1C78A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
b'GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c78A00
1C78A 2SAKA 1C77A 1BUIC 1SSNA 1C79A 1C76A
chains in the Genus database with same CATH superfamily
3SDLC 1XLOA 2KT7A 3HVZA 1HXYD 3I63C 4ZDVA 1OQQA 1WH3A 5FK9C 4LJPB 4IWPA 5J2RA 4XGAB 3W5UB 1E6EB 2K6QA 2K1FA 3TIXA 2AQ1B 1WGYA 2DAFA 3Q2AC 4IC7B 3P1MA 3RFZB 3MTNB 3RNFC 2CJOA 2Z0EB 4XYCA 3X23A 2N7DA 4K7WA 4KKJA 4AWJA 1QT9A 2BGFA 2WXOA 2H89B 3ZJTA 2BF8B 3B2FA 3IVFA 1AN8A 3H8HA 3IHPC 1OEYJ 3NVYA 3OWEB 4HJGE 5H92C 1SEBD 2QJLA 4EE2A 3H6NA 3UI3A 3NUHB 3FAHA 3NS8A 1C79A 4ITKA 2WXLA 2WQYB 1LO5D 4AJYB 3MJ5A 1ET9A 4KGTA 1FO4A 4WJPA 4DQOC 1F2RI 1WJUA 2KWDA 2L0FA 2WXMA 5IN7A 3TEYA 2RDHA 1SE9A 1V1PB 1NVID 1FRRA 1KLUD 3ONSA 3PVLA 4HRSA 2LGSA 4MACA 1K53A 3AE5B 3ECIA 1DYQA 3NVVA 1MHXA 2MWSB 4B9KA 2X8XX 2PMVA 2WWZA 5JZEB 2WXGA 2O2VA 2REXA 2LZ6A 2I1KA 4HJKA 2RPQA 2WXPA 4RCOA 4A90A 1WM2A 1TS5A 2ZW1A 3S2AA 4W9CA 1T0YA 4N59A 2DBYA 2K0PA 2BBCA 3ZNID 3A4RA 4KKIA 1N61A 4US9A 2M1MA 1V5OA 2D3AA 2BS2B 2M56B 1YN5A 3UGBB 1WM3A 2AQ3B 2XN9C 4S0RA 5BYRA 5AZFA 1TY0A 4W9LA 4MEMA 2N7JA 3N1YC 2AEHA 3L10B 2QC8A 3FC4A 1A70A 1E8WA 1BUIC 2Z8LA 4OZBA 3T3NA 4I6LB 4PS3A 5T8IA 4NQLB 2MBOA 3DOWA 3RD2A 3WA0A 2JXXA 4DHJB 2B3AA 2DZIA 2V1YA 4LDTD 1OQYA 3DBSA 1MHHE 2MEKA 1WMHB 3AECB 3DVGX 3AI5A 4NAMA 3QJZA 4WQOB 1RFAA 4FHJA 2KD0A 2L32A 3ZW3A 4K3CA 2INDC 3PRPB 2G4DB 2MBEA 3MC8A 3JSVB 4BKTA 1NYRA 4MJSB 1V5TA 1P0RA 1FNWA 2WXJA 2AWTA 4WH4A 3LDZE 3AE2B 2PE6B 1YMHE 3TCAA 2KYWA 4GGQA 3NJTA 1SJHD 1JRUA 4A20A 4E3CA 1SJED 1X1MA 1F1HA 3UIPB 5LXIB 1WFYA 2QSDA 4ANVA 4HEA1 3AB5A 3P42A 1E8XA 4YTMB 2QIEB 3HM6X 2MJEA 4ZRJA 3ZDMC 2KC1A 1WZ3A 2HE7A 2GBMA 1TIFA 1L6VA 4M8MA 1WJ4A 4KGSA 4GDKB 3N1ZC 4NJ6A 4G3XB 4RMAA 1FIQA 3PZDA 4J3OD 4PS7A 3APCA 3ZRFA 4G50A 4RGMA 1E8YA 2NVUI 4BKSD 1E7PB 2GI9A 1ACCA 4XWWA 2G3QB 1VRAB 3KUDB 4JQWC 2BVCA 5D3IB 5D94A 2M8SA 3A9KA 3VTWA 4CYEA 4WAAA 3RZFA 4KGRA 3W1SC 2N9XA 3P4PB 1P7EA 3QC8B 3ZJVA 3T3OA 3VRAB 2E6XA 1F2RC 1WXMA 4IOIE 1YQ4B 2JUOA 4JLCA 4YSZB 3LYYA 1FFUA 1VZ7A 4PK1A 3PLVA 2UWQA 4Q2JA 3SD5A 5MPOA 2RSUA 1SIFA 4HK2A 4HWIB 3UQBA 3KLSX 2K9XA 3P63A 2FIFA 2CR5A 3ZIMA 1IBXA 3QK0A 3O13A 1FPYA 1TYGB 1ISNA 3VRBB 1ZDXA 3R2TA 2ASQA 3ZXRA 4WJQA 3BY4B 2BYEA 1JCKB 1AYFA 3OG5A 5GXGB 2E3TA 1AARA 2LGYA 4BZAA 2R2OA 4DHZB 3PZ7A 3HRDD 4P7IA 2JY6A 4ICVA 4R3DA 2G1EA 4A3PA 2V0GA 2PVOD 2QHOA 1SXTA 3W2DA 2LUEA 2DNFA 5AUKA 2BYVE 3JW0X 1I4QA 4NZLB 3AEAB 1WGHA 2EKIA 1YX5B 4JPSA 1WXSA 4RF1A 3AE6B 5KHQA 4N9F4 4IG7B 2N9PC 1WR1A 1J7CA 5G2NA 4KDLB 1T3QA 1YD8U 1E7UA 3KWVA 1C4CA 3ML9A 4XC2A 2K3UA 2BB5A 3O65B 2KMMA 2CU1A 1SB3C 2IO3B 2Y5CA 5FKAC 3W1SA 2JYTA 2LRWA 2JZZA 1RFKA 2KNBA 2A5UA 3IXSA 2NPTB 5HHDG 5AUIA 3L54A 4JWSC 2M0XA 4TQ0A 3FILB 1PYWD 4WAFA 2W54A 2L52A 3VH4B 2KTRB 3EA6A 3TMPB 2N1VA 1E7VA 1NDDA 3NY5A 3L0WB 1FEHA 1KLGD 5BMIA 2D5GA 2KFJA 2VZKD 4MT5A 2FCNA 4KIKB 3A1QA 2PVGC 3DPDA 2K8CA 3NS1A 1XLNA 2XK5B 1L2NA 3D32A 3V05A 4TMAB 4E74A 2QDFA 2BYFA 2LXCA 2KQ4X 1YX6B 2MW5A 3PV1A 2PLPA 5IOIA 2KDEB 3C0RB 2K5PA 2KX0A 3ZTCA 3K9PB 5IO9A 4XX5A 1C3TA 2PIAA 2K8HA 3GP7A 1R4NB 4EZLA 5EDSA 5C2TB 2RDGA 1YN3A 1DOXA 4YL8A 4WIPA 4OW0A 5DPWA 1EF1A 2IJ0A 3N9YC 3UINB 3R7QA 5GMVA 3RN9C 4GLSC 1Y8RC 2CU3A 2WXKA 2MRPA 1T5XD 4YSXB 3MC9A 1TKYA 3HIZA 3VTVA 4O1NA 1SBBB 1ET6A 2C60A 1UF0A 4MSMB 3BK2A 4W9FA 4MGYE 1HZ5A 1GNUA 3MC0B 3Q3FA 5BMGA 3HM3A 4DBGA 1WIAA 1YQ3B 3EGRA 1WXQA 2GBNA 3V61A 3RNBC 3AEDB 5CHVC 4ZRQA 3OJ3A 2GBRA 4BBNF 3VAWA 2JWZA 2BTEA 2JVCA 2LGXA 3VUXA 1S3SG 1BMLC 1KRHA 3PO0A 3QWZB 1I4PA 1FFVA 2FCMA 5L83A 2M4NA 3N3KB 3MP9A 1Q5WB 4ZOHC 4W9DA 4G0NB 1WF9A 4AUQC 3C8YA 1MI0A 1WMHA 5AZGA 2YVCA 3CF6E 2JRHA 2O6VD 2JF5A 2LGDA 1I4HA 2D2QA 3QARA 4DDGD 1IGCA 1UZXB 2ZZPB 3TL5A 1TZOA 1RYJA 1OGWA 2HDEA 3JSVA 5EE9A 2SEBD 2VH1A 1N60A 3PSEB 4II2B 4KSKC 3J9CA 2IO0B 4MJSA 1L0YB 5G55A 4AJWA 3DBRB 3VVWB 1WGGA 2NR2A 5AZHA 1S1QB 4HKQA 2OHFA 5HG2A 3H9DA 1XCQL 1WYWB 2KACA 1P9DU 3PS6A 3SFEB 2ZW0A 2LVQA 3QQ8B 1ZDVA 3Q3MC 2ZPYA 1FM0D 2RD0A 3QA8A 1L0VB 5E6OA 2OJWA 2V4LA 3C19A 2WGSA 2FCSA 1JWMD 5LLIA 1RAXA 1RRBA 1HZ6A 1XT9B 4JX1C 3KVFB 3EHVA 1T0SC 1Q0WB 1UGMA 4BAXA 3KW5B 3TEWA 3Q3NC 3UF8A 3DBRI 4EFOA 2KO3A 1WZ0A 3P4RB 2ZEQA 2DYMA 4W9EA 3ALBA 2L8JA 4WWNA 4RFBA 1QOAA 3DBLI 4DDID 1JALA 2BWES 1MG8A 1PDXA 2MCNB 1V86A 4IKGA 2O6VA 4EZJA 2K22A 2M19A 2V3SA 2Y5PA 1MVKA 5E6PA 2L3ZA 2UU7A 1GC6A 3ZQ4A 1P3QU 2EMTA 1UD7A 3RT3B 2W3SA 1TJEA 1ZP0B 4X57B 1TS3A 1TY2A 4II3B 4GMVA 4LJOB 1JWAD 1SE3A 2PPHA 1WGRA 2WXIA 3N20C 3AM9A 4M01A 4ZRPA 5IP4D 4MH8A 1YJ1A 4M8NA 3MFGA 3SEBA 2LJ5A 1G6JA 1VZ8A 4LK0M 4FHKA 2QMTA 2FNJB 4A9AA 4QAYA 3DVGY 3KWLA 4USAA 3U30A 1D5MC 4MGZE 2BKRB 1EU4A 1WJ6A 4DK5A 1TS4A 2HD5B 1R4MB 2IPKD 2NCNA 3M63B 1KLVA 3B2GA 1LXDA 1SSNA 4L23A 4AOFA 1V9JA 1L4ZB 1KFYB 4M00A 2ZNVB 2GLSA 3N32A 1GG3A 2HJ8A 3QAQA 3ZYYX 2J4XA 2MH7A 2IBIB 2MHJA 2KLCA 2K39A 5C1ZA 4DXAB 1L4DB 1HA5A 4NAWB 2KMCA 4HKZE 2PTLA 1P98A 2R61A 3BVGA 4EUTA 1R4MI 2JZ3B 1GPXA 2DAJA 3GZNB 2J0JA 2PW9A 2MJDA 1JROA 1STEA 4YT0B 1BXTA 2MSED 2MLBA 1NI2A 4OZAA 2M17A 3PREA 4URKA 4OVVA 3APFA 2NPTA 2LJIA 3W9CB 3KQ4A 3X0WA 2V3NA 3URYA 1SGHA 3Q14C 3FILA 4GDLB 2MBBB 2DWQA 1GOZA 3HHMA 3V62A 2MX2A 2WP9B 3Q8CA 1SE2A 1TBEA 2NMQA 2KTRA 2GBKA 2IDYA 4ZYNA 2KJHB 3PGEA 3GZNI 1V80A 2KFKB 1YQBA 2KMAA 2WU2B 5CHWA 4KIKA 2CHZA 3B0AA 4REZA 1QKZA 3U52E 3MHSD 1N5XA 4OZCA 2Z0DB 1QOGA 3E9SA 3RYTA 1H8CA 4K1RB 2BWFA 2TSSA 2D11A 1WWTA 1VCBA 2WXNA 1MJDA 1IPGA 4LTUA 3U2SC 3VUYA 4DXFA 3P2BA 3N1XC 5D7GA 3VR8B 2FUG1 1M4VA 3VHTC 2KWUB 4F7ZA 1V97A 3FKYA 2LFIA 5BO4B 1FXAA 1E90A 2B76B 1V1OA 2XNAC 2WDRB 3I57A 3GS2A 5EE3A 2EKEC 2INNE 4L1BA 2DZKA 3TSSA 4LNIA 3DVNU 3SHQA 1D5ZC 4BFRA 4FADA 4XWTA 2CKHB 3Q3JA 1LM8B 1XF5L 3AEEB 3PRZA 3RZWC 3TJPA 3BZDB 1GB1A 2LI5A 3R66C 3IAM1 4FXCA 2WS3B 1YJIA 3AE7B 1NEKB 5FR6A 1VD2A 1J7BA 1BT0A 1DGJA 4C56C 3KUZA 2KJ6A 1E0ZA 3A33B 3GB1A 3SFDB 3DWMA 1MG4A 3KH0A 4NJCA 4BKGA 2JXTA 1GAQB 1AWDA 2GB1A 5D6JB 2ZJDA 4ANXA 1QZEA 2JYEA 4A8XC 2KWVB 2V9HA 4N6EB 4KZ0A 2ZVNA 3H7PB 4CHKA 2KK8A 2O2VB 4WURA 2OJRA 4GN1A 5DPRA 2L05A 1H4RA 1B1ZA 3APDA 2L7RA 1F77A 4MGIE 5LXHA 4XZ4A 2YLMA 1L7YA 4FJYA 3WALA 3ZDTA 1D5XC 2WXFA 4L2YA 2ZNVC 1PUTA 3EC8A 4WWOA 4LNOA 1K50A 4NPNA 4TV3A 2FIDA 2KLGA 4BBNC 3R8BA 1TZ1A 3TUOA 2KOXA 2LHDA 3SU8X 2KDIA 4TUUA 4FJVB 2FE8A 3BYTB 3EFCA 4ZRIA 1CQVA 3WAPA 3AN1A 1YIWA 4HXDA 1PGAA 4XE0A 1WXAA 4RGTA 3V6CB 4G11A 2ACZB 3I9V1 1L5PA 2JSVX 4DHZE 1TKEA 2C7MB 3LJ3A 3L4PA 4LNNA 1I4XA 1WY8A 2N4FA 3GE8C 4RNAA 2Q5WD 2HTHA 3AU5A 1EUVB 1E9MA 1JWSD 2DENB 2MBHA 4DHJD 1N6ZA 4ACFA 3PT2B 4ZRKA 1D6EC 2RGFA 1T0RC 2CHXA 3IFWB 2HTME 1JQ4A 4HPLB 2WDQB 3IT6B 3I5JC 5D3DA 2LMCA 2D10A 5IKCM 2INPE 1MFWA 3WAOA 2VRRB 1XLPA 1LFDA 1V1PA 3Q8BA 4A6QA 2J42A 3AE3B 1N5WA 1CJEA 3ZXVA 2DZJA 3M95A 1V8CA 1NBFC 1KJTA 5TR5A 1C4AA 1WSPA 2IY0B 2W3RA 3GE3C 2KDFB 4WWMA 3WCQA 1NYQA 4KVGB 3SR6A 2H88B 3ZLZA 4JE3B 5HFYA 3RMKC 2X38A 1UUPA 4IUMB 4BOSC 1PGXA 2KC2A 2W82A 3BVZA 3U7DA 2L1AA 1R4NI 4KDIC 5D2MB 3GOEA 3U4EG 4IM0A 1NI3A 2GMIC 3ML8A 4RGNA 2G45B 3IBEA 3NOBA 1LGRA 2Y5BB 5H8YE 1FXIA 3PHWB 5CTRC 3B08A 2L0TA 2W9NA 4D2KA 4C7YA 4JIOU 1N63A 2KQSA 4HROA 5IA7A 1HQRD 2ON8A 3QHTA 3AE4B 3ZVVA 2PKOA 1K51A 3VUWA 4RM8A 1R7SA 3Q69A 4GOCA 3ZRCA 2OEDA 4NY0A 4ICUA 1GB4A 3A4SC 3PPAA 3IG3A 5BMHA 5G5HA 2BS4B 1C1YB 1J19A 4I6NB 1RM6C 2MP2B 4HLEA 2XBBC 3ZNZB 3L13A 1KM7A 4IWOA 2WXHA 3AEFB 1ROEA 1T6BX 1V6EA 2J52A 3CSFA 4IDIA 4RM9A 4ZHPA 4MSQB 3B9JA 3H7SA 4C4VB 2RR9A 2QEJC 2BYTA 2WX1A 5E6JA 1FCLA 1ZXIA 2KDMA 2KXJA 3P4QB 1P1AA 5TSSA 4MGKE 2BPSA 1WX7A 5IAAC 3DVNV 4RGOS 1IP9A 4MM3B 3L17A 1ENFA 4LLGM 1WX9A 1YN4A 4GDKA 2MJ3A 3DBHB 2K25A 1VJKA 4FBJB 4YTPB 3W1YA 4ANWA 4YTNB 1KTKA 2N9KA 1ZE3D 4NQKE 1SF0A 4MH0E 3RNEC 1IYFA 2GBJA 4E71A 3Q8EA 2I38A 4BOZB 3CSTA 3B1LX 3TEXA 1QILA 2GOWA 4FLHA 2AYOB 3NZSA 1B9RA 2EMSA 3BINA 2G9HD 5EE1A 3DHHC 3PTFC 1FNUA 3JVZX 2MA9B 4EZKA 4W9IA 4HVBA 1WGDA 2NTTA 3OJ4B 3WAMA 1PFDA 3DBHI 4ARIA 5KHOA 1VR9A 2LD9A 1WR6E 2V3PA 1HEZE 4C00A 3A9JB 3A1QB 2IGHA 4EKUA 3N30A 4HPPA 1AW7A 3NVZA 2KJRA 3UQAA 2G4SA 4OVUA 1MPEA 4EEWA 2EELA 1FCCC 3DQVA 3AEBB 3QIJA 1WJNA 3RNGC 3L08A 1XCTL 3EFUA 5I4DA 1IUEA 1UGJA 2BW2A 1UWXA 3E56A 2UYZB 3HK0A 4AQ7A 2LXAA 5C23A 4EOYA 3NG0A 4MDKE 1EF5A 5DPSA 4NJ7A 1D4BA 3ZKJC 1E8ZA 2BKFA 2N7EA 2WU5B 2M0AA 3H7PA 1OFFA 1WI0A 2N9EB 3HVDA 2NTSA 1UNSA 1Q10A 3NHEB 2FBWB 2NBUA 4P1CC 2KN5A 4W9GA 1WRIA 2KWCA 2D07B 2WX0A 4K7SA 1RWSA 5LNK1 1DOIA 2VH2A 2QCZA 3AXCA 3BK1A 2IGDA 3ZGZA 4N58A 1SE4A 2DZMA 3MHZA 2C9WB 2KX3A 1TT5B 1NENB 3U8ZA 3BIID 4GB9A 1I42A 4UDUC 1JMLA 4PYZA 1KOTA 2RMMA 2VZKB 3AEGB 1ZOYB 3VH3B 4IWQA 2DHZA 1E10A 1KF6B 1J7AA 2Y3AA 4TKNA 1ZKHA 3EECA 4GSWA 4I6PA 1FMAD 4B0MA 4US8A 2AL3A 1N62A 1ZUD2 4LNKA 1UH6A 3VQIA 4IM3A 1EWCA 5L95C 4DWFA 2FCQA 4GIVA 3AU4A 1WE7A 1UBQA 3RI7C 4PS8A 3ENEA 2JPHA 5G5GA 2KDBA 1FNVA 2WDVB 3VR9B 5CHFA 3AMZA 2XK5A 3T8MA 1ZGUB 4FULA 3R3MA 5C3JB 2JQRB 1I4RA 4JL9A 4M0WB 4AS1A 1JRPA 3QX1A 2N0SB 3VFKA 5JXVA 2JT4B 3NZ3A 3DWGC 3RULA 2WXQA 4W9KA 2I1JA 3VTUA 3PLUA 1P7FA 3P4SB 2KZRA 4YXDB 1M94A 2KVZA 3V3XA 2NBWB 4XDCA 2MBQA 2KN4A 2ICIA 2HJ1A 5DCNA 4XDDA 2LRUA 2IGGA 1DOYA 4P6VF 3Q3OC 1C76A 2CS4A 1F9JA 4W9HA 4KZCA 2O6VB 1D3ZA 4ANUA 3U7ZA 2BQQA 2JRIB 2AL6A 4HDQA 2DX5B 3RNAC 1F52A 5JH5C 2YEPF 3BYYB 3OLMD 3TEZA 3Q6BA 4HPMB 2LVPA 1QLBB 1JWBD 2IZVB 1UBIA 4A55A 1ZXHA 2N9LA 1UWMA 4IW0A 1CK1A 4LNFA 2DLBA 3RPFC 1XQQA 4J6IA 3TBLD 3RNCC 3DCGA 2KVRA 2LASA 5CX3A 1WE6A 2ZVOA 2WYQA 3VXWA 1JWUD 2PEAA 4IM2A 1QOBA 3ZNGC 4ARCA 4GU2A 1EWYC 4WJOA 2LEKA 1CMXB 3KUCB 4NNJB 3DDCB 1YJJA 3M62B 1WRDB 4GXBA 1ESFA 4W9JA 3ZO5B 4PYUA 1OTRB 2MP2A 1IGDA 2J0MA 2KAJA 4RF0A 2C7HA 4BVUC 1ZW7A 3Q8FA 3OAWA 2XEWA 4BKSA 2JWUA 3HUIA 4FJZA 2V4IB 2A4ZA 2K6DB 3AV8A 1FD6A 2DYOA 2WLBA 3W5VB 5E6NA 4B0EA 4C4VA 3BWUD 1GJZA 3LB8C 1VZ6A 2L76A 4P16A 1KH0A 3V6EB 1U4AA 1K52A 2D3GA 1UELA 1WX8A 3H1UA 1VLBA 5BYQA 1TGZB 4MM3A 1XO3A 2WHIA 5HI1A 3AE1B 3LXFA 1XXGA 3ZNHB 2KHWB 2JX5A 2INCC 4OVZA 1J8CA 2IY1B 2CHWA 1Z5SB 2KANA 3IT4B 3CWIA 1HE8A 2ZCBA 1I35A 3R2IA 1TTNA 3RCZA 2GRIA 4TSSA 2J53A 1CZPA 2RDBC 4MELA 2MQJA 1C78A 1GUAB 1Z2MA 5JHBA 2Z59B 1EO6A 2NS5A 2IO2B 2C7NB 1QQRA 1J0GA 5J18A 4DXGA 3ETRA 4WJNA 3ZJUA 3NVWA 1C77A 4KSLC 4C7ZA 1C4PA 4F1SA 1A5RA 1I7HA 3AULA 3A9JA 1QF6A 3PZ8A 2R2QA 3K9OB 4ASWC 1TKGA 4A3OA 2KTFA 3KYDD 1FXTB 3CIRB 1QOFA 2N1WA 2WNMA 4KV2A 4ZYSA 5BYSA 4OHJA 3V60A 2PE9A 1OQRA 3AE8B 3NZUA 2LWPA 3DHIC 1PQSA 2ONQA 3KYCD 2ZPNA 2IO1B 2W55A 3ABVB 4YWGG 2SAKA 2LHEA 2JU6X 5AEKB 4AP4C 4JGHB 4YSYB 2LUMA 2BB6A 2J7QB 4ZHOA 3NRZA 1PGBA 5FR3A 4LDTB 3A9KB 3R7RA 1E5WA 3I3TB 2ZCCA 4CQNA 3CMMB 3BVMA 1WGKA 1V49A 1LQBA 4LCDE 2YEPB 3DHGC 1I4GA 2OOBB 1WYGA 4K3BA 5EE0A 4HCNB 1YNTE 3T9LA 2FAZA 2LVOA 1SIJA 3PHXB 4NAWA 1Q1OA 3ZUNA 4F8CB 2I2YA 2LGIA 1ZPSA 1Y56A 3AH7A 3Q8AA 4K81A 2L00B 4B95A 1JW9D 2BS3B 2WDTB 2NBVB 1TS2A 4S17A 1K8RB 4H2AA 5JHAA 1XLQA 1V81A 1IBXB 2AQ2B 1F0ZA 3UIOB 3ZTDA 2RPVA 1EU3A 1VDVA 4KX6B 1XEEA 2WXRA 2K8BA 2L83A 2CJNA 1XD3B 5HKHA 1V2YA 4WQMA 1L6UA 4P1BC 4GDLA 1RLFA 4FN2A 2DYBA 1T0QC 3PRMB 2FUHB 2KQ7A 3M3JA 1YOVB 3MJWA 3QCAA 5J17A 4WWPA 4C80A 2KFKA 3RUIB 4HCPB 1EM7A 4M02A 1HTQA 3VDZA 3AE9B 3IAS1 5DPTA 1C9FA 4TQ1A 1WXVA 2C5LC 1HTOA 4CO7A 2QILA 3EUB2 3JYUA 3WANA 2PJHA 4RH6A 2BT6A 4FA6A 3L16A 4PT5A 2AX5A 4JWUC 4HDOA 1OEYA 1FRDA 2J0KA 3DBLB 3WIMA 2JZPA 1L0XB 2IYDB 4B6WA 4M0WA 2KKCA 2D3CA 2D3BA 1GC7A 4K7UA
chains in the Genus database with same CATH topology
1JMLA 3GB1A 3SFDB 2RMMA 2VZKB 3AEGB 3DWMA 2K5PA 4NJCA 1XLOA 2JXTA 1ZOYB 1GAQB 1AWDA 2GB1A 3HVZA 1HXYD 1OQQA 2PIAA 5FK9C 1E10A 1KF6B 1J7AA 2Y3AA 3W5UB 3GP7A 1FMAD 4B0MA 5C2TB 4US8A 1E6EB 2RDGA 1YN3A 2JYEA 1N62A 1DOXA 2AQ1B 1ZUD2 4A8XC 4WIPA 3P1MA 3RFZB 4OW0A 3VQIA 2CJOA 4N6EB 1EWCA 2IJ0A 4KKJA 1QT9A 2WXOA 2H89B 3ZJTA 3N9YC 3B2FA 4GLSC 2CU3A 4WURA 2WXKA 1AN8A 3H8HA 1T5XD 3NVYA 4HJGE 3OWEB 4YSXB 1TKYA 5H92C 4O1NA 1SBBB 1SEBD 1B1ZA 1ET6A 5G5GA 1FNVA 2QJLA 1F77A 2WDVB 4EE2A 3BK2A 3VR9B 3AMZA 3UI3A 3NUHB 1HZ5A 3FAHA 1C79A 4ITKA 3MC0B 5C3JB 5BMGA 2JQRB 2WXLA 1I4RA 1YQ3B 3EGRA 2WQYB 1LO5D 1WXQA 3MJ5A 1ET9A 1D5XC 2WXFA 3AEDB 4KGTA 4L2YA 1FO4A 1PUTA 4DQOC 1F2RI 4ZRQA 1K50A 2KWDA 2WXMA 4AS1A 3TEYA 1JRPA 2RDHA 2N0SB 3R8BA 2BTEA 1V1PB 3TUOA 5JXVA 1BMLC 1NVID 1KRHA 2LHDA 1FRRA 1KLUD 3PO0A 1I4PA 1FFVA 3NZ3A 2FE8A 3BYTB 3MP9A 3DWGC 4ZOHC 1CQVA 4HRSA 4MACA 1K53A 3AN1A 3C8YA 1MI0A 2WXQA 3AE5B 1PGAA 4XE0A 1DYQA 3NVVA 1I4HA 4RGTA 1MHXA 1P7FA 2ACZB 3I9V1 3P4SB 1IGCA 1L5PA 2JSVX 4YXDB 2PMVA 1TZOA 1TKEA 2WXGA 3V3XA 4XDCA 1RYJA 2WXPA 3L4PA 4RCOA 4A90A 2HDEA 1I4XA 1TS5A 2ZW1A 2KN4A 4N59A 5EE9A 2SEBD 2ICIA 1N60A 2DBYA 2Q5WD 4RNAA 4XDDA 3J9CA 2K0PA 2IGGA 1DOYA 4P6VF 1L0YB 2BBCA 4KKIA 1E9MA 1JWSD 1C76A 1N61A 4US9A 2BS2B 2M56B 1YN5A 1D6EC 3U7ZA 4HKQA 2HTME 2OHFA 2AQ3B 2XN9C 5HG2A 5BYRA 1JQ4A 2WDQB 3IT6B 1XCQL 2KACA 1TY0A 2N7JA 5D3DA 3SFEB 2ZW0A 2LMCA 2YEPF 1A70A 1ZDVA 3BYYB 3FC4A 1BUIC 2Z8LA 3TEZA 2INPE 4OZBA 1FM0D 1QLBB 1L0VB 3T3NA 1JWBD 1XLPA 5T8IA 4A55A 1V1PA 1ZXHA 2N9LA 1UWMA 1JWMD 3Q8BA 4A6QA 1CK1A 2J42A 2DLBA 3AE3B 1HZ6A 1N5WA 3RPFC 4JX1C 1CJEA 1V8CA 3TEWA 1C4AA 1WSPA 1MHHE 2MEKA 3AECB 2W3RA 1JWUD 4NAMA 1QOBA 4ARCA 3P4RB 1EWYC 2LEKA 2DYMA 4WWMA 2L32A 3WCQA 1NYQA 1YJJA 4RFBA 1ESFA 1QOAA 3SR6A 1JALA 2H88B 4JE3B 1PDXA 5HFYA 1NYRA 1IGDA 2X38A 1UUPA 2KAJA 4RF0A 1FNWA 2WXJA 4IKGA 1PGXA 4WH4A 3Q8FA 2K22A 2M19A 3AE2B 2Y5PA 1YMHE 1MVKA 2W82A 2JWUA 3BVZA 3HUIA 2V4IB 3ZQ4A 2L1AA 1SJHD 3AV8A 1FD6A 2DYOA 2WLBA 3W5VB 4B0EA 2W3SA 3U4EG 1TJEA 3BWUD 1SJED 1ZP0B 1TS3A 1TY2A 3LB8C 2QSDA 1JWAD 1VZ6A 1NI3A 4P16A 1KH0A 1SE3A 4RGNA 4HEA1 3AB5A 3P42A 1K52A 2WXIA 4YTMB 2QIEB 3AM9A 4ZRPA 1FXIA 4MH8A 5H8YE 1VLBA 5BYQA 2MJEA 3MFGA 1XO3A 3SEBA 5HI1A 4D2KA 3AE1B 1VZ8A 1XXGA 3LXFA 1L6VA 4LK0M 4C7YA 4KGSA 1N63A 4GDKB 2QMTA 4A9AA 2JX5A 4HROA 4OVZA 1HQRD 3KWLA 4USAA 2ON8A 1D5MC 1FIQA 4J3OD 3AE4B 4RGMA 1EU4A 1E7PB 2GI9A 1ACCA 2PKOA 3IT4B 4XWWA 1K51A 1TS4A 3CWIA 1VRAB 3R2IA 1R7SA 3Q69A 2GRIA 4TSSA 2OEDA 5D3IB 2J53A 2IPKD 1GB4A 1CZPA 5BMHA 5G5HA 2BS4B 1C78A 3B2GA 1SSNA 4L23A 1RM6C 1QQRA 1L4ZB 1KFYB 4DXGA 3ETRA 3ZJUA 4KGRA 3NVWA 3P4PB 3ZYYX 1C77A 2J4XA 2MH7A 2WXHA 3AEFB 4C7ZA 1ROEA 1P7EA 1T6BX 2J52A 4IDIA 3ZJVA 3T3OA 1C4PA 3VRAB 1L4DB 1HA5A 1F2RC 2E6XA 4ZHPA 3B9JA 1I7HA 4NAWB 4HKZE 2QEJC 2BYTA 5E6JA 4IOIE 2PTLA 1YQ4B 1FCLA 1ZXIA 1QF6A 2KDMA 3PZ8A 4YSZB 3P4QB 2R61A 5TSSA 3LYYA 1FFUA 3BVGA 1TKGA 1VZ7A 4RGOS 3CIRB 1QOFA 2WNMA 1GPXA 4MM3B 4Q2JA 4ZYSA 5MPOA 5BYSA 1ENFA 4OHJA 4LLGM 3KLSX 2K9XA 3P63A 2PW9A 2MJDA 1JROA 1OQRA 1STEA 1YN4A 1IBXA 2MJ3A 3AE8B 4YT0B 1BXTA 1VJKA 3O13A 2ONQA 2W55A 4YTPB 1TYGB 3ABVB 4YTNB 4OZAA 3VRBB 1KTKA 1ZDXA 1ZE3D 2N9KA 2SAKA 1SF0A 4YWGG 2LHEA 2JU6X 3R2TA 3Q8EA 2I38A 4YSYB 3W9CB 2LJIA 3KQ4A 2LUMA 2V3NA 3TEXA 3URYA 2BB6A 1JCKB 4ZHOA 3NRZA 1PGBA 3FILA 1AYFA 4GDLB 5FR3A 1QILA 2DWQA 5GXGB 1GOZA 2WP9B 3Q8CA 1SE2A 2E3TA 4CQNA 1B9RA 2NMQA 2G9HD 5EE1A 3BVMA 1WGKA 2YEPB 1I4GA 1FNUA 1WYGA 5EE0A 2IDYA 3PZ7A 3HRDD 1YNTE 2NTTA 4R3DA 2G1EA 1SIJA 1PFDA 2V0GA 2PVOD 2WU2B 1SXTA 3W2DA 4ARIA 4REZA 1QKZA 5AUKA 1VR9A 3U52E 4NZLB 1I4QA 3AEAB 1N5XA 2EKIA 2V3PA 1HEZE 4OZCA 2I2YA 2LGIA 4JPSA 2IGHA 4RF1A 1QOGA 3AE6B 3E9SA 1ZPSA 1Y56A 1AW7A 3AH7A 3Q8AA 1JW9D 2BS3B 1J7CA 3NVZA 2TSSA 1TS2A 4H2AA 1MPEA 1WWTA 1T3QA 2EELA 1FCCC 2WXNA 1XLQA 1C4CA 3AEBB 3KWVA 1IBXB 2AQ2B 1F0ZA 2K3UA 2BB5A 2KMMA 1XCTL 5I4DA 1IUEA 1UGJA 2RPVA 2BW2A 1SB3C 1UWXA 1EU3A 3E56A 4LTUA 1VDVA 4KX6B 3U2SC 4AQ7A 4DXFA 1XEEA 2WXRA 2Y5CA 5D7GA 2L83A 5FKAC 3VR8B 3W1SA 2JYTA 2FUG1 1M4VA 2CJNA 1RFKA 3IXSA 4WQMA 1L6UA 1V97A 2LFIA 5HHDG 5AUIA 1FXAA 4JWSC 4TQ0A 3FILB 1D4BA 1PYWD 2B76B 2WU5B 4WAFA 2W54A 2L52A 1V1OA 2M0AA 2XNAC 2WDRB 3I57A 3EA6A 1OFFA 3GS2A 3HVDA 4C80A 5EE3A 2INNE 2NTSA 4L1BA 1EM7A 1FEHA 3TSSA 1UNSA 1D5ZC 1KLGD 3AE9B 3IAS1 4XWTA 1C9FA 5BMIA 2D5GA 1Q10A 1XF5L 2VZKD 3AEEB 4MT5A 2FBWB 4TQ1A 3BZDB 1GB1A 1WRIA 3IAM1 4FXCA 2QILA 2PVGC 2WS3B 3EUB2 1YJIA 3AE7B 4RH6A 1NEKB 2BT6A 3NS1A 1RWSA 1XLNA 5LNK1 1DOIA 3V05A 1J7BA 4TMAB 3BK1A 2IGDA 2AX5A 4JWUC 4N58A 4PT5A 1SE4A 3ZGZA 1DGJA 1FRDA 3MHZA 2JZPA 4C56C 2KQ4X 1L0XB 1NENB 4M0WA 2PLPA 3BIID 1E0ZA 4UDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C78 A;  2SAK A;  1C77 A;  1BUI C;  1SSN A;  1C79 A;  1C76 A; 
#chains in the Genus database with same CATH topology
 3SDL C;  1XLO A;  2KT7 A;  3HVZ A;  1HXY D;  3I63 C;  4ZDV A;  1OQQ A;  1WH3 A;  5FK9 C;  4LJP B;  4IWP A;  5J2R A;  4XGA B;  3W5U B;  1E6E B;  2K6Q A;  2K1F A;  3TIX A;  2AQ1 B;  1WGY A;  2DAF A;  3Q2A C;  4IC7 B;  3P1M A;  3RFZ B;  3MTN B;  3RNF C;  2CJO A;  2Z0E B;  4XYC A;  3X23 A;  2N7D A;  4K7W A;  4KKJ A;  4AWJ A;  1QT9 A;  2BGF A;  2WXO A;  2H89 B;  3ZJT A;  2BF8 B;  3B2F A;  3IVF A;  1AN8 A;  3H8H A;  3IHP C;  1OEY J;  3NVY A;  3OWE B;  4HJG E;  5H92 C;  1SEB D;  2QJL A;  4EE2 A;  3H6N A;  3UI3 A;  3NUH B;  3FAH A;  3NS8 A;  1C79 A;  4ITK A;  2WXL A;  2WQY B;  1LO5 D;  4AJY B;  3MJ5 A;  1ET9 A;  4KGT A;  1FO4 A;  4WJP A;  4DQO C;  1F2R I;  1WJU A;  2KWD A;  2L0F A;  2WXM A;  5IN7 A;  3TEY A;  2RDH A;  1SE9 A;  1V1P B;  1NVI D;  1FRR A;  1KLU D;  3ONS A;  3PVL A;  4HRS A;  2LGS A;  4MAC A;  1K53 A;  3AE5 B;  3ECI A;  1DYQ A;  3NVV A;  1MHX A;  2MWS B;  4B9K A;  2X8X X;  2PMV A;  2WWZ A;  5JZE B;  2WXG A;  2O2V A;  2REX A;  2LZ6 A;  2I1K A;  4HJK A;  2RPQ A;  2WXP A;  4RCO A;  4A90 A;  1WM2 A;  1TS5 A;  2ZW1 A;  3S2A A;  4W9C A;  1T0Y A;  4N59 A;  2DBY A;  2K0P A;  2BBC A;  3ZNI D;  3A4R A;  4KKI A;  1N61 A;  4US9 A;  2M1M A;  1V5O A;  2D3A A;  2BS2 B;  2M56 B;  1YN5 A;  3UGB B;  1WM3 A;  2AQ3 B;  2XN9 C;  4S0R A;  5BYR A;  5AZF A;  1TY0 A;  4W9L A;  4MEM A;  2N7J A;  3N1Y C;  2AEH A;  3L10 B;  2QC8 A;  3FC4 A;  1A70 A;  1E8W A;  1BUI C;  2Z8L A;  4OZB A;  3T3N A;  4I6L B;  4PS3 A;  5T8I A;  4NQL B;  2MBO A;  3DOW A;  3RD2 A;  3WA0 A;  2JXX A;  4DHJ B;  2B3A A;  2DZI A;  2V1Y A;  4LDT D;  1OQY A;  3DBS A;  1MHH E;  2MEK A;  1WMH B;  3AEC B;  3DVG X;  3AI5 A;  4NAM A;  3QJZ A;  4WQO B;  1RFA A;  4FHJ A;  2KD0 A;  2L32 A;  3ZW3 A;  4K3C A;  2IND C;  3PRP B;  2G4D B;  2MBE A;  3MC8 A;  3JSV B;  4BKT A;  1NYR A;  4MJS B;  1V5T A;  1P0R A;  1FNW A;  2WXJ A;  2AWT A;  4WH4 A;  3LDZ E;  3AE2 B;  2PE6 B;  1YMH E;  3TCA A;  2KYW A;  4GGQ A;  3NJT A;  1SJH D;  1JRU A;  4A20 A;  4E3C A;  1SJE D;  1X1M A;  1F1H A;  3UIP B;  5LXI B;  1WFY A;  2QSD A;  4ANV A;  4HEA 1;  3AB5 A;  3P42 A;  1E8X A;  4YTM B;  2QIE B;  3HM6 X;  2MJE A;  4ZRJ A;  3ZDM C;  2KC1 A;  1WZ3 A;  2HE7 A;  2GBM A;  1TIF A;  1L6V A;  4M8M A;  1WJ4 A;  4KGS A;  4GDK B;  3N1Z C;  4NJ6 A;  4G3X B;  4RMA A;  1FIQ A;  3PZD A;  4J3O D;  4PS7 A;  3APC A;  3ZRF A;  4G50 A;  4RGM A;  1E8Y A;  2NVU I;  4BKS D;  1E7P B;  2GI9 A;  1ACC A;  4XWW A;  2G3Q B;  1VRA B;  3KUD B;  4JQW C;  2BVC A;  5D3I B;  5D94 A;  2M8S A;  3A9K A;  3VTW A;  4CYE A;  4WAA A;  3RZF A;  4KGR A;  3W1S C;  2N9X A;  3P4P B;  1P7E A;  3QC8 B;  3ZJV A;  3T3O A;  3VRA B;  2E6X A;  1F2R C;  1WXM A;  4IOI E;  1YQ4 B;  2JUO A;  4JLC A;  4YSZ B;  3LYY A;  1FFU A;  1VZ7 A;  4PK1 A;  3PLV A;  2UWQ A;  4Q2J A;  3SD5 A;  5MPO A;  2RSU A;  1SIF A;  4HK2 A;  4HWI B;  3UQB A;  3KLS X;  2K9X A;  3P63 A;  2FIF A;  2CR5 A;  3ZIM A;  1IBX A;  3QK0 A;  3O13 A;  1FPY A;  1TYG B;  1ISN A;  3VRB B;  1ZDX A;  3R2T A;  2ASQ A;  3ZXR A;  4WJQ A;  3BY4 B;  2BYE A;  1JCK B;  1AYF A;  3OG5 A;  5GXG B;  2E3T A;  1AAR A;  2LGY A;  4BZA A;  2R2O A;  4DHZ B;  3PZ7 A;  3HRD D;  4P7I A;  2JY6 A;  4ICV A;  4R3D A;  2G1E A;  4A3P A;  2V0G A;  2PVO D;  2QHO A;  1SXT A;  3W2D A;  2LUE A;  2DNF A;  5AUK A;  2BYV E;  3JW0 X;  1I4Q A;  4NZL B;  3AEA B;  1WGH A;  2EKI A;  1YX5 B;  4JPS A;  1WXS A;  4RF1 A;  3AE6 B;  5KHQ A;  4N9F 4;  4IG7 B;  2N9P C;  1WR1 A;  1J7C A;  5G2N A;  4KDL B;  1T3Q A;  1YD8 U;  1E7U A;  3KWV A;  1C4C A;  3ML9 A;  4XC2 A;  2K3U A;  2BB5 A;  3O65 B;  2KMM A;  2CU1 A;  1SB3 C;  2IO3 B;  2Y5C A;  5FKA C;  3W1S A;  2JYT A;  2LRW A;  2JZZ A;  1RFK A;  2KNB A;  2A5U A;  3IXS A;  2NPT B;  5HHD G;  5AUI A;  3L54 A;  4JWS C;  2M0X A;  4TQ0 A;  3FIL B;  1PYW D;  4WAF A;  2W54 A;  2L52 A;  3VH4 B;  2KTR B;  3EA6 A;  3TMP B;  2N1V A;  1E7V A;  1NDD A;  3NY5 A;  3L0W B;  1FEH A;  1KLG D;  5BMI A;  2D5G A;  2KFJ A;  2VZK D;  4MT5 A;  2FCN A;  4KIK B;  3A1Q A;  2PVG C;  3DPD A;  2K8C A;  3NS1 A;  1XLN A;  2XK5 B;  1L2N A;  3D32 A;  3V05 A;  4TMA B;  4E74 A;  2QDF A;  2BYF A;  2LXC A;  2KQ4 X;  1YX6 B;  2MW5 A;  3PV1 A;  2PLP A;  5IOI A;  2KDE B;  3C0R B;  2K5P A;  2KX0 A;  3ZTC A;  3K9P B;  5IO9 A;  4XX5 A;  1C3T A;  2PIA A;  2K8H A;  3GP7 A;  1R4N B;  4EZL A;  5EDS A;  5C2T B;  2RDG A;  1YN3 A;  1DOX A;  4YL8 A;  4WIP A;  4OW0 A;  5DPW A;  1EF1 A;  2IJ0 A;  3N9Y C;  3UIN B;  3R7Q A;  5GMV A;  3RN9 C;  4GLS C;  1Y8R C;  2CU3 A;  2WXK A;  2MRP A;  1T5X D;  4YSX B;  3MC9 A;  1TKY A;  3HIZ A;  3VTV A;  4O1N A;  1SBB B;  1ET6 A;  2C60 A;  1UF0 A;  4MSM B;  3BK2 A;  4W9F A;  4MGY E;  1HZ5 A;  1GNU A;  3MC0 B;  3Q3F A;  5BMG A;  3HM3 A;  4DBG A;  1WIA A;  1YQ3 B;  3EGR A;  1WXQ A;  2GBN A;  3V61 A;  3RNB C;  3AED B;  5CHV C;  4ZRQ A;  3OJ3 A;  2GBR A;  4BBN F;  3VAW A;  2JWZ A;  2BTE A;  2JVC A;  2LGX A;  3VUX A;  1S3S G;  1BML C;  1KRH A;  3PO0 A;  3QWZ B;  1I4P A;  1FFV A;  2FCM A;  5L83 A;  2M4N A;  3N3K B;  3MP9 A;  1Q5W B;  4ZOH C;  4W9D A;  4G0N B;  1WF9 A;  4AUQ C;  3C8Y A;  1MI0 A;  1WMH A;  5AZG A;  2YVC A;  3CF6 E;  2JRH A;  2O6V D;  2JF5 A;  2LGD A;  1I4H A;  2D2Q A;  3QAR A;  4DDG D;  1IGC A;  1UZX B;  2ZZP B;  3TL5 A;  1TZO A;  1RYJ A;  1OGW A;  2HDE A;  3JSV A;  5EE9 A;  2SEB D;  2VH1 A;  1N60 A;  3PSE B;  4II2 B;  4KSK C;  3J9C A;  2IO0 B;  4MJS A;  1L0Y B;  5G55 A;  4AJW A;  3DBR B;  3VVW B;  1WGG A;  2NR2 A;  5AZH A;  1S1Q B;  4HKQ A;  2OHF A;  5HG2 A;  3H9D A;  1XCQ L;  1WYW B;  2KAC A;  1P9D U;  3PS6 A;  3SFE B;  2ZW0 A;  2LVQ A;  3QQ8 B;  1ZDV A;  3Q3M C;  2ZPY A;  1FM0 D;  2RD0 A;  3QA8 A;  1L0V B;  5E6O A;  2OJW A;  2V4L A;  3C19 A;  2WGS A;  2FCS A;  1JWM D;  5LLI A;  1RAX A;  1RRB A;  1HZ6 A;  1XT9 B;  4JX1 C;  3KVF B;  3EHV A;  1T0S C;  1Q0W B;  1UGM A;  4BAX A;  3KW5 B;  3TEW A;  3Q3N C;  3UF8 A;  3DBR I;  4EFO A;  2KO3 A;  1WZ0 A;  3P4R B;  2ZEQ A;  2DYM A;  4W9E A;  3ALB A;  2L8J A;  4WWN A;  4RFB A;  1QOA A;  3DBL I;  4DDI D;  1JAL A;  2BWE S;  1MG8 A;  1PDX A;  2MCN B;  1V86 A;  4IKG A;  2O6V A;  4EZJ A;  2K22 A;  2M19 A;  2V3S A;  2Y5P A;  1MVK A;  5E6P A;  2L3Z A;  2UU7 A;  1GC6 A;  3ZQ4 A;  1P3Q U;  2EMT A;  1UD7 A;  3RT3 B;  2W3S A;  1TJE A;  1ZP0 B;  4X57 B;  1TS3 A;  1TY2 A;  4II3 B;  4GMV A;  4LJO B;  1JWA D;  1SE3 A;  2PPH A;  1WGR A;  2WXI A;  3N20 C;  3AM9 A;  4M01 A;  4ZRP A;  5IP4 D;  4MH8 A;  1YJ1 A;  4M8N A;  3MFG A;  3SEB A;  2LJ5 A;  1G6J A;  1VZ8 A;  4LK0 M;  4FHK A;  2QMT A;  2FNJ B;  4A9A A;  4QAY A;  3DVG Y;  3KWL A;  4USA A;  3U30 A;  1D5M C;  4MGZ E;  2BKR B;  1EU4 A;  1WJ6 A;  4DK5 A;  1TS4 A;  2HD5 B;  1R4M B;  2IPK D;  2NCN A;  3M63 B;  1KLV A;  3B2G A;  1LXD A;  1SSN A;  4L23 A;  4AOF A;  1V9J A;  1L4Z B;  1KFY B;  4M00 A;  2ZNV B;  2GLS A;  3N32 A;  1GG3 A;  2HJ8 A;  3QAQ A;  3ZYY X;  2J4X A;  2MH7 A;  2IBI B;  2MHJ A;  2KLC A;  2K39 A;  5C1Z A;  4DXA B;  1L4D B;  1HA5 A;  4NAW B;  2KMC A;  4HKZ E;  2PTL A;  1P98 A;  2R61 A;  3BVG A;  4EUT A;  1R4M I;  2JZ3 B;  1GPX A;  2DAJ A;  3GZN B;  2J0J A;  2PW9 A;  2MJD A;  1JRO A;  1STE A;  4YT0 B;  1BXT A;  2MSE D;  2MLB A;  1NI2 A;  4OZA A;  2M17 A;  3PRE A;  4URK A;  4OVV A;  3APF A;  2NPT A;  2LJI A;  3W9C B;  3KQ4 A;  3X0W A;  2V3N A;  3URY A;  1SGH A;  3Q14 C;  3FIL A;  4GDL B;  2MBB B;  2DWQ A;  1GOZ A;  3HHM A;  3V62 A;  2MX2 A;  2WP9 B;  3Q8C A;  1SE2 A;  1TBE A;  2NMQ A;  2KTR A;  2GBK A;  2IDY A;  4ZYN A;  2KJH B;  3PGE A;  3GZN I;  1V80 A;  2KFK B;  1YQB A;  2KMA A;  2WU2 B;  5CHW A;  4KIK A;  2CHZ A;  3B0A A;  4REZ A;  1QKZ A;  3U52 E;  3MHS D;  1N5X A;  4OZC A;  2Z0D B;  1QOG A;  3E9S A;  3RYT A;  1H8C A;  4K1R B;  2BWF A;  2TSS A;  2D11 A;  1WWT A;  1VCB A;  2WXN A;  1MJD A;  1IPG A;  4LTU A;  3U2S C;  3VUY A;  4DXF A;  3P2B A;  3N1X C;  5D7G A;  3VR8 B;  2FUG 1;  1M4V A;  3VHT C;  2KWU B;  4F7Z A;  1V97 A;  3FKY A;  2LFI A;  5BO4 B;  1FXA A;  1E90 A;  2B76 B;  1V1O A;  2XNA C;  2WDR B;  3I57 A;  3GS2 A;  5EE3 A;  2EKE C;  2INN E;  4L1B A;  2DZK A;  3TSS A;  4LNI A;  3DVN U;  3SHQ A;  1D5Z C;  4BFR A;  4FAD A;  4XWT A;  2CKH B;  3Q3J A;  1LM8 B;  1XF5 L;  3AEE B;  3PRZ A;  3RZW C;  3TJP A;  3BZD B;  1GB1 A;  2LI5 A;  3R66 C;  3IAM 1;  4FXC A;  2WS3 B;  1YJI A;  3AE7 B;  1NEK B;  5FR6 A;  1VD2 A;  1J7B A;  1BT0 A;  1DGJ A;  4C56 C;  3KUZ A;  2KJ6 A;  1E0Z A;  3A33 B;  3GB1 A;  3SFD B;  3DWM A;  1MG4 A;  3KH0 A;  4NJC A;  4BKG A;  2JXT A;  1GAQ B;  1AWD A;  2GB1 A;  5D6J B;  2ZJD A;  4ANX A;  1QZE A;  2JYE A;  4A8X C;  2KWV B;  2V9H A;  4N6E B;  4KZ0 A;  2ZVN A;  3H7P B;  4CHK A;  2KK8 A;  2O2V B;  4WUR A;  2OJR A;  4GN1 A;  5DPR A;  2L05 A;  1H4R A;  1B1Z A;  3APD A;  2L7R A;  1F77 A;  4MGI E;  5LXH A;  4XZ4 A;  2YLM A;  1L7Y A;  4FJY A;  3WAL A;  3ZDT A;  1D5X C;  2WXF A;  4L2Y A;  2ZNV C;  1PUT A;  3EC8 A;  4WWO A;  4LNO A;  1K50 A;  4NPN A;  4TV3 A;  2FID A;  2KLG A;  4BBN C;  3R8B A;  1TZ1 A;  3TUO A;  2KOX A;  2LHD A;  3SU8 X;  2KDI A;  4TUU A;  4FJV B;  2FE8 A;  3BYT B;  3EFC A;  4ZRI A;  1CQV A;  3WAP A;  3AN1 A;  1YIW A;  4HXD A;  1PGA A;  4XE0 A;  1WXA A;  4RGT A;  3V6C B;  4G11 A;  2ACZ B;  3I9V 1;  1L5P A;  2JSV X;  4DHZ E;  1TKE A;  2C7M B;  3LJ3 A;  3L4P A;  4LNN A;  1I4X A;  1WY8 A;  2N4F A;  3GE8 C;  4RNA A;  2Q5W D;  2HTH A;  3AU5 A;  1EUV B;  1E9M A;  1JWS D;  2DEN B;  2MBH A;  4DHJ D;  1N6Z A;  4ACF A;  3PT2 B;  4ZRK A;  1D6E C;  2RGF A;  1T0R C;  2CHX A;  3IFW B;  2HTM E;  1JQ4 A;  4HPL B;  2WDQ B;  3IT6 B;  3I5J C;  5D3D A;  2LMC A;  2D10 A;  5IKC M;  2INP E;  1MFW A;  3WAO A;  2VRR B;  1XLP A;  1LFD A;  1V1P A;  3Q8B A;  4A6Q A;  2J42 A;  3AE3 B;  1N5W A;  1CJE A;  3ZXV A;  2DZJ A;  3M95 A;  1V8C A;  1NBF C;  1KJT A;  5TR5 A;  1C4A A;  1WSP A;  2IY0 B;  2W3R A;  3GE3 C;  2KDF B;  4WWM A;  3WCQ A;  1NYQ A;  4KVG B;  3SR6 A;  2H88 B;  3ZLZ A;  4JE3 B;  5HFY A;  3RMK C;  2X38 A;  1UUP A;  4IUM B;  4BOS C;  1PGX A;  2KC2 A;  2W82 A;  3BVZ A;  3U7D A;  2L1A A;  1R4N I;  4KDI C;  5D2M B;  3GOE A;  3U4E G;  4IM0 A;  1NI3 A;  2GMI C;  3ML8 A;  4RGN A;  2G45 B;  3IBE A;  3NOB A;  1LGR A;  2Y5B B;  5H8Y E;  1FXI A;  3PHW B;  5CTR C;  3B08 A;  2L0T A;  2W9N A;  4D2K A;  4C7Y A;  4JIO U;  1N63 A;  2KQS A;  4HRO A;  5IA7 A;  1HQR D;  2ON8 A;  3QHT A;  3AE4 B;  3ZVV A;  2PKO A;  1K51 A;  3VUW A;  4RM8 A;  1R7S A;  3Q69 A;  4GOC A;  3ZRC A;  2OED A;  4NY0 A;  4ICU A;  1GB4 A;  3A4S C;  3PPA A;  3IG3 A;  5BMH A;  5G5H A;  2BS4 B;  1C1Y B;  1J19 A;  4I6N B;  1RM6 C;  2MP2 B;  4HLE A;  2XBB C;  3ZNZ B;  3L13 A;  1KM7 A;  4IWO A;  2WXH A;  3AEF B;  1ROE A;  1T6B X;  1V6E A;  2J52 A;  3CSF A;  4IDI A;  4RM9 A;  4ZHP A;  4MSQ B;  3B9J A;  3H7S A;  4C4V B;  2RR9 A;  2QEJ C;  2BYT A;  2WX1 A;  5E6J A;  1FCL A;  1ZXI A;  2KDM A;  2KXJ A;  3P4Q B;  1P1A A;  5TSS A;  4MGK E;  2BPS A;  1WX7 A;  5IAA C;  3DVN V;  4RGO S;  1IP9 A;  4MM3 B;  3L17 A;  1ENF A;  4LLG M;  1WX9 A;  1YN4 A;  4GDK A;  2MJ3 A;  3DBH B;  2K25 A;  1VJK A;  4FBJ B;  4YTP B;  3W1Y A;  4ANW A;  4YTN B;  1KTK A;  2N9K A;  1ZE3 D;  4NQK E;  1SF0 A;  4MH0 E;  3RNE C;  1IYF A;  2GBJ A;  4E71 A;  3Q8E A;  2I38 A;  4BOZ B;  3CST A;  3B1L X;  3TEX A;  1QIL A;  2GOW A;  4FLH A;  2AYO B;  3NZS A;  1B9R A;  2EMS A;  3BIN A;  2G9H D;  5EE1 A;  3DHH C;  3PTF C;  1FNU A;  3JVZ X;  2MA9 B;  4EZK A;  4W9I A;  4HVB A;  1WGD A;  2NTT A;  3OJ4 B;  3WAM A;  1PFD A;  3DBH I;  4ARI A;  5KHO A;  1VR9 A;  2LD9 A;  1WR6 E;  2V3P A;  1HEZ E;  4C00 A;  3A9J B;  3A1Q B;  2IGH A;  4EKU A;  3N30 A;  4HPP A;  1AW7 A;  3NVZ A;  2KJR A;  3UQA A;  2G4S A;  4OVU A;  1MPE A;  4EEW A;  2EEL A;  1FCC C;  3DQV A;  3AEB B;  3QIJ A;  1WJN A;  3RNG C;  3L08 A;  1XCT L;  3EFU A;  5I4D A;  1IUE A;  1UGJ A;  2BW2 A;  1UWX A;  3E56 A;  2UYZ B;  3HK0 A;  4AQ7 A;  2LXA A;  5C23 A;  4EOY A;  3NG0 A;  4MDK E;  1EF5 A;  5DPS A;  4NJ7 A;  1D4B A;  3ZKJ C;  1E8Z A;  2BKF A;  2N7E A;  2WU5 B;  2M0A A;  3H7P A;  1OFF A;  1WI0 A;  2N9E B;  3HVD A;  2NTS A;  1UNS A;  1Q10 A;  3NHE B;  2FBW B;  2NBU A;  4P1C C;  2KN5 A;  4W9G A;  1WRI A;  2KWC A;  2D07 B;  2WX0 A;  4K7S A;  1RWS A;  5LNK 1;  1DOI A;  2VH2 A;  2QCZ A;  3AXC A;  3BK1 A;  2IGD A;  3ZGZ A;  4N58 A;  1SE4 A;  2DZM A;  3MHZ A;  2C9W B;  2KX3 A;  1TT5 B;  1NEN B;  3U8Z A;  3BII D;  4GB9 A;  1I42 A;  4UDU C;  1JML A;  4PYZ A;  1KOT A;  2RMM A;  2VZK B;  3AEG B;  1ZOY B;  3VH3 B;  4IWQ A;  2DHZ A;  1E10 A;  1KF6 B;  1J7A A;  2Y3A A;  4TKN A;  1ZKH A;  3EEC A;  4GSW A;  4I6P A;  1FMA D;  4B0M A;  4US8 A;  2AL3 A;  1N62 A;  1ZUD 2;  4LNK A;  1UH6 A;  3VQI A;  4IM3 A;  1EWC A;  5L95 C;  4DWF A;  2FCQ A;  4GIV A;  3AU4 A;  1WE7 A;  1UBQ A;  3RI7 C;  4PS8 A;  3ENE A;  2JPH A;  5G5G A;  2KDB A;  1FNV A;  2WDV B;  3VR9 B;  5CHF A;  3AMZ A;  2XK5 A;  3T8M A;  1ZGU B;  4FUL A;  3R3M A;  5C3J B;  2JQR B;  1I4R A;  4JL9 A;  4M0W B;  4AS1 A;  1JRP A;  3QX1 A;  2N0S B;  3VFK A;  5JXV A;  2JT4 B;  3NZ3 A;  3DWG C;  3RUL A;  2WXQ A;  4W9K A;  2I1J A;  3VTU A;  3PLU A;  1P7F A;  3P4S B;  2KZR A;  4YXD B;  1M94 A;  2KVZ A;  3V3X A;  2NBW B;  4XDC A;  2MBQ A;  2KN4 A;  2ICI A;  2HJ1 A;  5DCN A;  4XDD A;  2LRU A;  2IGG A;  1DOY A;  4P6V F;  3Q3O C;  1C76 A;  2CS4 A;  1F9J A;  4W9H A;  4KZC A;  2O6V B;  1D3Z A;  4ANU A;  3U7Z A;  2BQQ A;  2JRI B;  2AL6 A;  4HDQ A;  2DX5 B;  3RNA C;  1F52 A;  5JH5 C;  2YEP F;  3BYY B;  3OLM D;  3TEZ A;  3Q6B A;  4HPM B;  2LVP A;  1QLB B;  1JWB D;  2IZV B;  1UBI A;  4A55 A;  1ZXH A;  2N9L A;  1UWM A;  4IW0 A;  1CK1 A;  4LNF A;  2DLB A;  3RPF C;  1XQQ A;  4J6I A;  3TBL D;  3RNC C;  3DCG A;  2KVR A;  2LAS A;  5CX3 A;  1WE6 A;  2ZVO A;  2WYQ A;  3VXW A;  1JWU D;  2PEA A;  4IM2 A;  1QOB A;  3ZNG C;  4ARC A;  4GU2 A;  1EWY C;  4WJO A;  2LEK A;  1CMX B;  3KUC B;  4NNJ B;  3DDC B;  1YJJ A;  3M62 B;  1WRD B;  4GXB A;  1ESF A;  4W9J A;  3ZO5 B;  4PYU A;  1OTR B;  2MP2 A;  1IGD A;  2J0M A;  2KAJ A;  4RF0 A;  2C7H A;  4BVU C;  1ZW7 A;  3Q8F A;  3OAW A;  2XEW A;  4BKS A;  2JWU A;  3HUI A;  4FJZ A;  2V4I B;  2A4Z A;  2K6D B;  3AV8 A;  1FD6 A;  2DYO A;  2WLB A;  3W5V B;  5E6N A;  4B0E A;  4C4V A;  3BWU D;  1GJZ A;  3LB8 C;  1VZ6 A;  2L76 A;  4P16 A;  1KH0 A;  3V6E B;  1U4A A;  1K52 A;  2D3G A;  1UEL A;  1WX8 A;  3H1U A;  1VLB A;  5BYQ A;  1TGZ B;  4MM3 A;  1XO3 A;  2WHI A;  5HI1 A;  3AE1 B;  3LXF A;  1XXG A;  3ZNH B;  2KHW B;  2JX5 A;  2INC C;  4OVZ A;  1J8C A;  2IY1 B;  2CHW A;  1Z5S B;  2KAN A;  3IT4 B;  3CWI A;  1HE8 A;  2ZCB A;  1I35 A;  3R2I A;  1TTN A;  3RCZ A;  2GRI A;  4TSS A;  2J53 A;  1CZP A;  2RDB C;  4MEL A;  2MQJ A;  1C78 A;  1GUA B;  1Z2M A;  5JHB A;  2Z59 B;  1EO6 A;  2NS5 A;  2IO2 B;  2C7N B;  1QQR A;  1J0G A;  5J18 A;  4DXG A;  3ETR A;  4WJN A;  3ZJU A;  3NVW A;  1C77 A;  4KSL C;  4C7Z A;  1C4P A;  4F1S A;  1A5R A;  1I7H A;  3AUL A;  3A9J A;  1QF6 A;  3PZ8 A;  2R2Q A;  3K9O B;  4ASW C;  1TKG A;  4A3O A;  2KTF A;  3KYD D;  1FXT B;  3CIR B;  1QOF A;  2N1W A;  2WNM A;  4KV2 A;  4ZYS A;  5BYS A;  4OHJ A;  3V60 A;  2PE9 A;  1OQR A;  3AE8 B;  3NZU A;  2LWP A;  3DHI C;  1PQS A;  2ONQ A;  3KYC D;  2ZPN A;  2IO1 B;  2W55 A;  3ABV B;  4YWG G;  2SAK A;  2LHE A;  2JU6 X;  5AEK B;  4AP4 C;  4JGH B;  4YSY B;  2LUM A;  2BB6 A;  2J7Q B;  4ZHO A;  3NRZ A;  1PGB A;  5FR3 A;  4LDT B;  3A9K B;  3R7R A;  1E5W A;  3I3T B;  2ZCC A;  4CQN A;  3CMM B;  3BVM A;  1WGK A;  1V49 A;  1LQB A;  4LCD E;  2YEP B;  3DHG C;  1I4G A;  2OOB B;  1WYG A;  4K3B A;  5EE0 A;  4HCN B;  1YNT E;  3T9L A;  2FAZ A;  2LVO A;  1SIJ A;  3PHX B;  4NAW A;  1Q1O A;  3ZUN A;  4F8C B;  2I2Y A;  2LGI A;  1ZPS A;  1Y56 A;  3AH7 A;  3Q8A A;  4K81 A;  2L00 B;  4B95 A;  1JW9 D;  2BS3 B;  2WDT B;  2NBV B;  1TS2 A;  4S17 A;  1K8R B;  4H2A A;  5JHA A;  1XLQ A;  1V81 A;  1IBX B;  2AQ2 B;  1F0Z A;  3UIO B;  3ZTD A;  2RPV A;  1EU3 A;  1VDV A;  4KX6 B;  1XEE A;  2WXR A;  2K8B A;  2L83 A;  2CJN A;  1XD3 B;  5HKH A;  1V2Y A;  4WQM A;  1L6U A;  4P1B C;  4GDL A;  1RLF A;  4FN2 A;  2DYB A;  1T0Q C;  3PRM B;  2FUH B;  2KQ7 A;  3M3J A;  1YOV B;  3MJW A;  3QCA A;  5J17 A;  4WWP A;  4C80 A;  2KFK A;  3RUI B;  4HCP B;  1EM7 A;  4M02 A;  1HTQ A;  3VDZ A;  3AE9 B;  3IAS 1;  5DPT A;  1C9F A;  4TQ1 A;  1WXV A;  2C5L C;  1HTO A;  4CO7 A;  2QIL A;  3EUB 2;  3JYU A;  3WAN A;  2PJH A;  4RH6 A;  2BT6 A;  4FA6 A;  3L16 A;  4PT5 A;  2AX5 A;  4JWU C;  4HDO A;  1OEY A;  1FRD A;  2J0K A;  3DBL B;  3WIM A;  2JZP A;  1L0X B;  2IYD B;  4B6W A;  4M0W A;  2KKC A;  2D3C A;  2D3B A;  1GC7 A;  4K7U A; 
#chains in the Genus database with same CATH homology
 1JML A;  3GB1 A;  3SFD B;  2RMM A;  2VZK B;  3AEG B;  3DWM A;  2K5P A;  4NJC A;  1XLO A;  2JXT A;  1ZOY B;  1GAQ B;  1AWD A;  2GB1 A;  3HVZ A;  1HXY D;  1OQQ A;  2PIA A;  5FK9 C;  1E10 A;  1KF6 B;  1J7A A;  2Y3A A;  3W5U B;  3GP7 A;  1FMA D;  4B0M A;  5C2T B;  4US8 A;  1E6E B;  2RDG A;  1YN3 A;  2JYE A;  1N62 A;  1DOX A;  2AQ1 B;  1ZUD 2;  4A8X C;  4WIP A;  3P1M A;  3RFZ B;  4OW0 A;  3VQI A;  2CJO A;  4N6E B;  1EWC A;  2IJ0 A;  4KKJ A;  1QT9 A;  2WXO A;  2H89 B;  3ZJT A;  3N9Y C;  3B2F A;  4GLS C;  2CU3 A;  4WUR A;  2WXK A;  1AN8 A;  3H8H A;  1T5X D;  3NVY A;  4HJG E;  3OWE B;  4YSX B;  1TKY A;  5H92 C;  4O1N A;  1SBB B;  1SEB D;  1B1Z A;  1ET6 A;  5G5G A;  1FNV A;  2QJL A;  1F77 A;  2WDV B;  4EE2 A;  3BK2 A;  3VR9 B;  3AMZ A;  3UI3 A;  3NUH B;  1HZ5 A;  3FAH A;  1C79 A;  4ITK A;  3MC0 B;  5C3J B;  5BMG A;  2JQR B;  2WXL A;  1I4R A;  1YQ3 B;  3EGR A;  2WQY B;  1LO5 D;  1WXQ A;  3MJ5 A;  1ET9 A;  1D5X C;  2WXF A;  3AED B;  4KGT A;  4L2Y A;  1FO4 A;  1PUT A;  4DQO C;  1F2R I;  4ZRQ A;  1K50 A;  2KWD A;  2WXM A;  4AS1 A;  3TEY A;  1JRP A;  2RDH A;  2N0S B;  3R8B A;  2BTE A;  1V1P B;  3TUO A;  5JXV A;  1BML C;  1NVI D;  1KRH A;  2LHD A;  1FRR A;  1KLU D;  3PO0 A;  1I4P A;  1FFV A;  3NZ3 A;  2FE8 A;  3BYT B;  3MP9 A;  3DWG C;  4ZOH C;  1CQV A;  4HRS A;  4MAC A;  1K53 A;  3AN1 A;  3C8Y A;  1MI0 A;  2WXQ A;  3AE5 B;  1PGA A;  4XE0 A;  1DYQ A;  3NVV A;  1I4H A;  4RGT A;  1MHX A;  1P7F A;  2ACZ B;  3I9V 1;  3P4S B;  1IGC A;  1L5P A;  2JSV X;  4YXD B;  2PMV A;  1TZO A;  1TKE A;  2WXG A;  3V3X A;  4XDC A;  1RYJ A;  2WXP A;  3L4P A;  4RCO A;  4A90 A;  2HDE A;  1I4X A;  1TS5 A;  2ZW1 A;  2KN4 A;  4N59 A;  5EE9 A;  2SEB D;  2ICI A;  1N60 A;  2DBY A;  2Q5W D;  4RNA A;  4XDD A;  3J9C A;  2K0P A;  2IGG A;  1DOY A;  4P6V F;  1L0Y B;  2BBC A;  4KKI A;  1E9M A;  1JWS D;  1C76 A;  1N61 A;  4US9 A;  2BS2 B;  2M56 B;  1YN5 A;  1D6E C;  3U7Z A;  4HKQ A;  2HTM E;  2OHF A;  2AQ3 B;  2XN9 C;  5HG2 A;  5BYR A;  1JQ4 A;  2WDQ B;  3IT6 B;  1XCQ L;  2KAC A;  1TY0 A;  2N7J A;  5D3D A;  3SFE B;  2ZW0 A;  2LMC A;  2YEP F;  1A70 A;  1ZDV A;  3BYY B;  3FC4 A;  1BUI C;  2Z8L A;  3TEZ A;  2INP E;  4OZB A;  1FM0 D;  1QLB B;  1L0V B;  3T3N A;  1JWB D;  1XLP A;  5T8I A;  4A55 A;  1V1P A;  1ZXH A;  2N9L A;  1UWM A;  1JWM D;  3Q8B A;  4A6Q A;  1CK1 A;  2J42 A;  2DLB A;  3AE3 B;  1HZ6 A;  1N5W A;  3RPF C;  4JX1 C;  1CJE A;  1V8C A;  3TEW A;  1C4A A;  1WSP A;  1MHH E;  2MEK A;  3AEC B;  2W3R A;  1JWU D;  4NAM A;  1QOB A;  4ARC A;  3P4R B;  1EWY C;  2LEK A;  2DYM A;  4WWM A;  2L32 A;  3WCQ A;  1NYQ A;  1YJJ A;  4RFB A;  1ESF A;  1QOA A;  3SR6 A;  1JAL A;  2H88 B;  4JE3 B;  1PDX A;  5HFY A;  1NYR A;  1IGD A;  2X38 A;  1UUP A;  2KAJ A;  4RF0 A;  1FNW A;  2WXJ A;  4IKG A;  1PGX A;  4WH4 A;  3Q8F A;  2K22 A;  2M19 A;  3AE2 B;  2Y5P A;  1YMH E;  1MVK A;  2W82 A;  2JWU A;  3BVZ A;  3HUI A;  2V4I B;  3ZQ4 A;  2L1A A;  1SJH D;  3AV8 A;  1FD6 A;  2DYO A;  2WLB A;  3W5V B;  4B0E A;  2W3S A;  3U4E G;  1TJE A;  3BWU D;  1SJE D;  1ZP0 B;  1TS3 A;  1TY2 A;  3LB8 C;  2QSD A;  1JWA D;  1VZ6 A;  1NI3 A;  4P16 A;  1KH0 A;  1SE3 A;  4RGN A;  4HEA 1;  3AB5 A;  3P42 A;  1K52 A;  2WXI A;  4YTM B;  2QIE B;  3AM9 A;  4ZRP A;  1FXI A;  4MH8 A;  5H8Y E;  1VLB A;  5BYQ A;  2MJE A;  3MFG A;  1XO3 A;  3SEB A;  5HI1 A;  4D2K A;  3AE1 B;  1VZ8 A;  1XXG A;  3LXF A;  1L6V A;  4LK0 M;  4C7Y A;  4KGS A;  1N63 A;  4GDK B;  2QMT A;  4A9A A;  2JX5 A;  4HRO A;  4OVZ A;  1HQR D;  3KWL A;  4USA A;  2ON8 A;  1D5M C;  1FIQ A;  4J3O D;  3AE4 B;  4RGM A;  1EU4 A;  1E7P B;  2GI9 A;  1ACC A;  2PKO A;  3IT4 B;  4XWW A;  1K51 A;  1TS4 A;  3CWI A;  1VRA B;  3R2I A;  1R7S A;  3Q69 A;  2GRI A;  4TSS A;  2OED A;  5D3I B;  2J53 A;  2IPK D;  1GB4 A;  1CZP A;  5BMH A;  5G5H A;  2BS4 B;  1C78 A;  3B2G A;  1SSN A;  4L23 A;  1RM6 C;  1QQR A;  1L4Z B;  1KFY B;  4DXG A;  3ETR A;  3ZJU A;  4KGR A;  3NVW A;  3P4P B;  3ZYY X;  1C77 A;  2J4X A;  2MH7 A;  2WXH A;  3AEF B;  4C7Z A;  1ROE A;  1P7E A;  1T6B X;  2J52 A;  4IDI A;  3ZJV A;  3T3O A;  1C4P A;  3VRA B;  1L4D B;  1HA5 A;  1F2R C;  2E6X A;  4ZHP A;  3B9J A;  1I7H A;  4NAW B;  4HKZ E;  2QEJ C;  2BYT A;  5E6J A;  4IOI E;  2PTL A;  1YQ4 B;  1FCL A;  1ZXI A;  1QF6 A;  2KDM A;  3PZ8 A;  4YSZ B;  3P4Q B;  2R61 A;  5TSS A;  3LYY A;  1FFU A;  3BVG A;  1TKG A;  1VZ7 A;  4RGO S;  3CIR B;  1QOF A;  2WNM A;  1GPX A;  4MM3 B;  4Q2J A;  4ZYS A;  5MPO A;  5BYS A;  1ENF A;  4OHJ A;  4LLG M;  3KLS X;  2K9X A;  3P63 A;  2PW9 A;  2MJD A;  1JRO A;  1OQR A;  1STE A;  1YN4 A;  1IBX A;  2MJ3 A;  3AE8 B;  4YT0 B;  1BXT A;  1VJK A;  3O13 A;  2ONQ A;  2W55 A;  4YTP B;  1TYG B;  3ABV B;  4YTN B;  4OZA A;  3VRB B;  1KTK A;  1ZDX A;  1ZE3 D;  2N9K A;  2SAK A;  1SF0 A;  4YWG G;  2LHE A;  2JU6 X;  3R2T A;  3Q8E A;  2I38 A;  4YSY B;  3W9C B;  2LJI A;  3KQ4 A;  2LUM A;  2V3N A;  3TEX A;  3URY A;  2BB6 A;  1JCK B;  4ZHO A;  3NRZ A;  1PGB A;  3FIL A;  1AYF A;  4GDL B;  5FR3 A;  1QIL A;  2DWQ A;  5GXG B;  1GOZ A;  2WP9 B;  3Q8C A;  1SE2 A;  2E3T A;  4CQN A;  1B9R A;  2NMQ A;  2G9H D;  5EE1 A;  3BVM A;  1WGK A;  2YEP B;  1I4G A;  1FNU A;  1WYG A;  5EE0 A;  2IDY A;  3PZ7 A;  3HRD D;  1YNT E;  2NTT A;  4R3D A;  2G1E A;  1SIJ A;  1PFD A;  2V0G A;  2PVO D;  2WU2 B;  1SXT A;  3W2D A;  4ARI A;  4REZ A;  1QKZ A;  5AUK A;  1VR9 A;  3U52 E;  4NZL B;  1I4Q A;  3AEA B;  1N5X A;  2EKI A;  2V3P A;  1HEZ E;  4OZC A;  2I2Y A;  2LGI A;  4JPS A;  2IGH A;  4RF1 A;  1QOG A;  3AE6 B;  3E9S A;  1ZPS A;  1Y56 A;  1AW7 A;  3AH7 A;  3Q8A A;  1JW9 D;  2BS3 B;  1J7C A;  3NVZ A;  2TSS A;  1TS2 A;  4H2A A;  1MPE A;  1WWT A;  1T3Q A;  2EEL A;  1FCC C;  2WXN A;  1XLQ A;  1C4C A;  3AEB B;  3KWV A;  1IBX B;  2AQ2 B;  1F0Z A;  2K3U A;  2BB5 A;  2KMM A;  1XCT L;  5I4D A;  1IUE A;  1UGJ A;  2RPV A;  2BW2 A;  1SB3 C;  1UWX A;  1EU3 A;  3E56 A;  4LTU A;  1VDV A;  4KX6 B;  3U2S C;  4AQ7 A;  4DXF A;  1XEE A;  2WXR A;  2Y5C A;  5D7G A;  2L83 A;  5FKA C;  3VR8 B;  3W1S A;  2JYT A;  2FUG 1;  1M4V A;  2CJN A;  1RFK A;  3IXS A;  4WQM A;  1L6U A;  1V97 A;  2LFI A;  5HHD G;  5AUI A;  1FXA A;  4JWS C;  4TQ0 A;  3FIL B;  1D4B A;  1PYW D;  2B76 B;  2WU5 B;  4WAF A;  2W54 A;  2L52 A;  1V1O A;  2M0A A;  2XNA C;  2WDR B;  3I57 A;  3EA6 A;  1OFF A;  3GS2 A;  3HVD A;  4C80 A;  5EE3 A;  2INN E;  2NTS A;  4L1B A;  1EM7 A;  1FEH A;  3TSS A;  1UNS A;  1D5Z C;  1KLG D;  3AE9 B;  3IAS 1;  4XWT A;  1C9F A;  5BMI A;  2D5G A;  1Q10 A;  1XF5 L;  2VZK D;  3AEE B;  4MT5 A;  2FBW B;  4TQ1 A;  3BZD B;  1GB1 A;  1WRI A;  3IAM 1;  4FXC A;  2QIL A;  2PVG C;  2WS3 B;  3EUB 2;  1YJI A;  3AE7 B;  4RH6 A;  1NEK B;  2BT6 A;  3NS1 A;  1RWS A;  1XLN A;  5LNK 1;  1DOI A;  3V05 A;  1J7B A;  4TMA B;  3BK1 A;  2IGD A;  2AX5 A;  4JWU C;  4N58 A;  4PT5 A;  1SE4 A;  3ZGZ A;  1DGJ A;  1FRD A;  3MHZ A;  2JZP A;  4C56 C;  2KQ4 X;  1L0X B;  1NEN B;  4M0W A;  2PLP A;  3BII D;  1E0Z A;  4UDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...