1C7OA

Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
394
structure length
394
Chain Sequence
b'MIYDFTTKISRKNLGSLKWDLMYSQNPEVGNEVVPLSVADMEFKNPPELIEGLKKYLDETVLGYTGPTEEYKKTVKKWMKDRHQWDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELLEKDGYYTIDFQKLEKLSKDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHTVFQSIDEQLADKTITFTAPSKTFNIAGMGMSNIIIKNPDIRERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPLIEGTYLQWIDFRALKMDHKAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAAPSSVIQESLERLNKALKDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTALYSIN
publication title Crystal structure of cystalysin from Treponema denticola: a pyridoxal 5'-phosphate-dependent protein acting as a haemolytic enzyme.
pubmed doi rcsb
source organism Treponema denticola
molecule tags Transferase
total genus 145
structure length 394
sequence length 394
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1c7oA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1c7oA01
1IAYA 1GC2A 4FL0A 3WY7A 4ITGA 5E5IA 3F0HA 2O0RA 3CQ6A 5FT6A 4CXRA 4CBSA 4ZM3A 1O4SA 3BC8A 4LC3A 2C7TA 3EI7A 3PA9A 4WYEA 1ZC9A 3BWOA 3HQTA 1S07A 4GSAA 2CSTA 2W7DA 3LY1A 4MQQA 4EB5A 1C9CA 4A0HA 1OATA 5EQCA 2R2NA 3R9AA 3ACZA 4ZAHA 3DC1A 1BJNA 5M4DA 3BN1A 2VGZA 4E77A 3TFUA 5BJ3A 3B1CA 3PD6B 1GC0A 1YJSA 4JEWA 4RM1A 3HDOA 1ASLA 4MSOA 2VMNA 1DJEA 1DJUA 1N8PA 2HORA 4EU1A 4TMRA 1SVVA 2FNIA 2YRRA 1UU1A 1CQ6A 1GD9A 1G4XA 2CTZA 3NNKA 2FQ6A 2BHXA 1BQDA 1V2EA 2VI9A 3EI8A 2DGMA 2VMWA 3FCRA 3FVSA 3NX3A 1LC8A 2ORDA 3MADA 4MQRA 1FG7A 3HBXA 1UU0A 3CBFA 3B1EA 1QIRA 1KL1A 1LC5A 4LW4A 1AX4A 1B8GA 1YOOA 4LW2A 4F5KA 1X2AA 3NUIA 4JEYA 1BJOA 1AHXA 1WKHA 1YJYA 4PIWA 4WB0A 2R5CB 3K7YA 1V72A 2ZYJA 1QGNA 2EZ1A 1IAXA 4ISYA 3PGYA 2WKAA 2AEUA 2X8UA 1U08A 2JJEA 1PG8A 1AY4A 2JGTA 4BHDA 1G4VA 4F5HA 3LVKA 2QA3A 1CZEA 3EIAA 4UOYA 2JJHA 2Z9UA 3FZ8A 2OGEA 3OP7A 2V0YA 1CS1A 1OHVA 3BCXA 1ASCA 3ASAA 5G0AA 1OXPA 3AEPA 3HT4A 1RV4A 4WYAA 1IBJA 2ZJGA 1MAPA 1X28A 5G2PA 1ARIA 2HZPA 1YIZA 4ADCA 3GZCA 1CQ8A 3WZFA 1ASNA 1J04A 1TOEA 1CL2A 2W7IA 2PB2A 2XH1A 3E77A 4OBUA 4OT8A 1AMAA 2OKJA 1LC7A 1AICA 2VMSA 2YKUA 3AEOA 3NDNA 4F5MA 1XI9A 1DGDA 2DR1A 4F5JA 1ARTA 3ASBA 4XAUA 5C6UA 4ZLVA 4ZASA 3ISLA 1PMMA 4JE5D 1AKAA 2VMXA 1MDOA 4OC9A 2BIEA 4W1XA 1WYTB 5M49A 2CFBA 4WYGA 2AY2A 3AEJA 1E5FA 4P3MA 4R8DA 4UHMA 3WX9A 2AY9A 1JF9A 2E54A 3EUCA 4PFFA 1VJOA 1V2DA 2D7ZA 1RVYA 3I4JA 3ZZJA 1CZCA 1GDEA 2Z1ZA 2FYFA 1P3WA 2BI1A 1YNUA 3W1JA 3CQ4A 1B9IA 1KL2A 2BWNA 1AHGA 1I29A 5J8QA 3JU7A 5E4ZA 4E3RA 3MAFB 4XK1A 4XJLA 3EI6A 2WK7A 4R5ZA 1V2FA 4GE4A 5LHAA 1AMRA 3GSBA 2C44A 3W1HA 4CXQA 3AENA 4W8IA 2O7CA 4WYFA 3NYTA 1MDXA 3EZSA 3NU8A 1JS3A 2VMOA 1OXOA 4AZJA 1AHEA 4JEVA 4WBTA 4XEWA 3E2ZA 4RIZA 1SF2A 3NYUA 5EUNA 1KKJA 1B4XA 5G4JA 2D5YA 2O1BA 2HUIA 4Q6RA 4WB0B 1AMQA 1BQAA 5D95A 4Q76A 2YKVA 3OKSA 3LV2A 2Z9VA 3W1IA 2QB2A 1O62A 4MY5A 2W7HA 4A6TA 4A0RA 4OTLA 2JJGA 1TOKA 4BQ0A 4AOAA 1ASEA 1AMSA 3GWPA 3P1TA 1ELUA 3AATA 1H0CA 1AAMA 2CINA 1ASAA 3GBXA 1AKCA 2X3LA 3EZ1A 3ZRRA 4K2IA 4KYOA 4JE5A 1LW4A 2AY7A 2F8JA 2HOYA 3E6GA 3WKRA 3BV0A 4UHNA 1AY8A 1ASBA 1I41A 2VMRA 4GEBA 4P7YA 2YCNA 3BCAA 1TOGA 2W8TA 1QJ5A 2DKBA 3RBLA 4CVQA 1JS6A 4XJPA 2VYCA 1RVUA 2E7JA 3BB8A 3KKIA 2FN6A 2D64A 5DJ9A 4ATQA 3Q8NA 5F8VA 1ASFA 4R2NA 1IVRA 1AJRA 2VGWA 3NU7A 4RITA 1IX6A 4WLHA 3A2BA 3QGUA 3MKJA 4A6RA 4ITXA 3PDBA 3LWSA 4RAEA 4W5KA 4IY7A 1H1CA 1LKCA 3FFRA 1TOIA 2HP1A 1C4KA 4MGRA 4ATPA 5EAVA 1AJSB 4W1VA 3NUBA 1D2FA 1M32A 3PJ0A 4ZWMA 4BA4A 3L44A 2BWPA 2D61A 1BKGA 1C0NA 4XQ2A 4XJMA 2DKJA 3DR7A 1GCKA 2BI2A 5HHYA 3FQ7A 4UQVA 4ZSWA 3ZRPA 2VLFA 3EI9A 3H14A 1QITA 4IYOA 2BKWA 3N0LA 2VMQA 4KXKA 4RKDA 3RCHA 4N0BA 4BMKA 3NRAA 3K40A 3FKDA 2YRIA 2W7KA 5AX8A 2W8JA 3GZDA 3HVYA 2QBTA 3JWBA 3JZLA 1WYUB 1S0AA 3AENB 5EFSA 1W3UA 2AY4A 2W8UA 3AEMA 4AH3A 1M0OA 4ZDOA 2W7GA 3WKSA 4ZM4A 2X5DA 2C81A 1ZOBA 3E2YA 4MKJA 4U1TA 1GC3A 2FM1A 3E2ZB 2HOZA 3VK2A 3DXWA 2W8WA 4Q75A 7AATA 4L0OA 4DBCA 1AAWA 1ARSA 1CL1A 4ZDPA 3I16A 4IXSA 4GDYA 3BWNA 3WGCA 1D7UA 1YIYA 3P6KA 5EIGA 4A6UA 2CJGA 4LNLA 5EUEA 2V1PA 2BIAA 3PDXA 1GEXA 1S06A 1WYVA 4WXBA 4ADDA 2NMPA 2ZY5A 2WK9A 3LG0A 3KE3A 3LVMA 4Y0IA 3BS8A 2QLRA 1MLZA 1DKAA 3WLXA 5M4BA 4WXFA 2W7LA 1TARA 3GZDC 3ZRQA 4PVFA 1W7NA 4QGRA 2BIGA 2GMSA 3ELPA 3PD6A 4K2MA 5DX5A 3AEMC 3MC6C 4M2JA 1MLYA 1FC4A 4RJYA 3RQ1A 1QISA 3DZZA 3PAAA 4TV7A 2DOUA 4E3QA 3KGXA 3DYDA 5EAAA 3LVJA 1TPLA 4M2KA 3WCOA 2YCPA 1IUGA 2DGLA 4Y0HA 1LK9A 1TOJA 1VEFA 4F4EA 2Q7WA 2VMTA 1B5PA 4OMAA 1DFOA 1AY5A 4KAMA 2X5FA 4MQPA 4NOGA 4CBRA 2Z20A 1T3IA 4RJ0A 1KKPA 2YOBA 3BWNC 4GE9A 4EFFA 3QM2A 1ZODA 3A9YA 4WP0A 3AV7A 2BI3A 2Z61A 3FDBA 1BJWA 1VP4A 2R5CA 2TPLA 4IW7A 2Z67A 2W7EA 1SZSA 3NTJA 3NYSA 1SPAA 2HUFA 1BJOB 4WYCA 3DR4A 1M0PA 1GEWA 2R0TA 1I48A 4GE7A 3FSLA 4DQ6A 2PB0A 2BYLA 1BJ4A 1ELQA 2EGYA 1B5OA 3BCBA 2AY6A 5IWQA 1MDZA 3L8AA 4BA5A 5HDMA 4J5UA 3A8UX 9AATA 1FG3A 2AY8A 4RKCA 2DGKA 3HMUA 4HVKA 1W23A 3QPGA 2VGUA 2CJHA 3HLMA 4WYDA 1I43A 4F5IA 3VK4A 2GMUA 3PPLA 4OCAA 5E3KA 1AIBA 4ZWVA 2ZC0A 2CJDA 1TATA 2YKXA 3CQ5A 4PFNA 4WLJA 3TFTA 1EJIA 4M2MA 1C7GA 2W7MA 4OBVA 3COGA 2ZUKA 3FD0A 3FQ8A 1BT4A 5JAYA 2BYJA 2FNUA 3UWCA 3B1DA 2VMPA 4TN4A 1BS0A 3IF2A 2ZP7A 4F5LA 3B8XA 2CY8A 3JW9A 2OQXA 4B9BA 1YJZA 1W7MA 4HF8A 4ADEA 2VLHA 2HP2A 1UKJA 3E9KA 1SFFA 1WYTA 3B46A 1AIAA 5EIGB 2JJFA 3JTXA 1WSTA 1N2TA 3VOMA 2VI8A 1QZ9A 4Y0DA 4ADBA 2VGSA 4N0WA 3QBOA 1LS3A 1WYVB 1S08A 2VIBA 3JWAA 3EI5A 3GR9A 1KMJA 2VMVA 3CAIA 5G4IA 3DODA 4WD2A 3ATHA 4U2HA 4A0GA 2D63A 3FRKA 2AEVA 1LW5A 3E2FA 1ARGA 1ASDA 1MGVA 3FQAA 1SZUA 2E7IA 1IJIA 4A0FA 1GBNA 1EQBA 3UAKA 1GEYA 1Z3ZA 2VMUA 4EMYA 1CQ7A 3MAFA 3F6TA 2W8VA 3K28A 1IX8A 3HL2A 2ZY4A 3MEBA 4RLGA 4B98A 2EZ2A 1W7LA 3KGWA 2CB1A 5TF5A 4H51A 5I92A 1OHYA 3D6KA 3G8MA 2OATA 3AOWA 5DB5A 2YHKA 3MC6A 1CJ0A 2AY5A 3R4TA 3M5UA 2ZY2A 4J8LA 2Z9WA 5G2QA 2Z9XA 2W7JA 3DXVA 4LNMA 1O61A 5FT4A 1ARHA 1DGEA 2JG2A 4W91A 3ECDA 3QHXA 2EH6A 4W1WA 1C7OA 4JEXA 4GRXA 2VGVA 1G7XA 2XBNA 4EB7A 1BW0A 1RV3A 3FZ7A 4WXGA 5M46A 1D7SA 2VMYA 8AATA 2BWOA 1OHWA 3F9TA 3FFHA 5D5SA 3ELEA 3G0TA 2C0RA 3WGBA 2CANA 1XEYA 2EO5A 2YKYA 3MAUA 2D65A 1Z7DA 4JEZA 1DJ9A 1QJ3A 1M7YA 3AELA 3N5MA 1N31A 1S09A 1JG8A 2PO3A 3FTBA 4IX8A 1X0MA 4IXZA 4Q31A 1PFFA 1AHFA 3VP6A 1MAQA 1Y4IA 1D7RA 2G6WA 3A9ZA 3RI6A 4E1OA 5K8BA 5DJ1A 5BJ4A 1M4NA 3N75A 3USFA 2D7YA 2HUUA 3LVLB 5EUDA 2GB3A 1GC4A 2EPJA 1WKGA 3TCMA 4A72A 3QN6A 1M6SA 5HXXA 1ASMA 4I8AA 2JISA 4OYTA 5FT5A 1DTYA 4F5FA 3FVXA 2CH1A 3II0A 4AO9A 1J32A 2HOXA 3PDBB 1AJSA 1SZKA 2R5EA 4R5FA 3DRDA 1G7WA 3QI6A 1C7NA 2YCTA 1O69A 3VAXA 3T32A 3UE8A 2AY3A 1AHYA 2D66A 3GJUA 2BI5A 5FT8A 2WK8A 4AO4A 1X29A 2E7UA 2OGAA 2VGTA 3DU4A 4DGTA 1B9HA 4F5GA 3G7QA 4XJOA 1ORDA 1IX7A 2ZY3A 3EIBA 4IXOA 4UHOA 1D7VA 3IHJA 3H7FA 4MKKA 4IYOB 3RUYA 2QMAA 2Z1YA 3RCHB 3VK3A 1ASGA 4FFCA 1WYUA 5G09A 1KMKA 2GQNA 3PIUA 2CH2A 3RBFA 4A00A 4JF0A 1ECXA 3FVUA 3A9XA 1M0NA 3WCNA 4JF1A 1EG5A 3TATA 3ZZKA 5F9SA 3MBBA 4ZDLA 2VIAA 1M0QA 3I5TA 4AZKA 2BI9A 2AY1A 2ZSMA 4O6ZA 5LH9A 3GETA 2QB3A 1TASA 2RFVA 4ZSYA 1YAAA 2AATA 3AEJC 4K2BA 3FDDA 1UU2A 1PMOA 2GSAA 3TQXA 1E5EA 3AOVA 2W7FA 4LNJA 1AKBA 2VMZA 2ZSLA 3FZ6A 2OKKA
chains in the Genus database with same CATH superfamily
1IAYA 1GC2A 4FL0A 3WY7A 4ITGA 5E5IA 3F0HA 2O0RA 3CQ6A 5FT6A 4CXRA 4CBSA 4ZM3A 1O4SA 3BC8A 4LC3A 2C7TA 3EI7A 3PA9A 4WYEA 1ZC9A 3BWOA 3HQTA 1S07A 4GSAA 2CSTA 2W7DA 3LY1A 4MQQA 4EB5A 1C9CA 4A0HA 2A1VA 1OATA 5EQCA 2R2NA 3R9AA 3ACZA 4ZAHA 3DC1A 1BJNA 5M4DA 3BN1A 2VGZA 4E77A 3TFUA 5BJ3A 3B1CA 3PD6B 1GC0A 1YJSA 4JEWA 4RM1A 3HDOA 1ASLA 4MSOA 2VMNA 1DJEA 1DJUA 1N8PA 2HORA 4EU1A 4TMRA 1SVVA 2FNIA 2YRRA 1UU1A 1CQ6A 1GD9A 1G4XA 2CTZA 3NNKA 2FQ6A 2BHXA 1BQDA 1V2EA 2VI9A 3EI8A 2DGMA 2VMWA 3FCRA 3FVSA 3NX3A 1LC8A 2ORDA 3MADA 4MQRA 1FG7A 3HBXA 1UU0A 3CBFA 3B1EA 1QIRA 1KL1A 1LC5A 4LW4A 1AX4A 1B8GA 1YOOA 4LW2A 4F5KA 1X2AA 3NUIA 4JEYA 1BJOA 1AHXA 1WKHA 1YJYA 4PIWA 4WB0A 2R5CB 3K7YA 1V72A 2ZYJA 1QGNA 2EZ1A 1IAXA 4ISYA 3PGYA 2WKAA 2AEUA 2X8UA 1U08A 2JJEA 1PG8A 1AY4A 2JGTA 4BHDA 1G4VA 4F5HA 3LVKA 2QA3A 1CZEA 3EIAA 4UOYA 2JJHA 2Z9UA 3FZ8A 2OGEA 3OP7A 2V0YA 1CS1A 1OHVA 3BCXA 1ASCA 3ASAA 5G0AA 1OXPA 3AEPA 3HT4A 1RV4A 4WYAA 1IBJA 2ZJGA 4H63Q 1MAPA 1X28A 5G2PA 1ARIA 2HZPA 1YIZA 4ADCA 3GZCA 1CQ8A 3WZFA 1ASNA 1J04A 1TOEA 1CL2A 2W7IA 2PB2A 2XH1A 3E77A 4OBUA 4OT8A 1AMAA 2OKJA 1LC7A 1AICA 2VMSA 2YKUA 3AEOA 3NDNA 4F5MA 1XI9A 1DGDA 2DR1A 4F5JA 1ARTA 3ASBA 4XAUA 5C6UA 4ZLVA 4ZASA 3ISLA 1PMMA 2WB6A 4JE5D 1AKAA 2VMXA 1MDOA 4OC9A 2BIEA 4W1XA 1WYTB 5M49A 2CFBA 4WYGA 2AY2A 3AEJA 1E5FA 4P3MA 4R8DA 4UHMA 3WX9A 2AY9A 1JF9A 2E54A 3EUCA 4PFFA 1VJOA 1V2DA 2D7ZA 1RVYA 5KTBA 3I4JA 3ZZJA 1CZCA 1GDEA 2Z1ZA 2FYFA 1P3WA 2BI1A 1YNUA 3W1JA 3CQ4A 1B9IA 1KL2A 2BWNA 1AHGA 1I29A 5J8QA 3JU7A 5E4ZA 4E3RA 3MAFB 4XK1A 4XJLA 3EI6A 2WK7A 4R5ZA 1V2FA 4GE4A 5LHAA 1AMRA 3GSBA 2C44A 3W1HA 4CXQA 3AENA 4W8IA 2O7CA 2G7JA 4WYFA 3NYTA 1MDXA 3EZSA 3NU8A 1JS3A 2VMOA 1OXOA 4AZJA 1AHEA 4JEVA 4WBTA 4XEWA 3E2ZA 4RIZA 1SF2A 3NYUA 5EUNA 1KKJA 1B4XA 5G4JA 2D5YA 2O1BA 2HUIA 4Q6RA 4WB0B 1AMQA 1BQAA 5D95A 4Q76A 2YKVA 3OKSA 3LV2A 2Z9VA 3W1IA 2QB2A 1O62A 4MY5A 2W7HA 4A6TA 4A0RA 4OTLA 2JJGA 1TOKA 4BQ0A 4AOAA 1ASEA 1AMSA 3GWPA 3P1TA 1ELUA 3AATA 1H0CA 1AAMA 2CINA 1ASAA 3GBXA 1AKCA 2X3LA 3EZ1A 3ZRRA 4K2IA 4KYOA 4JE5A 1LW4A 2AY7A 2F8JA 2HOYA 3E6GA 3WKRA 4K05A 3BV0A 4UHNA 1AY8A 1ASBA 1I41A 2VMRA 4GEBA 4P7YA 2YCNA 3BCAA 1TOGA 2W8TA 1QJ5A 2DKBA 3RBLA 4CVQA 1JS6A 4XJPA 2VYCA 1RVUA 2E7JA 3BB8A 3KKIA 2FN6A 2D64A 5DJ9A 4ATQA 3Q8NA 5F8VA 1ASFA 4R2NA 1IVRA 1AJRA 2VGWA 3NU7A 4RITA 1IX6A 4WLHA 3A2BA 3QGUA 3MKJA 4A6RA 4ITXA 3PDBA 3LWSA 4RAEA 4W5KA 4IY7A 1H1CA 1LKCA 3FFRA 1TOIA 2HP1A 1C4KA 4MGRA 4ATPA 5EAVA 1AJSB 4W1VA 3NUBA 1D2FA 1M32A 3PJ0A 4ZWMA 4BA4A 3L44A 2BWPA 2D61A 1BKGA 1C0NA 4XQ2A 4XJMA 2DKJA 3DR7A 1GCKA 2BI2A 5HHYA 3FQ7A 4UQVA 4ZSWA 3ZRPA 2VLFA 3EI9A 3H14A 1QITA 4IYOA 2BKWA 3N0LA 2VMQA 4KXKA 4RKDA 3RCHA 4N0BA 4BMKA 3NRAA 3K40A 3FKDA 2YRIA 2W7KA 5AX8A 2W8JA 3GZDA 3HVYA 2QBTA 3JWBA 3JZLA 1WYUB 1S0AA 3AENB 5EFSA 1W3UA 2AY4A 2W8UA 3AEMA 4AH3A 1M0OA 4ZDOA 2W7GA 3WKSA 4ZM4A 2X5DA 2C81A 1ZOBA 3E2YA 4MKJA 4U1TA 1GC3A 2FM1A 3E2ZB 2HOZA 3VK2A 3DXWA 2W8WA 4Q75A 7AATA 4L0OA 4DBCA 1AAWA 1ARSA 1CL1A 4ZDPA 3I16A 4IXSA 4GDYA 3BWNA 3WGCA 2KFPA 1D7UA 1YIYA 3P6KA 5EIGA 4A6UA 2CJGA 4LNLA 5EUEA 2V1PA 2BIAA 3PDXA 1GEXA 1S06A 1WYVA 4WXBA 4ADDA 2NMPA 2ZY5A 2WK9A 3LG0A 3KE3A 3LVMA 4Y0IA 3BS8A 2QLRA 1MLZA 1DKAA 3WLXA 5M4BA 4WXFA 2W7LA 1TARA 3GZDC 3ZRQA 4PVFA 1W7NA 4QGRA 2BIGA 2GMSA 3ELPA 3PD6A 4K2MA 5DX5A 3AEMC 3MC6C 4M2JA 1MLYA 1FC4A 4RJYA 3RQ1A 1QISA 3DZZA 3PAAA 4TV7A 2DOUA 4E3QA 3KGXA 3DYDA 5EAAA 3LVJA 1TPLA 4M2KA 3WCOA 2YCPA 1IUGA 2DGLA 4Y0HA 1LK9A 1TOJA 1VEFA 4F4EA 2FKIA 2Q7WA 2VMTA 1B5PA 4OMAA 1DFOA 1AY5A 4KAMA 2X5FA 4MQPA 4NOGA 4CBRA 2Z20A 1T3IA 4RJ0A 1KKPA 2YOBA 3BWNC 4GE9A 4EFFA 3QM2A 1ZODA 3A9YA 4WP0A 3AV7A 2BI3A 2Z61A 3FDBA 1BJWA 1VP4A 2R5CA 2TPLA 4IW7A 2Z67A 2W7EA 1SZSA 3NTJA 3NYSA 1SPAA 2HUFA 1BJOB 4WYCA 3DR4A 1M0PA 1GEWA 2R0TA 1I48A 4GE7A 3FSLA 4DQ6A 2PB0A 2BYLA 1BJ4A 1ELQA 2EGYA 1B5OA 3BCBA 2AY6A 5IWQA 1MDZA 3L8AA 4BA5A 5HDMA 4J5UA 3A8UX 9AATA 1FG3A 2AY8A 4RKCA 2DGKA 3HMUA 4HVKA 1W23A 3N7NA 3QPGA 2VGUA 2CJHA 3HLMA 4WYDA 1I43A 4F5IA 3VK4A 2GMUA 3PPLA 4OCAA 5E3KA 1AIBA 4ZWVA 2ZC0A 2CJDA 3H9XA 1TATA 2YKXA 3CQ5A 4PFNA 4WLJA 3TFTA 1EJIA 4M2MA 1C7GA 2W7MA 4OBVA 3COGA 2ZUKA 3FD0A 3FQ8A 1BT4A 5JAYA 2BYJA 2FNUA 3UWCA 3B1DA 2VMPA 4TN4A 1BS0A 3IF2A 2ZP7A 4F5LA 3B8XA 2CY8A 3JW9A 2OQXA 4B9BA 1YJZA 1W7MA 4HF8A 4ADEA 2VLHA 2HP2A 1UKJA 3E9KA 1SFFA 1WYTA 3B46A 1AIAA 5EIGB 2JJFA 3JTXA 1WSTA 1N2TA 3VOMA 2VI8A 1QZ9A 4Y0DA 4ADBA 2VGSA 4N0WA 3QBOA 1LS3A 1WYVB 1S08A 2VIBA 3JWAA 3EI5A 3GR9A 1KMJA 2VMVA 2QSRA 3CAIA 5G4IA 3DODA 4WD2A 3ATHA 4U2HA 4A0GA 2D63A 3FRKA 2AEVA 1LW5A 3E2FA 1ARGA 1ASDA 1MGVA 3FQAA 1SZUA 2E7IA 1IJIA 4A0FA 1GBNA 1EQBA 3UAKA 1GEYA 1Z3ZA 2VMUA 4EMYA 1CQ7A 3MAFA 3F6TA 2W8VA 3K28A 1IX8A 3HL2A 2ZY4A 3MEBA 4RLGA 4B98A 2EZ2A 1W7LA 3KGWA 2CB1A 5TF5A 4H51A 5I92A 1OHYA 3D6KA 3G8MA 2OATA 3AOWA 5DB5A 2YHKA 3MC6A 3N4SA 1CJ0A 2AY5A 3R4TA 3M5UA 2ZY2A 4J8LA 2Z9WA 5G2QA 2Z9XA 3N4RA 2W7JA 3DXVA 4LNMA 1O61A 5FT4A 1ARHA 1DGEA 2JG2A 4W91A 3ECDA 3QHXA 2EH6A 4W1WA 1C7OA 4JEXA 4GRXA 2VGVA 1G7XA 2XBNA 4EB7A 1BW0A 1RV3A 3FZ7A 4WXGA 5M46A 1D7SA 2VMYA 8AATA 2BWOA 1OHWA 3F9TA 3FFHA 5D5SA 3ELEA 3G0TA 2C0RA 3WGBA 2CANA 1XEYA 2EO5A 2YKYA 3MAUA 2D65A 1Z7DA 4JEZA 1DJ9A 1QJ3A 1M7YA 3AELA 3N5MA 1N31A 1S09A 1JG8A 2PO3A 3FTBA 4IX8A 1X0MA 4IXZA 4Q31A 1PFFA 1AHFA 3VP6A 1MAQA 1Y4IA 1D7RA 2G6WA 3A9ZA 3RI6A 4E1OA 5K8BA 5DJ1A 5BJ4A 1M4NA 3N75A 3USFA 2D7YA 2HUUA 3LVLB 5EUDA 2GB3A 1GC4A 2EPJA 1WKGA 3TCMA 4A72A 3QN6A 1M6SA 5HXXA 1ASMA 4I8AA 2JISA 4OYTA 5FT5A 1DTYA 4F5FA 3FVXA 2CH1A 3II0A 4AO9A 1J32A 2HOXA 3PDBB 1KAFA 1AJSA 1SZKA 2R5EA 4R5FA 3DRDA 1G7WA 3QI6A 1C7NA 2YCTA 1O69A 3VAXA 3T32A 3UE8A 2AY3A 1AHYA 2D66A 3GJUA 2BI5A 5FT8A 2WK8A 4AO4A 1X29A 2E7UA 2OGAA 2VGTA 3DU4A 4DGTA 1B9HA 4F5GA 3G7QA 4XJOA 1ORDA 1IX7A 2ZY3A 3EIBA 4IXOA 4UHOA 1D7VA 3N4XA 3IHJA 3H7FA 4MKKA 4IYOB 3RUYA 2QMAA 2Z1YA 3RCHB 3VK3A 1ASGA 4FFCA 1WYUA 5G09A 1KMKA 2GQNA 3PIUA 2CH2A 3RBFA 4A00A 4JF0A 1ECXA 3FVUA 3A9XA 1M0NA 3WCNA 4JF1A 1EG5A 3TATA 3ZZKA 5F9SA 3MBBA 4ZDLA 2VIAA 1M0QA 3I5TA 4AZKA 2BI9A 2AY1A 2ZSMA 4O6ZA 5LH9A 3GETA 2QB3A 1TASA 2RFVA 4ZSYA 1YAAA 2AATA 2EYQA 3AEJC 4K2BA 3FDDA 1UU2A 1PMOA 2GSAA 3TQXA 1E5EA 3AOVA 2W7FA 4LNJA 1AKBA 2VMZA 2ZSLA 3FZ6A 2OKKA
chains in the Genus database with same CATH topology
1IAYA 1GC2A 4FL0A 3WY7A 4ITGA 5E5IA 3F0HA 2O0RA 3CQ6A 5FT6A 4CXRA 4CBSA 4ZM3A 1O4SA 3BC8A 4LC3A 2C7TA 3EI7A 3PA9A 4WYEA 1ZC9A 3BWOA 3HQTA 1S07A 4GSAA 2CSTA 2W7DA 3LY1A 4MQQA 4EB5A 1C9CA 4A0HA 2A1VA 1OATA 5EQCA 2R2NA 3R9AA 3ACZA 4ZAHA 3DC1A 1BJNA 5M4DA 3BN1A 2VGZA 4E77A 3TFUA 5BJ3A 3B1CA 3PD6B 1GC0A 1YJSA 4JEWA 4RM1A 3HDOA 1ASLA 4MSOA 2VMNA 1DJEA 1DJUA 1N8PA 2HORA 4EU1A 4TMRA 1SVVA 2FNIA 2YRRA 1UU1A 1CQ6A 1GD9A 1G4XA 2CTZA 3NNKA 2FQ6A 2BHXA 1BQDA 1V2EA 2VI9A 3EI8A 2DGMA 2VMWA 3FCRA 3FVSA 3NX3A 1LC8A 2ORDA 3MADA 4MQRA 1FG7A 3HBXA 1UU0A 3CBFA 3B1EA 1QIRA 1KL1A 1LC5A 4LW4A 1AX4A 1B8GA 1YOOA 4LW2A 4F5KA 1X2AA 3NUIA 4JEYA 1BJOA 1AHXA 1WKHA 1YJYA 4PIWA 4WB0A 2R5CB 3K7YA 1V72A 2ZYJA 1QGNA 2EZ1A 1IAXA 4ISYA 3PGYA 2WKAA 2AEUA 2X8UA 1U08A 2JJEA 1PG8A 1AY4A 2JGTA 4BHDA 1G4VA 4F5HA 3LVKA 2QA3A 1CZEA 3EIAA 4UOYA 2JJHA 2Z9UA 3FZ8A 2OGEA 3OP7A 2V0YA 1CS1A 1OHVA 3BCXA 1ASCA 3ASAA 5G0AA 1OXPA 3AEPA 3HT4A 1RV4A 4WYAA 1IBJA 2ZJGA 4H63Q 1MAPA 1X28A 5G2PA 1ARIA 2HZPA 1YIZA 4ADCA 3GZCA 1CQ8A 3WZFA 1ASNA 1J04A 1TOEA 1CL2A 2W7IA 2PB2A 2XH1A 3E77A 4OBUA 4OT8A 1AMAA 2OKJA 1LC7A 1AICA 2VMSA 2YKUA 3AEOA 3NDNA 4F5MA 1XI9A 1DGDA 2DR1A 4F5JA 1ARTA 3ASBA 4XAUA 5C6UA 4ZLVA 4ZASA 3ISLA 1PMMA 2WB6A 4JE5D 1AKAA 2VMXA 1MDOA 4OC9A 2BIEA 4W1XA 1WYTB 5M49A 2CFBA 4WYGA 2AY2A 3AEJA 1E5FA 4P3MA 4R8DA 4UHMA 3WX9A 2AY9A 1JF9A 2E54A 3EUCA 4PFFA 1VJOA 1V2DA 2D7ZA 1RVYA 5KTBA 3I4JA 3ZZJA 1CZCA 1GDEA 2Z1ZA 2FYFA 1P3WA 2BI1A 1YNUA 3W1JA 3CQ4A 1B9IA 1KL2A 2BWNA 1AHGA 1I29A 5J8QA 3JU7A 5E4ZA 4E3RA 3MAFB 4XK1A 4XJLA 3EI6A 2WK7A 4R5ZA 1V2FA 4GE4A 5LHAA 1AMRA 3GSBA 2C44A 3W1HA 4CXQA 3AENA 4W8IA 2O7CA 2G7JA 4WYFA 3NYTA 1MDXA 3EZSA 3NU8A 1JS3A 2VMOA 1OXOA 4AZJA 1AHEA 4JEVA 4WBTA 4XEWA 3E2ZA 4RIZA 1SF2A 3NYUA 5EUNA 1KKJA 1B4XA 5G4JA 2D5YA 2O1BA 2HUIA 4Q6RA 4WB0B 1AMQA 1BQAA 5D95A 4Q76A 2YKVA 3OKSA 3LV2A 2Z9VA 3W1IA 2QB2A 1O62A 4MY5A 2W7HA 4A6TA 4A0RA 4OTLA 2JJGA 1TOKA 4BQ0A 4AOAA 1ASEA 1AMSA 3GWPA 3P1TA 1ELUA 3AATA 1H0CA 1AAMA 2CINA 1ASAA 3GBXA 1AKCA 2X3LA 3EZ1A 3ZRRA 4K2IA 4KYOA 4JE5A 1LW4A 2AY7A 2F8JA 2HOYA 3E6GA 3WKRA 4K05A 3BV0A 4UHNA 1AY8A 1ASBA 1I41A 2VMRA 4GEBA 4P7YA 2YCNA 3BCAA 1TOGA 2W8TA 1QJ5A 2DKBA 3RBLA 4CVQA 1JS6A 4XJPA 2VYCA 1RVUA 2E7JA 3BB8A 3KKIA 2FN6A 2D64A 5DJ9A 4ATQA 3Q8NA 5F8VA 1ASFA 4R2NA 1IVRA 1AJRA 2VGWA 3NU7A 4RITA 1IX6A 4WLHA 3A2BA 3QGUA 3MKJA 4A6RA 4ITXA 3PDBA 3LWSA 4RAEA 4W5KA 4IY7A 1H1CA 1LKCA 3FFRA 1TOIA 2HP1A 1C4KA 4MGRA 4ATPA 5EAVA 1AJSB 4W1VA 3NUBA 1D2FA 1M32A 3PJ0A 4ZWMA 4BA4A 3L44A 2BWPA 2D61A 1BKGA 1C0NA 4XQ2A 4XJMA 2DKJA 3DR7A 1GCKA 2BI2A 5HHYA 3FQ7A 4UQVA 4ZSWA 3ZRPA 2VLFA 3EI9A 3H14A 1QITA 4IYOA 2BKWA 3N0LA 2VMQA 4KXKA 4RKDA 3RCHA 4N0BA 4BMKA 3NRAA 3K40A 3FKDA 2YRIA 2W7KA 5AX8A 2W8JA 3GZDA 3HVYA 2QBTA 3JWBA 3JZLA 1WYUB 1S0AA 3AENB 5EFSA 1W3UA 2AY4A 2W8UA 3AEMA 4AH3A 1M0OA 4ZDOA 2W7GA 3WKSA 4ZM4A 2X5DA 2C81A 1ZOBA 3E2YA 4MKJA 4U1TA 1GC3A 2FM1A 3E2ZB 2HOZA 3VK2A 3DXWA 2W8WA 4Q75A 7AATA 4L0OA 4DBCA 1AAWA 1ARSA 1CL1A 4ZDPA 3I16A 4IXSA 4GDYA 3BWNA 3WGCA 2KFPA 1D7UA 1YIYA 3P6KA 5EIGA 4A6UA 2CJGA 4LNLA 5EUEA 2V1PA 2BIAA 3PDXA 1GEXA 1S06A 1WYVA 4WXBA 4ADDA 2NMPA 2ZY5A 2WK9A 3LG0A 3KE3A 3LVMA 4Y0IA 3BS8A 2QLRA 1MLZA 1DKAA 3WLXA 5M4BA 4WXFA 2W7LA 1TARA 3GZDC 3ZRQA 4PVFA 1W7NA 4QGRA 2BIGA 2GMSA 3ELPA 3PD6A 4K2MA 5DX5A 3AEMC 3MC6C 4M2JA 1MLYA 1FC4A 4RJYA 3RQ1A 1QISA 3DZZA 3PAAA 4TV7A 2DOUA 4E3QA 3KGXA 3DYDA 5EAAA 3LVJA 1TPLA 4M2KA 3WCOA 2YCPA 1IUGA 2DGLA 4Y0HA 1LK9A 1TOJA 1VEFA 4F4EA 2FKIA 2Q7WA 2VMTA 1B5PA 4OMAA 1DFOA 1AY5A 4KAMA 2X5FA 4MQPA 4NOGA 4CBRA 2Z20A 1T3IA 4RJ0A 1KKPA 2YOBA 3BWNC 4GE9A 4EFFA 3QM2A 1ZODA 3A9YA 4WP0A 3AV7A 2BI3A 2Z61A 3FDBA 1BJWA 1VP4A 2R5CA 2TPLA 4IW7A 2Z67A 2W7EA 1SZSA 3NTJA 3NYSA 1SPAA 2HUFA 1BJOB 4WYCA 3DR4A 1M0PA 1GEWA 2R0TA 1I48A 4GE7A 3FSLA 4DQ6A 2PB0A 2BYLA 1BJ4A 1ELQA 2EGYA 1B5OA 3BCBA 2AY6A 5IWQA 1MDZA 3L8AA 4BA5A 5HDMA 4J5UA 3A8UX 9AATA 1FG3A 2AY8A 4RKCA 2DGKA 3HMUA 4HVKA 1W23A 3N7NA 3QPGA 2VGUA 2CJHA 3HLMA 4WYDA 1I43A 4F5IA 3VK4A 2GMUA 3PPLA 4OCAA 5E3KA 1AIBA 4ZWVA 2ZC0A 2CJDA 3H9XA 1TATA 2YKXA 3CQ5A 4PFNA 4WLJA 3TFTA 1EJIA 4M2MA 1C7GA 2W7MA 4OBVA 3COGA 2ZUKA 3FD0A 3FQ8A 1BT4A 5JAYA 2BYJA 2FNUA 3UWCA 3B1DA 2VMPA 4TN4A 1BS0A 3IF2A 2ZP7A 4F5LA 3B8XA 2CY8A 3JW9A 2OQXA 4B9BA 1YJZA 1W7MA 4HF8A 4ADEA 2VLHA 2HP2A 1UKJA 3E9KA 1SFFA 1WYTA 3B46A 1AIAA 5EIGB 2JJFA 3JTXA 1WSTA 1N2TA 3VOMA 2VI8A 1QZ9A 4Y0DA 4ADBA 2VGSA 4N0WA 3QBOA 1LS3A 1WYVB 1S08A 2VIBA 3JWAA 3EI5A 3GR9A 1KMJA 2VMVA 2QSRA 3CAIA 5G4IA 3DODA 4WD2A 3ATHA 4U2HA 4A0GA 2D63A 3FRKA 2AEVA 1LW5A 3E2FA 1ARGA 1ASDA 1MGVA 3FQAA 1SZUA 2E7IA 1IJIA 4A0FA 1GBNA 1EQBA 3UAKA 1GEYA 1Z3ZA 2VMUA 4EMYA 1CQ7A 3MAFA 3F6TA 2W8VA 3K28A 1IX8A 3HL2A 2ZY4A 3MEBA 4RLGA 4B98A 2EZ2A 1W7LA 3KGWA 2CB1A 5TF5A 4H51A 5I92A 1OHYA 3D6KA 3G8MA 2OATA 3AOWA 5DB5A 2YHKA 3MC6A 3N4SA 1CJ0A 2AY5A 3R4TA 3M5UA 2ZY2A 4J8LA 2Z9WA 5G2QA 2Z9XA 3N4RA 2W7JA 3DXVA 4LNMA 1O61A 5FT4A 1ARHA 1DGEA 2JG2A 4W91A 3ECDA 3QHXA 2EH6A 4W1WA 1C7OA 4JEXA 4GRXA 2VGVA 1G7XA 2XBNA 4EB7A 1BW0A 1RV3A 3FZ7A 4WXGA 5M46A 1D7SA 2VMYA 8AATA 2BWOA 1OHWA 3F9TA 3FFHA 5D5SA 3ELEA 3G0TA 2C0RA 3WGBA 2CANA 1XEYA 2EO5A 2YKYA 3MAUA 2D65A 1Z7DA 4JEZA 1DJ9A 1QJ3A 1M7YA 3AELA 3N5MA 1N31A 1S09A 1JG8A 2PO3A 3FTBA 4IX8A 1X0MA 4IXZA 4Q31A 1PFFA 1AHFA 3VP6A 1MAQA 1Y4IA 1D7RA 2G6WA 3A9ZA 3RI6A 4E1OA 5K8BA 5DJ1A 5BJ4A 1M4NA 3N75A 3USFA 2D7YA 2HUUA 3LVLB 5EUDA 2GB3A 1GC4A 2EPJA 1WKGA 3TCMA 4A72A 3QN6A 1M6SA 5HXXA 1ASMA 4I8AA 2JISA 4OYTA 5FT5A 1DTYA 4F5FA 3FVXA 2CH1A 3II0A 4AO9A 1J32A 2HOXA 3PDBB 1AJSA 1SZKA 2R5EA 4R5FA 3DRDA 1G7WA 3QI6A 1C7NA 2YCTA 1O69A 3VAXA 3T32A 3UE8A 2AY3A 1AHYA 2D66A 3GJUA 2BI5A 5FT8A 2WK8A 4AO4A 1X29A 2E7UA 2OGAA 2VGTA 3DU4A 4DGTA 1B9HA 4F5GA 3G7QA 4XJOA 1ORDA 1IX7A 2ZY3A 3EIBA 4IXOA 4UHOA 1D7VA 3N4XA 3IHJA 3H7FA 4MKKA 4IYOB 3RUYA 2QMAA 2Z1YA 3RCHB 3VK3A 1ASGA 4FFCA 1WYUA 5G09A 1KMKA 2GQNA 3PIUA 2CH2A 3RBFA 4A00A 4JF0A 1ECXA 3FVUA 3A9XA 1M0NA 3WCNA 4JF1A 1EG5A 3TATA 3ZZKA 5F9SA 3MBBA 4ZDLA 2VIAA 1M0QA 3I5TA 4AZKA 2BI9A 2AY1A 2ZSMA 4O6ZA 5LH9A 3GETA 2QB3A 1TASA 2RFVA 4ZSYA 1YAAA 2AATA 2EYQA 3AEJC 4K2BA 3FDDA 1UU2A 1PMOA 2GSAA 3TQXA 1E5EA 3AOVA 2W7FA 4LNJA 1AKBA 2VMZA 2ZSLA 3FZ6A 2OKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAY A;  1GC2 A;  4FL0 A;  3WY7 A;  4ITG A;  5E5I A;  3F0H A;  2O0R A;  3CQ6 A;  5FT6 A;  4CXR A;  4CBS A;  4ZM3 A;  1O4S A;  3BC8 A;  4LC3 A;  2C7T A;  3EI7 A;  3PA9 A;  4WYE A;  1ZC9 A;  3BWO A;  3HQT A;  1S07 A;  4GSA A;  2CST A;  2W7D A;  3LY1 A;  4MQQ A;  4EB5 A;  1C9C A;  4A0H A;  1OAT A;  5EQC A;  2R2N A;  3R9A A;  3ACZ A;  4ZAH A;  3DC1 A;  1BJN A;  5M4D A;  3BN1 A;  2VGZ A;  4E77 A;  3TFU A;  5BJ3 A;  3B1C A;  3PD6 B;  1GC0 A;  1YJS A;  4JEW A;  4RM1 A;  3HDO A;  1ASL A;  4MSO A;  2VMN A;  1DJE A;  1DJU A;  1N8P A;  2HOR A;  4EU1 A;  4TMR A;  1SVV A;  2FNI A;  2YRR A;  1UU1 A;  1CQ6 A;  1GD9 A;  1G4X A;  2CTZ A;  3NNK A;  2FQ6 A;  2BHX A;  1BQD A;  1V2E A;  2VI9 A;  3EI8 A;  2DGM A;  2VMW A;  3FCR A;  3FVS A;  3NX3 A;  1LC8 A;  2ORD A;  3MAD A;  4MQR A;  1FG7 A;  3HBX A;  1UU0 A;  3CBF A;  3B1E A;  1QIR A;  1KL1 A;  1LC5 A;  4LW4 A;  1AX4 A;  1B8G A;  1YOO A;  4LW2 A;  4F5K A;  1X2A A;  3NUI A;  4JEY A;  1BJO A;  1AHX A;  1WKH A;  1YJY A;  4PIW A;  4WB0 A;  2R5C B;  3K7Y A;  1V72 A;  2ZYJ A;  1QGN A;  2EZ1 A;  1IAX A;  4ISY A;  3PGY A;  2WKA A;  2AEU A;  2X8U A;  1U08 A;  2JJE A;  1PG8 A;  1AY4 A;  2JGT A;  4BHD A;  1G4V A;  4F5H A;  3LVK A;  2QA3 A;  1CZE A;  3EIA A;  4UOY A;  2JJH A;  2Z9U A;  3FZ8 A;  2OGE A;  3OP7 A;  2V0Y A;  1CS1 A;  1OHV A;  3BCX A;  1ASC A;  3ASA A;  5G0A A;  1OXP A;  3AEP A;  3HT4 A;  1RV4 A;  4WYA A;  1IBJ A;  2ZJG A;  1MAP A;  1X28 A;  5G2P A;  1ARI A;  2HZP A;  1YIZ A;  4ADC A;  3GZC A;  1CQ8 A;  3WZF A;  1ASN A;  1J04 A;  1TOE A;  1CL2 A;  2W7I A;  2PB2 A;  2XH1 A;  3E77 A;  4OBU A;  4OT8 A;  1AMA A;  2OKJ A;  1LC7 A;  1AIC A;  2VMS A;  2YKU A;  3AEO A;  3NDN A;  4F5M A;  1XI9 A;  1DGD A;  2DR1 A;  4F5J A;  1ART A;  3ASB A;  4XAU A;  5C6U A;  4ZLV A;  4ZAS A;  3ISL A;  1PMM A;  4JE5 D;  1AKA A;  2VMX A;  1MDO A;  4OC9 A;  2BIE A;  4W1X A;  1WYT B;  5M49 A;  2CFB A;  4WYG A;  2AY2 A;  3AEJ A;  1E5F A;  4P3M A;  4R8D A;  4UHM A;  3WX9 A;  2AY9 A;  1JF9 A;  2E54 A;  3EUC A;  4PFF A;  1VJO A;  1V2D A;  2D7Z A;  1RVY A;  3I4J A;  3ZZJ A;  1CZC A;  1GDE A;  2Z1Z A;  2FYF A;  1P3W A;  2BI1 A;  1YNU A;  3W1J A;  3CQ4 A;  1B9I A;  1KL2 A;  2BWN A;  1AHG A;  1I29 A;  5J8Q A;  3JU7 A;  5E4Z A;  4E3R A;  3MAF B;  4XK1 A;  4XJL A;  3EI6 A;  2WK7 A;  4R5Z A;  1V2F A;  4GE4 A;  5LHA A;  1AMR A;  3GSB A;  2C44 A;  3W1H A;  4CXQ A;  3AEN A;  4W8I A;  2O7C A;  4WYF A;  3NYT A;  1MDX A;  3EZS A;  3NU8 A;  1JS3 A;  2VMO A;  1OXO A;  4AZJ A;  1AHE A;  4JEV A;  4WBT A;  4XEW A;  3E2Z A;  4RIZ A;  1SF2 A;  3NYU A;  5EUN A;  1KKJ A;  1B4X A;  5G4J A;  2D5Y A;  2O1B A;  2HUI A;  4Q6R A;  4WB0 B;  1AMQ A;  1BQA A;  5D95 A;  4Q76 A;  2YKV A;  3OKS A;  3LV2 A;  2Z9V A;  3W1I A;  2QB2 A;  1O62 A;  4MY5 A;  2W7H A;  4A6T A;  4A0R A;  4OTL A;  2JJG A;  1TOK A;  4BQ0 A;  4AOA A;  1ASE A;  1AMS A;  3GWP A;  3P1T A;  1ELU A;  3AAT A;  1H0C A;  1AAM A;  2CIN A;  1ASA A;  3GBX A;  1AKC A;  2X3L A;  3EZ1 A;  3ZRR A;  4K2I A;  4KYO A;  4JE5 A;  1LW4 A;  2AY7 A;  2F8J A;  2HOY A;  3E6G A;  3WKR A;  3BV0 A;  4UHN A;  1AY8 A;  1ASB A;  1I41 A;  2VMR A;  4GEB A;  4P7Y A;  2YCN A;  3BCA A;  1TOG A;  2W8T A;  1QJ5 A;  2DKB A;  3RBL A;  4CVQ A;  1JS6 A;  4XJP A;  2VYC A;  1RVU A;  2E7J A;  3BB8 A;  3KKI A;  2FN6 A;  2D64 A;  5DJ9 A;  4ATQ A;  3Q8N A;  5F8V A;  1ASF A;  4R2N A;  1IVR A;  1AJR A;  2VGW A;  3NU7 A;  4RIT A;  1IX6 A;  4WLH A;  3A2B A;  3QGU A;  3MKJ A;  4A6R A;  4ITX A;  3PDB A;  3LWS A;  4RAE A;  4W5K A;  4IY7 A;  1H1C A;  1LKC A;  3FFR A;  1TOI A;  2HP1 A;  1C4K A;  4MGR A;  4ATP A;  5EAV A;  1AJS B;  4W1V A;  3NUB A;  1D2F A;  1M32 A;  3PJ0 A;  4ZWM A;  4BA4 A;  3L44 A;  2BWP A;  2D61 A;  1BKG A;  1C0N A;  4XQ2 A;  4XJM A;  2DKJ A;  3DR7 A;  1GCK A;  2BI2 A;  5HHY A;  3FQ7 A;  4UQV A;  4ZSW A;  3ZRP A;  2VLF A;  3EI9 A;  3H14 A;  1QIT A;  4IYO A;  2BKW A;  3N0L A;  2VMQ A;  4KXK A;  4RKD A;  3RCH A;  4N0B A;  4BMK A;  3NRA A;  3K40 A;  3FKD A;  2YRI A;  2W7K A;  5AX8 A;  2W8J A;  3GZD A;  3HVY A;  2QBT A;  3JWB A;  3JZL A;  1WYU B;  1S0A A;  3AEN B;  5EFS A;  1W3U A;  2AY4 A;  2W8U A;  3AEM A;  4AH3 A;  1M0O A;  4ZDO A;  2W7G A;  3WKS A;  4ZM4 A;  2X5D A;  2C81 A;  1ZOB A;  3E2Y A;  4MKJ A;  4U1T A;  1GC3 A;  2FM1 A;  3E2Z B;  2HOZ A;  3VK2 A;  3DXW A;  2W8W A;  4Q75 A;  7AAT A;  4L0O A;  4DBC A;  1AAW A;  1ARS A;  1CL1 A;  4ZDP A;  3I16 A;  4IXS A;  4GDY A;  3BWN A;  3WGC A;  1D7U A;  1YIY A;  3P6K A;  5EIG A;  4A6U A;  2CJG A;  4LNL A;  5EUE A;  2V1P A;  2BIA A;  3PDX A;  1GEX A;  1S06 A;  1WYV A;  4WXB A;  4ADD A;  2NMP A;  2ZY5 A;  2WK9 A;  3LG0 A;  3KE3 A;  3LVM A;  4Y0I A;  3BS8 A;  2QLR A;  1MLZ A;  1DKA A;  3WLX A;  5M4B A;  4WXF A;  2W7L A;  1TAR A;  3GZD C;  3ZRQ A;  4PVF A;  1W7N A;  4QGR A;  2BIG A;  2GMS A;  3ELP A;  3PD6 A;  4K2M A;  5DX5 A;  3AEM C;  3MC6 C;  4M2J A;  1MLY A;  1FC4 A;  4RJY A;  3RQ1 A;  1QIS A;  3DZZ A;  3PAA A;  4TV7 A;  2DOU A;  4E3Q A;  3KGX A;  3DYD A;  5EAA A;  3LVJ A;  1TPL A;  4M2K A;  3WCO A;  2YCP A;  1IUG A;  2DGL A;  4Y0H A;  1LK9 A;  1TOJ A;  1VEF A;  4F4E A;  2Q7W A;  2VMT A;  1B5P A;  4OMA A;  1DFO A;  1AY5 A;  4KAM A;  2X5F A;  4MQP A;  4NOG A;  4CBR A;  2Z20 A;  1T3I A;  4RJ0 A;  1KKP A;  2YOB A;  3BWN C;  4GE9 A;  4EFF A;  3QM2 A;  1ZOD A;  3A9Y A;  4WP0 A;  3AV7 A;  2BI3 A;  2Z61 A;  3FDB A;  1BJW A;  1VP4 A;  2R5C A;  2TPL A;  4IW7 A;  2Z67 A;  2W7E A;  1SZS A;  3NTJ A;  3NYS A;  1SPA A;  2HUF A;  1BJO B;  4WYC A;  3DR4 A;  1M0P A;  1GEW A;  2R0T A;  1I48 A;  4GE7 A;  3FSL A;  4DQ6 A;  2PB0 A;  2BYL A;  1BJ4 A;  1ELQ A;  2EGY A;  1B5O A;  3BCB A;  2AY6 A;  5IWQ A;  1MDZ A;  3L8A A;  4BA5 A;  5HDM A;  4J5U A;  3A8U X;  9AAT A;  1FG3 A;  2AY8 A;  4RKC A;  2DGK A;  3HMU A;  4HVK A;  1W23 A;  3QPG A;  2VGU A;  2CJH A;  3HLM A;  4WYD A;  1I43 A;  4F5I A;  3VK4 A;  2GMU A;  3PPL A;  4OCA A;  5E3K A;  1AIB A;  4ZWV A;  2ZC0 A;  2CJD A;  1TAT A;  2YKX A;  3CQ5 A;  4PFN A;  4WLJ A;  3TFT A;  1EJI A;  4M2M A;  1C7G A;  2W7M A;  4OBV A;  3COG A;  2ZUK A;  3FD0 A;  3FQ8 A;  1BT4 A;  5JAY A;  2BYJ A;  2FNU A;  3UWC A;  3B1D A;  2VMP A;  4TN4 A;  1BS0 A;  3IF2 A;  2ZP7 A;  4F5L A;  3B8X A;  2CY8 A;  3JW9 A;  2OQX A;  4B9B A;  1YJZ A;  1W7M A;  4HF8 A;  4ADE A;  2VLH A;  2HP2 A;  1UKJ A;  3E9K A;  1SFF A;  1WYT A;  3B46 A;  1AIA A;  5EIG B;  2JJF A;  3JTX A;  1WST A;  1N2T A;  3VOM A;  2VI8 A;  1QZ9 A;  4Y0D A;  4ADB A;  2VGS A;  4N0W A;  3QBO A;  1LS3 A;  1WYV B;  1S08 A;  2VIB A;  3JWA A;  3EI5 A;  3GR9 A;  1KMJ A;  2VMV A;  3CAI A;  5G4I A;  3DOD A;  4WD2 A;  3ATH A;  4U2H A;  4A0G A;  2D63 A;  3FRK A;  2AEV A;  1LW5 A;  3E2F A;  1ARG A;  1ASD A;  1MGV A;  3FQA A;  1SZU A;  2E7I A;  1IJI A;  4A0F A;  1GBN A;  1EQB A;  3UAK A;  1GEY A;  1Z3Z A;  2VMU A;  4EMY A;  1CQ7 A;  3MAF A;  3F6T A;  2W8V A;  3K28 A;  1IX8 A;  3HL2 A;  2ZY4 A;  3MEB A;  4RLG A;  4B98 A;  2EZ2 A;  1W7L A;  3KGW A;  2CB1 A;  5TF5 A;  4H51 A;  5I92 A;  1OHY A;  3D6K A;  3G8M A;  2OAT A;  3AOW A;  5DB5 A;  2YHK A;  3MC6 A;  1CJ0 A;  2AY5 A;  3R4T A;  3M5U A;  2ZY2 A;  4J8L A;  2Z9W A;  5G2Q A;  2Z9X A;  2W7J A;  3DXV A;  4LNM A;  1O61 A;  5FT4 A;  1ARH A;  1DGE A;  2JG2 A;  4W91 A;  3ECD A;  3QHX A;  2EH6 A;  4W1W A;  1C7O A;  4JEX A;  4GRX A;  2VGV A;  1G7X A;  2XBN A;  4EB7 A;  1BW0 A;  1RV3 A;  3FZ7 A;  4WXG A;  5M46 A;  1D7S A;  2VMY A;  8AAT A;  2BWO A;  1OHW A;  3F9T A;  3FFH A;  5D5S A;  3ELE A;  3G0T A;  2C0R A;  3WGB A;  2CAN A;  1XEY A;  2EO5 A;  2YKY A;  3MAU A;  2D65 A;  1Z7D A;  4JEZ A;  1DJ9 A;  1QJ3 A;  1M7Y A;  3AEL A;  3N5M A;  1N31 A;  1S09 A;  1JG8 A;  2PO3 A;  3FTB A;  4IX8 A;  1X0M A;  4IXZ A;  4Q31 A;  1PFF A;  1AHF A;  3VP6 A;  1MAQ A;  1Y4I A;  1D7R A;  2G6W A;  3A9Z A;  3RI6 A;  4E1O A;  5K8B A;  5DJ1 A;  5BJ4 A;  1M4N A;  3N75 A;  3USF A;  2D7Y A;  2HUU A;  3LVL B;  5EUD A;  2GB3 A;  1GC4 A;  2EPJ A;  1WKG A;  3TCM A;  4A72 A;  3QN6 A;  1M6S A;  5HXX A;  1ASM A;  4I8A A;  2JIS A;  4OYT A;  5FT5 A;  1DTY A;  4F5F A;  3FVX A;  2CH1 A;  3II0 A;  4AO9 A;  1J32 A;  2HOX A;  3PDB B;  1AJS A;  1SZK A;  2R5E A;  4R5F A;  3DRD A;  1G7W A;  3QI6 A;  1C7N A;  2YCT A;  1O69 A;  3VAX A;  3T32 A;  3UE8 A;  2AY3 A;  1AHY A;  2D66 A;  3GJU A;  2BI5 A;  5FT8 A;  2WK8 A;  4AO4 A;  1X29 A;  2E7U A;  2OGA A;  2VGT A;  3DU4 A;  4DGT A;  1B9H A;  4F5G A;  3G7Q A;  4XJO A;  1ORD A;  1IX7 A;  2ZY3 A;  3EIB A;  4IXO A;  4UHO A;  1D7V A;  3IHJ A;  3H7F A;  4MKK A;  4IYO B;  3RUY A;  2QMA A;  2Z1Y A;  3RCH B;  3VK3 A;  1ASG A;  4FFC A;  1WYU A;  5G09 A;  1KMK A;  2GQN A;  3PIU A;  2CH2 A;  3RBF A;  4A00 A;  4JF0 A;  1ECX A;  3FVU A;  3A9X A;  1M0N A;  3WCN A;  4JF1 A;  1EG5 A;  3TAT A;  3ZZK A;  5F9S A;  3MBB A;  4ZDL A;  2VIA A;  1M0Q A;  3I5T A;  4AZK A;  2BI9 A;  2AY1 A;  2ZSM A;  4O6Z A;  5LH9 A;  3GET A;  2QB3 A;  1TAS A;  2RFV A;  4ZSY A;  1YAA A;  2AAT A;  3AEJ C;  4K2B A;  3FDD A;  1UU2 A;  1PMO A;  2GSA A;  3TQX A;  1E5E A;  3AOV A;  2W7F A;  4LNJ A;  1AKB A;  2VMZ A;  2ZSL A;  3FZ6 A;  2OKK A; 
#chains in the Genus database with same CATH topology
 1IAY A;  1GC2 A;  4FL0 A;  3WY7 A;  4ITG A;  5E5I A;  3F0H A;  2O0R A;  3CQ6 A;  5FT6 A;  4CXR A;  4CBS A;  4ZM3 A;  1O4S A;  3BC8 A;  4LC3 A;  2C7T A;  3EI7 A;  3PA9 A;  4WYE A;  1ZC9 A;  3BWO A;  3HQT A;  1S07 A;  4GSA A;  2CST A;  2W7D A;  3LY1 A;  4MQQ A;  4EB5 A;  1C9C A;  4A0H A;  2A1V A;  1OAT A;  5EQC A;  2R2N A;  3R9A A;  3ACZ A;  4ZAH A;  3DC1 A;  1BJN A;  5M4D A;  3BN1 A;  2VGZ A;  4E77 A;  3TFU A;  5BJ3 A;  3B1C A;  3PD6 B;  1GC0 A;  1YJS A;  4JEW A;  4RM1 A;  3HDO A;  1ASL A;  4MSO A;  2VMN A;  1DJE A;  1DJU A;  1N8P A;  2HOR A;  4EU1 A;  4TMR A;  1SVV A;  2FNI A;  2YRR A;  1UU1 A;  1CQ6 A;  1GD9 A;  1G4X A;  2CTZ A;  3NNK A;  2FQ6 A;  2BHX A;  1BQD A;  1V2E A;  2VI9 A;  3EI8 A;  2DGM A;  2VMW A;  3FCR A;  3FVS A;  3NX3 A;  1LC8 A;  2ORD A;  3MAD A;  4MQR A;  1FG7 A;  3HBX A;  1UU0 A;  3CBF A;  3B1E A;  1QIR A;  1KL1 A;  1LC5 A;  4LW4 A;  1AX4 A;  1B8G A;  1YOO A;  4LW2 A;  4F5K A;  1X2A A;  3NUI A;  4JEY A;  1BJO A;  1AHX A;  1WKH A;  1YJY A;  4PIW A;  4WB0 A;  2R5C B;  3K7Y A;  1V72 A;  2ZYJ A;  1QGN A;  2EZ1 A;  1IAX A;  4ISY A;  3PGY A;  2WKA A;  2AEU A;  2X8U A;  1U08 A;  2JJE A;  1PG8 A;  1AY4 A;  2JGT A;  4BHD A;  1G4V A;  4F5H A;  3LVK A;  2QA3 A;  1CZE A;  3EIA A;  4UOY A;  2JJH A;  2Z9U A;  3FZ8 A;  2OGE A;  3OP7 A;  2V0Y A;  1CS1 A;  1OHV A;  3BCX A;  1ASC A;  3ASA A;  5G0A A;  1OXP A;  3AEP A;  3HT4 A;  1RV4 A;  4WYA A;  1IBJ A;  2ZJG A;  4H63 Q;  1MAP A;  1X28 A;  5G2P A;  1ARI A;  2HZP A;  1YIZ A;  4ADC A;  3GZC A;  1CQ8 A;  3WZF A;  1ASN A;  1J04 A;  1TOE A;  1CL2 A;  2W7I A;  2PB2 A;  2XH1 A;  3E77 A;  4OBU A;  4OT8 A;  1AMA A;  2OKJ A;  1LC7 A;  1AIC A;  2VMS A;  2YKU A;  3AEO A;  3NDN A;  4F5M A;  1XI9 A;  1DGD A;  2DR1 A;  4F5J A;  1ART A;  3ASB A;  4XAU A;  5C6U A;  4ZLV A;  4ZAS A;  3ISL A;  1PMM A;  2WB6 A;  4JE5 D;  1AKA A;  2VMX A;  1MDO A;  4OC9 A;  2BIE A;  4W1X A;  1WYT B;  5M49 A;  2CFB A;  4WYG A;  2AY2 A;  3AEJ A;  1E5F A;  4P3M A;  4R8D A;  4UHM A;  3WX9 A;  2AY9 A;  1JF9 A;  2E54 A;  3EUC A;  4PFF A;  1VJO A;  1V2D A;  2D7Z A;  1RVY A;  5KTB A;  3I4J A;  3ZZJ A;  1CZC A;  1GDE A;  2Z1Z A;  2FYF A;  1P3W A;  2BI1 A;  1YNU A;  3W1J A;  3CQ4 A;  1B9I A;  1KL2 A;  2BWN A;  1AHG A;  1I29 A;  5J8Q A;  3JU7 A;  5E4Z A;  4E3R A;  3MAF B;  4XK1 A;  4XJL A;  3EI6 A;  2WK7 A;  4R5Z A;  1V2F A;  4GE4 A;  5LHA A;  1AMR A;  3GSB A;  2C44 A;  3W1H A;  4CXQ A;  3AEN A;  4W8I A;  2O7C A;  2G7J A;  4WYF A;  3NYT A;  1MDX A;  3EZS A;  3NU8 A;  1JS3 A;  2VMO A;  1OXO A;  4AZJ A;  1AHE A;  4JEV A;  4WBT A;  4XEW A;  3E2Z A;  4RIZ A;  1SF2 A;  3NYU A;  5EUN A;  1KKJ A;  1B4X A;  5G4J A;  2D5Y A;  2O1B A;  2HUI A;  4Q6R A;  4WB0 B;  1AMQ A;  1BQA A;  5D95 A;  4Q76 A;  2YKV A;  3OKS A;  3LV2 A;  2Z9V A;  3W1I A;  2QB2 A;  1O62 A;  4MY5 A;  2W7H A;  4A6T A;  4A0R A;  4OTL A;  2JJG A;  1TOK A;  4BQ0 A;  4AOA A;  1ASE A;  1AMS A;  3GWP A;  3P1T A;  1ELU A;  3AAT A;  1H0C A;  1AAM A;  2CIN A;  1ASA A;  3GBX A;  1AKC A;  2X3L A;  3EZ1 A;  3ZRR A;  4K2I A;  4KYO A;  4JE5 A;  1LW4 A;  2AY7 A;  2F8J A;  2HOY A;  3E6G A;  3WKR A;  4K05 A;  3BV0 A;  4UHN A;  1AY8 A;  1ASB A;  1I41 A;  2VMR A;  4GEB A;  4P7Y A;  2YCN A;  3BCA A;  1TOG A;  2W8T A;  1QJ5 A;  2DKB A;  3RBL A;  4CVQ A;  1JS6 A;  4XJP A;  2VYC A;  1RVU A;  2E7J A;  3BB8 A;  3KKI A;  2FN6 A;  2D64 A;  5DJ9 A;  4ATQ A;  3Q8N A;  5F8V A;  1ASF A;  4R2N A;  1IVR A;  1AJR A;  2VGW A;  3NU7 A;  4RIT A;  1IX6 A;  4WLH A;  3A2B A;  3QGU A;  3MKJ A;  4A6R A;  4ITX A;  3PDB A;  3LWS A;  4RAE A;  4W5K A;  4IY7 A;  1H1C A;  1LKC A;  3FFR A;  1TOI A;  2HP1 A;  1C4K A;  4MGR A;  4ATP A;  5EAV A;  1AJS B;  4W1V A;  3NUB A;  1D2F A;  1M32 A;  3PJ0 A;  4ZWM A;  4BA4 A;  3L44 A;  2BWP A;  2D61 A;  1BKG A;  1C0N A;  4XQ2 A;  4XJM A;  2DKJ A;  3DR7 A;  1GCK A;  2BI2 A;  5HHY A;  3FQ7 A;  4UQV A;  4ZSW A;  3ZRP A;  2VLF A;  3EI9 A;  3H14 A;  1QIT A;  4IYO A;  2BKW A;  3N0L A;  2VMQ A;  4KXK A;  4RKD A;  3RCH A;  4N0B A;  4BMK A;  3NRA A;  3K40 A;  3FKD A;  2YRI A;  2W7K A;  5AX8 A;  2W8J A;  3GZD A;  3HVY A;  2QBT A;  3JWB A;  3JZL A;  1WYU B;  1S0A A;  3AEN B;  5EFS A;  1W3U A;  2AY4 A;  2W8U A;  3AEM A;  4AH3 A;  1M0O A;  4ZDO A;  2W7G A;  3WKS A;  4ZM4 A;  2X5D A;  2C81 A;  1ZOB A;  3E2Y A;  4MKJ A;  4U1T A;  1GC3 A;  2FM1 A;  3E2Z B;  2HOZ A;  3VK2 A;  3DXW A;  2W8W A;  4Q75 A;  7AAT A;  4L0O A;  4DBC A;  1AAW A;  1ARS A;  1CL1 A;  4ZDP A;  3I16 A;  4IXS A;  4GDY A;  3BWN A;  3WGC A;  2KFP A;  1D7U A;  1YIY A;  3P6K A;  5EIG A;  4A6U A;  2CJG A;  4LNL A;  5EUE A;  2V1P A;  2BIA A;  3PDX A;  1GEX A;  1S06 A;  1WYV A;  4WXB A;  4ADD A;  2NMP A;  2ZY5 A;  2WK9 A;  3LG0 A;  3KE3 A;  3LVM A;  4Y0I A;  3BS8 A;  2QLR A;  1MLZ A;  1DKA A;  3WLX A;  5M4B A;  4WXF A;  2W7L A;  1TAR A;  3GZD C;  3ZRQ A;  4PVF A;  1W7N A;  4QGR A;  2BIG A;  2GMS A;  3ELP A;  3PD6 A;  4K2M A;  5DX5 A;  3AEM C;  3MC6 C;  4M2J A;  1MLY A;  1FC4 A;  4RJY A;  3RQ1 A;  1QIS A;  3DZZ A;  3PAA A;  4TV7 A;  2DOU A;  4E3Q A;  3KGX A;  3DYD A;  5EAA A;  3LVJ A;  1TPL A;  4M2K A;  3WCO A;  2YCP A;  1IUG A;  2DGL A;  4Y0H A;  1LK9 A;  1TOJ A;  1VEF A;  4F4E A;  2FKI A;  2Q7W A;  2VMT A;  1B5P A;  4OMA A;  1DFO A;  1AY5 A;  4KAM A;  2X5F A;  4MQP A;  4NOG A;  4CBR A;  2Z20 A;  1T3I A;  4RJ0 A;  1KKP A;  2YOB A;  3BWN C;  4GE9 A;  4EFF A;  3QM2 A;  1ZOD A;  3A9Y A;  4WP0 A;  3AV7 A;  2BI3 A;  2Z61 A;  3FDB A;  1BJW A;  1VP4 A;  2R5C A;  2TPL A;  4IW7 A;  2Z67 A;  2W7E A;  1SZS A;  3NTJ A;  3NYS A;  1SPA A;  2HUF A;  1BJO B;  4WYC A;  3DR4 A;  1M0P A;  1GEW A;  2R0T A;  1I48 A;  4GE7 A;  3FSL A;  4DQ6 A;  2PB0 A;  2BYL A;  1BJ4 A;  1ELQ A;  2EGY A;  1B5O A;  3BCB A;  2AY6 A;  5IWQ A;  1MDZ A;  3L8A A;  4BA5 A;  5HDM A;  4J5U A;  3A8U X;  9AAT A;  1FG3 A;  2AY8 A;  4RKC A;  2DGK A;  3HMU A;  4HVK A;  1W23 A;  3N7N A;  3QPG A;  2VGU A;  2CJH A;  3HLM A;  4WYD A;  1I43 A;  4F5I A;  3VK4 A;  2GMU A;  3PPL A;  4OCA A;  5E3K A;  1AIB A;  4ZWV A;  2ZC0 A;  2CJD A;  3H9X A;  1TAT A;  2YKX A;  3CQ5 A;  4PFN A;  4WLJ A;  3TFT A;  1EJI A;  4M2M A;  1C7G A;  2W7M A;  4OBV A;  3COG A;  2ZUK A;  3FD0 A;  3FQ8 A;  1BT4 A;  5JAY A;  2BYJ A;  2FNU A;  3UWC A;  3B1D A;  2VMP A;  4TN4 A;  1BS0 A;  3IF2 A;  2ZP7 A;  4F5L A;  3B8X A;  2CY8 A;  3JW9 A;  2OQX A;  4B9B A;  1YJZ A;  1W7M A;  4HF8 A;  4ADE A;  2VLH A;  2HP2 A;  1UKJ A;  3E9K A;  1SFF A;  1WYT A;  3B46 A;  1AIA A;  5EIG B;  2JJF A;  3JTX A;  1WST A;  1N2T A;  3VOM A;  2VI8 A;  1QZ9 A;  4Y0D A;  4ADB A;  2VGS A;  4N0W A;  3QBO A;  1LS3 A;  1WYV B;  1S08 A;  2VIB A;  3JWA A;  3EI5 A;  3GR9 A;  1KMJ A;  2VMV A;  2QSR A;  3CAI A;  5G4I A;  3DOD A;  4WD2 A;  3ATH A;  4U2H A;  4A0G A;  2D63 A;  3FRK A;  2AEV A;  1LW5 A;  3E2F A;  1ARG A;  1ASD A;  1MGV A;  3FQA A;  1SZU A;  2E7I A;  1IJI A;  4A0F A;  1GBN A;  1EQB A;  3UAK A;  1GEY A;  1Z3Z A;  2VMU A;  4EMY A;  1CQ7 A;  3MAF A;  3F6T A;  2W8V A;  3K28 A;  1IX8 A;  3HL2 A;  2ZY4 A;  3MEB A;  4RLG A;  4B98 A;  2EZ2 A;  1W7L A;  3KGW A;  2CB1 A;  5TF5 A;  4H51 A;  5I92 A;  1OHY A;  3D6K A;  3G8M A;  2OAT A;  3AOW A;  5DB5 A;  2YHK A;  3MC6 A;  3N4S A;  1CJ0 A;  2AY5 A;  3R4T A;  3M5U A;  2ZY2 A;  4J8L A;  2Z9W A;  5G2Q A;  2Z9X A;  3N4R A;  2W7J A;  3DXV A;  4LNM A;  1O61 A;  5FT4 A;  1ARH A;  1DGE A;  2JG2 A;  4W91 A;  3ECD A;  3QHX A;  2EH6 A;  4W1W A;  1C7O A;  4JEX A;  4GRX A;  2VGV A;  1G7X A;  2XBN A;  4EB7 A;  1BW0 A;  1RV3 A;  3FZ7 A;  4WXG A;  5M46 A;  1D7S A;  2VMY A;  8AAT A;  2BWO A;  1OHW A;  3F9T A;  3FFH A;  5D5S A;  3ELE A;  3G0T A;  2C0R A;  3WGB A;  2CAN A;  1XEY A;  2EO5 A;  2YKY A;  3MAU A;  2D65 A;  1Z7D A;  4JEZ A;  1DJ9 A;  1QJ3 A;  1M7Y A;  3AEL A;  3N5M A;  1N31 A;  1S09 A;  1JG8 A;  2PO3 A;  3FTB A;  4IX8 A;  1X0M A;  4IXZ A;  4Q31 A;  1PFF A;  1AHF A;  3VP6 A;  1MAQ A;  1Y4I A;  1D7R A;  2G6W A;  3A9Z A;  3RI6 A;  4E1O A;  5K8B A;  5DJ1 A;  5BJ4 A;  1M4N A;  3N75 A;  3USF A;  2D7Y A;  2HUU A;  3LVL B;  5EUD A;  2GB3 A;  1GC4 A;  2EPJ A;  1WKG A;  3TCM A;  4A72 A;  3QN6 A;  1M6S A;  5HXX A;  1ASM A;  4I8A A;  2JIS A;  4OYT A;  5FT5 A;  1DTY A;  4F5F A;  3FVX A;  2CH1 A;  3II0 A;  4AO9 A;  1J32 A;  2HOX A;  3PDB B;  1KAF A;  1AJS A;  1SZK A;  2R5E A;  4R5F A;  3DRD A;  1G7W A;  3QI6 A;  1C7N A;  2YCT A;  1O69 A;  3VAX A;  3T32 A;  3UE8 A;  2AY3 A;  1AHY A;  2D66 A;  3GJU A;  2BI5 A;  5FT8 A;  2WK8 A;  4AO4 A;  1X29 A;  2E7U A;  2OGA A;  2VGT A;  3DU4 A;  4DGT A;  1B9H A;  4F5G A;  3G7Q A;  4XJO A;  1ORD A;  1IX7 A;  2ZY3 A;  3EIB A;  4IXO A;  4UHO A;  1D7V A;  3N4X A;  3IHJ A;  3H7F A;  4MKK A;  4IYO B;  3RUY A;  2QMA A;  2Z1Y A;  3RCH B;  3VK3 A;  1ASG A;  4FFC A;  1WYU A;  5G09 A;  1KMK A;  2GQN A;  3PIU A;  2CH2 A;  3RBF A;  4A00 A;  4JF0 A;  1ECX A;  3FVU A;  3A9X A;  1M0N A;  3WCN A;  4JF1 A;  1EG5 A;  3TAT A;  3ZZK A;  5F9S A;  3MBB A;  4ZDL A;  2VIA A;  1M0Q A;  3I5T A;  4AZK A;  2BI9 A;  2AY1 A;  2ZSM A;  4O6Z A;  5LH9 A;  3GET A;  2QB3 A;  1TAS A;  2RFV A;  4ZSY A;  1YAA A;  2AAT A;  2EYQ A;  3AEJ C;  4K2B A;  3FDD A;  1UU2 A;  1PMO A;  2GSA A;  3TQX A;  1E5E A;  3AOV A;  2W7F A;  4LNJ A;  1AKB A;  2VMZ A;  2ZSL A;  3FZ6 A;  2OKK A; 
#chains in the Genus database with same CATH homology
 1IAY A;  1GC2 A;  4FL0 A;  3WY7 A;  4ITG A;  5E5I A;  3F0H A;  2O0R A;  3CQ6 A;  5FT6 A;  4CXR A;  4CBS A;  4ZM3 A;  1O4S A;  3BC8 A;  4LC3 A;  2C7T A;  3EI7 A;  3PA9 A;  4WYE A;  1ZC9 A;  3BWO A;  3HQT A;  1S07 A;  4GSA A;  2CST A;  2W7D A;  3LY1 A;  4MQQ A;  4EB5 A;  1C9C A;  4A0H A;  2A1V A;  1OAT A;  5EQC A;  2R2N A;  3R9A A;  3ACZ A;  4ZAH A;  3DC1 A;  1BJN A;  5M4D A;  3BN1 A;  2VGZ A;  4E77 A;  3TFU A;  5BJ3 A;  3B1C A;  3PD6 B;  1GC0 A;  1YJS A;  4JEW A;  4RM1 A;  3HDO A;  1ASL A;  4MSO A;  2VMN A;  1DJE A;  1DJU A;  1N8P A;  2HOR A;  4EU1 A;  4TMR A;  1SVV A;  2FNI A;  2YRR A;  1UU1 A;  1CQ6 A;  1GD9 A;  1G4X A;  2CTZ A;  3NNK A;  2FQ6 A;  2BHX A;  1BQD A;  1V2E A;  2VI9 A;  3EI8 A;  2DGM A;  2VMW A;  3FCR A;  3FVS A;  3NX3 A;  1LC8 A;  2ORD A;  3MAD A;  4MQR A;  1FG7 A;  3HBX A;  1UU0 A;  3CBF A;  3B1E A;  1QIR A;  1KL1 A;  1LC5 A;  4LW4 A;  1AX4 A;  1B8G A;  1YOO A;  4LW2 A;  4F5K A;  1X2A A;  3NUI A;  4JEY A;  1BJO A;  1AHX A;  1WKH A;  1YJY A;  4PIW A;  4WB0 A;  2R5C B;  3K7Y A;  1V72 A;  2ZYJ A;  1QGN A;  2EZ1 A;  1IAX A;  4ISY A;  3PGY A;  2WKA A;  2AEU A;  2X8U A;  1U08 A;  2JJE A;  1PG8 A;  1AY4 A;  2JGT A;  4BHD A;  1G4V A;  4F5H A;  3LVK A;  2QA3 A;  1CZE A;  3EIA A;  4UOY A;  2JJH A;  2Z9U A;  3FZ8 A;  2OGE A;  3OP7 A;  2V0Y A;  1CS1 A;  1OHV A;  3BCX A;  1ASC A;  3ASA A;  5G0A A;  1OXP A;  3AEP A;  3HT4 A;  1RV4 A;  4WYA A;  1IBJ A;  2ZJG A;  4H63 Q;  1MAP A;  1X28 A;  5G2P A;  1ARI A;  2HZP A;  1YIZ A;  4ADC A;  3GZC A;  1CQ8 A;  3WZF A;  1ASN A;  1J04 A;  1TOE A;  1CL2 A;  2W7I A;  2PB2 A;  2XH1 A;  3E77 A;  4OBU A;  4OT8 A;  1AMA A;  2OKJ A;  1LC7 A;  1AIC A;  2VMS A;  2YKU A;  3AEO A;  3NDN A;  4F5M A;  1XI9 A;  1DGD A;  2DR1 A;  4F5J A;  1ART A;  3ASB A;  4XAU A;  5C6U A;  4ZLV A;  4ZAS A;  3ISL A;  1PMM A;  2WB6 A;  4JE5 D;  1AKA A;  2VMX A;  1MDO A;  4OC9 A;  2BIE A;  4W1X A;  1WYT B;  5M49 A;  2CFB A;  4WYG A;  2AY2 A;  3AEJ A;  1E5F A;  4P3M A;  4R8D A;  4UHM A;  3WX9 A;  2AY9 A;  1JF9 A;  2E54 A;  3EUC A;  4PFF A;  1VJO A;  1V2D A;  2D7Z A;  1RVY A;  5KTB A;  3I4J A;  3ZZJ A;  1CZC A;  1GDE A;  2Z1Z A;  2FYF A;  1P3W A;  2BI1 A;  1YNU A;  3W1J A;  3CQ4 A;  1B9I A;  1KL2 A;  2BWN A;  1AHG A;  1I29 A;  5J8Q A;  3JU7 A;  5E4Z A;  4E3R A;  3MAF B;  4XK1 A;  4XJL A;  3EI6 A;  2WK7 A;  4R5Z A;  1V2F A;  4GE4 A;  5LHA A;  1AMR A;  3GSB A;  2C44 A;  3W1H A;  4CXQ A;  3AEN A;  4W8I A;  2O7C A;  2G7J A;  4WYF A;  3NYT A;  1MDX A;  3EZS A;  3NU8 A;  1JS3 A;  2VMO A;  1OXO A;  4AZJ A;  1AHE A;  4JEV A;  4WBT A;  4XEW A;  3E2Z A;  4RIZ A;  1SF2 A;  3NYU A;  5EUN A;  1KKJ A;  1B4X A;  5G4J A;  2D5Y A;  2O1B A;  2HUI A;  4Q6R A;  4WB0 B;  1AMQ A;  1BQA A;  5D95 A;  4Q76 A;  2YKV A;  3OKS A;  3LV2 A;  2Z9V A;  3W1I A;  2QB2 A;  1O62 A;  4MY5 A;  2W7H A;  4A6T A;  4A0R A;  4OTL A;  2JJG A;  1TOK A;  4BQ0 A;  4AOA A;  1ASE A;  1AMS A;  3GWP A;  3P1T A;  1ELU A;  3AAT A;  1H0C A;  1AAM A;  2CIN A;  1ASA A;  3GBX A;  1AKC A;  2X3L A;  3EZ1 A;  3ZRR A;  4K2I A;  4KYO A;  4JE5 A;  1LW4 A;  2AY7 A;  2F8J A;  2HOY A;  3E6G A;  3WKR A;  4K05 A;  3BV0 A;  4UHN A;  1AY8 A;  1ASB A;  1I41 A;  2VMR A;  4GEB A;  4P7Y A;  2YCN A;  3BCA A;  1TOG A;  2W8T A;  1QJ5 A;  2DKB A;  3RBL A;  4CVQ A;  1JS6 A;  4XJP A;  2VYC A;  1RVU A;  2E7J A;  3BB8 A;  3KKI A;  2FN6 A;  2D64 A;  5DJ9 A;  4ATQ A;  3Q8N A;  5F8V A;  1ASF A;  4R2N A;  1IVR A;  1AJR A;  2VGW A;  3NU7 A;  4RIT A;  1IX6 A;  4WLH A;  3A2B A;  3QGU A;  3MKJ A;  4A6R A;  4ITX A;  3PDB A;  3LWS A;  4RAE A;  4W5K A;  4IY7 A;  1H1C A;  1LKC A;  3FFR A;  1TOI A;  2HP1 A;  1C4K A;  4MGR A;  4ATP A;  5EAV A;  1AJS B;  4W1V A;  3NUB A;  1D2F A;  1M32 A;  3PJ0 A;  4ZWM A;  4BA4 A;  3L44 A;  2BWP A;  2D61 A;  1BKG A;  1C0N A;  4XQ2 A;  4XJM A;  2DKJ A;  3DR7 A;  1GCK A;  2BI2 A;  5HHY A;  3FQ7 A;  4UQV A;  4ZSW A;  3ZRP A;  2VLF A;  3EI9 A;  3H14 A;  1QIT A;  4IYO A;  2BKW A;  3N0L A;  2VMQ A;  4KXK A;  4RKD A;  3RCH A;  4N0B A;  4BMK A;  3NRA A;  3K40 A;  3FKD A;  2YRI A;  2W7K A;  5AX8 A;  2W8J A;  3GZD A;  3HVY A;  2QBT A;  3JWB A;  3JZL A;  1WYU B;  1S0A A;  3AEN B;  5EFS A;  1W3U A;  2AY4 A;  2W8U A;  3AEM A;  4AH3 A;  1M0O A;  4ZDO A;  2W7G A;  3WKS A;  4ZM4 A;  2X5D A;  2C81 A;  1ZOB A;  3E2Y A;  4MKJ A;  4U1T A;  1GC3 A;  2FM1 A;  3E2Z B;  2HOZ A;  3VK2 A;  3DXW A;  2W8W A;  4Q75 A;  7AAT A;  4L0O A;  4DBC A;  1AAW A;  1ARS A;  1CL1 A;  4ZDP A;  3I16 A;  4IXS A;  4GDY A;  3BWN A;  3WGC A;  2KFP A;  1D7U A;  1YIY A;  3P6K A;  5EIG A;  4A6U A;  2CJG A;  4LNL A;  5EUE A;  2V1P A;  2BIA A;  3PDX A;  1GEX A;  1S06 A;  1WYV A;  4WXB A;  4ADD A;  2NMP A;  2ZY5 A;  2WK9 A;  3LG0 A;  3KE3 A;  3LVM A;  4Y0I A;  3BS8 A;  2QLR A;  1MLZ A;  1DKA A;  3WLX A;  5M4B A;  4WXF A;  2W7L A;  1TAR A;  3GZD C;  3ZRQ A;  4PVF A;  1W7N A;  4QGR A;  2BIG A;  2GMS A;  3ELP A;  3PD6 A;  4K2M A;  5DX5 A;  3AEM C;  3MC6 C;  4M2J A;  1MLY A;  1FC4 A;  4RJY A;  3RQ1 A;  1QIS A;  3DZZ A;  3PAA A;  4TV7 A;  2DOU A;  4E3Q A;  3KGX A;  3DYD A;  5EAA A;  3LVJ A;  1TPL A;  4M2K A;  3WCO A;  2YCP A;  1IUG A;  2DGL A;  4Y0H A;  1LK9 A;  1TOJ A;  1VEF A;  4F4E A;  2FKI A;  2Q7W A;  2VMT A;  1B5P A;  4OMA A;  1DFO A;  1AY5 A;  4KAM A;  2X5F A;  4MQP A;  4NOG A;  4CBR A;  2Z20 A;  1T3I A;  4RJ0 A;  1KKP A;  2YOB A;  3BWN C;  4GE9 A;  4EFF A;  3QM2 A;  1ZOD A;  3A9Y A;  4WP0 A;  3AV7 A;  2BI3 A;  2Z61 A;  3FDB A;  1BJW A;  1VP4 A;  2R5C A;  2TPL A;  4IW7 A;  2Z67 A;  2W7E A;  1SZS A;  3NTJ A;  3NYS A;  1SPA A;  2HUF A;  1BJO B;  4WYC A;  3DR4 A;  1M0P A;  1GEW A;  2R0T A;  1I48 A;  4GE7 A;  3FSL A;  4DQ6 A;  2PB0 A;  2BYL A;  1BJ4 A;  1ELQ A;  2EGY A;  1B5O A;  3BCB A;  2AY6 A;  5IWQ A;  1MDZ A;  3L8A A;  4BA5 A;  5HDM A;  4J5U A;  3A8U X;  9AAT A;  1FG3 A;  2AY8 A;  4RKC A;  2DGK A;  3HMU A;  4HVK A;  1W23 A;  3N7N A;  3QPG A;  2VGU A;  2CJH A;  3HLM A;  4WYD A;  1I43 A;  4F5I A;  3VK4 A;  2GMU A;  3PPL A;  4OCA A;  5E3K A;  1AIB A;  4ZWV A;  2ZC0 A;  2CJD A;  3H9X A;  1TAT A;  2YKX A;  3CQ5 A;  4PFN A;  4WLJ A;  3TFT A;  1EJI A;  4M2M A;  1C7G A;  2W7M A;  4OBV A;  3COG A;  2ZUK A;  3FD0 A;  3FQ8 A;  1BT4 A;  5JAY A;  2BYJ A;  2FNU A;  3UWC A;  3B1D A;  2VMP A;  4TN4 A;  1BS0 A;  3IF2 A;  2ZP7 A;  4F5L A;  3B8X A;  2CY8 A;  3JW9 A;  2OQX A;  4B9B A;  1YJZ A;  1W7M A;  4HF8 A;  4ADE A;  2VLH A;  2HP2 A;  1UKJ A;  3E9K A;  1SFF A;  1WYT A;  3B46 A;  1AIA A;  5EIG B;  2JJF A;  3JTX A;  1WST A;  1N2T A;  3VOM A;  2VI8 A;  1QZ9 A;  4Y0D A;  4ADB A;  2VGS A;  4N0W A;  3QBO A;  1LS3 A;  1WYV B;  1S08 A;  2VIB A;  3JWA A;  3EI5 A;  3GR9 A;  1KMJ A;  2VMV A;  2QSR A;  3CAI A;  5G4I A;  3DOD A;  4WD2 A;  3ATH A;  4U2H A;  4A0G A;  2D63 A;  3FRK A;  2AEV A;  1LW5 A;  3E2F A;  1ARG A;  1ASD A;  1MGV A;  3FQA A;  1SZU A;  2E7I A;  1IJI A;  4A0F A;  1GBN A;  1EQB A;  3UAK A;  1GEY A;  1Z3Z A;  2VMU A;  4EMY A;  1CQ7 A;  3MAF A;  3F6T A;  2W8V A;  3K28 A;  1IX8 A;  3HL2 A;  2ZY4 A;  3MEB A;  4RLG A;  4B98 A;  2EZ2 A;  1W7L A;  3KGW A;  2CB1 A;  5TF5 A;  4H51 A;  5I92 A;  1OHY A;  3D6K A;  3G8M A;  2OAT A;  3AOW A;  5DB5 A;  2YHK A;  3MC6 A;  3N4S A;  1CJ0 A;  2AY5 A;  3R4T A;  3M5U A;  2ZY2 A;  4J8L A;  2Z9W A;  5G2Q A;  2Z9X A;  3N4R A;  2W7J A;  3DXV A;  4LNM A;  1O61 A;  5FT4 A;  1ARH A;  1DGE A;  2JG2 A;  4W91 A;  3ECD A;  3QHX A;  2EH6 A;  4W1W A;  1C7O A;  4JEX A;  4GRX A;  2VGV A;  1G7X A;  2XBN A;  4EB7 A;  1BW0 A;  1RV3 A;  3FZ7 A;  4WXG A;  5M46 A;  1D7S A;  2VMY A;  8AAT A;  2BWO A;  1OHW A;  3F9T A;  3FFH A;  5D5S A;  3ELE A;  3G0T A;  2C0R A;  3WGB A;  2CAN A;  1XEY A;  2EO5 A;  2YKY A;  3MAU A;  2D65 A;  1Z7D A;  4JEZ A;  1DJ9 A;  1QJ3 A;  1M7Y A;  3AEL A;  3N5M A;  1N31 A;  1S09 A;  1JG8 A;  2PO3 A;  3FTB A;  4IX8 A;  1X0M A;  4IXZ A;  4Q31 A;  1PFF A;  1AHF A;  3VP6 A;  1MAQ A;  1Y4I A;  1D7R A;  2G6W A;  3A9Z A;  3RI6 A;  4E1O A;  5K8B A;  5DJ1 A;  5BJ4 A;  1M4N A;  3N75 A;  3USF A;  2D7Y A;  2HUU A;  3LVL B;  5EUD A;  2GB3 A;  1GC4 A;  2EPJ A;  1WKG A;  3TCM A;  4A72 A;  3QN6 A;  1M6S A;  5HXX A;  1ASM A;  4I8A A;  2JIS A;  4OYT A;  5FT5 A;  1DTY A;  4F5F A;  3FVX A;  2CH1 A;  3II0 A;  4AO9 A;  1J32 A;  2HOX A;  3PDB B;  1AJS A;  1SZK A;  2R5E A;  4R5F A;  3DRD A;  1G7W A;  3QI6 A;  1C7N A;  2YCT A;  1O69 A;  3VAX A;  3T32 A;  3UE8 A;  2AY3 A;  1AHY A;  2D66 A;  3GJU A;  2BI5 A;  5FT8 A;  2WK8 A;  4AO4 A;  1X29 A;  2E7U A;  2OGA A;  2VGT A;  3DU4 A;  4DGT A;  1B9H A;  4F5G A;  3G7Q A;  4XJO A;  1ORD A;  1IX7 A;  2ZY3 A;  3EIB A;  4IXO A;  4UHO A;  1D7V A;  3N4X A;  3IHJ A;  3H7F A;  4MKK A;  4IYO B;  3RUY A;  2QMA A;  2Z1Y A;  3RCH B;  3VK3 A;  1ASG A;  4FFC A;  1WYU A;  5G09 A;  1KMK A;  2GQN A;  3PIU A;  2CH2 A;  3RBF A;  4A00 A;  4JF0 A;  1ECX A;  3FVU A;  3A9X A;  1M0N A;  3WCN A;  4JF1 A;  1EG5 A;  3TAT A;  3ZZK A;  5F9S A;  3MBB A;  4ZDL A;  2VIA A;  1M0Q A;  3I5T A;  4AZK A;  2BI9 A;  2AY1 A;  2ZSM A;  4O6Z A;  5LH9 A;  3GET A;  2QB3 A;  1TAS A;  2RFV A;  4ZSY A;  1YAA A;  2AAT A;  2EYQ A;  3AEJ C;  4K2B A;  3FDD A;  1UU2 A;  1PMO A;  2GSA A;  3TQX A;  1E5E A;  3AOV A;  2W7F A;  4LNJ A;  1AKB A;  2VMZ A;  2ZSL A;  3FZ6 A;  2OKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...