1C7OA

Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
394
structure length
394
Chain Sequence
MIYDFTTKISRKNLGSLKWDLMYSQNPEVGNEVVPLSVADMEFKNPPELIEGLKKYLDETVLGYTGPTEEYKKTVKKWMKDRHQWDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELLEKDGYYTIDFQKLEKLSKDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHTVFQSIDEQLADKTITFTAPSKTFNIAGMGMSNIIIKNPDIRERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPLIEGTYLQWIDFRALKMDHKAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAAPSSVIQESLERLNKALKDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTALYSIN
publication title Crystal structure of cystalysin from Treponema denticola: a pyridoxal 5'-phosphate-dependent protein acting as a haemolytic enzyme.
pubmed doi rcsb
source organism Treponema denticola
molecule tags Transferase
total genus 145
structure length 394
sequence length 394
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1c7oA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1c7oA01
3COGA 2JJEA 3LVLB 2X8UA 2ZSMA 1Y4IA 3JZLA 3P1TA 4M2MA 3BV0A 5F8VA 4F5LA 2YCPA 1AAMA 1DGDA 1AIBA 4RJYA 1U08A 1VEFA 5LH9A 3PPLA 3RBLA 2R5CA 2CINA 4U1TA 2EPJA 4MGRA 4TMRA 4XK1A 3OP7A 1BW0A 3E2ZA 3RQ1A 4AO4A 4EMYA 1QGNA 4GEBA 2EZ1A 1CZCA 2JJGA 2JGTA 3RCHB 2VMVA 1V2EA 3ACZA 3ELEA 3PA9A 1IBJA 2CTZA 3A2BA 1CZEA 1EJIA 2Z9WA 3ZRQA 2VGUA 1IUGA 2C0RA 3K28A 4CXRA 4LW4A 4MSOA 4XJOA 1D2FA 3PDBB 1ASDA 4ZDLA 1B9HA 5J8QA 1M0OA 4WP0A 2CSTA 3K7YA 4F5KA 2WK8A 1ASBA 3H14A 5I92A 1JG8A 2AY6A 2VGZA 1AX4A 5DJ9A 2VMTA 4M2KA 4ZASA 1I41A 1O62A 2BWOA 3FZ6A 4WYDA 4Q76A 4WXFA 3AATA 3PDXA 4ZSYA 4JEWA 5D95A 1P3WA 5G4JA 3W1IA 2EO5A 3IHJA 2HUUA 3BN1A 5G0AA 1AJRA 1JS6A 1MDOA 2ZY3A 4FL0A 1UKJA 2CJDA 4W8IA 1M4NA 3ATHA 3LVJA 2VI8A 2FN6A 1UU2A 2OKKA 3N75A 2Z9XA 4MQRA 4O6ZA 2AEVA 3JTXA 3R9AA 1CQ7A 1DJEA 2YCTA 2X5DA 3EI6A 3GZCA 3AEOA 2FYFA 2YRRA 2D65A 2VMUA 3HVYA 2C7TA 2ORDA 5M4BA 4GE7A 1YIYA 3T32A 1EG5A 3AEMC 3FTBA 1SF2A 1TOJA 2PB2A 2OATA 3FVXA 1GEWA 3LY1A 1J04A 4RM1A 1W7LA 3DR4A 2VMSA 1KMKA 3F0HA 4RAEA 4XEWA 4A0RA 4ZM4A 8AATA 3AENB 4ADEA 4QGRA 4A6RA 4H51A 1QZ9A 3RUYA 4B9BA 2O7CA 1DJ9A 2FQ6A 4WYEA 1QITA 1AY5A 2D66A 3GR9A 3WGCA 3ZZJA 1MGVA 2F8JA 5EUDA 1AHXA 3WKRA 2AATA 4WB0B 4LW2A 5FT5A 3TQXA 1CL1A 3FFHA 3QN6A 1VP4A 2DGLA 4UQVA 3UE8A 4ZDPA 3AENA 2DOUA 1ASAA 1H0CA 4BA5A 1ECXA 2VGWA 1ELQA 4ZSWA 3NDNA 3NTJA 4MKJA 4UHMA 4OTLA 1G7WA 3P6KA 5E3KA 4GSAA 4XJPA 2ZSLA 1SZKA 2VMZA 1RV3A 1WYTB 2C44A 2YRIA 4WXBA 1B4XA 3FDDA 1X0MA 4IW7A 4ITGA 2O1BA 1W7NA 4IYOB 4UOYA 1SVVA 1TOKA 2E7JA 3DZZA 3AOVA 1CQ6A 1GDEA 1ZODA 4BQ0A 5G2QA 2GSAA 1OHWA 4XJLA 1YJSA 2QB2A 3NUBA 4MY5A 3QPGA 5DJ1A 4A72A 2D7ZA 4ZLVA 2Z9UA 1WYTA 3JWBA 3RBFA 4E77A 3DXVA 1OHVA 1QISA 1ELUA 1LC7A 2OQXA 4LNJA 4WD2A 1H1CA 1S0AA 3HDOA 1GC2A 2AY9A 2QLRA 3HLMA 3F9TA 4P7YA 4E3QA 1MLZA 4OBVA 9AATA 1B8GA 3MEBA 4IYOA 4A6TA 4ADDA 4XJMA 1X28A 4E1OA 5EIGB 3WCOA 2HUIA 3EI9A 2BYLA 3CAIA 1IX7A 3GZDA 2AY5A 2Z1ZA 2Z67A 4A6UA 1BJWA 3LVMA 1KKPA 3LV2A 1KL2A 3WX9A 2ZC0A 3BB8A 3AOWA 5BJ4A 3KGWA 3AEMA 1RVYA 4PVFA 2VGVA 2ZP7A 2C81A 1B5OA 1GBNA 5G4IA 3FZ7A 4CBRA 2HZPA 4Q31A 2YKVA 3QM2A 4LC3A 1I43A 4OBUA 5EIGA 1M0NA 4ATQA 4F5IA 3EZSA 1S06A 2W7DA 1AAWA 1LC5A 1QJ3A 1MLYA 3MC6C 3FVUA 3M5UA 1SZUA 1ASEA 1T3IA 2BI5A 4WYCA 4PIWA 1WYVB 4Y0HA 1ARHA 2R2NA 4RJ0A 3KKIA 1ARGA 4W1VA 4W1WA 4K2BA 1N2TA 2VYCA 4JE5D 4F5JA 3TATA 1IAYA 1TOIA 3BWNA 5K8BA 2HUFA 2BHXA 1MAPA 4NOGA 4CXQA 1OHYA 1W23A 3KE3A 3UWCA 4GRXA 4W91A 1JF9A 1ARTA 1WYVA 2AY7A 3N5MA 2W7IA 1AKCA 2X3LA 3NU8A 2DKJA 2E54A 2E7IA 5M4DA 3BC8A 1M0QA 2HOXA 4N0BA 2FNIA 1UU1A 3G8MA 3R4TA 4K2IA 1QIRA 2EH6A 5DB5A 2AEUA 5FT6A 3FCRA 4JEZA 4DBCA 1V2DA 4F5FA 4FFCA 3PAAA 2ZY2A 1X2AA 1C9CA 2DGKA 3A9YA 2VMNA 4ZWMA 1PMMA 1FC4A 1M0PA 3F6TA 2JISA 2EZ2A 2TPLA 3FSLA 2GMUA 4OYTA 1Z7DA 4J5UA 3NX3A 3PD6B 4KYOA 3B1CA 4R5ZA 3B46A 1DKAA 1BS0A 3GZDC 1O61A 4P3MA 1D7VA 4EFFA 2CJHA 2W7FA 3FQAA 3NU7A 4DQ6A 1OATA 2CANA 1B9IA 3CQ5A 3LG0A 3L8AA 4BA4A 4EB7A 3TFUA 1W7MA 1DTYA 2VMXA 7AATA 3PGYA 1OXOA 1SPAA 2D61A 4AOAA 3PD6A 1YNUA 2Z1YA 1UU0A 2VI9A 5FT8A 2PB0A 3MAFA 3AELA 3CQ6A 3II0A 5G2PA 1WYUB 3AV7A 2OKJA 1BKGA 2O0RA 1AHEA 4JEYA 1TATA 2D7YA 3MC6A 1AHYA 1SFFA 1QJ5A 2Q7WA 3JW9A 1AHGA 2BI1A 3FKDA 2YHKA 3VOMA 1AHFA 1AKAA 3I4JA 2FM1A 3WLXA 3A9XA 2VIAA 3BWOA 4R8DA 4XAUA 2W7KA 2ZY4A 1WYUA 4TV7A 4ZDOA 2AY8A 3WCNA 3ZRRA 4ADBA 3BWNC 1XI9A 3AEJA 1D7UA 1LS3A 1SZSA 2YCNA 3BCXA 3DODA 1GC4A 3PJ0A 2FNUA 2XH1A 3ECDA 4MQPA 3CBFA 3K40A 2BWPA 1IVRA 2HOYA 3LWSA 4EB5A 1M7YA 4GE9A 2V0YA 3RI6A 2CY8A 2R5EA 3HT4A 3WY7A 2JJHA 1TARA 3G7QA 4AO9A 4F4EA 4JF0A 2OGAA 2WKAA 1IX6A 3BS8A 1ASNA 3B1EA 3HQTA 1CL2A 4A00A 2ZY5A 5TF5A 1O69A 2GQNA 4IXZA 3NYSA 3UAKA 4MKKA 2VGSA 3MAUA 3QGUA 1BQDA 3L44A 1ORDA 4IY7A 4U2HA 3DXWA 4JE5A 4OCAA 1D7SA 3GSBA 1FG3A 2CB1A 3MBBA 3VAXA 4ZWVA 2AY4A 2Z61A 2WK9A 1S08A 3EZ1A 3NUIA 3EI8A 4I8AA 1GCKA 5C6UA 3PIUA 2QA3A 4WXGA 2HP1A 2D64A 3NYTA 1C7OA 1X29A 3ZRPA 2W8JA 1S07A 5F9SA 2AY2A 4PFNA 1V2FA 2YKYA 1BJNA 2HORA 1LC8A 1TASA 4XQ2A 1W3UA 1G4XA 2RFVA 1C7NA 2XBNA 4E3RA 2QMAA 2VLHA 2G6WA 1YIZA 1TPLA 3VK3A 2VMOA 4Q6RA 1AMQA 3DRDA 3MADA 4B98A 2BIAA 4R2NA 3EUCA 2D5YA 1CQ8A 3ASAA 3NRAA 4MQQA 1DJUA 5DX5A 3DYDA 1ASFA 3FQ8A 1E5FA 1RV4A 3FDBA 3FRKA 3N0LA 4OT8A 1IX8A 4W5KA 3E9KA 1MDXA 2CH2A 5G09A 3E2FA 3WZFA 4UHNA 3AEJC 4Y0DA 3VK2A 2ZYJA 5IWQA 4ITXA 4A0HA 3BCAA 3CQ4A 2BIEA 2VMPA 3HBXA 2OGEA 4HF8A 3GETA 2BIGA 1YJZA 2VGTA 2R0TA 1ZC9A 4WLHA 1AMAA 3GWPA 4ATPA 1B5PA 2CFBA 3TFTA 1KKJA 4R5FA 2W7EA 2PO3A 3NNKA 4ISYA 1ARIA 1ZOBA 4A0GA 1MAQA 1PFFA 1OXPA 2Z20A 2BI3A 2EGYA 4IXSA 3H7FA 1BJOB 2DGMA 3FVSA 4JF1A 4KXKA 2VMWA 2W8TA 1TOGA 4Y0IA 2VLFA 4GE4A 4RITA 4BHDA 2ZUKA 3VK4A 5EAAA 1Z3ZA 1GEXA 2QB3A 3ASBA 2NMPA 4LNLA 2BWNA 3W1HA 3RCHA 1LW5A 1BT4A 1M6SA 4N0WA 3G0TA 1WSTA 3MKJA 4TN4A 4HVKA 1JS3A 4RLGA 2D63A 3MAFB 3GBXA 4OC9A 3OKSA 2VIBA 1AJSB 3WKSA 1GC3A 1M32A 5HDMA 1BJOA 2GMSA 4RKDA 3FQ7A 3NYUA 1ASCA 3PDBA 3VP6A 3B8XA 4F5HA 1LK9A 4A0FA 1CS1A 3ZZKA 1GC0A 2E7UA 1AY8A 1J32A 1AICA 4W1XA 3EI5A 3ISLA 3HL2A 4WYGA 2W8WA 1IAXA 2ZJGA 1ASGA 5M49A 3E6GA 1YAAA 1YJYA 1AJSA 1G4VA 2W7MA 5D5SA 4ZM3A 2YOBA 1E5EA 3TCMA 1RVUA 3A8UX 3Q8NA 2W7HA 1C0NA 3DR7A 1VJOA 1MDZA 3I16A 3WGBA 1AY4A 2VMYA 3EIAA 3JWAA 1G7XA 3QBOA 1IJIA 2DR1A 2VMQA 4ZAHA 2WK7A 4GDYA 2YKUA 3DU4A 4EU1A 2HOZA 2CJGA 4IXOA 1D7RA 3EIBA 1KMJA 1YOOA 2YKXA 4L0OA 4M2JA 1CJ0A 1DFOA 1S09A 5LHAA 3LVKA 5EFSA 1C4KA 3QHXA 4RIZA 1ARSA 5EAVA 3QI6A 1C7GA 4CBSA 1WKHA 1N8PA 5AX8A 3ELPA 1I48A 2AY1A 3A9ZA 4RKCA 1AMSA 3D6KA 1I29A 3B1DA 2DKBA 3FD0A 1AIAA 2HP2A 2QBTA 3E2YA 4WYAA 5M46A 4KAMA 4JEXA 4AZJA 4F5GA 1GD9A 3JU7A 3KGXA 4LNMA 4OMAA 3GJUA 4AZKA 2Z9VA 4WLJA 4WBTA 3I5TA 5JAYA 2BYJA 3DC1A 4WB0A 4BMKA 4IX8A 2W8UA 3FFRA 3USFA 1DGEA 2W7LA 2AY3A 2JG2A 4JEVA 2W7JA 5HHYA 3BCBA 1TOEA 4K2MA 2BI9A 5EQCA 5HXXA 1BQAA 4UHOA 5FT4A 4ADCA 4DGTA 1LW4A 2V1PA 1WKGA 3FZ8A 4J8LA 3E77A 1N31A 4F5MA 2X5FA 1FG7A 1PMOA 4PFFA 5BJ3A 2CH1A 2BKWA 2GB3A 1ASMA 2VMRA 3EI7A 1KL1A 4CVQA 1BJ4A 2W7GA 2BI2A 1AMRA 1GEYA 5E4ZA 5EUEA 1EQBA 1ASLA 1LKCA 1XEYA 1PG8A 4Q75A 3IF2A 5E5IA 2R5CB 1AKBA 1O4SA 4WYFA 3W1JA 1V72A 3AEPA 2JJFA 3E2ZB 4AH3A 5EUNA 2W8VA 3HMUA
chains in the Genus database with same CATH superfamily
3COGA 2JJEA 3LVLB 2X8UA 2ZSMA 1Y4IA 3JZLA 3P1TA 4M2MA 3BV0A 5F8VA 4F5LA 3N4XA 2YCPA 1AAMA 1DGDA 1AIBA 4RJYA 1U08A 1VEFA 5LH9A 3PPLA 3RBLA 2R5CA 2CINA 4U1TA 2EPJA 4MGRA 4TMRA 4XK1A 3OP7A 1BW0A 3E2ZA 3RQ1A 4AO4A 4EMYA 1QGNA 4GEBA 2EZ1A 1CZCA 2JJGA 2JGTA 3RCHB 2VMVA 1V2EA 3ACZA 3ELEA 3PA9A 1IBJA 2CTZA 3A2BA 1CZEA 1EJIA 2Z9WA 3ZRQA 2VGUA 3N4RA 1IUGA 2C0RA 3K28A 4CXRA 4LW4A 4MSOA 2KFPA 4XJOA 1D2FA 3PDBB 1ASDA 4ZDLA 1B9HA 5J8QA 1M0OA 4WP0A 2CSTA 3K7YA 4F5KA 2WK8A 1ASBA 3H14A 5I92A 1JG8A 2AY6A 2VGZA 1AX4A 5DJ9A 2VMTA 4M2KA 4ZASA 1I41A 1O62A 2BWOA 3FZ6A 4WYDA 4Q76A 2FKIA 4WXFA 3AATA 3PDXA 4ZSYA 4JEWA 5D95A 1P3WA 5G4JA 3W1IA 2EO5A 3IHJA 2HUUA 3BN1A 1KAFA 5G0AA 1AJRA 1JS6A 1MDOA 2ZY3A 4FL0A 1UKJA 2CJDA 3N7NA 4W8IA 1M4NA 3ATHA 3LVJA 2VI8A 2FN6A 1UU2A 2OKKA 3N75A 2Z9XA 4MQRA 4O6ZA 2AEVA 3JTXA 3R9AA 1CQ7A 1DJEA 2YCTA 2X5DA 3EI6A 3GZCA 3AEOA 2FYFA 2YRRA 2D65A 2VMUA 3HVYA 2C7TA 2ORDA 5M4BA 4GE7A 1YIYA 3T32A 1EG5A 3AEMC 3FTBA 1SF2A 1TOJA 2PB2A 2OATA 3FVXA 1GEWA 3LY1A 1J04A 4RM1A 1W7LA 3DR4A 2VMSA 1KMKA 3F0HA 4RAEA 4XEWA 4A0RA 4ZM4A 8AATA 3AENB 4ADEA 4QGRA 4A6RA 4H51A 1QZ9A 3RUYA 4B9BA 2O7CA 1DJ9A 2FQ6A 4WYEA 1QITA 1AY5A 2D66A 3GR9A 3WGCA 3ZZJA 1MGVA 2F8JA 5EUDA 1AHXA 3WKRA 5KTBA 2AATA 4WB0B 4LW2A 5FT5A 3TQXA 1CL1A 3FFHA 3QN6A 1VP4A 2DGLA 4UQVA 3UE8A 4ZDPA 3AENA 2DOUA 1ASAA 1H0CA 4BA5A 1ECXA 2VGWA 1ELQA 4ZSWA 3NDNA 3NTJA 4MKJA 4UHMA 4OTLA 1G7WA 3P6KA 5E3KA 4GSAA 4XJPA 2ZSLA 1SZKA 2VMZA 1RV3A 1WYTB 2C44A 2YRIA 4WXBA 1B4XA 3FDDA 1X0MA 4IW7A 4ITGA 2O1BA 1W7NA 4IYOB 4UOYA 1SVVA 1TOKA 2E7JA 3DZZA 3AOVA 1CQ6A 1GDEA 1ZODA 4BQ0A 5G2QA 2GSAA 1OHWA 4XJLA 1YJSA 2QB2A 3NUBA 4MY5A 3QPGA 5DJ1A 4A72A 2D7ZA 4ZLVA 2Z9UA 1WYTA 3JWBA 3RBFA 4E77A 3DXVA 1OHVA 1QISA 1ELUA 1LC7A 2OQXA 4LNJA 4WD2A 1H1CA 1S0AA 3HDOA 1GC2A 2AY9A 2QLRA 3HLMA 3F9TA 4P7YA 4E3QA 1MLZA 4OBVA 9AATA 1B8GA 3MEBA 4IYOA 4A6TA 4ADDA 4XJMA 1X28A 4E1OA 5EIGB 3WCOA 2HUIA 3EI9A 2BYLA 3CAIA 1IX7A 3GZDA 2AY5A 2Z1ZA 2Z67A 4A6UA 1BJWA 3LVMA 1KKPA 3LV2A 1KL2A 3WX9A 2ZC0A 3BB8A 3AOWA 5BJ4A 3KGWA 3AEMA 1RVYA 4PVFA 2VGVA 2ZP7A 2C81A 1B5OA 1GBNA 5G4IA 3FZ7A 4CBRA 2HZPA 4Q31A 2YKVA 3QM2A 4LC3A 1I43A 4OBUA 5EIGA 1M0NA 4ATQA 4F5IA 3EZSA 1S06A 2W7DA 1AAWA 1LC5A 1QJ3A 1MLYA 3MC6C 3FVUA 3M5UA 1SZUA 1ASEA 1T3IA 2BI5A 4WYCA 4PIWA 1WYVB 4Y0HA 1ARHA 2R2NA 4RJ0A 3KKIA 1ARGA 4W1VA 4W1WA 4K2BA 1N2TA 2VYCA 4JE5D 4F5JA 3TATA 1IAYA 1TOIA 3BWNA 5K8BA 2HUFA 2BHXA 1MAPA 4NOGA 4CXQA 1OHYA 1W23A 3KE3A 3UWCA 4GRXA 4W91A 1JF9A 1ARTA 1WYVA 2AY7A 3N5MA 2W7IA 1AKCA 2X3LA 3NU8A 2DKJA 2E54A 2E7IA 5M4DA 3BC8A 1M0QA 2HOXA 4N0BA 2FNIA 1UU1A 3G8MA 3R4TA 4K2IA 1QIRA 2EH6A 5DB5A 2AEUA 5FT6A 3FCRA 4JEZA 4DBCA 1V2DA 4F5FA 4FFCA 3PAAA 2ZY2A 1X2AA 1C9CA 2DGKA 3A9YA 2VMNA 4ZWMA 1PMMA 1FC4A 1M0PA 3F6TA 2JISA 2EZ2A 2TPLA 3FSLA 2GMUA 4OYTA 1Z7DA 4J5UA 3NX3A 3PD6B 4KYOA 3B1CA 4R5ZA 3B46A 1DKAA 1BS0A 3GZDC 1O61A 4P3MA 1D7VA 4EFFA 2CJHA 2W7FA 3FQAA 3NU7A 4DQ6A 1OATA 2CANA 1B9IA 3CQ5A 3LG0A 3L8AA 4BA4A 4EB7A 3TFUA 2QSRA 1W7MA 1DTYA 2VMXA 7AATA 3PGYA 1OXOA 1SPAA 2D61A 4AOAA 2G7JA 3PD6A 1YNUA 2Z1YA 1UU0A 2VI9A 5FT8A 2PB0A 3MAFA 3AELA 3CQ6A 3II0A 5G2PA 1WYUB 3H9XA 3AV7A 2OKJA 1BKGA 2O0RA 1AHEA 4JEYA 1TATA 2D7YA 3MC6A 1AHYA 1SFFA 1QJ5A 2Q7WA 3JW9A 1AHGA 2BI1A 3FKDA 2YHKA 3VOMA 1AHFA 1AKAA 3I4JA 2FM1A 3WLXA 3A9XA 2VIAA 3BWOA 4R8DA 4XAUA 2W7KA 2ZY4A 2WB6A 1WYUA 4TV7A 4ZDOA 2AY8A 3WCNA 3ZRRA 4ADBA 3BWNC 1XI9A 3AEJA 1D7UA 1LS3A 1SZSA 2YCNA 3BCXA 3DODA 1GC4A 3PJ0A 2FNUA 2XH1A 3ECDA 4MQPA 3CBFA 3K40A 2BWPA 1IVRA 2HOYA 3LWSA 4EB5A 1M7YA 4GE9A 2V0YA 3RI6A 2CY8A 2R5EA 3HT4A 3WY7A 2JJHA 1TARA 3G7QA 4AO9A 4F4EA 4JF0A 2OGAA 2WKAA 1IX6A 3BS8A 1ASNA 3B1EA 3HQTA 1CL2A 4A00A 2ZY5A 5TF5A 1O69A 2GQNA 4IXZA 3NYSA 3UAKA 4H63Q 4MKKA 2VGSA 3MAUA 3QGUA 1BQDA 3L44A 1ORDA 4IY7A 4U2HA 3DXWA 4JE5A 4OCAA 1D7SA 3GSBA 1FG3A 2CB1A 3MBBA 3VAXA 4ZWVA 3N4SA 2AY4A 2Z61A 2WK9A 1S08A 3EZ1A 3NUIA 3EI8A 4I8AA 1GCKA 5C6UA 3PIUA 2QA3A 4WXGA 2HP1A 2D64A 3NYTA 1C7OA 1X29A 3ZRPA 2W8JA 1S07A 5F9SA 2AY2A 4PFNA 1V2FA 2YKYA 1BJNA 2HORA 1LC8A 1TASA 4XQ2A 1W3UA 1G4XA 2RFVA 1C7NA 2XBNA 4E3RA 2QMAA 2VLHA 2G6WA 1YIZA 1TPLA 3VK3A 2VMOA 4Q6RA 1AMQA 3DRDA 3MADA 4B98A 2BIAA 4R2NA 3EUCA 2D5YA 1CQ8A 3ASAA 3NRAA 4MQQA 1DJUA 5DX5A 3DYDA 1ASFA 3FQ8A 1E5FA 1RV4A 3FDBA 3FRKA 3N0LA 4OT8A 1IX8A 4W5KA 3E9KA 1MDXA 2CH2A 5G09A 3E2FA 3WZFA 4UHNA 3AEJC 4Y0DA 3VK2A 2ZYJA 5IWQA 4ITXA 4A0HA 3BCAA 3CQ4A 2BIEA 2VMPA 3HBXA 2OGEA 4HF8A 3GETA 2BIGA 1YJZA 2VGTA 2R0TA 1ZC9A 4WLHA 1AMAA 3GWPA 4ATPA 1B5PA 2CFBA 3TFTA 1KKJA 4R5FA 2W7EA 2PO3A 3NNKA 4ISYA 1ARIA 1ZOBA 4A0GA 1MAQA 1PFFA 1OXPA 2Z20A 2BI3A 2EGYA 4IXSA 3H7FA 1BJOB 2DGMA 3FVSA 4JF1A 4KXKA 2VMWA 2W8TA 1TOGA 4Y0IA 2VLFA 4GE4A 4RITA 4BHDA 2ZUKA 3VK4A 5EAAA 1Z3ZA 1GEXA 2QB3A 3ASBA 2NMPA 4LNLA 2A1VA 2BWNA 3W1HA 3RCHA 1LW5A 1BT4A 1M6SA 4N0WA 3G0TA 1WSTA 3MKJA 4TN4A 4HVKA 1JS3A 4RLGA 2D63A 3MAFB 3GBXA 4OC9A 3OKSA 2VIBA 1AJSB 3WKSA 1GC3A 1M32A 5HDMA 1BJOA 2GMSA 4RKDA 3FQ7A 3NYUA 1ASCA 3PDBA 3VP6A 3B8XA 4F5HA 1LK9A 4A0FA 1CS1A 3ZZKA 1GC0A 2EYQA 2E7UA 1AY8A 1J32A 1AICA 4W1XA 3EI5A 3ISLA 3HL2A 4WYGA 2W8WA 1IAXA 2ZJGA 1ASGA 5M49A 3E6GA 1YAAA 1YJYA 1AJSA 1G4VA 2W7MA 5D5SA 4ZM3A 2YOBA 1E5EA 3TCMA 1RVUA 3A8UX 3Q8NA 2W7HA 1C0NA 3DR7A 1VJOA 1MDZA 3I16A 3WGBA 1AY4A 2VMYA 3EIAA 3JWAA 1G7XA 3QBOA 1IJIA 2DR1A 2VMQA 4ZAHA 2WK7A 4GDYA 2YKUA 3DU4A 4EU1A 2HOZA 2CJGA 4IXOA 1D7RA 3EIBA 1KMJA 1YOOA 2YKXA 4L0OA 4M2JA 1CJ0A 1DFOA 1S09A 5LHAA 3LVKA 5EFSA 1C4KA 3QHXA 4RIZA 1ARSA 5EAVA 3QI6A 1C7GA 4CBSA 1WKHA 1N8PA 4K05A 5AX8A 3ELPA 1I48A 2AY1A 3A9ZA 4RKCA 1AMSA 3D6KA 1I29A 3B1DA 2DKBA 3FD0A 1AIAA 2HP2A 2QBTA 3E2YA 4WYAA 5M46A 4KAMA 4JEXA 4AZJA 4F5GA 1GD9A 3JU7A 3KGXA 4LNMA 4OMAA 3GJUA 4AZKA 2Z9VA 4WLJA 4WBTA 3I5TA 5JAYA 2BYJA 3DC1A 4WB0A 4BMKA 4IX8A 2W8UA 3FFRA 3USFA 1DGEA 2W7LA 2AY3A 2JG2A 4JEVA 2W7JA 5HHYA 3BCBA 1TOEA 4K2MA 2BI9A 5EQCA 5HXXA 1BQAA 4UHOA 5FT4A 4ADCA 4DGTA 1LW4A 2V1PA 1WKGA 3FZ8A 4J8LA 3E77A 1N31A 4F5MA 2X5FA 1FG7A 1PMOA 4PFFA 5BJ3A 2CH1A 2BKWA 2GB3A 1ASMA 2VMRA 3EI7A 1KL1A 4CVQA 1BJ4A 2W7GA 2BI2A 1AMRA 1GEYA 5E4ZA 5EUEA 1EQBA 1ASLA 1LKCA 1XEYA 1PG8A 4Q75A 3IF2A 5E5IA 2R5CB 1AKBA 1O4SA 4WYFA 3W1JA 1V72A 3AEPA 2JJFA 3E2ZB 4AH3A 5EUNA 2W8VA 3HMUA
chains in the Genus database with same CATH topology
3COGA 2JJEA 3LVLB 2X8UA 2ZSMA 1Y4IA 3JZLA 3P1TA 4M2MA 3BV0A 5F8VA 4F5LA 3N4XA 2YCPA 1AAMA 1DGDA 1AIBA 4RJYA 1U08A 1VEFA 5LH9A 3PPLA 3RBLA 2R5CA 2CINA 4U1TA 2EPJA 4MGRA 4TMRA 4XK1A 3OP7A 1BW0A 3E2ZA 3RQ1A 4AO4A 4EMYA 1QGNA 4GEBA 2EZ1A 1CZCA 2JJGA 2JGTA 3RCHB 2VMVA 1V2EA 3ACZA 3ELEA 3PA9A 1IBJA 2CTZA 3A2BA 1CZEA 1EJIA 2Z9WA 3ZRQA 2VGUA 3N4RA 1IUGA 2C0RA 3K28A 4CXRA 4LW4A 4MSOA 2KFPA 4XJOA 1D2FA 3PDBB 1ASDA 4ZDLA 1B9HA 5J8QA 1M0OA 4WP0A 2CSTA 3K7YA 4F5KA 2WK8A 1ASBA 3H14A 5I92A 1JG8A 2AY6A 2VGZA 1AX4A 5DJ9A 2VMTA 4M2KA 4ZASA 1I41A 1O62A 2BWOA 3FZ6A 4WYDA 4Q76A 2FKIA 4WXFA 3AATA 3PDXA 4ZSYA 4JEWA 5D95A 1P3WA 5G4JA 3W1IA 2EO5A 3IHJA 2HUUA 3BN1A 5G0AA 1AJRA 1JS6A 1MDOA 2ZY3A 4FL0A 1UKJA 2CJDA 3N7NA 4W8IA 1M4NA 3ATHA 3LVJA 2VI8A 2FN6A 1UU2A 2OKKA 3N75A 2Z9XA 4MQRA 4O6ZA 2AEVA 3JTXA 3R9AA 1CQ7A 1DJEA 2YCTA 2X5DA 3EI6A 3GZCA 3AEOA 2FYFA 2YRRA 2D65A 2VMUA 3HVYA 2C7TA 2ORDA 5M4BA 4GE7A 1YIYA 3T32A 1EG5A 3AEMC 3FTBA 1SF2A 1TOJA 2PB2A 2OATA 3FVXA 1GEWA 3LY1A 1J04A 4RM1A 1W7LA 3DR4A 2VMSA 1KMKA 3F0HA 4RAEA 4XEWA 4A0RA 4ZM4A 8AATA 3AENB 4ADEA 4QGRA 4A6RA 4H51A 1QZ9A 3RUYA 4B9BA 2O7CA 1DJ9A 2FQ6A 4WYEA 1QITA 1AY5A 2D66A 3GR9A 3WGCA 3ZZJA 1MGVA 2F8JA 5EUDA 1AHXA 3WKRA 5KTBA 2AATA 4WB0B 4LW2A 5FT5A 3TQXA 1CL1A 3FFHA 3QN6A 1VP4A 2DGLA 4UQVA 3UE8A 4ZDPA 3AENA 2DOUA 1ASAA 1H0CA 4BA5A 1ECXA 2VGWA 1ELQA 4ZSWA 3NDNA 3NTJA 4MKJA 4UHMA 4OTLA 1G7WA 3P6KA 5E3KA 4GSAA 4XJPA 2ZSLA 1SZKA 2VMZA 1RV3A 1WYTB 2C44A 2YRIA 4WXBA 1B4XA 3FDDA 1X0MA 4IW7A 4ITGA 2O1BA 1W7NA 4IYOB 4UOYA 1SVVA 1TOKA 2E7JA 3DZZA 3AOVA 1CQ6A 1GDEA 1ZODA 4BQ0A 5G2QA 2GSAA 1OHWA 4XJLA 1YJSA 2QB2A 3NUBA 4MY5A 3QPGA 5DJ1A 4A72A 2D7ZA 4ZLVA 2Z9UA 1WYTA 3JWBA 3RBFA 4E77A 3DXVA 1OHVA 1QISA 1ELUA 1LC7A 2OQXA 4LNJA 4WD2A 1H1CA 1S0AA 3HDOA 1GC2A 2AY9A 2QLRA 3HLMA 3F9TA 4P7YA 4E3QA 1MLZA 4OBVA 9AATA 1B8GA 3MEBA 4IYOA 4A6TA 4ADDA 4XJMA 1X28A 4E1OA 5EIGB 3WCOA 2HUIA 3EI9A 2BYLA 3CAIA 1IX7A 3GZDA 2AY5A 2Z1ZA 2Z67A 4A6UA 1BJWA 3LVMA 1KKPA 3LV2A 1KL2A 3WX9A 2ZC0A 3BB8A 3AOWA 5BJ4A 3KGWA 3AEMA 1RVYA 4PVFA 2VGVA 2ZP7A 2C81A 1B5OA 1GBNA 5G4IA 3FZ7A 4CBRA 2HZPA 4Q31A 2YKVA 3QM2A 4LC3A 1I43A 4OBUA 5EIGA 1M0NA 4ATQA 4F5IA 3EZSA 1S06A 2W7DA 1AAWA 1LC5A 1QJ3A 1MLYA 3MC6C 3FVUA 3M5UA 1SZUA 1ASEA 1T3IA 2BI5A 4WYCA 4PIWA 1WYVB 4Y0HA 1ARHA 2R2NA 4RJ0A 3KKIA 1ARGA 4W1VA 4W1WA 4K2BA 1N2TA 2VYCA 4JE5D 4F5JA 3TATA 1IAYA 1TOIA 3BWNA 5K8BA 2HUFA 2BHXA 1MAPA 4NOGA 4CXQA 1OHYA 1W23A 3KE3A 3UWCA 4GRXA 4W91A 1JF9A 1ARTA 1WYVA 2AY7A 3N5MA 2W7IA 1AKCA 2X3LA 3NU8A 2DKJA 2E54A 2E7IA 5M4DA 3BC8A 1M0QA 2HOXA 4N0BA 2FNIA 1UU1A 3G8MA 3R4TA 4K2IA 1QIRA 2EH6A 5DB5A 2AEUA 5FT6A 3FCRA 4JEZA 4DBCA 1V2DA 4F5FA 4FFCA 3PAAA 2ZY2A 1X2AA 1C9CA 2DGKA 3A9YA 2VMNA 4ZWMA 1PMMA 1FC4A 1M0PA 3F6TA 2JISA 2EZ2A 2TPLA 3FSLA 2GMUA 4OYTA 1Z7DA 4J5UA 3NX3A 3PD6B 4KYOA 3B1CA 4R5ZA 3B46A 1DKAA 1BS0A 3GZDC 1O61A 4P3MA 1D7VA 4EFFA 2CJHA 2W7FA 3FQAA 3NU7A 4DQ6A 1OATA 2CANA 1B9IA 3CQ5A 3LG0A 3L8AA 4BA4A 4EB7A 3TFUA 2QSRA 1W7MA 1DTYA 2VMXA 7AATA 3PGYA 1OXOA 1SPAA 2D61A 4AOAA 2G7JA 3PD6A 1YNUA 2Z1YA 1UU0A 2VI9A 5FT8A 2PB0A 3MAFA 3AELA 3CQ6A 3II0A 5G2PA 1WYUB 3H9XA 3AV7A 2OKJA 1BKGA 2O0RA 1AHEA 4JEYA 1TATA 2D7YA 3MC6A 1AHYA 1SFFA 1QJ5A 2Q7WA 3JW9A 1AHGA 2BI1A 3FKDA 2YHKA 3VOMA 1AHFA 1AKAA 3I4JA 2FM1A 3WLXA 3A9XA 2VIAA 3BWOA 4R8DA 4XAUA 2W7KA 2ZY4A 2WB6A 1WYUA 4TV7A 4ZDOA 2AY8A 3WCNA 3ZRRA 4ADBA 3BWNC 1XI9A 3AEJA 1D7UA 1LS3A 1SZSA 2YCNA 3BCXA 3DODA 1GC4A 3PJ0A 2FNUA 2XH1A 3ECDA 4MQPA 3CBFA 3K40A 2BWPA 1IVRA 2HOYA 3LWSA 4EB5A 1M7YA 4GE9A 2V0YA 3RI6A 2CY8A 2R5EA 3HT4A 3WY7A 2JJHA 1TARA 3G7QA 4AO9A 4F4EA 4JF0A 2OGAA 2WKAA 1IX6A 3BS8A 1ASNA 3B1EA 3HQTA 1CL2A 4A00A 2ZY5A 5TF5A 1O69A 2GQNA 4IXZA 3NYSA 3UAKA 4H63Q 4MKKA 2VGSA 3MAUA 3QGUA 1BQDA 3L44A 1ORDA 4IY7A 4U2HA 3DXWA 4JE5A 4OCAA 1D7SA 3GSBA 1FG3A 2CB1A 3MBBA 3VAXA 4ZWVA 3N4SA 2AY4A 2Z61A 2WK9A 1S08A 3EZ1A 3NUIA 3EI8A 4I8AA 1GCKA 5C6UA 3PIUA 2QA3A 4WXGA 2HP1A 2D64A 3NYTA 1C7OA 1X29A 3ZRPA 2W8JA 1S07A 5F9SA 2AY2A 4PFNA 1V2FA 2YKYA 1BJNA 2HORA 1LC8A 1TASA 4XQ2A 1W3UA 1G4XA 2RFVA 1C7NA 2XBNA 4E3RA 2QMAA 2VLHA 2G6WA 1YIZA 1TPLA 3VK3A 2VMOA 4Q6RA 1AMQA 3DRDA 3MADA 4B98A 2BIAA 4R2NA 3EUCA 2D5YA 1CQ8A 3ASAA 3NRAA 4MQQA 1DJUA 5DX5A 3DYDA 1ASFA 3FQ8A 1E5FA 1RV4A 3FDBA 3FRKA 3N0LA 4OT8A 1IX8A 4W5KA 3E9KA 1MDXA 2CH2A 5G09A 3E2FA 3WZFA 4UHNA 3AEJC 4Y0DA 3VK2A 2ZYJA 5IWQA 4ITXA 4A0HA 3BCAA 3CQ4A 2BIEA 2VMPA 3HBXA 2OGEA 4HF8A 3GETA 2BIGA 1YJZA 2VGTA 2R0TA 1ZC9A 4WLHA 1AMAA 3GWPA 4ATPA 1B5PA 2CFBA 3TFTA 1KKJA 4R5FA 2W7EA 2PO3A 3NNKA 4ISYA 1ARIA 1ZOBA 4A0GA 1MAQA 1PFFA 1OXPA 2Z20A 2BI3A 2EGYA 4IXSA 3H7FA 1BJOB 2DGMA 3FVSA 4JF1A 4KXKA 2VMWA 2W8TA 1TOGA 4Y0IA 2VLFA 4GE4A 4RITA 4BHDA 2ZUKA 3VK4A 5EAAA 1Z3ZA 1GEXA 2QB3A 3ASBA 2NMPA 4LNLA 2A1VA 2BWNA 3W1HA 3RCHA 1LW5A 1BT4A 1M6SA 4N0WA 3G0TA 1WSTA 3MKJA 4TN4A 4HVKA 1JS3A 4RLGA 2D63A 3MAFB 3GBXA 4OC9A 3OKSA 2VIBA 1AJSB 3WKSA 1GC3A 1M32A 5HDMA 1BJOA 2GMSA 4RKDA 3FQ7A 3NYUA 1ASCA 3PDBA 3VP6A 3B8XA 4F5HA 1LK9A 4A0FA 1CS1A 3ZZKA 1GC0A 2EYQA 2E7UA 1AY8A 1J32A 1AICA 4W1XA 3EI5A 3ISLA 3HL2A 4WYGA 2W8WA 1IAXA 2ZJGA 1ASGA 5M49A 3E6GA 1YAAA 1YJYA 1AJSA 1G4VA 2W7MA 5D5SA 4ZM3A 2YOBA 1E5EA 3TCMA 1RVUA 3A8UX 3Q8NA 2W7HA 1C0NA 3DR7A 1VJOA 1MDZA 3I16A 3WGBA 1AY4A 2VMYA 3EIAA 3JWAA 1G7XA 3QBOA 1IJIA 2DR1A 2VMQA 4ZAHA 2WK7A 4GDYA 2YKUA 3DU4A 4EU1A 2HOZA 2CJGA 4IXOA 1D7RA 3EIBA 1KMJA 1YOOA 2YKXA 4L0OA 4M2JA 1CJ0A 1DFOA 1S09A 5LHAA 3LVKA 5EFSA 1C4KA 3QHXA 4RIZA 1ARSA 5EAVA 3QI6A 1C7GA 4CBSA 1WKHA 1N8PA 4K05A 5AX8A 3ELPA 1I48A 2AY1A 3A9ZA 4RKCA 1AMSA 3D6KA 1I29A 3B1DA 2DKBA 3FD0A 1AIAA 2HP2A 2QBTA 3E2YA 4WYAA 5M46A 4KAMA 4JEXA 4AZJA 4F5GA 1GD9A 3JU7A 3KGXA 4LNMA 4OMAA 3GJUA 4AZKA 2Z9VA 4WLJA 4WBTA 3I5TA 5JAYA 2BYJA 3DC1A 4WB0A 4BMKA 4IX8A 2W8UA 3FFRA 3USFA 1DGEA 2W7LA 2AY3A 2JG2A 4JEVA 2W7JA 5HHYA 3BCBA 1TOEA 4K2MA 2BI9A 5EQCA 5HXXA 1BQAA 4UHOA 5FT4A 4ADCA 4DGTA 1LW4A 2V1PA 1WKGA 3FZ8A 4J8LA 3E77A 1N31A 4F5MA 2X5FA 1FG7A 1PMOA 4PFFA 5BJ3A 2CH1A 2BKWA 2GB3A 1ASMA 2VMRA 3EI7A 1KL1A 4CVQA 1BJ4A 2W7GA 2BI2A 1AMRA 1GEYA 5E4ZA 5EUEA 1EQBA 1ASLA 1LKCA 1XEYA 1PG8A 4Q75A 3IF2A 5E5IA 2R5CB 1AKBA 1O4SA 4WYFA 3W1JA 1V72A 3AEPA 2JJFA 3E2ZB 4AH3A 5EUNA 2W8VA 3HMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3COG A;  2JJE A;  3LVL B;  2X8U A;  2ZSM A;  1Y4I A;  3JZL A;  3P1T A;  4M2M A;  3BV0 A;  5F8V A;  4F5L A;  2YCP A;  1AAM A;  1DGD A;  1AIB A;  4RJY A;  1U08 A;  1VEF A;  5LH9 A;  3PPL A;  3RBL A;  2R5C A;  2CIN A;  4U1T A;  2EPJ A;  4MGR A;  4TMR A;  4XK1 A;  3OP7 A;  1BW0 A;  3E2Z A;  3RQ1 A;  4AO4 A;  4EMY A;  1QGN A;  4GEB A;  2EZ1 A;  1CZC A;  2JJG A;  2JGT A;  3RCH B;  2VMV A;  1V2E A;  3ACZ A;  3ELE A;  3PA9 A;  1IBJ A;  2CTZ A;  3A2B A;  1CZE A;  1EJI A;  2Z9W A;  3ZRQ A;  2VGU A;  1IUG A;  2C0R A;  3K28 A;  4CXR A;  4LW4 A;  4MSO A;  4XJO A;  1D2F A;  3PDB B;  1ASD A;  4ZDL A;  1B9H A;  5J8Q A;  1M0O A;  4WP0 A;  2CST A;  3K7Y A;  4F5K A;  2WK8 A;  1ASB A;  3H14 A;  5I92 A;  1JG8 A;  2AY6 A;  2VGZ A;  1AX4 A;  5DJ9 A;  2VMT A;  4M2K A;  4ZAS A;  1I41 A;  1O62 A;  2BWO A;  3FZ6 A;  4WYD A;  4Q76 A;  4WXF A;  3AAT A;  3PDX A;  4ZSY A;  4JEW A;  5D95 A;  1P3W A;  5G4J A;  3W1I A;  2EO5 A;  3IHJ A;  2HUU A;  3BN1 A;  5G0A A;  1AJR A;  1JS6 A;  1MDO A;  2ZY3 A;  4FL0 A;  1UKJ A;  2CJD A;  4W8I A;  1M4N A;  3ATH A;  3LVJ A;  2VI8 A;  2FN6 A;  1UU2 A;  2OKK A;  3N75 A;  2Z9X A;  4MQR A;  4O6Z A;  2AEV A;  3JTX A;  3R9A A;  1CQ7 A;  1DJE A;  2YCT A;  2X5D A;  3EI6 A;  3GZC A;  3AEO A;  2FYF A;  2YRR A;  2D65 A;  2VMU A;  3HVY A;  2C7T A;  2ORD A;  5M4B A;  4GE7 A;  1YIY A;  3T32 A;  1EG5 A;  3AEM C;  3FTB A;  1SF2 A;  1TOJ A;  2PB2 A;  2OAT A;  3FVX A;  1GEW A;  3LY1 A;  1J04 A;  4RM1 A;  1W7L A;  3DR4 A;  2VMS A;  1KMK A;  3F0H A;  4RAE A;  4XEW A;  4A0R A;  4ZM4 A;  8AAT A;  3AEN B;  4ADE A;  4QGR A;  4A6R A;  4H51 A;  1QZ9 A;  3RUY A;  4B9B A;  2O7C A;  1DJ9 A;  2FQ6 A;  4WYE A;  1QIT A;  1AY5 A;  2D66 A;  3GR9 A;  3WGC A;  3ZZJ A;  1MGV A;  2F8J A;  5EUD A;  1AHX A;  3WKR A;  2AAT A;  4WB0 B;  4LW2 A;  5FT5 A;  3TQX A;  1CL1 A;  3FFH A;  3QN6 A;  1VP4 A;  2DGL A;  4UQV A;  3UE8 A;  4ZDP A;  3AEN A;  2DOU A;  1ASA A;  1H0C A;  4BA5 A;  1ECX A;  2VGW A;  1ELQ A;  4ZSW A;  3NDN A;  3NTJ A;  4MKJ A;  4UHM A;  4OTL A;  1G7W A;  3P6K A;  5E3K A;  4GSA A;  4XJP A;  2ZSL A;  1SZK A;  2VMZ A;  1RV3 A;  1WYT B;  2C44 A;  2YRI A;  4WXB A;  1B4X A;  3FDD A;  1X0M A;  4IW7 A;  4ITG A;  2O1B A;  1W7N A;  4IYO B;  4UOY A;  1SVV A;  1TOK A;  2E7J A;  3DZZ A;  3AOV A;  1CQ6 A;  1GDE A;  1ZOD A;  4BQ0 A;  5G2Q A;  2GSA A;  1OHW A;  4XJL A;  1YJS A;  2QB2 A;  3NUB A;  4MY5 A;  3QPG A;  5DJ1 A;  4A72 A;  2D7Z A;  4ZLV A;  2Z9U A;  1WYT A;  3JWB A;  3RBF A;  4E77 A;  3DXV A;  1OHV A;  1QIS A;  1ELU A;  1LC7 A;  2OQX A;  4LNJ A;  4WD2 A;  1H1C A;  1S0A A;  3HDO A;  1GC2 A;  2AY9 A;  2QLR A;  3HLM A;  3F9T A;  4P7Y A;  4E3Q A;  1MLZ A;  4OBV A;  9AAT A;  1B8G A;  3MEB A;  4IYO A;  4A6T A;  4ADD A;  4XJM A;  1X28 A;  4E1O A;  5EIG B;  3WCO A;  2HUI A;  3EI9 A;  2BYL A;  3CAI A;  1IX7 A;  3GZD A;  2AY5 A;  2Z1Z A;  2Z67 A;  4A6U A;  1BJW A;  3LVM A;  1KKP A;  3LV2 A;  1KL2 A;  3WX9 A;  2ZC0 A;  3BB8 A;  3AOW A;  5BJ4 A;  3KGW A;  3AEM A;  1RVY A;  4PVF A;  2VGV A;  2ZP7 A;  2C81 A;  1B5O A;  1GBN A;  5G4I A;  3FZ7 A;  4CBR A;  2HZP A;  4Q31 A;  2YKV A;  3QM2 A;  4LC3 A;  1I43 A;  4OBU A;  5EIG A;  1M0N A;  4ATQ A;  4F5I A;  3EZS A;  1S06 A;  2W7D A;  1AAW A;  1LC5 A;  1QJ3 A;  1MLY A;  3MC6 C;  3FVU A;  3M5U A;  1SZU A;  1ASE A;  1T3I A;  2BI5 A;  4WYC A;  4PIW A;  1WYV B;  4Y0H A;  1ARH A;  2R2N A;  4RJ0 A;  3KKI A;  1ARG A;  4W1V A;  4W1W A;  4K2B A;  1N2T A;  2VYC A;  4JE5 D;  4F5J A;  3TAT A;  1IAY A;  1TOI A;  3BWN A;  5K8B A;  2HUF A;  2BHX A;  1MAP A;  4NOG A;  4CXQ A;  1OHY A;  1W23 A;  3KE3 A;  3UWC A;  4GRX A;  4W91 A;  1JF9 A;  1ART A;  1WYV A;  2AY7 A;  3N5M A;  2W7I A;  1AKC A;  2X3L A;  3NU8 A;  2DKJ A;  2E54 A;  2E7I A;  5M4D A;  3BC8 A;  1M0Q A;  2HOX A;  4N0B A;  2FNI A;  1UU1 A;  3G8M A;  3R4T A;  4K2I A;  1QIR A;  2EH6 A;  5DB5 A;  2AEU A;  5FT6 A;  3FCR A;  4JEZ A;  4DBC A;  1V2D A;  4F5F A;  4FFC A;  3PAA A;  2ZY2 A;  1X2A A;  1C9C A;  2DGK A;  3A9Y A;  2VMN A;  4ZWM A;  1PMM A;  1FC4 A;  1M0P A;  3F6T A;  2JIS A;  2EZ2 A;  2TPL A;  3FSL A;  2GMU A;  4OYT A;  1Z7D A;  4J5U A;  3NX3 A;  3PD6 B;  4KYO A;  3B1C A;  4R5Z A;  3B46 A;  1DKA A;  1BS0 A;  3GZD C;  1O61 A;  4P3M A;  1D7V A;  4EFF A;  2CJH A;  2W7F A;  3FQA A;  3NU7 A;  4DQ6 A;  1OAT A;  2CAN A;  1B9I A;  3CQ5 A;  3LG0 A;  3L8A A;  4BA4 A;  4EB7 A;  3TFU A;  1W7M A;  1DTY A;  2VMX A;  7AAT A;  3PGY A;  1OXO A;  1SPA A;  2D61 A;  4AOA A;  3PD6 A;  1YNU A;  2Z1Y A;  1UU0 A;  2VI9 A;  5FT8 A;  2PB0 A;  3MAF A;  3AEL A;  3CQ6 A;  3II0 A;  5G2P A;  1WYU B;  3AV7 A;  2OKJ A;  1BKG A;  2O0R A;  1AHE A;  4JEY A;  1TAT A;  2D7Y A;  3MC6 A;  1AHY A;  1SFF A;  1QJ5 A;  2Q7W A;  3JW9 A;  1AHG A;  2BI1 A;  3FKD A;  2YHK A;  3VOM A;  1AHF A;  1AKA A;  3I4J A;  2FM1 A;  3WLX A;  3A9X A;  2VIA A;  3BWO A;  4R8D A;  4XAU A;  2W7K A;  2ZY4 A;  1WYU A;  4TV7 A;  4ZDO A;  2AY8 A;  3WCN A;  3ZRR A;  4ADB A;  3BWN C;  1XI9 A;  3AEJ A;  1D7U A;  1LS3 A;  1SZS A;  2YCN A;  3BCX A;  3DOD A;  1GC4 A;  3PJ0 A;  2FNU A;  2XH1 A;  3ECD A;  4MQP A;  3CBF A;  3K40 A;  2BWP A;  1IVR A;  2HOY A;  3LWS A;  4EB5 A;  1M7Y A;  4GE9 A;  2V0Y A;  3RI6 A;  2CY8 A;  2R5E A;  3HT4 A;  3WY7 A;  2JJH A;  1TAR A;  3G7Q A;  4AO9 A;  4F4E A;  4JF0 A;  2OGA A;  2WKA A;  1IX6 A;  3BS8 A;  1ASN A;  3B1E A;  3HQT A;  1CL2 A;  4A00 A;  2ZY5 A;  5TF5 A;  1O69 A;  2GQN A;  4IXZ A;  3NYS A;  3UAK A;  4MKK A;  2VGS A;  3MAU A;  3QGU A;  1BQD A;  3L44 A;  1ORD A;  4IY7 A;  4U2H A;  3DXW A;  4JE5 A;  4OCA A;  1D7S A;  3GSB A;  1FG3 A;  2CB1 A;  3MBB A;  3VAX A;  4ZWV A;  2AY4 A;  2Z61 A;  2WK9 A;  1S08 A;  3EZ1 A;  3NUI A;  3EI8 A;  4I8A A;  1GCK A;  5C6U A;  3PIU A;  2QA3 A;  4WXG A;  2HP1 A;  2D64 A;  3NYT A;  1C7O A;  1X29 A;  3ZRP A;  2W8J A;  1S07 A;  5F9S A;  2AY2 A;  4PFN A;  1V2F A;  2YKY A;  1BJN A;  2HOR A;  1LC8 A;  1TAS A;  4XQ2 A;  1W3U A;  1G4X A;  2RFV A;  1C7N A;  2XBN A;  4E3R A;  2QMA A;  2VLH A;  2G6W A;  1YIZ A;  1TPL A;  3VK3 A;  2VMO A;  4Q6R A;  1AMQ A;  3DRD A;  3MAD A;  4B98 A;  2BIA A;  4R2N A;  3EUC A;  2D5Y A;  1CQ8 A;  3ASA A;  3NRA A;  4MQQ A;  1DJU A;  5DX5 A;  3DYD A;  1ASF A;  3FQ8 A;  1E5F A;  1RV4 A;  3FDB A;  3FRK A;  3N0L A;  4OT8 A;  1IX8 A;  4W5K A;  3E9K A;  1MDX A;  2CH2 A;  5G09 A;  3E2F A;  3WZF A;  4UHN A;  3AEJ C;  4Y0D A;  3VK2 A;  2ZYJ A;  5IWQ A;  4ITX A;  4A0H A;  3BCA A;  3CQ4 A;  2BIE A;  2VMP A;  3HBX A;  2OGE A;  4HF8 A;  3GET A;  2BIG A;  1YJZ A;  2VGT A;  2R0T A;  1ZC9 A;  4WLH A;  1AMA A;  3GWP A;  4ATP A;  1B5P A;  2CFB A;  3TFT A;  1KKJ A;  4R5F A;  2W7E A;  2PO3 A;  3NNK A;  4ISY A;  1ARI A;  1ZOB A;  4A0G A;  1MAQ A;  1PFF A;  1OXP A;  2Z20 A;  2BI3 A;  2EGY A;  4IXS A;  3H7F A;  1BJO B;  2DGM A;  3FVS A;  4JF1 A;  4KXK A;  2VMW A;  2W8T A;  1TOG A;  4Y0I A;  2VLF A;  4GE4 A;  4RIT A;  4BHD A;  2ZUK A;  3VK4 A;  5EAA A;  1Z3Z A;  1GEX A;  2QB3 A;  3ASB A;  2NMP A;  4LNL A;  2BWN A;  3W1H A;  3RCH A;  1LW5 A;  1BT4 A;  1M6S A;  4N0W A;  3G0T A;  1WST A;  3MKJ A;  4TN4 A;  4HVK A;  1JS3 A;  4RLG A;  2D63 A;  3MAF B;  3GBX A;  4OC9 A;  3OKS A;  2VIB A;  1AJS B;  3WKS A;  1GC3 A;  1M32 A;  5HDM A;  1BJO A;  2GMS A;  4RKD A;  3FQ7 A;  3NYU A;  1ASC A;  3PDB A;  3VP6 A;  3B8X A;  4F5H A;  1LK9 A;  4A0F A;  1CS1 A;  3ZZK A;  1GC0 A;  2E7U A;  1AY8 A;  1J32 A;  1AIC A;  4W1X A;  3EI5 A;  3ISL A;  3HL2 A;  4WYG A;  2W8W A;  1IAX A;  2ZJG A;  1ASG A;  5M49 A;  3E6G A;  1YAA A;  1YJY A;  1AJS A;  1G4V A;  2W7M A;  5D5S A;  4ZM3 A;  2YOB A;  1E5E A;  3TCM A;  1RVU A;  3A8U X;  3Q8N A;  2W7H A;  1C0N A;  3DR7 A;  1VJO A;  1MDZ A;  3I16 A;  3WGB A;  1AY4 A;  2VMY A;  3EIA A;  3JWA A;  1G7X A;  3QBO A;  1IJI A;  2DR1 A;  2VMQ A;  4ZAH A;  2WK7 A;  4GDY A;  2YKU A;  3DU4 A;  4EU1 A;  2HOZ A;  2CJG A;  4IXO A;  1D7R A;  3EIB A;  1KMJ A;  1YOO A;  2YKX A;  4L0O A;  4M2J A;  1CJ0 A;  1DFO A;  1S09 A;  5LHA A;  3LVK A;  5EFS A;  1C4K A;  3QHX A;  4RIZ A;  1ARS A;  5EAV A;  3QI6 A;  1C7G A;  4CBS A;  1WKH A;  1N8P A;  5AX8 A;  3ELP A;  1I48 A;  2AY1 A;  3A9Z A;  4RKC A;  1AMS A;  3D6K A;  1I29 A;  3B1D A;  2DKB A;  3FD0 A;  1AIA A;  2HP2 A;  2QBT A;  3E2Y A;  4WYA A;  5M46 A;  4KAM A;  4JEX A;  4AZJ A;  4F5G A;  1GD9 A;  3JU7 A;  3KGX A;  4LNM A;  4OMA A;  3GJU A;  4AZK A;  2Z9V A;  4WLJ A;  4WBT A;  3I5T A;  5JAY A;  2BYJ A;  3DC1 A;  4WB0 A;  4BMK A;  4IX8 A;  2W8U A;  3FFR A;  3USF A;  1DGE A;  2W7L A;  2AY3 A;  2JG2 A;  4JEV A;  2W7J A;  5HHY A;  3BCB A;  1TOE A;  4K2M A;  2BI9 A;  5EQC A;  5HXX A;  1BQA A;  4UHO A;  5FT4 A;  4ADC A;  4DGT A;  1LW4 A;  2V1P A;  1WKG A;  3FZ8 A;  4J8L A;  3E77 A;  1N31 A;  4F5M A;  2X5F A;  1FG7 A;  1PMO A;  4PFF A;  5BJ3 A;  2CH1 A;  2BKW A;  2GB3 A;  1ASM A;  2VMR A;  3EI7 A;  1KL1 A;  4CVQ A;  1BJ4 A;  2W7G A;  2BI2 A;  1AMR A;  1GEY A;  5E4Z A;  5EUE A;  1EQB A;  1ASL A;  1LKC A;  1XEY A;  1PG8 A;  4Q75 A;  3IF2 A;  5E5I A;  2R5C B;  1AKB A;  1O4S A;  4WYF A;  3W1J A;  1V72 A;  3AEP A;  2JJF A;  3E2Z B;  4AH3 A;  5EUN A;  2W8V A;  3HMU A; 
#chains in the Genus database with same CATH topology
 3COG A;  2JJE A;  3LVL B;  2X8U A;  2ZSM A;  1Y4I A;  3JZL A;  3P1T A;  4M2M A;  3BV0 A;  5F8V A;  4F5L A;  3N4X A;  2YCP A;  1AAM A;  1DGD A;  1AIB A;  4RJY A;  1U08 A;  1VEF A;  5LH9 A;  3PPL A;  3RBL A;  2R5C A;  2CIN A;  4U1T A;  2EPJ A;  4MGR A;  4TMR A;  4XK1 A;  3OP7 A;  1BW0 A;  3E2Z A;  3RQ1 A;  4AO4 A;  4EMY A;  1QGN A;  4GEB A;  2EZ1 A;  1CZC A;  2JJG A;  2JGT A;  3RCH B;  2VMV A;  1V2E A;  3ACZ A;  3ELE A;  3PA9 A;  1IBJ A;  2CTZ A;  3A2B A;  1CZE A;  1EJI A;  2Z9W A;  3ZRQ A;  2VGU A;  3N4R A;  1IUG A;  2C0R A;  3K28 A;  4CXR A;  4LW4 A;  4MSO A;  2KFP A;  4XJO A;  1D2F A;  3PDB B;  1ASD A;  4ZDL A;  1B9H A;  5J8Q A;  1M0O A;  4WP0 A;  2CST A;  3K7Y A;  4F5K A;  2WK8 A;  1ASB A;  3H14 A;  5I92 A;  1JG8 A;  2AY6 A;  2VGZ A;  1AX4 A;  5DJ9 A;  2VMT A;  4M2K A;  4ZAS A;  1I41 A;  1O62 A;  2BWO A;  3FZ6 A;  4WYD A;  4Q76 A;  2FKI A;  4WXF A;  3AAT A;  3PDX A;  4ZSY A;  4JEW A;  5D95 A;  1P3W A;  5G4J A;  3W1I A;  2EO5 A;  3IHJ A;  2HUU A;  3BN1 A;  1KAF A;  5G0A A;  1AJR A;  1JS6 A;  1MDO A;  2ZY3 A;  4FL0 A;  1UKJ A;  2CJD A;  3N7N A;  4W8I A;  1M4N A;  3ATH A;  3LVJ A;  2VI8 A;  2FN6 A;  1UU2 A;  2OKK A;  3N75 A;  2Z9X A;  4MQR A;  4O6Z A;  2AEV A;  3JTX A;  3R9A A;  1CQ7 A;  1DJE A;  2YCT A;  2X5D A;  3EI6 A;  3GZC A;  3AEO A;  2FYF A;  2YRR A;  2D65 A;  2VMU A;  3HVY A;  2C7T A;  2ORD A;  5M4B A;  4GE7 A;  1YIY A;  3T32 A;  1EG5 A;  3AEM C;  3FTB A;  1SF2 A;  1TOJ A;  2PB2 A;  2OAT A;  3FVX A;  1GEW A;  3LY1 A;  1J04 A;  4RM1 A;  1W7L A;  3DR4 A;  2VMS A;  1KMK A;  3F0H A;  4RAE A;  4XEW A;  4A0R A;  4ZM4 A;  8AAT A;  3AEN B;  4ADE A;  4QGR A;  4A6R A;  4H51 A;  1QZ9 A;  3RUY A;  4B9B A;  2O7C A;  1DJ9 A;  2FQ6 A;  4WYE A;  1QIT A;  1AY5 A;  2D66 A;  3GR9 A;  3WGC A;  3ZZJ A;  1MGV A;  2F8J A;  5EUD A;  1AHX A;  3WKR A;  5KTB A;  2AAT A;  4WB0 B;  4LW2 A;  5FT5 A;  3TQX A;  1CL1 A;  3FFH A;  3QN6 A;  1VP4 A;  2DGL A;  4UQV A;  3UE8 A;  4ZDP A;  3AEN A;  2DOU A;  1ASA A;  1H0C A;  4BA5 A;  1ECX A;  2VGW A;  1ELQ A;  4ZSW A;  3NDN A;  3NTJ A;  4MKJ A;  4UHM A;  4OTL A;  1G7W A;  3P6K A;  5E3K A;  4GSA A;  4XJP A;  2ZSL A;  1SZK A;  2VMZ A;  1RV3 A;  1WYT B;  2C44 A;  2YRI A;  4WXB A;  1B4X A;  3FDD A;  1X0M A;  4IW7 A;  4ITG A;  2O1B A;  1W7N A;  4IYO B;  4UOY A;  1SVV A;  1TOK A;  2E7J A;  3DZZ A;  3AOV A;  1CQ6 A;  1GDE A;  1ZOD A;  4BQ0 A;  5G2Q A;  2GSA A;  1OHW A;  4XJL A;  1YJS A;  2QB2 A;  3NUB A;  4MY5 A;  3QPG A;  5DJ1 A;  4A72 A;  2D7Z A;  4ZLV A;  2Z9U A;  1WYT A;  3JWB A;  3RBF A;  4E77 A;  3DXV A;  1OHV A;  1QIS A;  1ELU A;  1LC7 A;  2OQX A;  4LNJ A;  4WD2 A;  1H1C A;  1S0A A;  3HDO A;  1GC2 A;  2AY9 A;  2QLR A;  3HLM A;  3F9T A;  4P7Y A;  4E3Q A;  1MLZ A;  4OBV A;  9AAT A;  1B8G A;  3MEB A;  4IYO A;  4A6T A;  4ADD A;  4XJM A;  1X28 A;  4E1O A;  5EIG B;  3WCO A;  2HUI A;  3EI9 A;  2BYL A;  3CAI A;  1IX7 A;  3GZD A;  2AY5 A;  2Z1Z A;  2Z67 A;  4A6U A;  1BJW A;  3LVM A;  1KKP A;  3LV2 A;  1KL2 A;  3WX9 A;  2ZC0 A;  3BB8 A;  3AOW A;  5BJ4 A;  3KGW A;  3AEM A;  1RVY A;  4PVF A;  2VGV A;  2ZP7 A;  2C81 A;  1B5O A;  1GBN A;  5G4I A;  3FZ7 A;  4CBR A;  2HZP A;  4Q31 A;  2YKV A;  3QM2 A;  4LC3 A;  1I43 A;  4OBU A;  5EIG A;  1M0N A;  4ATQ A;  4F5I A;  3EZS A;  1S06 A;  2W7D A;  1AAW A;  1LC5 A;  1QJ3 A;  1MLY A;  3MC6 C;  3FVU A;  3M5U A;  1SZU A;  1ASE A;  1T3I A;  2BI5 A;  4WYC A;  4PIW A;  1WYV B;  4Y0H A;  1ARH A;  2R2N A;  4RJ0 A;  3KKI A;  1ARG A;  4W1V A;  4W1W A;  4K2B A;  1N2T A;  2VYC A;  4JE5 D;  4F5J A;  3TAT A;  1IAY A;  1TOI A;  3BWN A;  5K8B A;  2HUF A;  2BHX A;  1MAP A;  4NOG A;  4CXQ A;  1OHY A;  1W23 A;  3KE3 A;  3UWC A;  4GRX A;  4W91 A;  1JF9 A;  1ART A;  1WYV A;  2AY7 A;  3N5M A;  2W7I A;  1AKC A;  2X3L A;  3NU8 A;  2DKJ A;  2E54 A;  2E7I A;  5M4D A;  3BC8 A;  1M0Q A;  2HOX A;  4N0B A;  2FNI A;  1UU1 A;  3G8M A;  3R4T A;  4K2I A;  1QIR A;  2EH6 A;  5DB5 A;  2AEU A;  5FT6 A;  3FCR A;  4JEZ A;  4DBC A;  1V2D A;  4F5F A;  4FFC A;  3PAA A;  2ZY2 A;  1X2A A;  1C9C A;  2DGK A;  3A9Y A;  2VMN A;  4ZWM A;  1PMM A;  1FC4 A;  1M0P A;  3F6T A;  2JIS A;  2EZ2 A;  2TPL A;  3FSL A;  2GMU A;  4OYT A;  1Z7D A;  4J5U A;  3NX3 A;  3PD6 B;  4KYO A;  3B1C A;  4R5Z A;  3B46 A;  1DKA A;  1BS0 A;  3GZD C;  1O61 A;  4P3M A;  1D7V A;  4EFF A;  2CJH A;  2W7F A;  3FQA A;  3NU7 A;  4DQ6 A;  1OAT A;  2CAN A;  1B9I A;  3CQ5 A;  3LG0 A;  3L8A A;  4BA4 A;  4EB7 A;  3TFU A;  2QSR A;  1W7M A;  1DTY A;  2VMX A;  7AAT A;  3PGY A;  1OXO A;  1SPA A;  2D61 A;  4AOA A;  2G7J A;  3PD6 A;  1YNU A;  2Z1Y A;  1UU0 A;  2VI9 A;  5FT8 A;  2PB0 A;  3MAF A;  3AEL A;  3CQ6 A;  3II0 A;  5G2P A;  1WYU B;  3H9X A;  3AV7 A;  2OKJ A;  1BKG A;  2O0R A;  1AHE A;  4JEY A;  1TAT A;  2D7Y A;  3MC6 A;  1AHY A;  1SFF A;  1QJ5 A;  2Q7W A;  3JW9 A;  1AHG A;  2BI1 A;  3FKD A;  2YHK A;  3VOM A;  1AHF A;  1AKA A;  3I4J A;  2FM1 A;  3WLX A;  3A9X A;  2VIA A;  3BWO A;  4R8D A;  4XAU A;  2W7K A;  2ZY4 A;  2WB6 A;  1WYU A;  4TV7 A;  4ZDO A;  2AY8 A;  3WCN A;  3ZRR A;  4ADB A;  3BWN C;  1XI9 A;  3AEJ A;  1D7U A;  1LS3 A;  1SZS A;  2YCN A;  3BCX A;  3DOD A;  1GC4 A;  3PJ0 A;  2FNU A;  2XH1 A;  3ECD A;  4MQP A;  3CBF A;  3K40 A;  2BWP A;  1IVR A;  2HOY A;  3LWS A;  4EB5 A;  1M7Y A;  4GE9 A;  2V0Y A;  3RI6 A;  2CY8 A;  2R5E A;  3HT4 A;  3WY7 A;  2JJH A;  1TAR A;  3G7Q A;  4AO9 A;  4F4E A;  4JF0 A;  2OGA A;  2WKA A;  1IX6 A;  3BS8 A;  1ASN A;  3B1E A;  3HQT A;  1CL2 A;  4A00 A;  2ZY5 A;  5TF5 A;  1O69 A;  2GQN A;  4IXZ A;  3NYS A;  3UAK A;  4H63 Q;  4MKK A;  2VGS A;  3MAU A;  3QGU A;  1BQD A;  3L44 A;  1ORD A;  4IY7 A;  4U2H A;  3DXW A;  4JE5 A;  4OCA A;  1D7S A;  3GSB A;  1FG3 A;  2CB1 A;  3MBB A;  3VAX A;  4ZWV A;  3N4S A;  2AY4 A;  2Z61 A;  2WK9 A;  1S08 A;  3EZ1 A;  3NUI A;  3EI8 A;  4I8A A;  1GCK A;  5C6U A;  3PIU A;  2QA3 A;  4WXG A;  2HP1 A;  2D64 A;  3NYT A;  1C7O A;  1X29 A;  3ZRP A;  2W8J A;  1S07 A;  5F9S A;  2AY2 A;  4PFN A;  1V2F A;  2YKY A;  1BJN A;  2HOR A;  1LC8 A;  1TAS A;  4XQ2 A;  1W3U A;  1G4X A;  2RFV A;  1C7N A;  2XBN A;  4E3R A;  2QMA A;  2VLH A;  2G6W A;  1YIZ A;  1TPL A;  3VK3 A;  2VMO A;  4Q6R A;  1AMQ A;  3DRD A;  3MAD A;  4B98 A;  2BIA A;  4R2N A;  3EUC A;  2D5Y A;  1CQ8 A;  3ASA A;  3NRA A;  4MQQ A;  1DJU A;  5DX5 A;  3DYD A;  1ASF A;  3FQ8 A;  1E5F A;  1RV4 A;  3FDB A;  3FRK A;  3N0L A;  4OT8 A;  1IX8 A;  4W5K A;  3E9K A;  1MDX A;  2CH2 A;  5G09 A;  3E2F A;  3WZF A;  4UHN A;  3AEJ C;  4Y0D A;  3VK2 A;  2ZYJ A;  5IWQ A;  4ITX A;  4A0H A;  3BCA A;  3CQ4 A;  2BIE A;  2VMP A;  3HBX A;  2OGE A;  4HF8 A;  3GET A;  2BIG A;  1YJZ A;  2VGT A;  2R0T A;  1ZC9 A;  4WLH A;  1AMA A;  3GWP A;  4ATP A;  1B5P A;  2CFB A;  3TFT A;  1KKJ A;  4R5F A;  2W7E A;  2PO3 A;  3NNK A;  4ISY A;  1ARI A;  1ZOB A;  4A0G A;  1MAQ A;  1PFF A;  1OXP A;  2Z20 A;  2BI3 A;  2EGY A;  4IXS A;  3H7F A;  1BJO B;  2DGM A;  3FVS A;  4JF1 A;  4KXK A;  2VMW A;  2W8T A;  1TOG A;  4Y0I A;  2VLF A;  4GE4 A;  4RIT A;  4BHD A;  2ZUK A;  3VK4 A;  5EAA A;  1Z3Z A;  1GEX A;  2QB3 A;  3ASB A;  2NMP A;  4LNL A;  2A1V A;  2BWN A;  3W1H A;  3RCH A;  1LW5 A;  1BT4 A;  1M6S A;  4N0W A;  3G0T A;  1WST A;  3MKJ A;  4TN4 A;  4HVK A;  1JS3 A;  4RLG A;  2D63 A;  3MAF B;  3GBX A;  4OC9 A;  3OKS A;  2VIB A;  1AJS B;  3WKS A;  1GC3 A;  1M32 A;  5HDM A;  1BJO A;  2GMS A;  4RKD A;  3FQ7 A;  3NYU A;  1ASC A;  3PDB A;  3VP6 A;  3B8X A;  4F5H A;  1LK9 A;  4A0F A;  1CS1 A;  3ZZK A;  1GC0 A;  2EYQ A;  2E7U A;  1AY8 A;  1J32 A;  1AIC A;  4W1X A;  3EI5 A;  3ISL A;  3HL2 A;  4WYG A;  2W8W A;  1IAX A;  2ZJG A;  1ASG A;  5M49 A;  3E6G A;  1YAA A;  1YJY A;  1AJS A;  1G4V A;  2W7M A;  5D5S A;  4ZM3 A;  2YOB A;  1E5E A;  3TCM A;  1RVU A;  3A8U X;  3Q8N A;  2W7H A;  1C0N A;  3DR7 A;  1VJO A;  1MDZ A;  3I16 A;  3WGB A;  1AY4 A;  2VMY A;  3EIA A;  3JWA A;  1G7X A;  3QBO A;  1IJI A;  2DR1 A;  2VMQ A;  4ZAH A;  2WK7 A;  4GDY A;  2YKU A;  3DU4 A;  4EU1 A;  2HOZ A;  2CJG A;  4IXO A;  1D7R A;  3EIB A;  1KMJ A;  1YOO A;  2YKX A;  4L0O A;  4M2J A;  1CJ0 A;  1DFO A;  1S09 A;  5LHA A;  3LVK A;  5EFS A;  1C4K A;  3QHX A;  4RIZ A;  1ARS A;  5EAV A;  3QI6 A;  1C7G A;  4CBS A;  1WKH A;  1N8P A;  4K05 A;  5AX8 A;  3ELP A;  1I48 A;  2AY1 A;  3A9Z A;  4RKC A;  1AMS A;  3D6K A;  1I29 A;  3B1D A;  2DKB A;  3FD0 A;  1AIA A;  2HP2 A;  2QBT A;  3E2Y A;  4WYA A;  5M46 A;  4KAM A;  4JEX A;  4AZJ A;  4F5G A;  1GD9 A;  3JU7 A;  3KGX A;  4LNM A;  4OMA A;  3GJU A;  4AZK A;  2Z9V A;  4WLJ A;  4WBT A;  3I5T A;  5JAY A;  2BYJ A;  3DC1 A;  4WB0 A;  4BMK A;  4IX8 A;  2W8U A;  3FFR A;  3USF A;  1DGE A;  2W7L A;  2AY3 A;  2JG2 A;  4JEV A;  2W7J A;  5HHY A;  3BCB A;  1TOE A;  4K2M A;  2BI9 A;  5EQC A;  5HXX A;  1BQA A;  4UHO A;  5FT4 A;  4ADC A;  4DGT A;  1LW4 A;  2V1P A;  1WKG A;  3FZ8 A;  4J8L A;  3E77 A;  1N31 A;  4F5M A;  2X5F A;  1FG7 A;  1PMO A;  4PFF A;  5BJ3 A;  2CH1 A;  2BKW A;  2GB3 A;  1ASM A;  2VMR A;  3EI7 A;  1KL1 A;  4CVQ A;  1BJ4 A;  2W7G A;  2BI2 A;  1AMR A;  1GEY A;  5E4Z A;  5EUE A;  1EQB A;  1ASL A;  1LKC A;  1XEY A;  1PG8 A;  4Q75 A;  3IF2 A;  5E5I A;  2R5C B;  1AKB A;  1O4S A;  4WYF A;  3W1J A;  1V72 A;  3AEP A;  2JJF A;  3E2Z B;  4AH3 A;  5EUN A;  2W8V A;  3HMU A; 
#chains in the Genus database with same CATH homology
 3COG A;  2JJE A;  3LVL B;  2X8U A;  2ZSM A;  1Y4I A;  3JZL A;  3P1T A;  4M2M A;  3BV0 A;  5F8V A;  4F5L A;  3N4X A;  2YCP A;  1AAM A;  1DGD A;  1AIB A;  4RJY A;  1U08 A;  1VEF A;  5LH9 A;  3PPL A;  3RBL A;  2R5C A;  2CIN A;  4U1T A;  2EPJ A;  4MGR A;  4TMR A;  4XK1 A;  3OP7 A;  1BW0 A;  3E2Z A;  3RQ1 A;  4AO4 A;  4EMY A;  1QGN A;  4GEB A;  2EZ1 A;  1CZC A;  2JJG A;  2JGT A;  3RCH B;  2VMV A;  1V2E A;  3ACZ A;  3ELE A;  3PA9 A;  1IBJ A;  2CTZ A;  3A2B A;  1CZE A;  1EJI A;  2Z9W A;  3ZRQ A;  2VGU A;  3N4R A;  1IUG A;  2C0R A;  3K28 A;  4CXR A;  4LW4 A;  4MSO A;  2KFP A;  4XJO A;  1D2F A;  3PDB B;  1ASD A;  4ZDL A;  1B9H A;  5J8Q A;  1M0O A;  4WP0 A;  2CST A;  3K7Y A;  4F5K A;  2WK8 A;  1ASB A;  3H14 A;  5I92 A;  1JG8 A;  2AY6 A;  2VGZ A;  1AX4 A;  5DJ9 A;  2VMT A;  4M2K A;  4ZAS A;  1I41 A;  1O62 A;  2BWO A;  3FZ6 A;  4WYD A;  4Q76 A;  2FKI A;  4WXF A;  3AAT A;  3PDX A;  4ZSY A;  4JEW A;  5D95 A;  1P3W A;  5G4J A;  3W1I A;  2EO5 A;  3IHJ A;  2HUU A;  3BN1 A;  5G0A A;  1AJR A;  1JS6 A;  1MDO A;  2ZY3 A;  4FL0 A;  1UKJ A;  2CJD A;  3N7N A;  4W8I A;  1M4N A;  3ATH A;  3LVJ A;  2VI8 A;  2FN6 A;  1UU2 A;  2OKK A;  3N75 A;  2Z9X A;  4MQR A;  4O6Z A;  2AEV A;  3JTX A;  3R9A A;  1CQ7 A;  1DJE A;  2YCT A;  2X5D A;  3EI6 A;  3GZC A;  3AEO A;  2FYF A;  2YRR A;  2D65 A;  2VMU A;  3HVY A;  2C7T A;  2ORD A;  5M4B A;  4GE7 A;  1YIY A;  3T32 A;  1EG5 A;  3AEM C;  3FTB A;  1SF2 A;  1TOJ A;  2PB2 A;  2OAT A;  3FVX A;  1GEW A;  3LY1 A;  1J04 A;  4RM1 A;  1W7L A;  3DR4 A;  2VMS A;  1KMK A;  3F0H A;  4RAE A;  4XEW A;  4A0R A;  4ZM4 A;  8AAT A;  3AEN B;  4ADE A;  4QGR A;  4A6R A;  4H51 A;  1QZ9 A;  3RUY A;  4B9B A;  2O7C A;  1DJ9 A;  2FQ6 A;  4WYE A;  1QIT A;  1AY5 A;  2D66 A;  3GR9 A;  3WGC A;  3ZZJ A;  1MGV A;  2F8J A;  5EUD A;  1AHX A;  3WKR A;  5KTB A;  2AAT A;  4WB0 B;  4LW2 A;  5FT5 A;  3TQX A;  1CL1 A;  3FFH A;  3QN6 A;  1VP4 A;  2DGL A;  4UQV A;  3UE8 A;  4ZDP A;  3AEN A;  2DOU A;  1ASA A;  1H0C A;  4BA5 A;  1ECX A;  2VGW A;  1ELQ A;  4ZSW A;  3NDN A;  3NTJ A;  4MKJ A;  4UHM A;  4OTL A;  1G7W A;  3P6K A;  5E3K A;  4GSA A;  4XJP A;  2ZSL A;  1SZK A;  2VMZ A;  1RV3 A;  1WYT B;  2C44 A;  2YRI A;  4WXB A;  1B4X A;  3FDD A;  1X0M A;  4IW7 A;  4ITG A;  2O1B A;  1W7N A;  4IYO B;  4UOY A;  1SVV A;  1TOK A;  2E7J A;  3DZZ A;  3AOV A;  1CQ6 A;  1GDE A;  1ZOD A;  4BQ0 A;  5G2Q A;  2GSA A;  1OHW A;  4XJL A;  1YJS A;  2QB2 A;  3NUB A;  4MY5 A;  3QPG A;  5DJ1 A;  4A72 A;  2D7Z A;  4ZLV A;  2Z9U A;  1WYT A;  3JWB A;  3RBF A;  4E77 A;  3DXV A;  1OHV A;  1QIS A;  1ELU A;  1LC7 A;  2OQX A;  4LNJ A;  4WD2 A;  1H1C A;  1S0A A;  3HDO A;  1GC2 A;  2AY9 A;  2QLR A;  3HLM A;  3F9T A;  4P7Y A;  4E3Q A;  1MLZ A;  4OBV A;  9AAT A;  1B8G A;  3MEB A;  4IYO A;  4A6T A;  4ADD A;  4XJM A;  1X28 A;  4E1O A;  5EIG B;  3WCO A;  2HUI A;  3EI9 A;  2BYL A;  3CAI A;  1IX7 A;  3GZD A;  2AY5 A;  2Z1Z A;  2Z67 A;  4A6U A;  1BJW A;  3LVM A;  1KKP A;  3LV2 A;  1KL2 A;  3WX9 A;  2ZC0 A;  3BB8 A;  3AOW A;  5BJ4 A;  3KGW A;  3AEM A;  1RVY A;  4PVF A;  2VGV A;  2ZP7 A;  2C81 A;  1B5O A;  1GBN A;  5G4I A;  3FZ7 A;  4CBR A;  2HZP A;  4Q31 A;  2YKV A;  3QM2 A;  4LC3 A;  1I43 A;  4OBU A;  5EIG A;  1M0N A;  4ATQ A;  4F5I A;  3EZS A;  1S06 A;  2W7D A;  1AAW A;  1LC5 A;  1QJ3 A;  1MLY A;  3MC6 C;  3FVU A;  3M5U A;  1SZU A;  1ASE A;  1T3I A;  2BI5 A;  4WYC A;  4PIW A;  1WYV B;  4Y0H A;  1ARH A;  2R2N A;  4RJ0 A;  3KKI A;  1ARG A;  4W1V A;  4W1W A;  4K2B A;  1N2T A;  2VYC A;  4JE5 D;  4F5J A;  3TAT A;  1IAY A;  1TOI A;  3BWN A;  5K8B A;  2HUF A;  2BHX A;  1MAP A;  4NOG A;  4CXQ A;  1OHY A;  1W23 A;  3KE3 A;  3UWC A;  4GRX A;  4W91 A;  1JF9 A;  1ART A;  1WYV A;  2AY7 A;  3N5M A;  2W7I A;  1AKC A;  2X3L A;  3NU8 A;  2DKJ A;  2E54 A;  2E7I A;  5M4D A;  3BC8 A;  1M0Q A;  2HOX A;  4N0B A;  2FNI A;  1UU1 A;  3G8M A;  3R4T A;  4K2I A;  1QIR A;  2EH6 A;  5DB5 A;  2AEU A;  5FT6 A;  3FCR A;  4JEZ A;  4DBC A;  1V2D A;  4F5F A;  4FFC A;  3PAA A;  2ZY2 A;  1X2A A;  1C9C A;  2DGK A;  3A9Y A;  2VMN A;  4ZWM A;  1PMM A;  1FC4 A;  1M0P A;  3F6T A;  2JIS A;  2EZ2 A;  2TPL A;  3FSL A;  2GMU A;  4OYT A;  1Z7D A;  4J5U A;  3NX3 A;  3PD6 B;  4KYO A;  3B1C A;  4R5Z A;  3B46 A;  1DKA A;  1BS0 A;  3GZD C;  1O61 A;  4P3M A;  1D7V A;  4EFF A;  2CJH A;  2W7F A;  3FQA A;  3NU7 A;  4DQ6 A;  1OAT A;  2CAN A;  1B9I A;  3CQ5 A;  3LG0 A;  3L8A A;  4BA4 A;  4EB7 A;  3TFU A;  2QSR A;  1W7M A;  1DTY A;  2VMX A;  7AAT A;  3PGY A;  1OXO A;  1SPA A;  2D61 A;  4AOA A;  2G7J A;  3PD6 A;  1YNU A;  2Z1Y A;  1UU0 A;  2VI9 A;  5FT8 A;  2PB0 A;  3MAF A;  3AEL A;  3CQ6 A;  3II0 A;  5G2P A;  1WYU B;  3H9X A;  3AV7 A;  2OKJ A;  1BKG A;  2O0R A;  1AHE A;  4JEY A;  1TAT A;  2D7Y A;  3MC6 A;  1AHY A;  1SFF A;  1QJ5 A;  2Q7W A;  3JW9 A;  1AHG A;  2BI1 A;  3FKD A;  2YHK A;  3VOM A;  1AHF A;  1AKA A;  3I4J A;  2FM1 A;  3WLX A;  3A9X A;  2VIA A;  3BWO A;  4R8D A;  4XAU A;  2W7K A;  2ZY4 A;  2WB6 A;  1WYU A;  4TV7 A;  4ZDO A;  2AY8 A;  3WCN A;  3ZRR A;  4ADB A;  3BWN C;  1XI9 A;  3AEJ A;  1D7U A;  1LS3 A;  1SZS A;  2YCN A;  3BCX A;  3DOD A;  1GC4 A;  3PJ0 A;  2FNU A;  2XH1 A;  3ECD A;  4MQP A;  3CBF A;  3K40 A;  2BWP A;  1IVR A;  2HOY A;  3LWS A;  4EB5 A;  1M7Y A;  4GE9 A;  2V0Y A;  3RI6 A;  2CY8 A;  2R5E A;  3HT4 A;  3WY7 A;  2JJH A;  1TAR A;  3G7Q A;  4AO9 A;  4F4E A;  4JF0 A;  2OGA A;  2WKA A;  1IX6 A;  3BS8 A;  1ASN A;  3B1E A;  3HQT A;  1CL2 A;  4A00 A;  2ZY5 A;  5TF5 A;  1O69 A;  2GQN A;  4IXZ A;  3NYS A;  3UAK A;  4H63 Q;  4MKK A;  2VGS A;  3MAU A;  3QGU A;  1BQD A;  3L44 A;  1ORD A;  4IY7 A;  4U2H A;  3DXW A;  4JE5 A;  4OCA A;  1D7S A;  3GSB A;  1FG3 A;  2CB1 A;  3MBB A;  3VAX A;  4ZWV A;  3N4S A;  2AY4 A;  2Z61 A;  2WK9 A;  1S08 A;  3EZ1 A;  3NUI A;  3EI8 A;  4I8A A;  1GCK A;  5C6U A;  3PIU A;  2QA3 A;  4WXG A;  2HP1 A;  2D64 A;  3NYT A;  1C7O A;  1X29 A;  3ZRP A;  2W8J A;  1S07 A;  5F9S A;  2AY2 A;  4PFN A;  1V2F A;  2YKY A;  1BJN A;  2HOR A;  1LC8 A;  1TAS A;  4XQ2 A;  1W3U A;  1G4X A;  2RFV A;  1C7N A;  2XBN A;  4E3R A;  2QMA A;  2VLH A;  2G6W A;  1YIZ A;  1TPL A;  3VK3 A;  2VMO A;  4Q6R A;  1AMQ A;  3DRD A;  3MAD A;  4B98 A;  2BIA A;  4R2N A;  3EUC A;  2D5Y A;  1CQ8 A;  3ASA A;  3NRA A;  4MQQ A;  1DJU A;  5DX5 A;  3DYD A;  1ASF A;  3FQ8 A;  1E5F A;  1RV4 A;  3FDB A;  3FRK A;  3N0L A;  4OT8 A;  1IX8 A;  4W5K A;  3E9K A;  1MDX A;  2CH2 A;  5G09 A;  3E2F A;  3WZF A;  4UHN A;  3AEJ C;  4Y0D A;  3VK2 A;  2ZYJ A;  5IWQ A;  4ITX A;  4A0H A;  3BCA A;  3CQ4 A;  2BIE A;  2VMP A;  3HBX A;  2OGE A;  4HF8 A;  3GET A;  2BIG A;  1YJZ A;  2VGT A;  2R0T A;  1ZC9 A;  4WLH A;  1AMA A;  3GWP A;  4ATP A;  1B5P A;  2CFB A;  3TFT A;  1KKJ A;  4R5F A;  2W7E A;  2PO3 A;  3NNK A;  4ISY A;  1ARI A;  1ZOB A;  4A0G A;  1MAQ A;  1PFF A;  1OXP A;  2Z20 A;  2BI3 A;  2EGY A;  4IXS A;  3H7F A;  1BJO B;  2DGM A;  3FVS A;  4JF1 A;  4KXK A;  2VMW A;  2W8T A;  1TOG A;  4Y0I A;  2VLF A;  4GE4 A;  4RIT A;  4BHD A;  2ZUK A;  3VK4 A;  5EAA A;  1Z3Z A;  1GEX A;  2QB3 A;  3ASB A;  2NMP A;  4LNL A;  2A1V A;  2BWN A;  3W1H A;  3RCH A;  1LW5 A;  1BT4 A;  1M6S A;  4N0W A;  3G0T A;  1WST A;  3MKJ A;  4TN4 A;  4HVK A;  1JS3 A;  4RLG A;  2D63 A;  3MAF B;  3GBX A;  4OC9 A;  3OKS A;  2VIB A;  1AJS B;  3WKS A;  1GC3 A;  1M32 A;  5HDM A;  1BJO A;  2GMS A;  4RKD A;  3FQ7 A;  3NYU A;  1ASC A;  3PDB A;  3VP6 A;  3B8X A;  4F5H A;  1LK9 A;  4A0F A;  1CS1 A;  3ZZK A;  1GC0 A;  2EYQ A;  2E7U A;  1AY8 A;  1J32 A;  1AIC A;  4W1X A;  3EI5 A;  3ISL A;  3HL2 A;  4WYG A;  2W8W A;  1IAX A;  2ZJG A;  1ASG A;  5M49 A;  3E6G A;  1YAA A;  1YJY A;  1AJS A;  1G4V A;  2W7M A;  5D5S A;  4ZM3 A;  2YOB A;  1E5E A;  3TCM A;  1RVU A;  3A8U X;  3Q8N A;  2W7H A;  1C0N A;  3DR7 A;  1VJO A;  1MDZ A;  3I16 A;  3WGB A;  1AY4 A;  2VMY A;  3EIA A;  3JWA A;  1G7X A;  3QBO A;  1IJI A;  2DR1 A;  2VMQ A;  4ZAH A;  2WK7 A;  4GDY A;  2YKU A;  3DU4 A;  4EU1 A;  2HOZ A;  2CJG A;  4IXO A;  1D7R A;  3EIB A;  1KMJ A;  1YOO A;  2YKX A;  4L0O A;  4M2J A;  1CJ0 A;  1DFO A;  1S09 A;  5LHA A;  3LVK A;  5EFS A;  1C4K A;  3QHX A;  4RIZ A;  1ARS A;  5EAV A;  3QI6 A;  1C7G A;  4CBS A;  1WKH A;  1N8P A;  4K05 A;  5AX8 A;  3ELP A;  1I48 A;  2AY1 A;  3A9Z A;  4RKC A;  1AMS A;  3D6K A;  1I29 A;  3B1D A;  2DKB A;  3FD0 A;  1AIA A;  2HP2 A;  2QBT A;  3E2Y A;  4WYA A;  5M46 A;  4KAM A;  4JEX A;  4AZJ A;  4F5G A;  1GD9 A;  3JU7 A;  3KGX A;  4LNM A;  4OMA A;  3GJU A;  4AZK A;  2Z9V A;  4WLJ A;  4WBT A;  3I5T A;  5JAY A;  2BYJ A;  3DC1 A;  4WB0 A;  4BMK A;  4IX8 A;  2W8U A;  3FFR A;  3USF A;  1DGE A;  2W7L A;  2AY3 A;  2JG2 A;  4JEV A;  2W7J A;  5HHY A;  3BCB A;  1TOE A;  4K2M A;  2BI9 A;  5EQC A;  5HXX A;  1BQA A;  4UHO A;  5FT4 A;  4ADC A;  4DGT A;  1LW4 A;  2V1P A;  1WKG A;  3FZ8 A;  4J8L A;  3E77 A;  1N31 A;  4F5M A;  2X5F A;  1FG7 A;  1PMO A;  4PFF A;  5BJ3 A;  2CH1 A;  2BKW A;  2GB3 A;  1ASM A;  2VMR A;  3EI7 A;  1KL1 A;  4CVQ A;  1BJ4 A;  2W7G A;  2BI2 A;  1AMR A;  1GEY A;  5E4Z A;  5EUE A;  1EQB A;  1ASL A;  1LKC A;  1XEY A;  1PG8 A;  4Q75 A;  3IF2 A;  5E5I A;  2R5C B;  1AKB A;  1O4S A;  4WYF A;  3W1J A;  1V72 A;  3AEP A;  2JJF A;  3E2Z B;  4AH3 A;  5EUN A;  2W8V A;  3HMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...