 2B7DH 1AVGH 3RXTA 5DP5A 3SNBA 4MLFB 3GCHB 2BY9X 3Q76A 2NU2E 2IJOB 2PV9B 1AGJA 1N8OC 2ZPRA 3VFEA 1V2OT 1UTJA 2UUJB 4OS7A 5CMXH 2ZNKH 3P92A 3BSQA 2GTBA 1AO5A 3LH3A 2OXSA 2P95A 1F0RA 1MABB 2R3YA 2D1JA 3SNEA 2H9HA 1TGBA 3MTYA 5DP8A 1BTPA 1W8BH 3SQEE 1EJNA 2WZQA 4Z0KA 4Q7YA 4YTAA 1Z6JH 3RUOA 2NWNA 2W3KA 5GPIB 1AZZA 2Z9GA 1UW7A 2ULLA 4NG9H 1P03A 3GISB 1BTWA 3GCOA 3M36A 1PPGE 4AG1A 4I8KA 4BANB 2QN5T 3RU4D 1A5GH 5FX5A 1YPJH 3B8JA 1D3PB 2R2WU 5A0CA 1O3OA 1C5OH 3PRBA 3SGQE 4DIIH 1D9IA 2NU3E 2PKSC 2BHGA 3E16B 4FUIA 1BRUP 2WHXA 1GHAF 4Q7XA 4DJZB 3SGBE 4AFUA 1O33A 3U28C 1EPTA 1O2RA 1TX6A 3QDZB 2G4UA 4CRDA 3ZZ8A 3D62A 2XBXA 2VIVA 1QJ7B 3A82A 2QY0B 2OBQA 1O3LA 5LGOA 3DCLA 3KYGA 2A2QH 4YM9A 4X1PU 3I77A 3UFAA 1AKSA 1C5VA 4HFPB 2A31A 1RTFB 1O2LA 2ZHDA 1CHGA 1GWAA 2V35A 3RM0H 1YLDA 4J2YB 4Q4LA 1G37A 3KQDA 1ETRH 2BY6X 1VJAU 3PV4A 4Y76A 2I6QA 1CQQA 5LH8A 3OTPA 1O3BA 1EUFA 1NRRH 2W5EA 1NROH 3P8OA 1AFEH 2AGGX 3KGPA 3MHWU 1VITF 3SUGA 1IQKA 1MQ6A 5FHTA 4X6PA 4ZKSU 2KM0A 2PKAB 1NO9H 3RXKA 5EXNA 2JETC 2WV4A 1SGNE 1EAUA 2K0QA 3UIRA 2PUQH 4FUHA 1AUJA 4CR5A 4CBNA 3CP7A 1GMHG 1ZOMA 3M3VA 1S81A 3QN7A 2BD4A 2BY7X 4JZIA 1BBRE 2XBYA 1C5QA 3MYWA 1V2MT 2AGEX 3SNDA 4TWWA 5EXMA 1IHTH 4ZHLU 3OY6U 4AOQA 4E7NA 1QTFA 4YOJA 1YP9A 3R3GB 1EOLA 2VINA 3D49H 3SV2H 1P2OA 2QXIA 2BD9A 1GI7B 1QBVH 3M5LA 2NU4E 5F8ZA 3RU4T 2AFQB 3FP6E 4FUJA 1GPZA 3NPSA 5IDKA 1V2KT 3GY8A 1C5LH 2HLDD 3E6PH 2ZF0H 4GPGA 1FAXA 2PGBB 2GCHF 4SGAE 2BQ7B 1AB9B 2C8YB 3RU4E 3UY9A 2KCPA 4P02A 1Y8TA 2H1UA 1HJ8A 3K9XB 5DN6D 1CT4E 1MBQA 2FOGA 5FBIA 1C1PA 1W11U 2V3MA 4K69A 4WXIA 1T4VH 2J95A 2PGQB 3MH4A 2P8OB 1GJ7B 1CHOF 3ZZ7A 2WPHS 4GHTA 2GT7A 2Z6BD 2BD8A 3BTKE 4WF8A 2WUBA 2HVXA 1VCQA 3ZZDA 2TGTA 2ZU4A 1EAXA 4HZHA 1OKXA 2GV6A 3BTME 1GBJA 2F83A 4ACBA 3HK3B 1ZGVA 1C1WH 2RA0A 2CK3D 2J2UA 3DT0H 1UHBB 3OAAD 4FVBA 1GJBB 1XMNB 3SNCA 1TMTH 5DJ7A 4ZKNU 1EJAA 5C20A 1Y3UA 4A92A 1ABJH 3K65B 2H5DA 1VCPA 2IPHA 3M7QA 5TCCA 4LXBH 4YT6H 1TIOA 1AZ8A 2P94A 1BQYA 2EI7A 4I31A 1O2HA 4ZCNA 4KKDA 2L6OA 1H4WA 4YXWD 4UE7H 2M2AA 2VGCB 3A7YA 1W10U 1T31A 3D23A 4RKOB 9LPRA 4ZMAH 2EI6A 4K2YA 1TAWA 3PMHB 5JPMH 1P2QA 3LGIA 4UFGH 2ODPA 2J34A 4ZAEA 3LC3A 4AG2A 1THRH 1QL8A 1C1TA 3QO6A 2G8TA 4H6TA 1LQDB 5KEDA 3ATLA 5EPYA 1H9HE 4YO9A 1MCVA 3ZZ3A 6ESTA 2ZFQH 3UPEA 1GJCB 3RMNH 5EW2H 1SGDE 2BDYA 2XC0A 3Q77A 4K60A 4WVPE 1GL0E 1OPHB 3MU8A 1Z8IB 2Z94A 2QA9E 1HV7A 1DE7H 2XOKD 3S69A 4IGDA 1CBWB 2B8OH 5F6MA 3T2NA 3VXFH 1COWD 2FMJA 5TCAA 1XVOA 2A4QA 2F9UA 1K1OA 1MAXA 3LONA 3WY8A 1C5PA 4X6MA 2O9QA 1MTNC 1CGIE 2OUAA 3K6ZA 2C3SA 4INLA 4CRAA 1O5BB 1O2XA 1YPLH 3S9BA 1GI6A 4NFFA 4IC5A 1JRSA 5HIZA 3BEFB 2ZU5A 1PPFE 2FOBA 2XWBI 3AAVA 2J98B 2XXLA 2OQ5A 2RG3A 4CREA 1SOTA 1SFIA 1WQVH 1ETTH 2ZGCA 1IQMA 3SZNA 3UTUH 1Z71A 3ZVCA 1OHHD 1SGQE 3R0FA 1O2QA 1CT0E 1S0RA 2EC9H 3PV2A 2BY8X 1Y5UT 1QR3E 1O5CB 1F5KU 4K1SA 3UOPA 2ZC9H 5HKKD 2ALPA 4OS4A 3F9EA 3PLBA 2VWLA 4AGJA 2WUCA 3M5OA 1HYLA 1F7ZA 2TRMA 1O5GH 1D6WA 1JWTA 3SUDA 4X0WU 3EE0B 4TY7A 4CRFA 4WH6A 1GGDB 1DOJA 5ABWA 1W2KH 1A0HB 3F0PA 1QFKH 4UFEH 3ATWA 2FOFA 2V0BA 4HG6A 5JBCS 4MG3A 1SLXB 3QK1A 4VGCB 1HB0B 1NRNH 3RXAA 3MNSA 1C2LA 5JYIA 5LPFA 1RD3B 3HK6B 1MUEB 3Q00A 4A6LA 3RXLA 3F6UH 1GMCG 1FY1A 3EYDA 3BTQE 1ZHRA 3RM2H 1SGYE 1FAKH 2EI8A 3P17H 1G2LA 1LHEH 3MO6A 4D9QA 1DWEH 2F3CE 9ESTA 1TE0A 5A8XA 4CHAC 4AN7A 3LU9B 1C1QA 1GI0A 1C1RA 5G4BA 5A09A 1C2HA 5ESTE 2GCTB 3UNRA 1DUAA 1O3IA 1L1NA 1HBTH 4ISHH 5AF9H 1C2MA 4RN6A 3KL6A 1FQ3A 3SNAA 1T8NA 1IQJA 2KX4A 2FTMA 1NU7B 1DSUA 4WMFA 2ANMH 3ZZBA 2XNIA 2HPPH 1GCTC 4KGAA 1LPGB 1WYKA 1VGCC 2QXJA 2QCYA 1TGSZ 2HALA 3GOVB 1ZTKA 2P3FH 4X8TH 5FXLA 2JDID 3O8BA 4U30A 1ZPBA 3LIWA 2V6NA 2AHME 1SLVB 1T7CA 1UTKA 1QRXA 3RXMA 2UUYA 1MH0A 1J16A 2PFEA 1ZMNA 3SI4H 3VB6A 1ZPZA 3PWBA 3S7KB 1ZSLA 1O5AB 1DX5M 4A1VA 5A8YA 2D8WA 2GP9B 3TH4H 2CHAB 4BTTB 2BDAA 5C67A 3JZ1B 1XKBC 1L0ZA 1K1PA 1GJDB 2Y5GA 4ABEA 3GY4A 4YOGA 3RXHA 1AWFH 3DFLA 1ZJKA 2DUCA 5AHGH 2WPLS 2C93B 3VGCC 4ABFA 1FIZA 1TNJA 2WINI 2ZGBH 4FUGA 2GD4B 1P10A 2GMTC 1KSNA 1ELVA 4GUXA 4AFSA 3E91A 5LPEA 3UWJH 1YBWA 2YMSB 3A83A 1EASA 1QGFA 4MNYA 1N8OB 3UREA 4TPIZ 4JZDH 3NWUA 1UTMA 1W0JD 2VH6A 5EXLA 2FWWA 4ISNA 1THSH 3FANA 2G4TA 1L4DA 3TU7H 5L6NH 2ZQ2A 1A46H 1NM6A 2BDBA 4H6SB 1P2KA 1W0ZU 2WPDD 3EAJA 4ZXYH 1L2EA 3VB7A 4F4OC 4X2WA 1GVLA 2XTTB 1H8ED 4DT4A 3FP8E 4LZ4B 4TYDA 1CO7E 3F2GA 1NN6A 4JK5A 4DG4A 1AVXA 2FS9A 3E90B 4P00A 1C2DA 4XFQA 1H1BA 1S6FA 3GY6A 1QRZA 4ABDA 1DXPA 3OEHD 1TRMA 3SJ9A 2WV5A 2XC4A 2AEIH 5C1UA 3MNCA 2BB4A 3OYPA 3OEED 1O3HA 1HIAB 2CGAA 2P3UB 2ZA5A 3KYFA 4MPVA 3ZVDA 1S6LA 4MNWA 3LGWA 4LK4A 2Z9LA 4DOQA 1V2ST 3BF6H 2ILNA 1IQEA 4FUDA 4X2VA 4JZEH 1P3EA 5F03A 3O8RA 2PKSB 4NA9H 1FPCH 6CHAC 2ZO3H 4K8BA 3A8AA 1GHBG 3DSPA 5CHAC 1FY5A 1B0FA 2ZEBA 2BVXH 1O2IA 1ZHPA 4AB9A 3ZZ5A 2KFWA 2OC7A 1Z1JA 1CGJE 3ZYDA 1BMMH 1FIWA 2CF9H 2ZQ1A 1EKBB 4OS5A 1LKBA 1ANDA 2P93A 5C5NA 1QJ6B 3ZVEA 3O8CA 3QGNB 2ODYB 2GCHG 1CE5A 1HJAC 1GI8B 1ZPCA 1WDIA 1FUJA 1QA0A 2BZ6H 4ABHA 1O2WA 2H9EH 2R0LA 1BTYA 5AFYH 2Q6GA 1NY22 8KME2 1IQNA 1SQAA 2PUXB 4WMEA 1ARBA 3ATIA 4FU9A 3M5NA 1WUNH 2PR3A 5GIBA 3PTBA 3ELAH 1GBMA 1HAGE 1MKXK 4WXVA 2FOEA 3S7HB 1FNIA 2FX4A 3QUMP 1YKTA 2GZ8A 1HAOH 1C1NA 1O31A 1E36B 4NWKA 1WXRA 1CVWH 1C2FA 3BTTE 4B6FA 2JETB 4NSYA 1W7GH 1AE8H 2V3OH 1J15A 1GBIA 1ZTJA 4Y10E 1C2JA 1XUHA 2BX3A 4CR9A 5C1XA 3WWFA 3HGNA 2O8UA 1VR1H 3NZIA 1IQFA 1A0LA 1DXWA 2VH0A 4ISOA 1JRTA 1XX9A 2SGDE 2WV9A 3URDA 3P6ZB 1UTOA 3A81A 3H7OA 3SGAE 1TNGA 2B5TB 1AY6H 1QURH 5J4QA 1HUTH 4AYYB 1BMFD 1JIRA 1Y3WA 3SN8A 1QL7A 1GMCF 2BX4A 2VIOA 6LPRA 1HFDA 3LJJA 4X1NU 1DUEA 1N1LA 1SQRA 2R2MB 1SQTA 1MAYA 5GXPA 2HVYB 1ANCA 2Y81A 4IC6A 2V3HH 1PPHE 2ESTE 4YZUA 2FP7B 5HIYA 2OQUA 1QB1A 3GICB 3RXDA 2UWLA 1KTSB 4UFFH 3QGJA 3QZRA 8LPRA 5IYTA 2LNCA 5GCHG 1TX7A 2ZU1A 4MQAA 5JBTA 2C90B 1NESE 1DDJA 1P2JA 1Y59T 4DCDA 1DWBH 1UO6A 3RMOH 3ZZ9A 2G81E 1P02A 3A88A 2BDCA 1LPKB 5AFZH 1PJPA 3RP2A 4B71A 1OP2A 2O8MA 1BTZA 1GCDA 1GDQA 1JXPA 1WU1A 2SGPE 1C4U2 1YM0A 4I32A 4NWLA 2EQNA 1HNEE 2VIQA 4YT7H 1GI2A 1T8MA 1HAVA 1BIOA 2A7JA 3RXEA 2SNWA 1C5TA 3LGTA 1QHRB 4F55A 1RTKA 2HOBA 5IK2D 1UTNA 1TRNA 1A0JA 1RFNA 1ESAA 4BXSA 1SSXA 1ZSKA 1FN6A 2YOLA 3NKKA 2BVSH 2QC2A 1G3EA 4BAHB 4B76A 3SYJA 2ZKSA 6GCHG 1ELCA 3AK5A 2FM2A 2F9VA 2JIZD 3T27A 5E0JA 4GLYA 2BMGB 1GJ5H 4UEHH 3L33A 4HTCH 3HATH 3KCGH 3MNBA 1TGTA 1QCPA 1RGQA 4TPYA 3W1EA 3MFJA 1W0KD 7GCHG 3A8BA 2ZZUH 3CS0A 3MU4A 1D4PB 4RKJB 3VB4A 1ELGA 1K1MA 2XBVA 1FXYA 4DT7B 2G52A 1NFYA 1BITA 1O2KA 3NK8A 3A89A 1EX3A 4JYVH 1MCTA 1E1RD 3SV8A 3I78A 2PWXA 1V2QT 1AU8A 1EPTC 1HCGA 2Y80A 2PSYA 2ZDVH 4NGAH 3K6YA 4CH8B 1SFQB 2PHBA 1N6YA 2HNTC 3OY5U 2VVUA 1TBZH 3S9CA 1FI8A 3U8OH 3DA9B 1BUIA 2XWAA 1A2CH 1QIXB 1NZQH 4X6OA 1MKXH 1O3DA 1UJ1A 4ZHMU 4ZKRU 2Y7ZA 3STJA 1EATA 1OWIA 1ZSJA 1FY3A 1GHBF 1D3TB 3SU0A 1DY9A 4AFQA 2WPIS 3RMMH 1BHXF 3QLPH 1SB1H 2GX4A 3A86A 3LGUA 1GBDA 2KR7A 2HNTF 3FN8A 3HPTB 1J17T 1P2NA 1QQUA 1ZR0A 3DSGA 4GHQA 1Q2WA 2STBE 1O2SA 1DITH 1EFRD 1P2IA 3UR9A 3BTDE 1GVKB 2F9PA 1DSTA 2C4FH 3RXVA 3UAIC 1EB2A 1G9IE 2F43B 4TWYA 1GDUA 1MQ5A 1MMJN 1O5DH 1H8DH 3RXRA 2TPIZ 1GHWH 1YCPK 3NRLA 1C5UA 2VBCA 4U01A 5LPRA 3HKJB 1GI5A 1FZZA 2I6SA 1EZXC 3LGYA 3VG8A 1SLUB 2FYQA 4AFZA 5HM2A 1NFWA 1QQ4A 3BIUH 5ETXA 2G00A 4ASHA 2BY5X 2LP6A 1ELFA 4X8VH 1RIWC 2O8TA 1TBRH 3N99A 3RC4A 4IBLH 4B74A 5C2ZA 1GI3A 3TH2H 3ZZCA 1Z8JB 3QTOH 4NFEA 1O3PB 1DS2E 5C5OA 3TITA 1TOMH 5GDSH 1TMUH 1FPHH 5EIYA 2ZDNA 1MU8B 1KXFA 2ZPQA 4NIXA 3E0NB 2GKVE 3EE7A 3ODFA 2HNTE 1KXAA 3KEEA 1NFUA 3RXBA 3S9AA 2VWOA 2PKAA 3GS9A 3M3TA 3QTVH 2TGDA 1P11E 1UTQA 3MO3A 5T6FA 1EJMA 1EP6A 3A7WA 1GI4A 4D7FA 1LQEA 3AW0A 3SOSA 3A7ZA 4FUFA 1U6QA 4X1SU 3TJNA 1O5EH 5DO4H 3SUEA 2OD3B 1Y3VA 2FOAA 5FPTA 3A7XA 4GVUA 3ITIA 4MTBA 5GCHF 1GHXH 1HJ9A 2WPMS 3NUMA 3SU3A 3PM3A 1AUTC 3RXFA 1EB1H 1SOZA 1GI9B 2Y82A 1TA2A 1HAIH 1SKYE 2XW9A 4CHAB 1G30B 3MH5A 1THPB 4SGBE 2F9NA 2YNBA 2ZG0H 3GY5A 1ZJDA 5EU8A 4M9FA 2P59A 3ESTA 4O03A 1BMNH 1C5NH 2KCOA 3VPKA 1C2EA 3ATKA 2PLXA 1ZRKA 1WBGB 3SHAH 1O2UA 1H9IE 5E0HA 1V2NT 1P06A 1GJ9B 1A61H 4UONA 3M7TA 5F53A 1QB6A 2J4IA 1TA6A 3BEIB 2YNAA 1BJUA 1BMLA 1C5XB 1CSOE 2ZDAH 2VB0A 1EQ9A 1P12E 4E05H 2FPZA 4ISIH 3TK5A 1RTLA 2FOCA 4XOJA 6GCHF 1HAPH 3FFGA 1C1OA 1BBRK 2P16A 3RXUA 1ZTLA 2JJ1D 1UVUH 2A32A 3UNQA 2FLBH 1AE5A 1DVAH 1HRTH 1PPCE 5FPSA 4XDEA 1RS0A 3SU5A 1H8IH 1FN8A 3UQVA 1C2GA 4WMDA 1T8OA 2R0KA 1S5SA 3SUFA 4F49A 1DANH 3UQOA 3VB5A 4DVAU 2GT8A 1EOJA 1NC6A 7GCHF 5EGMA 4H42U 5EQQA 1J14A 1SHHB 1DICA 1O2GH 1EZQA 5KGOA 2DE9A 1O3EA 1ORFA 2GMTB 1UHBA 1YPHC 1FY4A 3PYHA 3U1JB 1O2YA 1OXGA 3ZV9A 1GBTA 1AB9C 1LVBA 1TPOA 3SHCH 1J9CH 2UWPA 2ZU3A 3KF2A 1KLJH 5FPYA 3VB3A 5HM9A 1P3CA 3OU0A 3DD2H 2F9OA 2FXRA 1FLEE 3EQ0H 1QL9A 4KP0A 2B0FA 1AIXH 3SJOA 3PMJA 3BTEE 1KLIH 2P8OC 2CF8H 1C5RA 2QF0A 1AQ7A 2BXTH 2ZIQH 1BTHH 4Q80A 3PROA 2ZHFH 5KECA 2PTNA 4ABIA 1CGHA 3U8RH 4Q2KA 5SGAE 1OWHA 2IN2A 2FS8A 1HDTH 4O3TA 1KTTB 4E06H 2QYIA 1DFPA 3DHKH 3F9GA 4X2YA 4R8TB 1C5WB 3RMLH 3ZVGA 1L1GA 3MH7A 4NIVA 4IS5A 2GDEH 1O3JA 4ACAA 3A8DA 2H9TH 1MZDA 2W6ID 1LCYA 1PQ8A 2BZAA 4ISLA 3AASA 5CE1A 1B0EA 6CHAB 3JZ2B 3PO1B 2FOHA 3NCLA 3S0NA 4OS1A 1G36A 4PROA 5EOKA 2KAIB 3M35A 1OP0A 2THFB 1DM4B 1UMAH 1NBMD 1K21H 3C27B 2ANWA 1UVOA 2ZPSA 3BG4B 3FOAA 2VGCC 1O2VA 2QF5A 2P3TB 1ZMJA 4WY3A 3GYMA 5H4IB 1V2RT 4NZQA 2VNTA 4RI0A 1HJAB 1QBOA 1W12U 2C8ZB 1SGIB 5JB9S 1P0SH 1MTSA 1F0SA 1F5RA 1YPHE 5EW1H 1NPMA 1TQ7B 3W94A 8ESTE 2A4GA 1FY8E 1YPGH 4YLUA 2XBWA 3F0OA 2Y6TA 1SR5C 4UD9H 3T26A 1FMGA 2ZHWH 1UK4A 5DP7A 2Y7XA 1B5GH 1C1VH 2W26A 5B6OA 1TNHA 2J9NA 1FV9A 2BDIA 1CU1A 3PTNA 5EJLA 2J98A 3DUXH 2OC0A 3T25A 4BAMB 2TBSA 3SJ8A 1W7XH 3L3TA 4NCYA 3GDUA 1LPZB 3LKWA 4NA8A 1OWKA 2WYJA 4ABGA 1O3CA 1AVWA 1CBWC 4DIHH 3A80A 3RXGA 4K1TA 1TB6H 3SU4A 1UCYE 2ZTYA 4AYVB 1IAUA 1S0QA 4U32A 1K22H 1XXDA 1E38B 4X8SH 1C5YB 1GBBA 1XKAC 1TONA 1ZGIA 2AERH 3KQEA 4BTUB 1MU6B 1S83A 2VWMA 4BOHA 1GBFA 1Z8GA 4Y79A 2JKHA 3QWCH 2BLQA 3P70B 4THNH 5C1YA 1O3AA 1BBRH 2KCAA 2UWOA 1E37B 1EAIA 1QZ8A 2A5IA 3L6PA 3OTJE 2XCNA 1YLNA 3ZVBA 1O34A 2UUFB 4Y8YA 5CDFE 1YYY1 3EA7A 2G55A 1S82A 4MNVA 5DP4A 2JJ2D 4I7YH 3PV5A 3PLPA 1XUIA 2RDLA 3P8NA 1HPGA 1PYTD 1PPZA 1YLCA 3N7EA 3ZZ6A 4KELA 1LMWB 4XBBA 4OGXA 2Z9IA 3RLYH 1CA0C 2GGVB 3EDXB 5JBBS 2DE8A 2H2ZA 1ZRBA 1ABIH 4I8HA 5DP9A 3QX5H 1VITH 3T28A 2JH5D 2ZCKP 2EA3A 4H4FA 1EP5A 2H5CA 5DPAA 4A7IB 1O30A 1VKYA 3FZDA 5C17A 4RT0A 3E0PB 2BTCE 4I8GA 1OOKB 3M7UA 1GGDC 2A7HA 1NBME 2H6MA 5PTPA 1O0DH 4BXWA 1UVSH 1BA8B 1BJVA 1BDAA 1O3GA 2IJD1 2M5TA 4JZ1A 3TGIE 3CS7A 3V12A 4ZXXH 4DURA 1PYTC 5C94A 4VGCC 1MD8A 1M9UA 3UB0A 2W6JD 1H8HD 4ZHAA 3KQCA 3SBKA 1CT2E 1GBEA 3UOUA 4X8UH 4DGJA 1HAXB 5T6DA 4XBCA 1KY9A 1ANBA 1DWDH 4IN1A 3B9FH 4ASUD 1W14U 3ODDA 4MPWA 3GCTG 2ZTXA 3A85A 1C5MD 2ALVA 2J38A 3V13A 2F4LA 2GCTC 1GG6C 1FDPA 1XUKA 2BLOA 3MU5A 4KTUA 4RSPA 3N7OA 4WWYA 3MU1A 4Y71A 2G51A 1TPAE 1HXEH 3SU1A 5EQRA 1G32B 1NRSH 5BRRE 1EPTB 4D76A 1W13U 1V2JT 5A2MH 1TGCA 2ZFTA 1C9PA 3IG6B 4JZFH 2YMSD 3GCNA 1MBMA 3GDSA 1QB9A 4XSKU 1PFXC 5F8TA 1K1JA 1HAZB 5E2OA 1BTUA 1J8AA 1SHYA 2JH6D 2ZHQH 1AKSB 5GJ4B 1MD7A 3V0XA 3UNSA 5T3HA 1O3FA 1O3MA 1EZUC 2F9BH 1C1UH 1E1QD 2CHAC 1TPSA 3LC5A 4FETA 2Y5HA 4NA7A 4OGYA 4D8NA 4DY7B 3U1IB 1W3CA 1PQ5A 1HAHH 1HIAA 4B6EA 1SC8U 1UCYK 3LT3A 1F0UA 5T6GA 1BTXA 4YOIA 3C1KA 1C4Y2 2VIWA 1BCUH 4AC9A 1OYQA 3SU2A 4J1YA 2QXGA 1FONA 4ABJA 4Y8XA 1RRKA 2YMSC 2L74A 2OBOA 1SGFG 2BLVA 1JOUB 3SZEA 1O3KA 3N7DA 1DPOA 1A3EH 4CRCA 2AIPA 2ASUB 5E2PA 3TVJB 2GVFA 1P9UA 2OC8A 1WQSA 2XYAA 4K3JA 3T5FH 5FAHA 2AS9A 5DK1A 4CRBA 3A87A 1V2WT 3TIUA 2HLCA 4D7GA 3DSOA 1C4V2 3M5MA 4A1TA 3F3BA 5GWZA 1MZAA 2NU1E 2FIRH 1RIWB 4X6NA 1ZMLA 1A4WH 3T62A 1BRBE 2A5AA 3MNXA 1YPEH 5K0HA 1O2OA 2TGAA 2ZCLP 3ATMA 5E8EH 2Z3EA 2ZDLA 3U98H 1AI8H 2ZWLH 3KQBA 1KIGH 4MPUA 1JMOH 1DT2A 2OP9A 1YGCH 2OTVA 2D26C 3EGKH 4B2BA 1TABE 2QXHA 1ESTA 3CNRA 4A5TS 4Y7AA 4Q63A 3AVZA 1GBAA 5FX6A 1TPPA 1VZQH 2QF4A 4TT3D 3SORA 1P9SA 3TNSA 3K2UA 4WH8A 1AFQC 1AN1E 1GVZA 3H09A 4B2AA 4BAQB 1ELEE 1BRCE 4X2XA 5C3NA 2BD2A 3E8LA 4JCNA 1NU9A 1NFXA 5A0BA 1IQHA 3TH3H 4UFDH 1C1MA 1N6XA 1D3DB 1VCWA 1QRWA 2FX6A 4OM9A 3STIA 1IQLA 1YPKH 4FUBA 2ZDKA 5TJXA 3GDVA 1MTVA 2FI5E 1GBHA 2ZGJA 3LGVA 2OCVB 3BV9B 5EG4A 3BIVH 1SBWA 3EA8A 1WV7H 4XBDA 5F8XA 1GHYH 2Z9KA 3F1SB 2KCYA 1FX0B 1ANEA 2VWNA 3O8DA 2ZFPH 5K7RA 1EAWA 1YF4A 3KIDU 1XUJA 1RXPA 5I25A 3RXIA 1NTPA 3B23B 1XVMA 1SLWB 3F9HA 2Q1JA 3ZVFA 3URCA 3FAOA 2QF3A 3TGKE 2BOKA 1TGNA 2K8IA 2QE7D 5CHBA 2HPQH 1Z7KA 4WJG2 5DSFA 8GCHG 2A1DB 1GJ4H 1DLEA 1MTNB 3TJOA 2RA3A 5B6LA 1O2MA 1OWJA 1ETSH 4NIYA 3HKIB 3H5CB 1UVPA 2IOTA 4INKA 2VVVA 1WTHD 2OLGA 1IOEA 1GBCA 2SGEE 3PMBB 4Q7ZA 1GDNA 2BDGA 1PPEE 3GCHC 3M3SA 2SGAA 4Y0ZE 1TBQH 2Q6DA 3RXCA 1SGCA 1DWCH 1SGFA 2PP6A 2CJIA 3GCTF 3ZIAD 4ZUHA 3SJIA 3ZZAA 1TLDA 4GCHF 4B2CA 2ZI2H 1Y3YA 2A0QB 1B7XB 1E0FD 2WPKS 1LVMA 1TNIA 1KLTA 4TY6A 1KYNA 1ZLRA 3MI4A 2FO9A 1KXEA 1SVPA 1UCYH 1C1SA 2ZFRH 1Y5BT 3F9FA 3SO3A 5L30H 2QGRA 4K8YA 4I8LA 2BD7A 2W3IA 3M37A 4Y8ZA 3P95A 1T32A 3OX7U 2GV7A 1T4UH 1GJ8B 1Q31A 3TJUA 4AX9H 2BYAX 2OC1A 1A3BH 2KZ4A 3MQKC 2ZGHA 3IWMA 3SJKA 2CMYA 3MU0A 2ZTZA 3MOCA 1SGRE 1ELTA 1ELDE 4UDWH 2AGIX 3TJVA 3EA9A 4X1QU 3RXPA 3UR6A 5EJ1A 3BTWE 4HI3A 4FXGH 4K5ZA 2BVRH 4ZKOU 1AMHA 3TGJE 1PQ7A 2D2DA 1SI5H 4MPXA 1OP8A 5GNDA 1DY8A 4NSVA 4K1EA 5FBEA 1ARCA 2QAAA 5JB8S 1LHDH 4XD7D 3U69H 1GJ6A 3FZZA 5J4SA 1BB0B 1NS3A 3PLKA 1L1JA 3LDXH 4O97A 2OK5A 4LZ1H 5HMAA 3ZV8A 1O2NA
chains in the Genus database with same CATH topology
1V6DA 3ZVAA 2SGQE 3VEQB 1K1NA 1IQGA 4BAKB 1AWHB 1AHTH 1KXCA 1O36A 2AYWA 1TYNA 2A5KA 1NRPH 2AMDA 1F5LA 2FTLE 3E3TA 1EZSC 1LHCH 4Y6DA 2BQ6B 3TK9A 5EQSA 5JBAS 1A5HA 3SV6A 2A4OA 1SG8B 2EEKA 1GCTB 2OINA 2BXUH 2NU0E 1TFXA 1VGCB 2TGPZ 2TIOA 3ENSB 2UUKB 2GZ7A 1SPJA 2ZGXH 1V2UT 5FCKA 1TOCB 3G01A 2HGTH 1YC0A 3A84A 3W95A 4IN2A 2ZFSA 1XUFA 1S84A 2VIDA 3RC6A 2BLWA 2FEQH 1HAYB 1ELAA 1C5SA 3SW2B 3PWCA 5HXFA 1A5IA 1TALA 5BPEA 5DP3A 2ANKH 2Q6FA 1V2PT 1Z1IA 1VJ9U 5HYOA 3TPIZ 1O38A 1TMBH 2BDHA 2G5NA 4R0IA 1KXBA 2C8XB 2ZDMA 2JH0D 1P09A 3VGCB 1X7AC 5I46H 1O2TA 4JMYA 2BD3A 3A8CA 4CH2B 1TRYA 1Q3XA 1E34B 1V2VT 1SL3A 2ZU2A 3A7VA 2CV3A 5HGGA 1BT7A 1G2MA 2F91A 1F92A 4JYUH 2HRVA 5DP6A 4HGCA 1GMDG 1XXFA 4B1TA 2FYRA 1YCPH 5JDUB 5DGJA 1QY6A 1TQ0B 4ESTE 1C2IA 2BM2A 4KTCA 1QBNA 3D65E 4U2WA 4ZROA 1K9OE 1ELBA 4YESB 1LO6A 4CRGA 1UK2A 1BMAA 5DKMA 1CA0B 2STAE 1QJ1B 2Y5FA 2SGFE 1GMHF 3FP7E 1TWXB 4JK6A 1NT1A 2XRCA 1H9LB 4B75A 8GCHF 1YPMH 1C5ZB 2QV1A 1XUGA 1GL1A 3GY2A 4GAWA 4Y11E 1P04A 2AIQA 1RJXB 1Z6EA 3LH1A 2B9LA 4FU8A 2VJ1A 2BQWB 5CHAB 1NRQH 4CBOA 1EXFA 3GY3A 3U9AH 3T29A 3KN2A 2ANYA 1TX8A 2J92A 1P05A 3LPRA 1PQAA 3Q3KA 3E1XB 3SV7A 1LDTT 1TNKA 4A1XA 4IW4E 1O2PA 2CN0H 3P8FA 1O39A 2ZFFH 3UUZA 3LJOA 3DFJA 5A8ZA 2PW8H 4AB8A 2Z9JA 1LHGH 1O37A 3Q3YA 1DLKB 2A2XH 5AVDA 3H7TA 3RDZA 1ZYOA 2W7UA 1P2MA 3MMGA 3OSYA 4BTIB 1MTWA 1GG6B 1OYTH 3BEUA 3V3MA 3IITA 1HLTH 1UVTH 1K2I1 3F68H 4MVNA 1G3BA 3RXJA 1Y5AT 1F2SE 1BRAA 2GDDA 4BNRA 1KDQB 3PMAB 1QA7A 4FUCA 2O8WA 4I33A 1MKWK 2R9PA 4IMZA 1UTLM 1INCA 3ZZ4A 2CXVA 1A7SA 2R3UA 3KHVA 4XE4A 5L2ZH 1SQOA 1WTGH 2K1QA 1WSSH 1P01A 1Z8RA 1IQIA 3VXEH 4M7GA 2C8WB 3MWIU 1HGTH 2SFAA 3RLWH 1LHFH 1A1RA 1D3QB 2ZP0H 4DW2U 4JYTA 1TNLA 1WCZA 3ZYEA 1XM1A 4FUEA 1QNJA 4Y7BA 1LVOA 2VVCA 3KNXA 1GHAG 2AMPA 2ODQA 4NIWA 3MO9A 1G3CA 3I29A 1O3NA 1S6HA 1V2TT 2XCFA 1O5FH 2SNVA 2A4RA 1HXFH 3BG8A 1K28D 1T8LA 7ESTE 2A7CA 1ID5H 2XC5A 2Z3CA 1OWDA 2J94A 4OS6A 1GJAB 1OS8A 1GBLA 1YCPM 1OSSA 2QIQA 3BN9A 1UTPA 1LTOA 4GSOA 2KAIA 2VIPA 4I8JA 1ZHMA 3RXOA 1WOFA 3UWIA 2FI4E 2HWLB 2PSXA 7LPRA 4O3UA 2AH4X 3MH6A 4KTSA 4AORA 4ABBA 2O8LA 4AGKA 2Z7FE 3U8TH 1JBUH 2FOMB 2ZCHP 1VITG 4O9VA 2FESH 1SMFE 1C2KA 3GYLB 2AMQA 1D6RA 5A0AE 4D9RA 1OX1A 7KMEH 2FZZA 2G5VA 2GZ9A 4X1RU 1ESBA 2BOHB 2RCEA 2WYGA 1JIMA 1SGPE 3SI3H 1V2LT 1SGTA 1FJSA 3SU6A 2FLRH 4ABAA 2Z3DA 3BTHE 2ZECA 3PO1C 4MNXA 3QZQA 1BZXE 3AAUA 3P8GA 3TK6A 1KDQA 4IMQA 1P57B 3TNTA 4FU7A 1AFQB 1GI1A 1OWEA 1IHSH 2FI3E 1F0TA 3BG4C 4GCHG 5L2YH 1AD8H 4LOYH 5E0GA 1KXDA 4Z6AH 3CENA 1GMDF 5ESBA 4E7RG 1MTUA 1HAVB 1P8VC 1GBKA 3RXSA 3RC5A 4YLQH 1SGEE 3BTFE 1WAYB 2W7SA 3AW1A 1K1IA 1O32A 3PB1E 2WPJS 1BHXB 3M61U 1C9TA 1L4ZA 2PTCE 1CA8B 4BAOB 4QT8C 3Q3XA 4OS2A 1PPBH 4B73A 1O35A 1O2JA 3TLOA 5EPNA 2VU8E 3LOXA 4INHA 1CHOG 2A45B 4Y0YE 1ZZZA 1E35B 1K1LA 2LPRA 3RXQA 3BTGE 4NZLA 1Y3XA 1UK3A 1G3DA 1GHZA 3FVFB 1LKAA 5FCRA 4AZ2B 3V7TA 4FVDA 3HGPA 1ACBE 3NXPA 1GHVH 1S85A 1BOQA 2FDAA 1MKWH 3A7TA 2BD5A 1LVYA 1O2ZA 5EODA 2FODA 1W0YH 1V3XA 4MDSA 3GY7A 3SQHE 2ZHEH 5DG6A 4ZH8A 3SV9A 2B7DH 1AVGH 3RXTA 5DP5A 3SNBA 4MLFB 3GCHB 2BY9X 3Q76A 2NU2E 2IJOB 2PV9B 1AGJA 1N8OC 2ZPRA 3VFEA 1V2OT 1UTJA 2UUJB 4OS7A 5CMXH 2ZNKH 3P92A 3BSQA 2GTBA 1AO5A 3LH3A 2OXSA 2P95A 1F0RA 2R3YA 2D1JA 3SNEA 2H9HA 1TGBA 3MTYA 5DP8A 1BTPA 1W8BH 3SQEE 1EJNA 4Z0KA 4Q7YA 4YTAA 1Z6JH 3RUOA 2NWNA 2W3KA 5GPIB 1AZZA 2Z9GA 2ULLA 4NG9H 1P03A 3GISB 1BTWA 3GCOA 3M36A 1PPGE 4AG1A 4I8KA 4BANB 2QN5T 3RU4D 1A5GH 5FX5A 1YPJH 3B8JA 1D3PB 2R2WU 5A0CA 1O3OA 1C5OH 3SGQE 4DIIH 1D9IA 2NU3E 2PKSC 2BHGA 3E16B 4FUIA 1BRUP 1GHAF 4Q7XA 4DJZB 3SGBE 4AFUA 1O33A 1EPTA 1O2RA 1TX6A 3QDZB 2G4UA 4CRDA 3ZZ8A 3D62A 2XBXA 2VIVA 1QJ7B 3A82A 2QY0B 2OBQA 1O3LA 5LGOA 2A2QH 4YM9A 4X1PU 3I77A 3UFAA 1AKSA 1C5VA 4HFPB 2A31A 1RTFB 1O2LA 2ZHDA 1CHGA 1GWAA 2V35A 3RM0H 1YLDA 4J2YB 1G37A 3KQDA 1ETRH 2BY6X 1VJAU 3PV4A 4Y76A 2I6QA 1CQQA 5LH8A 1O3BA 1EUFA 1NRRH 2W5EA 1NROH 3P8OA 1AFEH 2AGGX 3KGPA 3MHWU 1VITF 3SUGA 1IQKA 1MQ6A 5FHTA 4X6PA 4ZKSU 2PKAB 1NO9H 3RXKA 5EXNA 2JETC 2WV4A 1SGNE 1EAUA 3UIRA 2PUQH 4FUHA 1AUJA 4CR5A 4CBNA 3CP7A 1GMHG 1ZOMA 3M3VA 1S81A 3QN7A 2BD4A 2BY7X 4JZIA 1BBRE 2XBYA 1C5QA 3MYWA 1V2MT 2AGEX 3SNDA 4TWWA 5EXMA 1IHTH 4ZHLU 3OY6U 4AOQA 4E7NA 1QTFA 4YOJA 1YP9A 3R3GB 1EOLA 2VINA 3D49H 3SV2H 1P2OA 2QXIA 2BD9A 1GI7B 1QBVH 3M5LA 2NU4E 5F8ZA 3RU4T 2AFQB 3FP6E 4FUJA 1GPZA 3NPSA 5IDKA 1V2KT 3GY8A 1C5LH 3E6PH 2ZF0H 4GPGA 1FAXA 2PGBB 2GCHF 4SGAE 2BQ7B 1AB9B 2C8YB 3RU4E 3UY9A 1Y8TA 2H1UA 1HJ8A 3K9XB 1CT4E 1MBQA 2FOGA 5FBIA 1C1PA 1W11U 4K69A 4WXIA 1T4VH 2J95A 2PGQB 3MH4A 2P8OB 1GJ7B 1CHOF 3ZZ7A 2WPHS 4GHTA 2GT7A 2Z6BD 2BD8A 3BTKE 4WF8A 2WUBA 2HVXA 1VCQA 3ZZDA 2TGTA 2ZU4A 1EAXA 4HZHA 1OKXA 2GV6A 3BTME 1GBJA 2F83A 3HK3B 1ZGVA 1C1WH 2RA0A 2J2UA 3DT0H 1UHBB 4FVBA 1GJBB 1XMNB 3SNCA 1TMTH 5DJ7A 4ZKNU 1EJAA 5C20A 1Y3UA 4A92A 1ABJH 3K65B 2H5DA 1VCPA 2IPHA 3M7QA 5TCCA 4LXBH 4YT6H 1TIOA 1AZ8A 2P94A 1BQYA 2EI7A 4I31A 1O2HA 4KKDA 1H4WA 4UE7H 2VGCB 3A7YA 1W10U 1T31A 3D23A 4RKOB 9LPRA 4ZMAH 2EI6A 4K2YA 1TAWA 3PMHB 5JPMH 1P2QA 3LGIA 4UFGH 2ODPA 2J34A 4ZAEA 3LC3A 4AG2A 1THRH 1QL8A 1C1TA 3QO6A 2G8TA 4H6TA 1LQDB 3ATLA 5EPYA 1H9HE 4YO9A 1MCVA 3ZZ3A 6ESTA 2ZFQH 3UPEA 1GJCB 3RMNH 5EW2H 1SGDE 2BDYA 2XC0A 3Q77A 4K60A 4WVPE 1GL0E 1OPHB 3MU8A 1Z8IB 2Z94A 2QA9E 1HV7A 1DE7H 3S69A 4IGDA 1CBWB 2B8OH 5F6MA 3T2NA 3VXFH 2FMJA 5TCAA 1XVOA 2A4QA 2F9UA 1K1OA 1MAXA 3LONA 3WY8A 1C5PA 4X6MA 2O9QA 1MTNC 1CGIE 2OUAA 3K6ZA 2C3SA 4INLA 4CRAA 1O5BB 1O2XA 1YPLH 3S9BA 1GI6A 4NFFA 4IC5A 1JRSA 3BEFB 2ZU5A 1PPFE 2FOBA 2XWBI 3AAVA 2XXLA 2OQ5A 2RG3A 4CREA 1SOTA 1SFIA 1WQVH 1ETTH 2ZGCA 1IQMA 3SZNA 3UTUH 1Z71A 3ZVCA 1SGQE 3R0FA 1O2QA 1CT0E 1S0RA 2EC9H 2BY8X 1Y5UT 1QR3E 1O5CB 1F5KU 4K1SA 3UOPA 2ZC9H 2ALPA 4OS4A 3F9EA 3PLBA 2VWLA 4AGJA 2WUCA 3M5OA 1HYLA 1F7ZA 2TRMA 1O5GH 1D6WA 1JWTA 3SUDA 4X0WU 3EE0B 4TY7A 4CRFA 4WH6A 1GGDB 1DOJA 5ABWA 1W2KH 1A0HB 1QFKH 4UFEH 3ATWA 2FOFA 2V0BA 5JBCS 4MG3A 1SLXB 3QK1A 4VGCB 1HB0B 1NRNH 3RXAA 3MNSA 1C2LA 5JYIA 5LPFA 1RD3B 3HK6B 1MUEB 3Q00A 4A6LA 3RXLA 3F6UH 1GMCG 1FY1A 3EYDA 3BTQE 1ZHRA 3RM2H 1SGYE 1FAKH 2EI8A 3P17H 1G2LA 1LHEH 3MO6A 4D9QA 1DWEH 2F3CE 9ESTA 1TE0A 5A8XA 4CHAC 4AN7A 3LU9B 1C1QA 1GI0A 1C1RA 5G4BA 5A09A 1C2HA 5ESTE 2GCTB 3UNRA 1DUAA 1O3IA 1L1NA 1HBTH 4ISHH 5AF9H 1C2MA 4RN6A 3KL6A 1FQ3A 3SNAA 1T8NA 1IQJA 2FTMA 1NU7B 1DSUA 4WMFA 2ANMH 3ZZBA 2XNIA 2HPPH 1GCTC 4KGAA 1LPGB 1WYKA 1VGCC 2QXJA 2QCYA 1TGSZ 2HALA 3GOVB 2P3FH 1ZTKA 4X8TH 5FXLA 3O8BA 4U30A 1ZPBA 3LIWA 2V6NA 1SLVB 1T7CA 3RXMA 1UTKA 1QRXA 2UUYA 1MH0A 1J16A 2PFEA 1ZMNA 3SI4H 3VB6A 1ZPZA 3PWBA 3S7KB 1ZSLA 1O5AB 1DX5M 4A1VA 5A8YA 2D8WA 2GP9B 3TH4H 2CHAB 4BTTB 2BDAA 5C67A 3JZ1B 1XKBC 1L0ZA 1K1PA 1GJDB 2Y5GA 4ABEA 3GY4A 4YOGA 3RXHA 1AWFH 3DFLA 1ZJKA 2DUCA 5AHGH 2WPLS 2C93B 3VGCC 4ABFA 1FIZA 1TNJA 2WINI 2ZGBH 4FUGA 2GD4B 1P10A 2GMTC 1KSNA 1ELVA 4GUXA 4AFSA 3E91A 5LPEA 3UWJH 1YBWA 3A83A 1EASA 1QGFA 4MNYA 1N8OB 3UREA 4TPIZ 4JZDH 3NWUA 1UTMA 5EXLA 2VH6A 2FWWA 4ISNA 1THSH 3FANA 2G4TA 1L4DA 3TU7H 5L6NH 2ZQ2A 1A46H 1NM6A 2BDBA 4H6SB 1P2KA 1W0ZU 3EAJA 3VB7A 4ZXYH 1L2EA 4F4OC 4X2WA 1GVLA 2XTTB 3FP8E 4LZ4B 4TYDA 1CO7E 1NN6A 4JK5A 4DG4A 1AVXA 2FS9A 3E90B 1C2DA 4XFQA 1H1BA 1S6FA 3GY6A 1QRZA 4ABDA 1DXPA 1TRMA 3SJ9A 2WV5A 2XC4A 2AEIH 5C1UA 3MNCA 2BB4A 3OYPA 1O3HA 1HIAB 2CGAA 2P3UB 2ZA5A 4MPVA 3ZVDA 4MNWA 3LGWA 4LK4A 2Z9LA 4DOQA 1V2ST 3BF6H 2ILNA 1IQEA 4FUDA 4X2VA 4JZEH 1P3EA 5F03A 3O8RA 2PKSB 4NA9H 1FPCH 6CHAC 2ZO3H 4K8BA 3A8AA 1GHBG 5CHAC 1FY5A 1B0FA 2ZEBA 2BVXH 1O2IA 1ZHPA 4AB9A 3ZZ5A 2OC7A 1Z1JA 1CGJE 3ZYDA 1BMMH 1FIWA 2CF9H 2ZQ1A 1EKBB 4OS5A 1LKBA 1ANDA 2P93A 5C5NA 1QJ6B 3ZVEA 3O8CA 3QGNB 2ODYB 2GCHG 1CE5A 1HJAC 1GI8B 1ZPCA 1FUJA 1QA0A 2BZ6H 4ABHA 1O2WA 2H9EH 2R0LA 1BTYA 5AFYH 2Q6GA 1NY22 8KME2 1IQNA 1SQAA 2PUXB 4WMEA 1ARBA 3ATIA 4FU9A 3M5NA 1WUNH 2PR3A 5GIBA 3PTBA 3ELAH 1GBMA 1HAGE 1MKXK 4WXVA 2FOEA 3S7HB 1FNIA 2FX4A 3QUMP 1YKTA 2GZ8A 1HA