1C6RA

Crystal structure of reduced cytochrome c6 from the green algae scenedesmus obliquus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
ADLALGKQTFEANCAACHAGGNNSVIPDHTLRKAAMEQFLQGGFNLEAITYQVENGKGAMPAWSGTLDDDEIAAVAAYVYDQASGDKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C6
publication title Amino acid sequence, crystallization and structure determination of reduced and oxidized cytochrome c6 from the green alga Scenedesmus obliquus.
pubmed doi rcsb
molecule tags Electron transport
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 1999-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1c6rA00
1MG3D 3DMIA 2GIWA 3OA8A 1MZ4A 1BE3D 1CRJA 1GQ1A 3CP5A 2N18B 1IQCA 5KLIB 5DFSA 1PPJD 3KZIV 5GTIV 1FI3A 2FYNB 2VHDA 1EB7A 1H33B 4QAOA 3A0BV 3MK7B 1ETPA 3PH2B 5B6QA 2EXVA 1C7MA 1KX2A 2YQBA 1QYZA 1CO6A 2CE0A 3CYTI 5CIHB 1SQPD 4H0KA 3HQ7A 4EIFA 1JDLA 1NIRA 1KV9A 2QJKB 2PCCB 5KAFV 1AOFA 5DJQC 5GTHV 3A0HV 3WUIA 1KYOD 3ZOWA 351CA 1SQQD 2BGVX 1NMLA 5CIGB 4KMGA 1P84D 1H1OA 3L4MA 1C75A 2N3BA 4IL6V 5EXQA 1R0QA 2GC7D 1QKSA 2PCBB 1KB9D 1CTZA 4L3GA 3RLMA 5TISV 2BPBB 4AANA 2C1DB 1BCCD 1GKSA 1EZVD 1I6EA 1YNRA 4N0KA 3H1KD 3RN1A 1L0ND 1HJ4A 1I8OA 4XYDB 2AIUA 4FANA 451CA 1W2LA 1CRGA 2N18C 4L1QA 1CYJA 4AALA 4DY9A 2JTIB 2C1DA 1LC2A 1W5CT 2JQRA 1A8CA 2CXBA 3ORVA 3NBTA 1KX7A 3MK7C 2BH4X 3O0RC 5CIEB 3PXTA 2N9JA 1CYCA 3HQ6A 2CE1A 3WU2V 3CXHW 3M97X 1YFCA 5B5EV 1HJ5A 4O1WA 1S6VB 1RAPA 4AAOA 1CYIA 1CIGA 3SXTA 3SLEA 3HQ9A 5CIDB 1CC5A 4PD4D 4AAMA 3VNWA 1CRCA 4MU8A 4EIDA 1IRVA 1SQVD 4J20A 3NWVA 2L4DA 1F1FA 1CTYA 1NU1D 1SQXD 3L73D 1NTKD 1HZUA 1YEBA 1M6ZA 2ORLA 2YK3A 4FA4A 3NBSA 1CXCA 1E8EA 2D0WA 3O20A 2AXTV 4V2KA 4FAVA 3L4OA 5IY51 1N90A 1AYGA 2DVHA 4PW9B 1H9XA 2IBZD 1CIFA 4UB8V 2ZONG 3CU4A 4RSZA 1C6OA 1GJQA 1LMSA 2CA3B 3C2CA 1H33A 4FA5A 3ZCFA 1DW3A 3ZBMA 3VYMA 2ZZS1 2C1UA 1K3HA 3OCDB 3PXWA 1FI9A 1YTCA 1CSUA 1CHHA 2AI5A 2YIUB 3VRDA 3H1HD 1BGYD 1H31B 4WQEA 3CX5D 1DIQC 1N9CA 4JCGA 3SJLA 5E79V 4P4QB 4WQAA 1WVEC 1KYOW 2FYUD 2BCCD 4AX3A 2B0ZB 1LFMA 1MG2D 3L75D 4FA1A 1N50A 1H9YA 4H0JA 1K3GA 5B66V 2MTAC 2N9IA 2CA4B 1E2RA 1OCDA 1S5LV 1CTJA 1QL4A 1YCCA 1C2RA 1A56A 5C0ZA 1FOCA 4EICA 3L72D 2FWLA 3CX5W 1FHBA 3TGUD 1HZVA 4Q5PA 2XTSB 2DGEA 2ZXYA 1COTA 2MHMA 1IO3A 1I5TA 3ZOYA 5KLVD 1CHJA 1C6SA 3PXSA 1BL9A 2GB8B 1YEAA 1RZ6A 1M70A 1IZL0 2N3YA 2GC4D 3L71D 3WC8A 1FCDC 1DIIC 4NFGB 1QL3A 2YCCA 1GIWA 3RMZA 1HJ3A 1CORA 1H32B 1IRWA 1L9BC 3WFBC 4GYDA 4WQBA 3HQ8A 1FI7A 3A9FA 1A2SA 2V08A 1RAQA 1NTZD 1E29A 2OZ1B 3OA8B 1I54A 2B4ZA 1CEDA 4O1QA 1CSXA 1NNOA 2HV4A 1DVHA 3H1ID 1ZZHA 5DF5A 2C1VA 1CXAA 1RZ5A 5C9MA 1LS9A 1KIBA 2ZBOA 3O1YA 1F1CA 3L70D 1HH7A 5H2FV 1U74B 1CSWA 3DP5A 2OZ1A 1DVVA 2B10B 4WQ8A 1OAEA 1YIQA 1GU2A 4PWAA 2I8FA 1C6RA 3ZOOA 1DW2A 5AURA 5KKZB 5KAIV 3ZOXA 1CRIA 1U75B 4FA9A 1I55A 2BH5X 1LC1A 3JBTB 1L0LD 4YE1A 4EIEA 4LJIA 3WFCC 5CICB 4U3FD 3L74D 1J3SA 1C2NA 155CA 1C52A 5CIFB 5CYTR 3WFDC 2C2CA 4K3IA 2LIRA 3SVWA 3RN0A 1CSVA 2FRCA 4FB1A 1PP9D 1I6DA 3OCDA 3CWBD 1AOQA 2BLFB 4WQDA 2C8SA 1N15A 1WEJF 1NMIA 4Y5RA 3H1LD 1H31A 2QJYB 1M60A 5CIBB 2PACA 1HCMA 1ZRTD 1VYDA 3BCCD 4D6TD 1QN2A 3X39A 1GDVA 3WFEC 1HRCA 1YICA 2D0SA 1L9JC 1CHIA 1B7VA 3CXHD 3SWSA 4L3HA 2BCNB 1CRHA 4WQ7A 5DJQB 2QJPB 3TYIA 2V07A 3O5CA 2B11B 1KB0A 1DW1A 2B12B 3ZIYA 1CCRA 1HROA 3DR0A 1CIEA 1SQBD 1NTMD 1CRYA 1CCHA 1CNOA 4XXLA 1I8PA 4UB6V 2A06D 4WQCA 1FJ0A 2ZOOA 4GEDB 1AKKA 1DT1A 1H32A 4WQ9A 3H1JD 2C9XB 4PJ0V 2LITA 1CIHA 1DW0A
chains in the Genus database with same CATH superfamily
1MG3D 3DMIA 2GIWA 3OA8A 1MZ4A 1BE3D 1CRJA 1GQ1A 3CP5A 2N18B 1IQCA 5KLIB 5DFSA 1PPJD 3KZIV 5GTIV 1FI3A 2FYNB 2VHDA 1EB7A 1H33B 4QAOA 3A0BV 3MK7B 1ETPA 3PH2B 5B6QA 2EXVA 1C7MA 1KX2A 2YQBA 1QYZA 1CO6A 2CE0A 3CYTI 5CIHB 1SQPD 4H0KA 3HQ7A 4EIFA 1JDLA 1NIRA 1KV9A 2QJKB 2PCCB 5KAFV 1AOFA 5DJQC 5GTHV 3A0HV 3WUIA 1KYOD 3ZOWA 351CA 1SQQD 2BGVX 1NMLA 5CIGB 4KMGA 1P84D 1H1OA 3L4MA 1C75A 2N3BA 4IL6V 5EXQA 1R0QA 2GC7D 1QKSA 2PCBB 1KB9D 1CTZA 4L3GA 3RLMA 5TISV 2BPBB 4AANA 2C1DB 1BCCD 1GKSA 1EZVD 1I6EA 1YNRA 4N0KA 3H1KD 3RN1A 1L0ND 1HJ4A 1I8OA 4XYDB 2AIUA 4FANA 451CA 1W2LA 1CRGA 2N18C 4L1QA 1CYJA 4AALA 4DY9A 2JTIB 2C1DA 1LC2A 3D0WA 1W5CT 2JQRA 1A8CA 2CXBA 3ORVA 3NBTA 1KX7A 3MK7C 2BH4X 3O0RC 5CIEB 3PXTA 2N9JA 1CYCA 3HQ6A 2CE1A 3WU2V 3CXHW 3M97X 1YFCA 5B5EV 1HJ5A 4O1WA 1S6VB 1RAPA 4AAOA 1CYIA 1CIGA 3SXTA 3SLEA 3HQ9A 5CIDB 1CC5A 4PD4D 4AAMA 3VNWA 1CRCA 4MU8A 4EIDA 1IRVA 1SQVD 4J20A 3NWVA 2L4DA 1F1FA 1CTYA 1NU1D 1SQXD 3L73D 1NTKD 1HZUA 1YEBA 1M6ZA 2ORLA 2YK3A 4FA4A 3NBSA 1CXCA 1E8EA 2D0WA 3O20A 2AXTV 4V2KA 4FAVA 3L4OA 5IY51 1N90A 1AYGA 2DVHA 4PW9B 1H9XA 2IBZD 1CIFA 4UB8V 2ZONG 3CU4A 4RSZA 1C6OA 1GJQA 1LMSA 2CA3B 3C2CA 1H33A 4FA5A 3ZCFA 1DW3A 3ZBMA 3VYMA 2ZZS1 2C1UA 1K3HA 3OCDB 3PXWA 1FI9A 1YTCA 1CSUA 1CHHA 2AI5A 2YIUB 3VRDA 3H1HD 1BGYD 1H31B 4WQEA 3CX5D 1DIQC 1N9CA 4JCGA 3SJLA 5E79V 4P4QB 4WQAA 1WVEC 1KYOW 2FYUD 2BCCD 4AX3A 2B0ZB 1LFMA 1MG2D 3L75D 4FA1A 1N50A 1H9YA 4H0JA 1K3GA 5B66V 2MTAC 2N9IA 2CA4B 1E2RA 1OCDA 1S5LV 1CTJA 1QL4A 1YCCA 1C2RA 1A56A 5C0ZA 1FOCA 4EICA 3L72D 2FWLA 3CX5W 1FHBA 3TGUD 1HZVA 4Q5PA 2XTSB 2DGEA 2ZXYA 1COTA 2MHMA 1IO3A 1I5TA 3ZOYA 5KLVD 1CHJA 1C6SA 3PXSA 1BL9A 2GB8B 1YEAA 1RZ6A 1M70A 1IZL0 2N3YA 2GC4D 3L71D 3WC8A 1FCDC 1DIIC 4NFGB 1QL3A 2YCCA 1GIWA 3RMZA 1HJ3A 1CORA 1H32B 1IRWA 1L9BC 3WFBC 4GYDA 4WQBA 3HQ8A 1FI7A 3A9FA 1A2SA 2V08A 1RAQA 1NTZD 1E29A 2OZ1B 3OA8B 1I54A 2B4ZA 1CEDA 4O1QA 1CSXA 1NNOA 2HV4A 1DVHA 3H1ID 1ZZHA 5DF5A 2C1VA 1CXAA 1RZ5A 5C9MA 1LS9A 1KIBA 2ZBOA 3O1YA 1F1CA 3L70D 1HH7A 5H2FV 1U74B 1CSWA 3DP5A 2OZ1A 1DVVA 2B10B 4WQ8A 1OAEA 1YIQA 1GU2A 4PWAA 2I8FA 1C6RA 3ZOOA 1DW2A 5AURA 5KKZB 5KAIV 3ZOXA 1CRIA 1U75B 4FA9A 1I55A 2BH5X 1LC1A 3JBTB 1L0LD 4YE1A 4EIEA 4LJIA 3WFCC 5CICB 4U3FD 3L74D 1J3SA 1C2NA 155CA 1C52A 5CIFB 5CYTR 3WFDC 2C2CA 4K3IA 2LIRA 3SVWA 3RN0A 1CSVA 2FRCA 4FB1A 1PP9D 1I6DA 3OCDA 3CWBD 1AOQA 2BLFB 4WQDA 2C8SA 1N15A 1WEJF 1NMIA 4Y5RA 3H1LD 1H31A 2QJYB 1M60A 5CIBB 2PACA 1HCMA 1ZRTD 1VYDA 3BCCD 4D6TD 1QN2A 3X39A 1GDVA 3WFEC 1HRCA 1YICA 2D0SA 1L9JC 1CHIA 1B7VA 3CXHD 3SWSA 4L3HA 2BCNB 1CRHA 4WQ7A 5DJQB 2QJPB 3TYIA 2V07A 3O5CA 2B11B 1KB0A 1DW1A 2B12B 3ZIYA 1CCRA 1HROA 3DR0A 1CIEA 1SQBD 1NTMD 1CRYA 1CCHA 1CNOA 4XXLA 1I8PA 4UB6V 2A06D 4WQCA 1FJ0A 2ZOOA 4GEDB 1AKKA 1DT1A 1H32A 4WQ9A 3H1JD 2C9XB 4PJ0V 2LITA 1CIHA 1DW0A
chains in the Genus database with same CATH topology
1MG3D 3DMIA 2GIWA 3OA8A 1MZ4A 1BE3D 1CRJA 1GQ1A 3CP5A 2N18B 1IQCA 5KLIB 5DFSA 1PPJD 3KZIV 5GTIV 1FI3A 2FYNB 2VHDA 1EB7A 1H33B 4QAOA 3A0BV 3MK7B 1ETPA 3PH2B 5B6QA 2EXVA 1C7MA 1KX2A 2YQBA 1QYZA 1CO6A 2CE0A 3CYTI 5CIHB 1SQPD 4H0KA 3HQ7A 4EIFA 1JDLA 1NIRA 1KV9A 2QJKB 2PCCB 5KAFV 1AOFA 5DJQC 5GTHV 3A0HV 3WUIA 1KYOD 3ZOWA 351CA 1SQQD 2BGVX 1NMLA 5CIGB 4KMGA 1P84D 1H1OA 3L4MA 1C75A 2N3BA 4IL6V 5EXQA 1R0QA 2GC7D 1QKSA 2PCBB 1KB9D 1CTZA 4L3GA 3RLMA 5TISV 2BPBB 4AANA 2C1DB 1BCCD 1GKSA 1EZVD 1I6EA 1YNRA 4N0KA 3H1KD 3RN1A 1L0ND 1HJ4A 1I8OA 4XYDB 2AIUA 4FANA 451CA 1W2LA 1CRGA 2N18C 4L1QA 1CYJA 4AALA 4DY9A 2JTIB 2C1DA 1LC2A 1W5CT 2JQRA 1A8CA 2CXBA 3ORVA 3NBTA 1KX7A 3MK7C 2BH4X 3O0RC 5CIEB 3PXTA 2N9JA 1CYCA 3HQ6A 2CE1A 3WU2V 3CXHW 3M97X 1YFCA 5B5EV 1HJ5A 4O1WA 1S6VB 1RAPA 4AAOA 1CYIA 1CIGA 3SXTA 3SLEA 3HQ9A 5CIDB 1CC5A 4PD4D 4AAMA 3VNWA 1CRCA 4MU8A 4EIDA 1IRVA 1SQVD 4J20A 3NWVA 2L4DA 1F1FA 1CTYA 1NU1D 1SQXD 3L73D 1NTKD 1HZUA 1YEBA 1M6ZA 2ORLA 2YK3A 4FA4A 3NBSA 1CXCA 1E8EA 2D0WA 3O20A 2AXTV 4V2KA 4FAVA 3L4OA 5IY51 1N90A 1AYGA 2DVHA 4PW9B 1H9XA 2IBZD 1CIFA 4UB8V 2ZONG 3CU4A 4RSZA 1C6OA 1GJQA 1LMSA 2CA3B 3C2CA 1H33A 4FA5A 3ZCFA 1DW3A 3ZBMA 3VYMA 2ZZS1 2C1UA 1K3HA 3OCDB 3PXWA 1FI9A 1YTCA 1CSUA 1CHHA 2AI5A 2YIUB 3VRDA 3H1HD 1BGYD 1H31B 4WQEA 3CX5D 1DIQC 1N9CA 4JCGA 3SJLA 5E79V 4P4QB 4WQAA 1WVEC 1KYOW 2FYUD 2BCCD 4AX3A 2B0ZB 1LFMA 1MG2D 3L75D 4FA1A 1N50A 1H9YA 4H0JA 1K3GA 5B66V 2MTAC 2N9IA 2CA4B 1E2RA 1OCDA 1S5LV 1CTJA 1QL4A 1YCCA 1C2RA 1A56A 5C0ZA 1FOCA 4EICA 3L72D 2FWLA 3CX5W 1FHBA 3TGUD 1HZVA 4Q5PA 2XTSB 2DGEA 2ZXYA 1COTA 2MHMA 1IO3A 1I5TA 3ZOYA 5KLVD 1CHJA 1C6SA 3PXSA 1BL9A 2GB8B 1YEAA 1RZ6A 1M70A 1IZL0 2N3YA 2GC4D 3L71D 3WC8A 1FCDC 1DIIC 4NFGB 1QL3A 2YCCA 1GIWA 3RMZA 1HJ3A 1CORA 1H32B 1IRWA 1L9BC 3WFBC 4GYDA 4WQBA 3HQ8A 1FI7A 3A9FA 1A2SA 2V08A 1RAQA 1NTZD 1E29A 2OZ1B 3OA8B 1I54A 2B4ZA 1CEDA 4O1QA 1CSXA 1NNOA 2HV4A 1DVHA 3H1ID 1ZZHA 5DF5A 2C1VA 1CXAA 1RZ5A 5C9MA 1LS9A 1KIBA 2ZBOA 3O1YA 1F1CA 3L70D 1HH7A 5H2FV 1U74B 1CSWA 3DP5A 2OZ1A 1DVVA 2B10B 4WQ8A 1OAEA 1YIQA 1GU2A 4PWAA 2I8FA 1C6RA 3ZOOA 1DW2A 5AURA 5KKZB 5KAIV 3ZOXA 1CRIA 1U75B 4FA9A 1I55A 2BH5X 1LC1A 3JBTB 1L0LD 4YE1A 4EIEA 4LJIA 3WFCC 5CICB 4U3FD 3L74D 1J3SA 1C2NA 155CA 1C52A 5CIFB 5CYTR 3WFDC 2C2CA 4K3IA 2LIRA 3SVWA 3RN0A 1CSVA 2FRCA 4FB1A 1PP9D 1I6DA 3OCDA 3CWBD 1AOQA 2BLFB 4WQDA 2C8SA 1N15A 1WEJF 1NMIA 4Y5RA 3H1LD 1H31A 2QJYB 1M60A 5CIBB 2PACA 1HCMA 1ZRTD 1VYDA 3BCCD 4D6TD 1QN2A 3X39A 1GDVA 3WFEC 1HRCA 1YICA 2D0SA 1L9JC 1CHIA 1B7VA 3CXHD 3SWSA 4L3HA 2BCNB 1CRHA 4WQ7A 5DJQB 2QJPB 3TYIA 2V07A 3O5CA 2B11B 1KB0A 1DW1A 2B12B 3ZIYA 1CCRA 1HROA 3DR0A 1CIEA 1SQBD 1NTMD 1CRYA 1CCHA 1CNOA 4XXLA 1I8PA 4UB6V 2A06D 4WQCA 1FJ0A 2ZOOA 4GEDB 1AKKA 1DT1A 1H32A 4WQ9A 3H1JD 2C9XB 4PJ0V 2LITA 1CIHA 1DW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG3 D;  3DMI A;  2GIW A;  3OA8 A;  1MZ4 A;  1BE3 D;  1CRJ A;  1GQ1 A;  3CP5 A;  2N18 B;  1IQC A;  5KLI B;  5DFS A;  1PPJ D;  3KZI V;  5GTI V;  1FI3 A;  2FYN B;  2VHD A;  1EB7 A;  1H33 B;  4QAO A;  3A0B V;  3MK7 B;  1ETP A;  3PH2 B;  5B6Q A;  2EXV A;  1C7M A;  1KX2 A;  2YQB A;  1QYZ A;  1CO6 A;  2CE0 A;  3CYT I;  5CIH B;  1SQP D;  4H0K A;  3HQ7 A;  4EIF A;  1JDL A;  1NIR A;  1KV9 A;  2QJK B;  2PCC B;  5KAF V;  1AOF A;  5DJQ C;  5GTH V;  3A0H V;  3WUI A;  1KYO D;  3ZOW A;  351C A;  1SQQ D;  2BGV X;  1NML A;  5CIG B;  4KMG A;  1P84 D;  1H1O A;  3L4M A;  1C75 A;  2N3B A;  4IL6 V;  5EXQ A;  1R0Q A;  2GC7 D;  1QKS A;  2PCB B;  1KB9 D;  1CTZ A;  4L3G A;  3RLM A;  5TIS V;  2BPB B;  4AAN A;  2C1D B;  1BCC D;  1GKS A;  1EZV D;  1I6E A;  1YNR A;  4N0K A;  3H1K D;  3RN1 A;  1L0N D;  1HJ4 A;  1I8O A;  4XYD B;  2AIU A;  4FAN A;  451C A;  1W2L A;  1CRG A;  2N18 C;  4L1Q A;  1CYJ A;  4AAL A;  4DY9 A;  2JTI B;  2C1D A;  1LC2 A;  1W5C T;  2JQR A;  1A8C A;  2CXB A;  3ORV A;  3NBT A;  1KX7 A;  3MK7 C;  2BH4 X;  3O0R C;  5CIE B;  3PXT A;  2N9J A;  1CYC A;  3HQ6 A;  2CE1 A;  3WU2 V;  3CXH W;  3M97 X;  1YFC A;  5B5E V;  1HJ5 A;  4O1W A;  1S6V B;  1RAP A;  4AAO A;  1CYI A;  1CIG A;  3SXT A;  3SLE A;  3HQ9 A;  5CID B;  1CC5 A;  4PD4 D;  4AAM A;  3VNW A;  1CRC A;  4MU8 A;  4EID A;  1IRV A;  1SQV D;  4J20 A;  3NWV A;  2L4D A;  1F1F A;  1CTY A;  1NU1 D;  1SQX D;  3L73 D;  1NTK D;  1HZU A;  1YEB A;  1M6Z A;  2ORL A;  2YK3 A;  4FA4 A;  3NBS A;  1CXC A;  1E8E A;  2D0W A;  3O20 A;  2AXT V;  4V2K A;  4FAV A;  3L4O A;  5IY5 1;  1N90 A;  1AYG A;  2DVH A;  4PW9 B;  1H9X A;  2IBZ D;  1CIF A;  4UB8 V;  2ZON G;  3CU4 A;  4RSZ A;  1C6O A;  1GJQ A;  1LMS A;  2CA3 B;  3C2C A;  1H33 A;  4FA5 A;  3ZCF A;  1DW3 A;  3ZBM A;  3VYM A;  2ZZS 1;  2C1U A;  1K3H A;  3OCD B;  3PXW A;  1FI9 A;  1YTC A;  1CSU A;  1CHH A;  2AI5 A;  2YIU B;  3VRD A;  3H1H D;  1BGY D;  1H31 B;  4WQE A;  3CX5 D;  1DIQ C;  1N9C A;  4JCG A;  3SJL A;  5E79 V;  4P4Q B;  4WQA A;  1WVE C;  1KYO W;  2FYU D;  2BCC D;  4AX3 A;  2B0Z B;  1LFM A;  1MG2 D;  3L75 D;  4FA1 A;  1N50 A;  1H9Y A;  4H0J A;  1K3G A;  5B66 V;  2MTA C;  2N9I A;  2CA4 B;  1E2R A;  1OCD A;  1S5L V;  1CTJ A;  1QL4 A;  1YCC A;  1C2R A;  1A56 A;  5C0Z A;  1FOC A;  4EIC A;  3L72 D;  2FWL A;  3CX5 W;  1FHB A;  3TGU D;  1HZV A;  4Q5P A;  2XTS B;  2DGE A;  2ZXY A;  1COT A;  2MHM A;  1IO3 A;  1I5T A;  3ZOY A;  5KLV D;  1CHJ A;  1C6S A;  3PXS A;  1BL9 A;  2GB8 B;  1YEA A;  1RZ6 A;  1M70 A;  1IZL 0;  2N3Y A;  2GC4 D;  3L71 D;  3WC8 A;  1FCD C;  1DII C;  4NFG B;  1QL3 A;  2YCC A;  1GIW A;  3RMZ A;  1HJ3 A;  1COR A;  1H32 B;  1IRW A;  1L9B C;  3WFB C;  4GYD A;  4WQB A;  3HQ8 A;  1FI7 A;  3A9F A;  1A2S A;  2V08 A;  1RAQ A;  1NTZ D;  1E29 A;  2OZ1 B;  3OA8 B;  1I54 A;  2B4Z A;  1CED A;  4O1Q A;  1CSX A;  1NNO A;  2HV4 A;  1DVH A;  3H1I D;  1ZZH A;  5DF5 A;  2C1V A;  1CXA A;  1RZ5 A;  5C9M A;  1LS9 A;  1KIB A;  2ZBO A;  3O1Y A;  1F1C A;  3L70 D;  1HH7 A;  5H2F V;  1U74 B;  1CSW A;  3DP5 A;  2OZ1 A;  1DVV A;  2B10 B;  4WQ8 A;  1OAE A;  1YIQ A;  1GU2 A;  4PWA A;  2I8F A;  1C6R A;  3ZOO A;  1DW2 A;  5AUR A;  5KKZ B;  5KAI V;  3ZOX A;  1CRI A;  1U75 B;  4FA9 A;  1I55 A;  2BH5 X;  1LC1 A;  3JBT B;  1L0L D;  4YE1 A;  4EIE A;  4LJI A;  3WFC C;  5CIC B;  4U3F D;  3L74 D;  1J3S A;  1C2N A;  155C A;  1C52 A;  5CIF B;  5CYT R;  3WFD C;  2C2C A;  4K3I A;  2LIR A;  3SVW A;  3RN0 A;  1CSV A;  2FRC A;  4FB1 A;  1PP9 D;  1I6D A;  3OCD A;  3CWB D;  1AOQ A;  2BLF B;  4WQD A;  2C8S A;  1N15 A;  1WEJ F;  1NMI A;  4Y5R A;  3H1L D;  1H31 A;  2QJY B;  1M60 A;  5CIB B;  2PAC A;  1HCM A;  1ZRT D;  1VYD A;  3BCC D;  4D6T D;  1QN2 A;  3X39 A;  1GDV A;  3WFE C;  1HRC A;  1YIC A;  2D0S A;  1L9J C;  1CHI A;  1B7V A;  3CXH D;  3SWS A;  4L3H A;  2BCN B;  1CRH A;  4WQ7 A;  5DJQ B;  2QJP B;  3TYI A;  2V07 A;  3O5C A;  2B11 B;  1KB0 A;  1DW1 A;  2B12 B;  3ZIY A;  1CCR A;  1HRO A;  3DR0 A;  1CIE A;  1SQB D;  1NTM D;  1CRY A;  1CCH A;  1CNO A;  4XXL A;  1I8P A;  4UB6 V;  2A06 D;  4WQC A;  1FJ0 A;  2ZOO A;  4GED B;  1AKK A;  1DT1 A;  1H32 A;  4WQ9 A;  3H1J D;  2C9X B;  4PJ0 V;  2LIT A;  1CIH A;  1DW0 A; 
#chains in the Genus database with same CATH topology
 1MG3 D;  3DMI A;  2GIW A;  3OA8 A;  1MZ4 A;  1BE3 D;  1CRJ A;  1GQ1 A;  3CP5 A;  2N18 B;  1IQC A;  5KLI B;  5DFS A;  1PPJ D;  3KZI V;  5GTI V;  1FI3 A;  2FYN B;  2VHD A;  1EB7 A;  1H33 B;  4QAO A;  3A0B V;  3MK7 B;  1ETP A;  3PH2 B;  5B6Q A;  2EXV A;  1C7M A;  1KX2 A;  2YQB A;  1QYZ A;  1CO6 A;  2CE0 A;  3CYT I;  5CIH B;  1SQP D;  4H0K A;  3HQ7 A;  4EIF A;  1JDL A;  1NIR A;  1KV9 A;  2QJK B;  2PCC B;  5KAF V;  1AOF A;  5DJQ C;  5GTH V;  3A0H V;  3WUI A;  1KYO D;  3ZOW A;  351C A;  1SQQ D;  2BGV X;  1NML A;  5CIG B;  4KMG A;  1P84 D;  1H1O A;  3L4M A;  1C75 A;  2N3B A;  4IL6 V;  5EXQ A;  1R0Q A;  2GC7 D;  1QKS A;  2PCB B;  1KB9 D;  1CTZ A;  4L3G A;  3RLM A;  5TIS V;  2BPB B;  4AAN A;  2C1D B;  1BCC D;  1GKS A;  1EZV D;  1I6E A;  1YNR A;  4N0K A;  3H1K D;  3RN1 A;  1L0N D;  1HJ4 A;  1I8O A;  4XYD B;  2AIU A;  4FAN A;  451C A;  1W2L A;  1CRG A;  2N18 C;  4L1Q A;  1CYJ A;  4AAL A;  4DY9 A;  2JTI B;  2C1D A;  1LC2 A;  3D0W A;  1W5C T;  2JQR A;  1A8C A;  2CXB A;  3ORV A;  3NBT A;  1KX7 A;  3MK7 C;  2BH4 X;  3O0R C;  5CIE B;  3PXT A;  2N9J A;  1CYC A;  3HQ6 A;  2CE1 A;  3WU2 V;  3CXH W;  3M97 X;  1YFC A;  5B5E V;  1HJ5 A;  4O1W A;  1S6V B;  1RAP A;  4AAO A;  1CYI A;  1CIG A;  3SXT A;  3SLE A;  3HQ9 A;  5CID B;  1CC5 A;  4PD4 D;  4AAM A;  3VNW A;  1CRC A;  4MU8 A;  4EID A;  1IRV A;  1SQV D;  4J20 A;  3NWV A;  2L4D A;  1F1F A;  1CTY A;  1NU1 D;  1SQX D;  3L73 D;  1NTK D;  1HZU A;  1YEB A;  1M6Z A;  2ORL A;  2YK3 A;  4FA4 A;  3NBS A;  1CXC A;  1E8E A;  2D0W A;  3O20 A;  2AXT V;  4V2K A;  4FAV A;  3L4O A;  5IY5 1;  1N90 A;  1AYG A;  2DVH A;  4PW9 B;  1H9X A;  2IBZ D;  1CIF A;  4UB8 V;  2ZON G;  3CU4 A;  4RSZ A;  1C6O A;  1GJQ A;  1LMS A;  2CA3 B;  3C2C A;  1H33 A;  4FA5 A;  3ZCF A;  1DW3 A;  3ZBM A;  3VYM A;  2ZZS 1;  2C1U A;  1K3H A;  3OCD B;  3PXW A;  1FI9 A;  1YTC A;  1CSU A;  1CHH A;  2AI5 A;  2YIU B;  3VRD A;  3H1H D;  1BGY D;  1H31 B;  4WQE A;  3CX5 D;  1DIQ C;  1N9C A;  4JCG A;  3SJL A;  5E79 V;  4P4Q B;  4WQA A;  1WVE C;  1KYO W;  2FYU D;  2BCC D;  4AX3 A;  2B0Z B;  1LFM A;  1MG2 D;  3L75 D;  4FA1 A;  1N50 A;  1H9Y A;  4H0J A;  1K3G A;  5B66 V;  2MTA C;  2N9I A;  2CA4 B;  1E2R A;  1OCD A;  1S5L V;  1CTJ A;  1QL4 A;  1YCC A;  1C2R A;  1A56 A;  5C0Z A;  1FOC A;  4EIC A;  3L72 D;  2FWL A;  3CX5 W;  1FHB A;  3TGU D;  1HZV A;  4Q5P A;  2XTS B;  2DGE A;  2ZXY A;  1COT A;  2MHM A;  1IO3 A;  1I5T A;  3ZOY A;  5KLV D;  1CHJ A;  1C6S A;  3PXS A;  1BL9 A;  2GB8 B;  1YEA A;  1RZ6 A;  1M70 A;  1IZL 0;  2N3Y A;  2GC4 D;  3L71 D;  3WC8 A;  1FCD C;  1DII C;  4NFG B;  1QL3 A;  2YCC A;  1GIW A;  3RMZ A;  1HJ3 A;  1COR A;  1H32 B;  1IRW A;  1L9B C;  3WFB C;  4GYD A;  4WQB A;  3HQ8 A;  1FI7 A;  3A9F A;  1A2S A;  2V08 A;  1RAQ A;  1NTZ D;  1E29 A;  2OZ1 B;  3OA8 B;  1I54 A;  2B4Z A;  1CED A;  4O1Q A;  1CSX A;  1NNO A;  2HV4 A;  1DVH A;  3H1I D;  1ZZH A;  5DF5 A;  2C1V A;  1CXA A;  1RZ5 A;  5C9M A;  1LS9 A;  1KIB A;  2ZBO A;  3O1Y A;  1F1C A;  3L70 D;  1HH7 A;  5H2F V;  1U74 B;  1CSW A;  3DP5 A;  2OZ1 A;  1DVV A;  2B10 B;  4WQ8 A;  1OAE A;  1YIQ A;  1GU2 A;  4PWA A;  2I8F A;  1C6R A;  3ZOO A;  1DW2 A;  5AUR A;  5KKZ B;  5KAI V;  3ZOX A;  1CRI A;  1U75 B;  4FA9 A;  1I55 A;  2BH5 X;  1LC1 A;  3JBT B;  1L0L D;  4YE1 A;  4EIE A;  4LJI A;  3WFC C;  5CIC B;  4U3F D;  3L74 D;  1J3S A;  1C2N A;  155C A;  1C52 A;  5CIF B;  5CYT R;  3WFD C;  2C2C A;  4K3I A;  2LIR A;  3SVW A;  3RN0 A;  1CSV A;  2FRC A;  4FB1 A;  1PP9 D;  1I6D A;  3OCD A;  3CWB D;  1AOQ A;  2BLF B;  4WQD A;  2C8S A;  1N15 A;  1WEJ F;  1NMI A;  4Y5R A;  3H1L D;  1H31 A;  2QJY B;  1M60 A;  5CIB B;  2PAC A;  1HCM A;  1ZRT D;  1VYD A;  3BCC D;  4D6T D;  1QN2 A;  3X39 A;  1GDV A;  3WFE C;  1HRC A;  1YIC A;  2D0S A;  1L9J C;  1CHI A;  1B7V A;  3CXH D;  3SWS A;  4L3H A;  2BCN B;  1CRH A;  4WQ7 A;  5DJQ B;  2QJP B;  3TYI A;  2V07 A;  3O5C A;  2B11 B;  1KB0 A;  1DW1 A;  2B12 B;  3ZIY A;  1CCR A;  1HRO A;  3DR0 A;  1CIE A;  1SQB D;  1NTM D;  1CRY A;  1CCH A;  1CNO A;  4XXL A;  1I8P A;  4UB6 V;  2A06 D;  4WQC A;  1FJ0 A;  2ZOO A;  4GED B;  1AKK A;  1DT1 A;  1H32 A;  4WQ9 A;  3H1J D;  2C9X B;  4PJ0 V;  2LIT A;  1CIH A;  1DW0 A; 
#chains in the Genus database with same CATH homology
 1MG3 D;  3DMI A;  2GIW A;  3OA8 A;  1MZ4 A;  1BE3 D;  1CRJ A;  1GQ1 A;  3CP5 A;  2N18 B;  1IQC A;  5KLI B;  5DFS A;  1PPJ D;  3KZI V;  5GTI V;  1FI3 A;  2FYN B;  2VHD A;  1EB7 A;  1H33 B;  4QAO A;  3A0B V;  3MK7 B;  1ETP A;  3PH2 B;  5B6Q A;  2EXV A;  1C7M A;  1KX2 A;  2YQB A;  1QYZ A;  1CO6 A;  2CE0 A;  3CYT I;  5CIH B;  1SQP D;  4H0K A;  3HQ7 A;  4EIF A;  1JDL A;  1NIR A;  1KV9 A;  2QJK B;  2PCC B;  5KAF V;  1AOF A;  5DJQ C;  5GTH V;  3A0H V;  3WUI A;  1KYO D;  3ZOW A;  351C A;  1SQQ D;  2BGV X;  1NML A;  5CIG B;  4KMG A;  1P84 D;  1H1O A;  3L4M A;  1C75 A;  2N3B A;  4IL6 V;  5EXQ A;  1R0Q A;  2GC7 D;  1QKS A;  2PCB B;  1KB9 D;  1CTZ A;  4L3G A;  3RLM A;  5TIS V;  2BPB B;  4AAN A;  2C1D B;  1BCC D;  1GKS A;  1EZV D;  1I6E A;  1YNR A;  4N0K A;  3H1K D;  3RN1 A;  1L0N D;  1HJ4 A;  1I8O A;  4XYD B;  2AIU A;  4FAN A;  451C A;  1W2L A;  1CRG A;  2N18 C;  4L1Q A;  1CYJ A;  4AAL A;  4DY9 A;  2JTI B;  2C1D A;  1LC2 A;  1W5C T;  2JQR A;  1A8C A;  2CXB A;  3ORV A;  3NBT A;  1KX7 A;  3MK7 C;  2BH4 X;  3O0R C;  5CIE B;  3PXT A;  2N9J A;  1CYC A;  3HQ6 A;  2CE1 A;  3WU2 V;  3CXH W;  3M97 X;  1YFC A;  5B5E V;  1HJ5 A;  4O1W A;  1S6V B;  1RAP A;  4AAO A;  1CYI A;  1CIG A;  3SXT A;  3SLE A;  3HQ9 A;  5CID B;  1CC5 A;  4PD4 D;  4AAM A;  3VNW A;  1CRC A;  4MU8 A;  4EID A;  1IRV A;  1SQV D;  4J20 A;  3NWV A;  2L4D A;  1F1F A;  1CTY A;  1NU1 D;  1SQX D;  3L73 D;  1NTK D;  1HZU A;  1YEB A;  1M6Z A;  2ORL A;  2YK3 A;  4FA4 A;  3NBS A;  1CXC A;  1E8E A;  2D0W A;  3O20 A;  2AXT V;  4V2K A;  4FAV A;  3L4O A;  5IY5 1;  1N90 A;  1AYG A;  2DVH A;  4PW9 B;  1H9X A;  2IBZ D;  1CIF A;  4UB8 V;  2ZON G;  3CU4 A;  4RSZ A;  1C6O A;  1GJQ A;  1LMS A;  2CA3 B;  3C2C A;  1H33 A;  4FA5 A;  3ZCF A;  1DW3 A;  3ZBM A;  3VYM A;  2ZZS 1;  2C1U A;  1K3H A;  3OCD B;  3PXW A;  1FI9 A;  1YTC A;  1CSU A;  1CHH A;  2AI5 A;  2YIU B;  3VRD A;  3H1H D;  1BGY D;  1H31 B;  4WQE A;  3CX5 D;  1DIQ C;  1N9C A;  4JCG A;  3SJL A;  5E79 V;  4P4Q B;  4WQA A;  1WVE C;  1KYO W;  2FYU D;  2BCC D;  4AX3 A;  2B0Z B;  1LFM A;  1MG2 D;  3L75 D;  4FA1 A;  1N50 A;  1H9Y A;  4H0J A;  1K3G A;  5B66 V;  2MTA C;  2N9I A;  2CA4 B;  1E2R A;  1OCD A;  1S5L V;  1CTJ A;  1QL4 A;  1YCC A;  1C2R A;  1A56 A;  5C0Z A;  1FOC A;  4EIC A;  3L72 D;  2FWL A;  3CX5 W;  1FHB A;  3TGU D;  1HZV A;  4Q5P A;  2XTS B;  2DGE A;  2ZXY A;  1COT A;  2MHM A;  1IO3 A;  1I5T A;  3ZOY A;  5KLV D;  1CHJ A;  1C6S A;  3PXS A;  1BL9 A;  2GB8 B;  1YEA A;  1RZ6 A;  1M70 A;  1IZL 0;  2N3Y A;  2GC4 D;  3L71 D;  3WC8 A;  1FCD C;  1DII C;  4NFG B;  1QL3 A;  2YCC A;  1GIW A;  3RMZ A;  1HJ3 A;  1COR A;  1H32 B;  1IRW A;  1L9B C;  3WFB C;  4GYD A;  4WQB A;  3HQ8 A;  1FI7 A;  3A9F A;  1A2S A;  2V08 A;  1RAQ A;  1NTZ D;  1E29 A;  2OZ1 B;  3OA8 B;  1I54 A;  2B4Z A;  1CED A;  4O1Q A;  1CSX A;  1NNO A;  2HV4 A;  1DVH A;  3H1I D;  1ZZH A;  5DF5 A;  2C1V A;  1CXA A;  1RZ5 A;  5C9M A;  1LS9 A;  1KIB A;  2ZBO A;  3O1Y A;  1F1C A;  3L70 D;  1HH7 A;  5H2F V;  1U74 B;  1CSW A;  3DP5 A;  2OZ1 A;  1DVV A;  2B10 B;  4WQ8 A;  1OAE A;  1YIQ A;  1GU2 A;  4PWA A;  2I8F A;  1C6R A;  3ZOO A;  1DW2 A;  5AUR A;  5KKZ B;  5KAI V;  3ZOX A;  1CRI A;  1U75 B;  4FA9 A;  1I55 A;  2BH5 X;  1LC1 A;  3JBT B;  1L0L D;  4YE1 A;  4EIE A;  4LJI A;  3WFC C;  5CIC B;  4U3F D;  3L74 D;  1J3S A;  1C2N A;  155C A;  1C52 A;  5CIF B;  5CYT R;  3WFD C;  2C2C A;  4K3I A;  2LIR A;  3SVW A;  3RN0 A;  1CSV A;  2FRC A;  4FB1 A;  1PP9 D;  1I6D A;  3OCD A;  3CWB D;  1AOQ A;  2BLF B;  4WQD A;  2C8S A;  1N15 A;  1WEJ F;  1NMI A;  4Y5R A;  3H1L D;  1H31 A;  2QJY B;  1M60 A;  5CIB B;  2PAC A;  1HCM A;  1ZRT D;  1VYD A;  3BCC D;  4D6T D;  1QN2 A;  3X39 A;  1GDV A;  3WFE C;  1HRC A;  1YIC A;  2D0S A;  1L9J C;  1CHI A;  1B7V A;  3CXH D;  3SWS A;  4L3H A;  2BCN B;  1CRH A;  4WQ7 A;  5DJQ B;  2QJP B;  3TYI A;  2V07 A;  3O5C A;  2B11 B;  1KB0 A;  1DW1 A;  2B12 B;  3ZIY A;  1CCR A;  1HRO A;  3DR0 A;  1CIE A;  1SQB D;  1NTM D;  1CRY A;  1CCH A;  1CNO A;  4XXL A;  1I8P A;  4UB6 V;  2A06 D;  4WQC A;  1FJ0 A;  2ZOO A;  4GED B;  1AKK A;  1DT1 A;  1H32 A;  4WQ9 A;  3H1J D;  2C9X B;  4PJ0 V;  2LIT A;  1CIH A;  1DW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...