1C8CA

Crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLAKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*AP*TP*CP*GP*C)-3'
publication title Crystal structures of the chromosomal proteins Sso7d/Sac7d bound to DNA containing T-G mismatched base-pairs.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2000-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c8cA00
2H1EA 2K03A 2HDLA 1WD0A 1QG7A 1NR4A 1SSOA 4X3TA 2L4NA 1SAPA 1HFNA 5EPKA 5T1GA 4ZLTF 2L1BA 1U4RA 2RA4A 2KECA 1SDFA 3GV6A 1MSGA 5CBAE 5AFWA 2EE1A 5E4WC 5COYA 3IL8A 1WTPA 1GUWA 2EPBA 1O7YA 2L9HA 2MP1A 5EPJA 3TZDA 2DY7A 2HUGA 1ESRA 1BO0A 1JICA 2X69A 2D9UA 1NAPA 4ZAIA 2HCIA 3I8ZA 1WD1A 1B2TA 2B2TC 2MPMA 2N55A 1ML0D 1RTNA 2B2VC 2K01A 2KEEA 1G6ZA 5EPLA 1F9PA 4QUCA 3R93A 1PFNA 5EKIA 4XDXA 4X3UA 1ILQA 1EOTA 2B2TA 1HUNA 2B2VA 1CM9A 3SVMA 1AZPA 1NR2A 3N52A 2RSNA 1EL0A 5CORA 5JJZA 2MJ8A 2J7ZA 5E4XA 1DZ1A 2K04A 2JYOA 1A15A 2NYZD 4RWSC 1WTXA 1B53A 1AZQA 1Q3LA 4XT3B 1NCVA 2XIWA 2KEDA 5CMDA 3F2UA 3LWEA 4IURA 1O7ZA 2HCCA 2NWGA 4ZKBB 1J8IA 5DNFA 1HRJA 4DN4M 2B2WC 1MI2A 2Q8RE 3H91A 1G91A 4IUVA 1IL8A 1U4PA 1E0BA 1F2LA 1DOLA 1F9SA 1HFGA 3MTSA 1PDQA 3P7JA 4MN3A 1CA6A 1S4ZA 2MGSA 3D6WA 4ZKCB 4IUQA 4OIKA 2B2WA 5EQ0A 1BBXC 1RTOA 1O80A 3Q6SA 1BNZA 5D14A 1HA6A 2JP1A 1WVLA 3G7LA 4XT1B 1BF4A 1RODA 1RHPA 3FPUB 2Q8TA 4IUPA 1X3PA 4RA8A 1JE4A 1DOKA 2M2LA 1M8AA 2RSOA 2RVLA 4CJ1B 4LMQD 4MHEA 2FJ2A 1EQTA 1KNEA 1WTWA 3TN2A 1WTQA 1PFMA 2IL8A 3MWYW 3I90A 1MSHA 1DOMA 3DEOA 5CBEE 4UAIA 3I91A 1ILPA 3UI2A 3FDTA 4HCSA 2L11A 2DY8A 2X6LA 4QUFA 2B2UC 2NZ1D 1AP0A 1VMPA 4RAUC 1B3AA 2K28A 2SDFA 3KUPA 5T1IA 1QE6A 4HEDA 3DEPA 1HHVA 3GV3A 2K05A 2VXWA 2FHTA 4HAEA 2B2UA 1U4MA 1TVXA 1PFBA 4NW2A 4ZK9B 4R8IA 2KVMA 1MGSA 3DM1A 4IUTA 1G2TA 1HUMA 3ONAB 2N88A 2HDMA 1X3QA 2FMMA 1WTVA 4IUUA 1RJTA 2KUMA 1CA5A 4HSVA 3QO2A 3HP3A 1ZXTA 2CVRA 2KOLA 1WTRA 1B4OA 1B50A 2B2YC 4CJ2C 1PLFA 1J9OA 1XX8A 4O42A 1KNAA 1WTOA 1DONA 2R3ZA 4R9WA 1IKMA 3KBXA 1IKLA 3IFDA 5EJWA 1F9QA 1XYIA 1QNKA 5D65A 4X3KA 2FFKB 1LV9A 1EIGA 1G2SA 2B2YA 2K1BA 1X32A 1F9RA 2BDNA 1ICWA 4U68A 4OIJA 1EIHA 1U4LA 1VMCA 2L12A 2X6GA 3I3CA 4X3SA 1C8CA 2FINB 2EOTA 4CJ0B
chains in the Genus database with same CATH superfamily
5A2QE 1SSOA 1YVCA 2PQAB 3AB9A 3HKZB 1CHQD 3S14B 4PQXA 2YTYA 4DAPA 2RA4A 3SK4A 3TRZA 1QJOA 3S1MB 3CAMA 3STBD 3DWPA 3S1RB 2EE1A 2MUYA 1I50H 1YHQA 1KQSA 3O13A 1IYUA 1K0SA 4V190 4DR5L 4JI2Q 1Q90A 1PH6A 2OT2A 2GVAA 1LABA 1WCMG 3W3AA 4GN3B 3TEHB 2Q2IA 1AE3A 1QWYA 5EPLA 2JA5G 3U58A 1GKHA 2B63B 1N34L 3H3VC 3A8JE 4DR2L 1JJ2A 2B2TA 3CHBD 4LF5Q 1AZPA 3H0GB 5JJZA 4DV3Q 1L1OC 3T13A 1Q7YC 1P16A 3F2UA 4DV4L 4A3JB 1JB7A 1HRJA 4ZKBB 4LNQA 1Q8IA 2A6HC 1EQRA 4H13C 3K57A 1FNVA 2XGTA 1G91A 5CR3A 4IUVA 1PRTB 5IP9H 4A3KB 1RKNA 3UE0A 1JJGA 4KY6A 4WJ3M 1RTOA 2E2IH 4A93H 4G7OC 2NVTH 4C3IH 1HA6A 2F3VA 3S2HB 4DXFA 4A3GB 1HZCA 1GUOA 1V1PB 4KK7A 5IWAQ 1Z6HA 2KBNA 1IBML 2M2LA 2ZJQA 1TWGH 1ICFB 4UY8C 2YYZA 2UUBL 1LUZA 4R4CA 2N78A 3SEBA 1NSNS 3NPPA 3PO2G 1KL9A 3KUPA 1SMXA 5T1IA 4HEDA 4ALPA 1QILA 5KEEA 4R8NA 3PF4A 1EY0A 2XN9C 4HJAA 4NW2A 3RUZA 3S1MH 2CKZB 4C1NI 1G2TA 3VYRA 4YHHL 4BXXG 3GTPB 2ZJRA 1L1OB 1SE2A 5NUCA 4CDEC 2MQHA 1WFQA 3KLSA 1GUNA 3NP8A 2B2YC 2EYMA 5JEAH 2O5JC 3BVGA 1B3QA 3OTOQ 1IKMA 1MIUA 3DXJC 5D65A 3T56B 2R92B 4B3RL 4K0KQ 2BDNA 5IOCA 4QQBX 3A54A 2ES2A 1QG7A 4LFBQ 4X3TA 2CH4W 5IYCH 4OO1H 5T1GA 3I4MH 4LK1C 2IPKD 1K8MA 1JJCB 4JV5L 1HR0Q 4IO9A 3I4NG 3J7YW 3GV6A 5BR8L 5EGTA 2JA9A 3ULPA 1OXXK 3WOEA 3KJPA 4G7ZC 5BN3A 1O7YA 3J81E 5M3FB 3S2HH 2E8GA 2B3GA 2WFWA 2K33A 4ZAIA 1NMGA 5HGQA 2QGQA 1BR9A 1FNUA 3HOWG 3PIP3 2KEEA 4LWCA 4QUCA 4FO2A 2K4KA 3ND8A 3S2DH 2QEJC 3VR5A 3KF8B 5C5MA 1RF2D 3VYSA 2YU9B 2SNMA 4F7XA 1NR2A 3S9WA 2A69D 4RWSC 4OWTB 2XIWA 1SMYC 2CQOA 5IGDA 3BS1A 4DKAC 3M4OB 3H91A 4RG1A 3AYHB 5F2DA 3GTPH 1GVPA 4LF7L 5FLXc 1PRTF 3K5OA 4OIKA 2IT1A 2ZT9C 1J6QA 1KRSA 5C4JH 2B8GA 4ID6A 1EIFA 1VQMA 1PTOD 4K8JA 4EQNA 1PFMA 3S1NB 5LL6X 5CV5A 1L0XB 1BCPC 3KK7A 1GUTA 2NZ1D 4YCUA 4EQPA 4JI7L 2AQ1B 1XNQQ 5I6WA 1TIID 3CC7A 3HOXH 4YY3Q 2KJXA 2NUCA 4A3BB 5C3EG 3I4OA 1ENFA 4BBSB 3FKIH 1GHKA 1Q82C 3HOYB 4LF8L 1EU3A 1YNND 2CH4A 2F4VQ 3HOUB 1WTOA 1KNAA 4BY1B 1B8AA 2Z4HA 1LV9A 3OPOA 2R93B 3RMHA 4X3SA 1C8CA 4JI6L 2K03A 4HMIA 1DM0B 3R3OA 5C44B 3MXNA 5ELNA 3F1ZA 1DCZA 2H4OA 1TS3A 2WAQB 4P74A 2VW9A 3U9SA 5IGFA 1BCPB 2KHSA 1D5XC 4DXGA 5M5XB 1XMOQ 3TZDA 1FJGL 1Q1EA 1IL2A 2HUGA 1JQYD 3TZUA 1NAPA 4A3EG 2VZAA 5EBCA 5IE8A 2UU9Q 2AQ2B 3KYHC 4HMJA 2EXZA 3S1NH 1N32L 5IYDH 1H9SA 2QW7A 1MD2D 1LACA 1DZ1A 4TQUS 1SNMA 2K04A 5IT9c 1B53A 5BN5A 3QIAA 1AN8A 2I5LX 4IFDG 1EYDA 4BWGB 1VQLA 4IPDA 1SE3A 4DNRB 2JEAI 2G5DA 1AH9A 2EYPA 4IUQA 3SHLA 5E3FA 4OHJA 1HNWL 2JP1A 1MJCA 1GUSA 2NB0A 3VR2A 3HOUH 4ILWA 4NXNQ 4IUPA 2AKWB 4JI3Q 2RSOA 1PH4A 1AW7A 4A3MB 2Z0SA 1JOOA 1WTWA 1HH2P 2IL8A 1LTRD 2K50A 4UAIA 4H7BA 4ZCKA 1W6KA 4A3DB 1B3AA 2PO4A 5HY6A 3NTKA 4OELB 1SNOA 1WOCA 2F0TA 3HGBA 1PFBA 4LUOA 4R8IA 3CCRA 3HOVB 3S1QB 3HFZB 2IY5B 5CC4A 2EJGC 1RD9D 5DM73 3ONAB 4L5QA 1PZJD 4B3TQ 3HP3A 1SYBA 1I4XA 4DAMA 1HTPA 4IOAA 4NDXA 2E2HB 3RN5A 3IFDA 1LM0A 4M1UB 4S3SA 2F0KA 3S15H 3D31A 1TWCB 1HNZQ 1VQ4A 2OWOA 1W3SA 2HQLA 4R1JA 4A3FB 2JN4A 2RKSA 4C3HG 1DXMA 3UDFA 1STGA 3K5LA 1HA5A 2CWAA 1QCBD 4KI0A 2L1BA 4DR3L 4LW1A 2NN6H 2JEBI 4LFAL 2KA7A 1A2UA 1TS4A 4OEMB 2EPBA 1WTHA 1T5XD 2JA7H 4DV2Q 4PZ7A 4IPCA 3K0XA 1Y1VH 3FEWX 5FLXL 1M4VA 4JI2L 2GA4B 1WD1A 3PO3B 3C2PA 1I6HB 4A3MH 1A3TA 3GTJB 1H9MA 3DWAA 1CKNB 1KDBA 1BKBA 4G57A 2O4XA 3IKJA 1UE7A 4DR1Q 3T1YL 1TQOA 4PMCA 4HJ7A 1GXDC 4KN7C 4A93G 4B3SQ 1OTCA 5DLQE 1WTXA 1G6PA 4DV3L 2D62A 4KD4A 1IBLL 2ZM6Q 1TY2A 1CUKA 1U4PA 4CHTB 1Q1BA 1CA6A 2F0SA 1JOQA 1JWSD 1O80A 4MZ9A 1EY7A 2DJFC 2DUDA 4V0BA 4KN4C 5KRUA 1TS5A 3HKZG 3L2PA 1XPUA 5D3DA 1X3PA 3P75A 2O2LD 2A73B 2ZXRA 1MSHA 4A3FH 4H0LC 3M85A 2EYFA 1CZWA 3SDZA 1LT6D 2NZHA 3DEPA 3EBEA 3A55A 5JEAG 3GTOB 2B63G 4B3ML 4A4IA 3DWQA 2IX1A 2AWNA 3ULJA 1XMQL 5GADC 3H0GG 2VB2X 3CXCA 2A1AA 2K5HA 3AFQA 3DHQA 4JI8Q 4OL7A 4JI4L 4A3JG 5IP7G 4BBRH 1EFID 5KYIA 2XSCA 4HN7A 4A3KG 3H6MA 3OSOA 3OTOL 3LX0A 1B1ZA 4JI1L 1DJRD 3B6YA 5J39A 4DK0A 4LUZA 2F0JA 3UDXA 1VQNA 4A3GG 4POFA 4JBWA 1MBYA 1HR0W 1ONLA 3JAMi 5IT9L 1KHIA 3NQIA 1MKHA 5AFWA 4ZUJA 1GO3E 3QOJA 2F52A 3MXNB 1VQ7A 3PUWA 1PTOH 1P8LA 1QZGA 4KHPQ 3QWNA 4B9XA 4AQYL 1ET6A 3V96A 1STAA 5K5PA 3SVMA 4IN3A 3N52A 2A6HD 3K7AB 1YJWA 4PMWA 1HXYD 5JPNC 4MTKA 1O7ZA 1J8IA 2RQXA 1K9MC 3D4WA 3VYUA 1RCVD 5AJ3Q 2R92G 4C3JB 5C3XA 5JJKA 4DNIA 4X65Q 1DD2A 4CBVA 3MTSA 4XQNA 2VQFL 1K28A 3OWFA 3JAMc 2VQEQ 1STYA 4IALA 4OX9L 1S5CD 4DUYL 1EYCA 2E76C 4JI0Q 4XT1B 1VQPA 4PV1C 3K59A 1E1OA 2Z6KC 1JE4A 5CYUA 4GNXA 1KDCA 5CV9A 2VNUD 1ZKOA 4F88A 4LUVA 2CW0D 1KNEA 3M4QA 2PQEA 3MWYW 1H95A 5M3FG 2F0VA 3T1HL 1SNDA 2L11A 3G48A 1YHBA 4EVOA 3K7UC 5C0XJ 3W1BA 2E5LL 1TWAB 1CTMA 1WYDA 4J1MA 1KAAA 3CD6A 1SEBD 2XTIA 1XNQL 3ICEA 4QMGA 1D2BA 1T9HA 4RKBA 1TU2B 3K58A 2VXWA 4B9WA 2IX3A 1SNCA 3MAQA 1I50B 1ZYRC 3HG9A 2HDMA 2IX0A 4GLAC 3RZOB 1RJTA 4LF6Q 4A3LG 2K6AA 3PV0A 1D1IA 4IFDJ 4C1NK 3V05A 4QIWB 2OQ0A 3F2DA 1O7LA 1J9OA 1XX8A 3I73A 1UEAB 3CCJA 3KBGA 1F9QA 4X3KA 3Q24A 2F0NA 2A68D 4X6AH 3P20A 4BA2I 4KV6A 4OIJA 3D4RA 1R4PB 3VR6A 3K7AH 4GKJL 2JA8B 1PYBA 4GLVB 4KMUC 2FXQA 1K8AC 2L4NA 5EPKA 2LKVA 1KXLA 3VYTA 1OXSC 3J80E 3MHBA 2JXMB 1HNXL 4LF9L 4IZ8A 2E2IB 2UXDQ 4BY7G 4C3IB 3D8GA 3NWTA 1K3RA 2EY5A 2HHHQ 2OXPA 1PZID 1V1QA 2K32A 4TVAB 4K5XA 4HIOA 2WP8J 1EWHA 2B2VC 2AMCB 2R7DA 4JOIC 5JPMC 3KDFB 1YNJC 1V8QA 1F2YA 4NB3A 5EKIA 4A3BG 3L0OA 1YZ6A 4BBSG 1TWAH 5M5WB 1PV4A 4KHZA 3HOYG 1VQ5A 2UXCL 1EL0A 4NKLA 2MJ8A 4NXML 1F2MA 3HOUG 1X3EA 4BY1G 4C2MB 1A3UA 1Q81C 4XQQA 3ULLA 2R93G 1EQVA 3RZOH 4HCEA 4L63B 1S4ZA 3GTGH 2B2WA 4JI5Q 5C44G 1Y1WH 4DU9A 1C9OA 1A63A 3GO5A 4FVMA 4X66Q 2WAQG 2QDBA 1OXUA 3M7GA 3E0EA 4DR4L 2R61A 4K2LA 2JA8H 3SK6A 4LF4Q 4BA1I 4QJFA 3UDIA 4DV5L 1BBWA 4JBKA 1VDZA 3Q23A 4DV7L 3I4MB 3MEHA 1Y14B 4K5WA 5M3MH 3HKZE 2B2UA 2I5HA 2KVMA 4WFN3 1JC7A 3D4DA 1XJVA 1VQ8A 1LT3D 1WTVA 5FLMG 2EIFA 1ZXTA 2RCFA 1E22A 1BBUA 3T4AC 3K80C 5CV7A 3S24A 3S2DB 4RGNA 1IKLA 1CK1A 2BDOA 1A8VA 1FYCA 5M5WH 4KD3A 3Q0AA 4FF3A 3AU7A 1ICWA 3G6EA 1H9KA 3I3CA 1A0IA 3V2TA 5IYBG 1Q86C 1XXGA 1NR4A 4P71A 4C2MH 2UXBQ 3MFYA 4A3MG 1XNRQ 4K8IA 3EQLC 1SBBB 2F0HA 2PNHA 2Z6BA 4FXKC 1BVSA 3G6JB 5C4JB 4A3DG 4JYAQ 3IL8A 2D5DA 1WTPA 1VQKA 4GS3A 1QVFA 2X69A 3GQBA 3JAML 3HOZH 1FGUA 3HOVG 5I9PA 2F0LA 3HEJA 3A0JA 1H9RA 4A3IH 3SK8A 1Y8NB 2NVXH 1X55A 1FVIA 5EAYA 5ELEA 1R9TH 4DV6L 3HOXB 4NMZA 5CMDA 2KEDA 4HIDA 3K5NA 2WB1B 2H5XA 3TQYA 1VCIA 2AQ3B 4AYBB 1AFPA 4DUZL 2R7ZH 3FKIB 2MGSA 1EQQA 3J81i 1IW7D 5EQ0A 2A6ED 1BDOA 2WINB 2KENA 4XTCS 1B7YB 1T5EA 3GTQH 1WI5A 1X56A 1RODA 3FPUB 1EIYB 2NN6I 4CJ1B 1UAPA 3TN2A 5C4ZA 1UE1A 5LMNQ 3CCLA 2Z4IA 1B9MA 2DN8A 4JC0A 4DF7A 3S17H 3PO3G 2UUAL 1QE6A 4P72A 2KCMA 1UWVA 1L0YB 2C35B 3E0JA 2EYOA 1JMCA 3J7AF 5K36H 4KY7A 2N88A 2BE5D 2ZTEA 4UDUC 2FMMA 5A35A 2EJMA 4B08A 4L5TA 3QO2A 1HTLD 3VR4A 3SK5A 3MZ5A 2KOLA 2I46A 3J81c 3GD7A 1PHJA 5I2XA 2KHJA 1EFWA 1YITA 1DONA 2PCFB 3STBC 1SJHD 1A2TA 3C3LA 1EIGA 2BH2A 3FPPA 2HT1A 3PCOB 2VUMB 2EOTA 1LTLA 4UP7A 2RCNA 1V43A 2QA4A 1X65A 1V1OA 1HFNA 1UE6A 4ZLTF 1LTGD 4GKKQ 2P5ZX 1GOZA 4QL5A 3MXUA 3F2BA 4OWWB 1VQHA 4JG2A 4GOPA 1YJNA 2PI2A 2JA6H 4HTHA 3U4VA 1BQQT 1FNWA 2I5MX 3I8ZA 1N33L 2B2TC 5DM63 2XRQD 1EY4A 2AUKA 3F8TA 1L2FA 1FGBD 2Y0SB 1ILQA 3X3NA 1G291 4LFCQ 3G4SA 2QF7A 1N9WA 2F0OA 1OO9B 4K6LA 1ASZA 1Q3LA 1J5EL 2UUCL 1PYWD 4KKUA 4FF4A 2NWGA 5LMUQ 4Z9CB 3RLOA 4Q5VA 4IOCA 2PNRC 3UDGA 5J3BA 2EY1A 4X65L 1NJIC 2PW5A 2BOSA 5A2QL 2L55A 2YV5A 1WJJA 4UPAA 5FK9C 5JVG3 4K2KA 2DJGC 1KDAA 1EYAA 4DV0Q 2GVBA 1FR3A 1RHPA 4JI0L 4XIGS 4DV1Q 2EQSA 4HJ9A 1E1TA 3LWUA 3S15B 4GLXA 3NE5B 3TP5A 4X62Q 2F0FA 2VUMH 3KLWA 5JJIA 5KNBA 4A3CH 1VMPA 3G71A 2CQAA 2NBFA 1LO5D 3I7FA 3FHWA 4FNFA 2F0DA 2FHTA 5KIXA 1PH3A 2WAQE 2PMZB 4ZK9B 2IJ0A 3RZDH 1M1KC 4DAYA 1G51A 2JA7B 4WJWA 1Y1VB 1IHZA 1LTAD 2K5VA 1IBKL 1LTID 5G3LF 4C3JG 1H9JA 4G7HC 3WDNA 2R3ZA 2KQ3A 1OXTA 2BCOA 1HQMC 3NWSA 5BN4A 1N34Q 1BUVT 4DR2Q 1O78A 3PUZA 4I65A 2F0PA 4KJOA 4FYDA 4IQZA 1BOSA 1SAPA 3MXGA 1EZ8A 1SYDA 4DV4Q 1WCMH 3H09A 1N36L 1B9NA 1K0RA 2OCEA 2A69C 1UE5A 2JA5H 2PPBC 1LLRD 1NY4A 5IIFA 2K01A 1LT5D 4K6DA 1EY5A 2WIIB 2M00A 2VB3X 3M9BA 4X64L 1U0LA 3OYYA 1HNZL 2SOBA 5C0XI 1CZGA 3E5SA 3HRZC 4UHVA 3A5UA 2UUBQ 3ERQA 3TMEA 3PF5A 1CHPD 1SYGA 1PTOC 5JOBA 3BU2A 3PUYA 1Q46A 5EBDA 4L5SA 1W2BA 1BCPF 3NHHA 1C48A 2Q2HA 3X3MA 2RF4A 2JA8G 3MFGA 1VQIA 4BBRB 4YHHQ 3CCMA 2MO0A 3M3YB 4HJ5A 1WVLA 4CKCA 4DR6Q 5IP9G 2IW3A 3AQQA 4DGZA 3PQIA 3CRLC 2BA0A 1S5ED 2NVYB 1KD1C 3PO2H 2FJ2A 4LF5L 2C9OA 4C3IG 3J81L 3DEOA 5ELDA 1PH7A 1D5MC 3CF5A 4P73A 1TY0A 3F2CA 2DNCA 3VDYA 1S3OA 2FMCA 3Q22A 5JVH3 1YNNC 3GTLH 1LYLA 1OXVA 4BXXH 3CCQA 2K28A 2SDFA 2C5CA 2K05A 4OXPA 3CPWA 2I0QA 4JV5Q 5IGBA 2KUMA 4RGMA 5FO9B 5IWAL 1I4HA 1PTOB 3TDQA 5BR8Q 5C3WA 2B39A 4I7ZC 4R9WA 5DEHA 1XWEA 3KLSX 1QNKA 1PYSB 2G9HD 3LGJA 3NXWA 1EIHA 4TKOB 5GQOA 3MA2B 4N9PA 2FINB 2MHVA 3BYYB 5EKKA 4Y7NH 4R4TA 1B44D 5L37A 3E9IA 4FXDA 3BZDB 1A3VA 1YHAA 2Z9HA 5C4HA 3HKSA 4K14A 3GDEA 3A8KE 5IYCG 1QZHA 4YWKA 3HOWH 5E4WC 4OO1G 1V1PA 3I4MG 3M3YH 1PRTD 2L9HA 2MP1A 4LF7Q 1JE5A 2CWPA 1JORA 4YWMA 4CDCC 3OW7A 2NVYH 1SYCA 4K0KL 2G9DA 3BJUA 5J22A 3ERSX 1SE4A 4ZRZA 4LFBL 3ZJYC 3I2ZA 1GM5A 1AZQA 2JYOA 2F0EA 5FOBB 1LTTD 3C1FA 5CV6A 2ZJPA 1HR0L 4JI7Q 2LSSA 1IXRA 4EGVA 1TWHH 4GZYC 1L1OA 3D6CA 2L15A 1EY9A 4BS9A 4RGOS 3SGIA 1E24A 5JJLA 1K8OA 4IUNA 3CU7A 1A6XA 1TR5A 4KY5A 4LF8Q 1M8AA 1ESFA 2RVLA 4H44C 3K5MA 2F0MA 1JWMD 1ASYA 2LXJA 3I91A 1QNUA 4HCSA 5EKLA 1E2WA 1CT1D 1ET9A 4J6HA 1H9SB 4JI6Q 2OEOA 5C3EH 5IY0A 2VL6A 4DK1A 1PVOA 3W2DA 1YIJA 5ELBA 4OGQC 3HOXG 1DGSA 3A7LA 4RKLA 3R2IA 4IJHA 4KKSA 4DPGA 1SJED 1CQVA 2WB1G 1PTOF 1FJGQ 3EN2A 2Q2TA 4CJ2C 4AYBG 2RDFA 1RL2A 4DAYB 4ZUIA 4CDDC 1K3BC 1SLJA 3FKIG 4KKTA 2B2YA 1X32A 2E75C 1N32Q 5C5LA 1FL0A 1WD0A 4GN5A 2VS1A 1Z9FA 3AMUA 4YY3L 4DR7Q 3PIOA 2ID0A 3RNUA 3EIVA 2A19A 4I7AA 3GTGB 1UUPA 4GKKL 5C0XH 3K6OA 1L0WA 1SDFA 4A3EH 3CKIB 1Y1WB 1EOVA 5I9OA 4M8AA 1GUWA 2F4VL 2N3SA 2DY7A 1LT4D 3GTKB 3OWEB 2HCIA 5D3IB 1HNWQ 3C46A 2XNAC 4XDXA 4FF2A 3RR5A 4IFDH 3FMCA 2K7VA 1CM9A 5G3LD 5M3MB 3I56A 3VA5A 3H3VI 2KHIA 1EZ6A 4IJLA 2F3IA 2JQOA 5IYDG 3SR1A 3LWEA 1K83B 3IAYA 3H15A 5J1ZA 3SE0A 1XMOL 3CQZH 4R4QA 1CFMA 2VUMG 3S16B 3D6WA 3P1HA 1QVCA 4A3CG 1DYQA 2UU9L 1HZ9A 4QIWE 2Q8TA 4EX5A 2F0QA 3L3OC 1SMYD 4DK6C 3KFUA 1PH2A 3CCSA 1Q8KA 2O5IC 3A5ZB 3EVQA 5C6AA 1I94Q 3UI2A 2Q8IB 3EA6A 2X6LA 4ODGA 2KCCA 2MFIA 4XXEA 4N8X1 1I5FA 2ASBA 2SEBD 2EYHA 3GTMH 4P75A 1XTDA 4G4KA 2Y0SG 3KJOA 5HURA 3J7ZC 2M9VA 4HSPA 1D6EC 5ELOA 1E3PA 4DR3Q 1PZKD 3J80c 3EFXD 3A8IE 1VQEA 4HR7B 2LS01 4LFAQ 4NXNL 4DA2A 1BCPD 3GTKH 3HOZB 4F8MA 1W6JA 2K75A 2RBMA 4JI3L 2MO1A 3RLNA 2EZVA 4KLKA 3TREA 4C3HH 4A3IB 1XYIA 1TWFH 4OONA 2FFKB 2NVXB 1R9TB 2ZTDA 2L12A 2X6GA 4PMBA 1NBWA 3T53B 4CJ0B 3CMEA 1HPCA 3T1YQ 2PZWA 1UEBA 4ME3A 1K83H 4XYQA 2HIXA 4MIUA 1R4QB 2F03A 2R7ZB 2K14A 3ND9A 5IGCA 3GP7A 1IBLQ 3S16H 1SNPA 4B3TL 3TS0A 3GTQB 5ELFA 2JK8A 3TP6A 2NN6G 1C4QA 1IYVA 1XPOA 5IGEA 1LTSD 2N55A 1QUQA 1RTNA 1KLUD 1G8ZD 5ISRA 1F9PA 2AHOB 4JW0A 3NUCA 1AEXA 2JA7G 3QB3A 1SRUA 4ZQ3A 4X3UA 1Y1VG 2OF1A 1X9NA 2CCZA 4DNTB 3S17B 1F2ZA 2NTTA 5CORA 1JR0D 3BZCA 2ZTCA 4AH6A 1PH1A 4WJ4A 1KTKA 2CW0C 2HCCA 4A75A 3NK9A 5CV8A 3BVZA 3TP7A 2L5TA 1E0BA 1F9SA 5JEAJ 1VQ6A 3CC2A 2EVBA 4B3MQ 3S14H 4DV2L 3OHXC 4GNXC 1XMQQ 1BNZA 1FD7D 4KHVA 4AIMA 3J7AV 3S1RH 2EY2A 3G7LA 2PW7A 3L9AX 4DR6L 4N9TA 4JI4Q 1DOKA 3OMCA 1PH5A 1Q12A 1JOKA 4DR1L 4MHEA 1NUCA 3DLLA 5GAGC 1WTQA 3I90A 4B3SL 5CBEE 1ILPA 1HCZA 2B63H 4JI1Q 1SN8A 3UE1A 2EYLA 1SFOB 1VQBA 1SYFA 3H0GH 3MEFA 4H02A 2ZM6L 1HHVA 5LL6S 4A3FG 1CKMA 1JT8A 2A68C 2D0PA 1E2VA 4FP5D 5FLXE 4A3JH 1ENAA 1UNSA 2E2DC 5IP7H 2RHSB 2JA6B 1HUMA 3OIQA 5H1SE 4IUUA 3RLFA 1X3FA 3K81C 3HS0C 4A3KH 4QGUA 3WOFA 1CKNA 5DAUA 3IRBA 3H94A 1PLFA 1VQCA 3D3RA 2SNSA 3KBXA 4A3GH 4K5VA 2V4DA 3CMAA 1SROA 4PNYA 5KNDA 4GNXB 4BBRG 1G2SA 2K1BA 1F9RA 4AQYQ 2EYJA 2F1MA 2ALYB 1EEID 1I4GA 2HDLA 4LAAA 4KTAA 1CSPA 4JBJA 2WB1E 2WKDA 4JPBW 3NELA 2VY3A 4AYBE 5LHY1 2B29A 1D1KA 5I4DA 1ENCA 4JI8L 5E1FA 4ME5A 4O0AA 1I6VC 3H3VH 5JAVA 5COYA 2OTLA 2NVQB 2J4XA 2VQFQ 2L0CA 2ZXPA 3NENA 1BO0A 1JICA 2XRSD 4WRDA 2EDGA 4JCVE 4PG3A 4OX9Q 1B2TA 1CSQA 5FKAC 4YWLA 4DUYQ 1KLGD 1SYEA 1Z47A 4YCVA 2I07B 3KF6A 3R8BA 1GHJA 1PFSA 1EOTA 3OW2A 1SFOH 2R92H 1CKOA 1EWCA 2RSNA 3CPFA 3CCEA 1A15A 3T1HQ 3BYTB 1EY8A 1NCVA 3KLRA 2E5LQ 2AUJD 4RH6A 4IURA 3RZDB 2EXDA 4UP8A 4BY7B 2B2WC 2QKIC 1VQDA 3NEMA 3HZXA 5IGGA 3VA7A 3P7JA 1VQAA 5FJ8H 2WACA 5E7NA 2J0TD 1I4PA 2R6GA 3Q6SA 1IZ6A 5D14A 1VQOA 5C4XB 4KHPL 2OTJA 1X54A 3M4PA 3J80L 2ENBA 5M3FH 4HIKA 4LMQD 4IPHA 4POGA 1I4QA 3A74A 4DFAA 1XTCD 4TSSA 3FDTA 5IT9E 3QG1A 2B2UC 2QDLA 2RDGA 1SXTA 3AFPA 3BDOA 3Q8DA 2YU9H 1AP0A 4RAUC 3PSIA 5AJ3L 4GKJQ 5FO8B 3SXHA 3D0FA 3T16A 1PA6A 2E2JB 3JC66 1WCMB 1S72A 4A3LH 2VQEL 1O7IA 1EY6A 3BVMA 3DM1A 1I3QB 3PUVA 2JA5B 2NVQH 3M4OH 1HNXQ 4APVA 1U9RA 4LF9Q 1CA5A 1YI2A 5M5YB 2CVRA 4XQJA 4WORA 5GROA 1A62A 4R4OA 2MNAA 4O42A 1HZBA 1KABA 5EJWA 5C0XG 2Y0SE 1QOHA 2Q2UA 1F77A 2F0GA 4U68A 1SE8A 1U4LA 1NE3A 3AEVA 1N8RC 4ABNA 4BY7H 1I4RA 2NTSA 1PH8A 1EWIA 4NXMQ 2UXCQ 2LMCB 4DR7L 2BH8A 2JE6I 1U4RA 3OIPA 5KGUA 1CQFA 3DM3A 4LF6L 2B8FA 2E74C 5I6YA 2Z1CA 1MSGA 2EJFC 4DR5Q 3NSWA 5C4XH 4OWXB 4A3BH 4Y52H 3PO2B 3PIO3 1X6OA 1Y69U 4BBSH 5HGTA 2MPMA 3HOYH 2A8VA 1MJEA 4RGTA 3M4YA 4BY1H 1IW7C 2A6EC 3GTLB 3CC4A 1HUNA 1S5FD 4DR4Q 2HIVA 2YTXA 1E7ZA 3EJIA 1CI3M 3A56A 2QILA 1QUQB 2R93H 4XT3B 2E2JH 3WWVA 1Z7TA 4DV5Q 1NNXA 2PMZE 4DV7Q 2UXDL 1I3QH 5C44H 2WKCA 1MI2A 3NBHA 1JB3A 1HFGA 2HHHL 4MN3A 1PDQA 5CV4A 4TRDA 5M5YH 1BBXC 3QR8A 2NZOA 4IPGA 1NMFA 2N8NA 3DMUA 1C0AA 1IBMQ 2K5WA 3W1GA 1BF4A 5M5XH 5KYLA 4JBMA 4YCWA 2WV6D 1EQTA 2EY6A 4Q0FA 2BE5C 4FDBA 1Y1WG 1NTGA 1QVGA 3NTHA 2TSSA 1D7QA 3I4NB 4Y7NB 2Z6KA 4NPSA 4EQOA 1SNQA 1I94L 2DY8A 1PXUA 2IHEA 4QUFA 4FF1A 3DUZA 3QJYA 2IHFA 4C56C 2ZXOA 4MTNA 1EUJA 3R2TA 1M90C 4L5RC 5GAHC 1D8LA 1U5KA 5FLMH 1S5BD 1TKWB 3HOWB 1MGSA 1B70B 2RDHA 4IFDI 4L6TB 4N8FA 1IYJB 4JI5L 4YIJA 5M3MG 1X3GA 3U9OA 4X66L 3KDFA 3KOJA 5TSSA 1ZEQX 2R7FA 5IYBH 2PQAA 1K73C 4U673 4LF4L 4B3RQ 4ZYSA 2RHQB 2K52A 4HJ8A 1GUGA 1TT2A 2TMPA 1ZYRD 5M9OA 2BA1A 2YTVA 4QCLA 2H1EA 4FXGC 3L7ZC 1BXTA 3RN2A 1TWHB 4GOPC 1VS0A 2CHBD 2D0OA 3BDLA 4A3DH 5GAEC 4DV6Q 3PIPA 2F3WA 3CW2C 1PH9A 2KECA 3I72A 3N6RA 2KCNA 2HQEA 3K0YA 3U50C 1EEFD 3CP0A 3S1QH 5CBAE 3PUXA 3HOVH 3I4LA 3EROA 4R4IA 4DUZQ 1ESRA 1YNXA 2D9UA 2D2CC 1ML0D 1HZAA 2HD3A 3TSSA 2GN5A 1PFNA 3I4NH 1SR3A 2E2HH 2B2VA 4JOIA 3HOZG 1KIXA 2UXBL 2J7ZA 2LFNA 2NYZD 5C3EB 1TWCH 3MVVA 1XNRL 2K5QA 1KAWA 3PGZA 3RD4A 2PZTA 4A3IG 3KF6B 4MNOA 4QF4A 1VQGA 2UUAQ 2QEXA 4JVZA 1STBA 4EQ5A 4JYAL 1STHA 1YNJD 2LXKA 4ZKCB 3NBIA 4J15A 4GOPB 2F4IA 1YBYA 4RMFA 3OOCA 2R7ZG 3U4ZA 4UP9A 4ULLA 3ZYYX 3J81j 3PO3H 2LY7A 4CKEA 4PZ8A 1I6HH 5ELCA 1E2ZA 3GTJH 1QB5D 1YEZA 1Y8OB 2IWHA 1K8GA 4A3EB 2JSOA 1TVXA 2KCTA 3JAME 1TS2A 4XYOA 3M7NA 1JCKB 2F0WA 5I2YA 4HSVA 5LMNW 5K36G 1EU4A 4QY7A 5LMNL 1RIPA 1N33Q 2PI2E 2A74C 1HQRD 1VQFA 1VMCA 1KRTA 1VQ9A 4P2CB 3E6ZX 4CKBA 1KC8C 3CQZB 2QCPX 1J5EQ 3ER0A 2UUCQ 2Z8LA 4KJNA 5FO7B 1YJ9A 2PZUA 1LTBD 3BDCA 3GTOH 3KF8A 1Y8PB 1VF5C 5EPJA 2V1CC 3T51B 1RDPD 3VR3A 1D5ZC 3TP8A 1G6ZA 3E9HA 2JA6G 4OO1I 1TXYA 2DNEA 3R93A 5CGKA 5FJ8G 1V9PA 1STNA 1EYGA 4LJZC 4L8JA 3LNNA 1HJPA 4RHSA 4RFBA 5E4XA 4HIMA 2A5HA 3GTMB 2AWOA 3PMFA 1AE2A 3CCVA 5DNFA 3C1EA 5KNCA 4DN4M 4GN4B 1XPRA 3NTIA 2Q8RE 3QOLA 3BG3A 1IL8A 4J8QA 1F2LA 2XWJB 1DOLA 2XVSA 3OMGA 4RCNA 2F0IA 3TS2A 4CGYB 3J7A5 4C3HB 4PZ6A 4RCOA 1JWUD 2ICEC 2ICIA 1TWFB 4O2DA 3MXPA 4RA8A 3NBHB 1IBKQ 4F87A 4LFCL 1DOMA 3FVQA 3IFTA 4DAVA 4A76A 3E3XA 4CDFC 4JK1C 3J80i 3URYA 5LMUL 1S40A 4O1NA 2CFMA 3MC0B 2XWBB 3GV3A 3K8AA 2N49A 1VQJA 4HAEA 1U4MA 2JJQA 3FP9A 4IUTA 1VF7A 3I70A 3CRKC 1X3QA 2PYKA 4C3JH 3CCUA 3BZKA 4DV0L 4NP5A 3W5OA 2K5DA 3TBIB 1N36Q 4DV1L 2F0UA 5IODA 4A93B 2NVTB 3I55A 1WTRA 1B4OA 1B50A 4X62L 4E6IA 1GD7A 1STEA 3NQTA 1PMRA 1II3A 1MHWC 2K5NA 2DGYA 3A7AB 3FRPB 2OQKA 1GJXA 1TWGB 1PRTC 3ITPA 2ATWA 1S5DD 4DK3C 4X64Q 4RHRA 5C4XG 4QB4A 1C7YA
chains in the Genus database with same CATH topology
5A2QE 1SSOA 3AB9A 3HKZB 1CHQD 3S14B 4PQXA 4DAPA 2RA4A 3SK4A 1QJOA 3S1MB 3DWPA 3S1RB 2EE1A 2MUYA 3O13A 1IYUA 4V190 1Q90A 2OT2A 1LABA 3W3AA 1QWYA 5EPLA 2B63B 3H3VC 3A8JE 2B2TA 3CHBD 1AZPA 3H0GB 5JJZA 3T13A 3F2UA 4A3JB 1HRJA 4ZKBB 1Q8IA 2A6HC 4H13C 3K57A 1FNVA 1G91A 5CR3A 4IUVA 1PRTB 4A3KB 1RKNA 4KY6A 1RTOA 4G7OC 1HA6A 2F3VA 3S2HB 4DXFA 4A3GB 4KK7A 1GUOA 1V1PB 1Z6HA 2M2LA 2YYZA 3SEBA 1NSNS 3NPPA 3KUPA 5T1IA 4HEDA 1QILA 5KEEA 4R8NA 1EY0A 2XN9C 4NW2A 3RUZA 1G2TA 4C1NI 3VYRA 3GTPB 1SE2A 5NUCA 3KLSA 1GUNA 3NP8A 2B2YC 2EYMA 5JEAH 2O5JC 3BVGA 1IKMA 3DXJC 5D65A 3T56B 2R92B 2BDNA 5IOCA 3A54A 1QG7A 4X3TA 4OO1H 5T1GA 4LK1C 2IPKD 1K8MA 3J7YW 3GV6A 5EGTA 1OXXK 3WOEA 4G7ZC 5BN3A 1O7YA 3J81E 5M3FB 2K33A 4ZAIA 1BR9A 1FNUA 3PIP3 2KEEA 4QUCA 4FO2A 3ND8A 2QEJC 3VR5A 5C5MA 1RF2D 3VYSA 2YU9B 2SNMA 4F7XA 1NR2A 3S9WA 2A69D 4RWSC 2XIWA 1SMYC 5IGDA 3BS1A 3M4OB 3H91A 5F2DA 1PRTF 3K5OA 4OIKA 2IT1A 2ZT9C 2B8GA 4ID6A 1PTOD 4K8JA 4EQNA 1PFMA 3S1NB 5LL6X 5CV5A 1L0XB 1BCPC 3KK7A 1GUTA 2NZ1D 4EQPA 2AQ1B 5I6WA 1TIID 2KJXA 2NUCA 4A3BB 1ENFA 4BBSB 1GHKA 3HOYB 1EU3A 1YNND 3HOUB 1WTOA 1KNAA 4BY1B 2Z4HA 1LV9A 3OPOA 2R93B 3RMHA 4X3SA 1C8CA 2K03A 4HMIA 1DM0B 3R3OA 5C44B 3MXNA 1DCZA 2H4OA 1TS3A 2WAQB 3U9SA 5IGFA 1BCPB 2KHSA 1D5XC 4DXGA 5M5XB 3TZDA 1Q1EA 2HUGA 1JQYD 3TZUA 1NAPA 5EBCA 2AQ2B 4HMJA 2EXZA 1H9SA 1MD2D 1LACA 1DZ1A 4TQUS 1SNMA 2K04A 1B53A 5BN5A 3QIAA 1AN8A 4IFDG 1EYDA 4BWGB 1SE3A 4DNRB 2JEAI 2EYPA 4IUQA 3SHLA 5E3FA 4OHJA 2JP1A 1GUSA 2NB0A 3VR2A 4ILWA 4IUPA 2RSOA 1AW7A 4A3MB 1WTWA 1JOOA 2IL8A 1LTRD 4UAIA 4H7BA 1W6KA 4A3DB 1B3AA 2PO4A 3NTKA 1SNOA 2F0TA 3HGBA 1PFBA 4R8IA 3S1QB 3HOVB 5CC4A 2EJGC 1RD9D 5DM73 3ONAB 1PZJD 3HP3A 1SYBA 1I4XA 1HTPA 4NDXA 2E2HB 3IFDA 4M1UB 4S3SA 2F0KA 3D31A 1TWCB 4A3FB 2RKSA 4C3HG 1DXMA 1STGA 3K5LA 1HA5A 4KI0A 1QCBD 2L1BA 2NN6H 2JEBI 2KA7A 1A2UA 1TS4A 2EPBA 1T5XD 3FEWX 5FLXL 1M4VA 2GA4B 1WD1A 3PO3B 3C2PA 1I6HB 1A3TA 3GTJB 1H9MA 3DWAA 1KDBA 4G57A 2O4XA 3IKJA 1TQOA 4PMCA 1GXDC 4KN7C 1WTXA 2D62A 4KD4A 1TY2A 4CHTB 1U4PA 1Q1BA 1CA6A 2F0SA 1JOQA 1JWSD 1O80A 1EY7A 4V0BA 4KN4C 5KRUA 1TS5A 5D3DA 1X3PA 3P75A 2O2LD 2A73B 2ZXRA 1MSHA 4H0LC 3M85A 2EYFA 1CZWA 3SDZA 1LT6D 3DEPA 3A55A 5JEAG 3GTOB 3DWQA 2IX1A 2AWNA 2VB2X 3DHQA 4OL7A 1EFID 5KYIA 2XSCA 4HN7A 3H6MA 3OSOA 3LX0A 1B1ZA 1DJRD 5J39A 4DK0A 2F0JA 4JBWA 1MBYA 1ONLA 5IT9L 3NQIA 5AFWA 4ZUJA 3QOJA 3PUWA 1PTOH 3QWNA 4B9XA 1ET6A 3V96A 1STAA 5K5PA 3SVMA 4IN3A 3N52A 2A6HD 3K7AB 4PMWA 1HXYD 5JPNC 1O7ZA 1J8IA 2RQXA 3D4WA 3VYUA 1RCVD 4C3JB 5C3XA 1DD2A 4CBVA 3MTSA 4XQNA 3OWFA 1STYA 4IALA 1S5CD 1EYCA 2E76C 4XT1B 4PV1C 3K59A 1JE4A 5CYUA 1KDCA 5CV9A 2VNUD 1ZKOA 4F88A 2CW0D 1KNEA 3MWYW 2PQEA 2F0VA 1SNDA 2L11A 4EVOA 5C0XJ 1TWAB 1CTMA 4J1MA 1KAAA 1SEBD 4QMGA 1D2BA 4RKBA 1TU2B 3K58A 2VXWA 4B9WA 2IX3A 1SNCA 3MAQA 1I50B 1ZYRC 3HG9A 2HDMA 2IX0A 3RZOB 1RJTA 2K6AA 3PV0A 1D1IA 4IFDJ 4C1NK 3V05A 4QIWB 1O7LA 1J9OA 1XX8A 3I73A 1UEAB 3KBGA 1F9QA 4X3KA 3Q24A 2F0NA 2A68D 3P20A 4BA2I 4KV6A 4OIJA 3D4RA 1R4PB 3VR6A 2JA8B 4KMUC 2L4NA 5EPKA 2LKVA 3VYTA 1OXSC 3J80E 3MHBA 2JXMB 4IZ8A 2E2IB 4C3IB 3D8GA 3NWTA 2EY5A 2OXPA 1PZID 2K32A 4K5XA 2WP8J 1EWHA 2B2VC 5JPMC 1YNJC 1V8QA 1F2YA 5EKIA 5M5WB 4KHZA 1EL0A 4NKLA 2MJ8A 1F2MA 4C2MB 1A3UA 4XQQA 1EQVA 4HCEA 4L63B 1S4ZA 2B2WA 4DU9A 3GO5A 4FVMA 2QDBA 1OXUA 3M7GA 2R61A 4K2LA 3SK6A 4BA1I 1VDZA 3Q23A 3I4MB 3MEHA 4K5WA 2B2UA 2KVMA 4WFN3 1JC7A 3D4DA 1LT3D 1WTVA 1ZXTA 3T4AC 5CV7A 3S2DB 4RGNA 1IKLA 1CK1A 2BDOA 1FYCA 4KD3A 3Q0AA 4FF3A 3AU7A 1ICWA 1H9KA 3I3CA 3V2TA 1XXGA 1NR4A 3MFYA 4K8IA 3EQLC 1SBBB 2F0HA 4FXKC 3G6JB 5C4JB 3IL8A 2D5DA 1WTPA 2X69A 3GQBA 3JAML 5I9PA 2F0LA 3HEJA 1H9RA 3SK8A 1Y8NB 5ELEA 3HOXB 4NMZA 5CMDA 2KEDA 3K5NA 2WB1B 1VCIA 2AQ3B 4AYBB 1AFPA 3FKIB 2MGSA 1IW7D 5EQ0A 2A6ED 1BDOA 2WINB 4XTCS 1T5EA 1RODA 3FPUB 2NN6I 4CJ1B 1UAPA 3TN2A 5C4ZA 2Z4IA 1B9MA 2DN8A 4DF7A 1QE6A 1L0YB 3E0JA 2EYOA 3J7AF 5K36H 4KY7A 2N88A 2BE5D 4UDUC 2FMMA 5A35A 2EJMA 4B08A 3QO2A 1HTLD 3VR4A 3SK5A 3MZ5A 2KOLA 2I46A 3GD7A 5I2XA 1DONA 2PCFB 1SJHD 1A2TA 3C3LA 1EIGA 3FPPA 2VUMB 2EOTA 1V43A 1V1OA 1HFNA 4ZLTF 1LTGD 1GOZA 3MXUA 4HTHA 1BQQT 1FNWA 3I8ZA 2B2TC 5DM63 2XRQD 1EY4A 2AUKA 1FGBD 2Y0SB 1ILQA 3X3NA 1G291 2QF7A 4K6LA 2F0OA 1OO9B 1Q3LA 1PYWD 4KKUA 4FF4A 2NWGA 4Z9CB 4Q5VA 2PNRC 2EY1A 2PW5A 2BOSA 5A2QL 2L55A 5FK9C 5JVG3 4K2KA 1KDAA 1EYAA 1FR3A 1RHPA 4XIGS 3LWUA 3S15B 3NE5B 3TP5A 2F0FA 5KNBA 1VMPA 2CQAA 2NBFA 1LO5D 4FNFA 2F0DA 2FHTA 5KIXA 2PMZB 4ZK9B 2IJ0A 4DAYA 2JA7B 4WJWA 1Y1VB 1IHZA 1LTAD 1LTID 5G3LF 4C3JG 1H9JA 4G7HC 3WDNA 2R3ZA 2KQ3A 1OXTA 2BCOA 1HQMC 3NWSA 5BN4A 1BUVT 1O78A 3PUZA 4I65A 2F0PA 4KJOA 4FYDA 4IQZA 1BOSA 1SAPA 3MXGA 1EZ8A 1SYDA 3H09A 1B9NA 2A69C 2PPBC 1LLRD 5IIFA 2K01A 1LT5D 4K6DA 1EY5A 2WIIB 2M00A 2VB3X 2SOBA 5C0XI 1CZGA 3E5SA 3HRZC 3ERQA 3TMEA 1CHPD 1SYGA 1PTOC 5JOBA 3PUYA 5EBDA 1BCPF 3NHHA 1C48A 3X3MA 3MFGA 4BBRB 3M3YB 1WVLA 4CKCA 2IW3A 4DGZA 3CRLC 2BA0A 1S5ED 2NVYB 2FJ2A 2C9OA 4C3IG 3J81L 3DEOA 5ELDA 1D5MC 1TY0A 2DNCA 2FMCA 3Q22A 5JVH3 1YNNC 1OXVA 2K28A 2SDFA 2C5CA 2K05A 5IGBA 2KUMA 4RGMA 5FO9B 1I4HA 1PTOB 3TDQA 5C3WA 2B39A 4I7ZC 4R9WA 5DEHA 1XWEA 3KLSX 1QNKA 2G9HD 3NXWA 1EIHA 4TKOB 3MA2B 4N9PA 2FINB 2MHVA 3BYYB 5EKKA 1B44D 4FXDA 3BZDB 1A3VA 5C4HA 4K14A 3A8KE 5E4WC 4OO1G 1V1PA 1PRTD 2L9HA 2MP1A 1JORA 3OW7A 1SYCA 2G9DA 5J22A 1SE4A 4ZRZA 1AZQA 2JYOA 2F0EA 5FOBB 1LTTD 3C1FA 5CV6A 4EGVA 4GZYC 3D6CA 1EY9A 4BS9A 4RGOS 1K8OA 4IUNA 3CU7A 1A6XA 1TR5A 4KY5A 1M8AA 1ESFA 2RVLA 4H44C 3K5MA 2F0MA 1JWMD 3I91A 1QNUA 4HCSA 5EKLA 1E2WA 1CT1D 1ET9A 4J6HA 1H9SB 2OEOA 4DK1A 3W2DA 5ELBA 4OGQC 3A7LA 4RKLA 3R2IA 4KKSA 1SJED 1CQVA 1PTOF 4CJ2C 2RDFA 4ZUIA 4KKTA 2B2YA 1X32A 2E75C 5C5LA 1WD0A 3AMUA 2ID0A 3GTGB 1UUPA 5C0XH 3K6OA 1SDFA 3CKIB 1Y1WB 5I9OA 4M8AA 1GUWA 2DY7A 1LT4D 3GTKB 3OWEB 2HCIA 5D3IB 3C46A 2XNAC 4XDXA 4FF2A 4IFDH 3FMCA 2K7VA 1CM9A 5G3LD 5M3MB 3VA5A 1EZ6A 3SR1A 3LWEA 1K83B 3IAYA 5J1ZA 3SE0A 1CFMA 3S16B 3D6WA 3P1HA 1DYQA 2Q8TA 2F0QA 3L3OC 1SMYD 2O5IC 3EVQA 5C6AA 3UI2A 2Q8IB 3EA6A 2X6LA 4ODGA 2KCCA 4XXEA 2SEBD 2EYHA 4G4KA 5HURA 2M9VA 4HSPA 1D6EC 1PZKD 3EFXD 3A8IE 4HR7B 2LS01 4DA2A 1BCPD 3HOZB 4F8MA 1W6JA 2RBMA 2EZVA 4A3IB 1XYIA 2FFKB 2NVXB 1R9TB 2L12A 2X6GA 4PMBA 3T53B 4CJ0B 1HPCA 2PZWA 4XYQA 4MIUA 1R4QB 2F03A 2R7ZB 3ND9A 5IGCA 3GP7A 1SNPA 3GTQB 5ELFA 3TP6A 2NN6G 1C4QA 1IYVA 5IGEA 1LTSD 2N55A 1RTNA 1KLUD 1G8ZD 5ISRA 1F9PA 3NUCA 1AEXA 3QB3A 4ZQ3A 4X3UA 2OF1A 4DNTB 3S17B 1F2ZA 2NTTA 5CORA 1JR0D 1KTKA 2CW0C 2HCCA 3NK9A 5CV8A 3BVZA 3TP7A 2L5TA 1E0BA 5JEAJ 1F9SA 2EVBA 3OHXC 1BNZA 1FD7D 4KHVA 3J7AV 2EY2A 3G7LA 2PW7A 3L9AX 4N9TA 1DOKA 3OMCA 1Q12A 1JOKA 4MHEA 1NUCA 1WTQA 3I90A 5CBEE 1ILPA 1HCZA 1SFOB 2EYLA 1SYFA 1HHVA 5LL6S 2A68C 5FLXE 1E2VA 4FP5D 1ENAA 1UNSA 2E2DC 2JA6B 1HUMA 3OIQA 4IUUA 3RLFA 3HS0C 3WOFA 5DAUA 3H94A 1PLFA 3D3RA 2SNSA 3KBXA 4K5VA 2V4DA 4PNYA 5KNDA 1G2SA 2K1BA 1F9RA 2EYJA 2F1MA 4LAAA 1EEID 1I4GA 2HDLA 4KTAA 2WKDA 5LHY1 1D1KA 5I4DA 1ENCA 5E1FA 4ME5A 1I6VC 5JAVA 5COYA 2NVQB 2J4XA 2L0CA 2ZXPA 1BO0A 1JICA 2XRSD 4WRDA 2EDGA 1B2TA 5FKAC 1KLGD 1SYEA 1Z47A 2I07B 3R8BA 1GHJA 1EOTA 1EWCA 2RSNA 1A15A 3BYTB 1EY8A 1NCVA 3KLRA 2AUJD 4RH6A 4IURA 3RZDB 4BY7B 2B2WC 2QKIC 5IGGA 3VA7A 3HZXA 3P7JA 2WACA 2J0TD 1I4PA 2R6GA 3Q6SA 5D14A 5C4XB 3J80L 2ENBA 4LMQD 1I4QA 4DFAA 1XTCD 4TSSA 3FDTA 5IT9E 3QG1A 2B2UC 2RDGA 1SXTA 3BDOA 1AP0A 4RAUC 5FO8B 3SXHA 3T16A 2E2JB 1WCMB 1EY6A 3BVMA 3DM1A 1I3QB 3PUVA 2JA5B 1U9RA 1CA5A 5M5YB 2CVRA 4XQJA 4WORA 4O42A 1KABA 5EJWA 5C0XG 1QOHA 1F77A 2F0GA 4U68A 1U4LA 4ABNA 1I4RA 2NTSA 2LMCB 2JE6I 1U4RA 3OIPA 5KGUA 1CQFA 2B8FA 2E74C 5I6YA 2Z1CA 1MSGA 2EJFC 3NSWA 3PO2B 3PIO3 1Y69U 5HGTA 2MPMA 4RGTA 3M4YA 1IW7C 2A6EC 3GTLB 1HUNA 1S5FD 3EJIA 1CI3M 3A56A 2QILA 4XT3B 1Z7TA 2WKCA 1MI2A 3NBHA 1JB3A 1HFGA 4MN3A 1PDQA 5CV4A 4TRDA 1BBXC 3DMUA 2K5WA 1BF4A 5KYLA 2WV6D 1EQTA 2EY6A 4Q0FA 2BE5C 3NTHA 2TSSA 3I4NB 4Y7NB 4EQOA 1SNQA 2DY8A 1PXUA 4QUFA 4FF1A 3DUZA 3QJYA 4C56C 2ZXOA 3R2TA 1S5BD 1TKWB 3HOWB 1MGSA 2RDHA 4IFDI 4L6TB 4YIJA 3U9OA 5TSSA 1ZEQX 4U673 4ZYSA 1GUGA 1TT2A 2TMPA 1ZYRD 5M9OA 2BA1A 4QCLA 2H1EA 4FXGC 3L7ZC 1BXTA 1TWHB 2CHBD 3BDLA 2F3WA 2KECA 3I72A 3N6RA 2KCNA 2HQEA 3K0YA 1EEFD 5CBAE 3PUXA 3I4LA 3EROA 1ESRA 2D9UA 2D2CC 1ML0D 3TSSA 1PFNA 2B2VA 2J7ZA 2LFNA 2NYZD 5C3EB 3MVVA 2K5QA 3RD4A 2PZTA 4QF4A 1STBA 1STHA 1YNJD 4ZKCB 3NBIA 2F4IA 3OOCA 4ULLA 3ZYYX 2LY7A 4CKEA 5ELCA 1E2ZA 1QB5D 1Y8OB 2IWHA 4A3EB 2JSOA 1TVXA 3JAME 1TS2A 4XYOA 3M7NA 1JCKB 2F0WA 5I2YA 4HSVA 5K36G 1EU4A 2A74C 1HQRD 1VMCA 4P2CB 3E6ZX 4CKBA 3CQZB 2QCPX 2Z8LA 4KJNA 5FO7B 2PZUA 1LTBD 3BDCA 3KF8A 1Y8PB 1VF5C 5EPJA 3T51B 1RDPD 3VR3A 1D5ZC 3TP8A 1G6ZA 4OO1I 2DNEA 3R93A 5CGKA 1STNA 4LJZC 4L8JA 3LNNA 4RHSA 4RFBA 5E4XA 2A5HA 3GTMB 2AWOA 3PMFA 5DNFA 3C1EA 5KNCA 4DN4M 3NTIA 2Q8RE 3QOLA 3BG3A 1IL8A 4J8QA 1F2LA 2XWJB 1DOLA 2XVSA 3OMGA 4RCNA 2F0IA 4CGYB 4C3HB 4RCOA 1JWUD 2ICEC 2ICIA 1TWFB 3MXPA 4RA8A 4F87A 1DOMA 3FVQA 3IFTA 4DAVA 4JK1C 3URYA 4O1NA 3MC0B 2XWBB 3GV3A 4HAEA 1U4MA 4IUTA 1VF7A 3I70A 3CRKC 1X3QA 2PYKA 4NP5A 2K5DA 3TBIB 2F0UA 5IODA 4A93B 2NVTB 1WTRA 1B4OA 1B50A 4E6IA 1STEA 3NQTA 1PMRA 1II3A 3A7AB 3FRPB 1GJXA 1TWGB 1PRTC 3ITPA 1S5DD 4RHRA 4QB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1E A;  2K03 A;  2HDL A;  1WD0 A;  1QG7 A;  1NR4 A;  1SSO A;  4X3T A;  2L4N A;  1SAP A;  1HFN A;  5EPK A;  5T1G A;  4ZLT F;  2L1B A;  1U4R A;  2RA4 A;  2KEC A;  1SDF A;  3GV6 A;  1MSG A;  5CBA E;  5AFW A;  2EE1 A;  5E4W C;  5COY A;  3IL8 A;  1WTP A;  1GUW A;  2EPB A;  1O7Y A;  2L9H A;  2MP1 A;  5EPJ A;  3TZD A;  2DY7 A;  2HUG A;  1ESR A;  1BO0 A;  1JIC A;  2X69 A;  2D9U A;  1NAP A;  4ZAI A;  2HCI A;  3I8Z A;  1WD1 A;  1B2T A;  2B2T C;  2MPM A;  2N55 A;  1ML0 D;  1RTN A;  2B2V C;  2K01 A;  2KEE A;  1G6Z A;  5EPL A;  1F9P A;  4QUC A;  3R93 A;  1PFN A;  5EKI A;  4XDX A;  4X3U A;  1ILQ A;  1EOT A;  2B2T A;  1HUN A;  2B2V A;  1CM9 A;  3SVM A;  1AZP A;  1NR2 A;  3N52 A;  2RSN A;  1EL0 A;  5COR A;  5JJZ A;  2MJ8 A;  2J7Z A;  5E4X A;  1DZ1 A;  2K04 A;  2JYO A;  1A15 A;  2NYZ D;  4RWS C;  1WTX A;  1B53 A;  1AZQ A;  1Q3L A;  4XT3 B;  1NCV A;  2XIW A;  2KED A;  5CMD A;  3F2U A;  3LWE A;  4IUR A;  1O7Z A;  2HCC A;  2NWG A;  4ZKB B;  1J8I A;  5DNF A;  1HRJ A;  4DN4 M;  2B2W C;  1MI2 A;  2Q8R E;  3H91 A;  1G91 A;  4IUV A;  1IL8 A;  1U4P A;  1E0B A;  1F2L A;  1DOL A;  1F9S A;  1HFG A;  3MTS A;  1PDQ A;  3P7J A;  4MN3 A;  1CA6 A;  1S4Z A;  2MGS A;  3D6W A;  4ZKC B;  4IUQ A;  4OIK A;  2B2W A;  5EQ0 A;  1BBX C;  1RTO A;  1O80 A;  3Q6S A;  1BNZ A;  5D14 A;  1HA6 A;  2JP1 A;  1WVL A;  3G7L A;  4XT1 B;  1BF4 A;  1ROD A;  1RHP A;  3FPU B;  2Q8T A;  4IUP A;  1X3P A;  4RA8 A;  1JE4 A;  1DOK A;  2M2L A;  1M8A A;  2RSO A;  2RVL A;  4CJ1 B;  4LMQ D;  4MHE A;  2FJ2 A;  1EQT A;  1KNE A;  1WTW A;  3TN2 A;  1WTQ A;  1PFM A;  2IL8 A;  3MWY W;  3I90 A;  1MSH A;  1DOM A;  3DEO A;  5CBE E;  4UAI A;  3I91 A;  1ILP A;  3UI2 A;  3FDT A;  4HCS A;  2L11 A;  2DY8 A;  2X6L A;  4QUF A;  2B2U C;  2NZ1 D;  1AP0 A;  1VMP A;  4RAU C;  1B3A A;  2K28 A;  2SDF A;  3KUP A;  5T1I A;  1QE6 A;  4HED A;  3DEP A;  1HHV A;  3GV3 A;  2K05 A;  2VXW A;  2FHT A;  4HAE A;  2B2U A;  1U4M A;  1TVX A;  1PFB A;  4NW2 A;  4ZK9 B;  4R8I A;  2KVM A;  1MGS A;  3DM1 A;  4IUT A;  1G2T A;  1HUM A;  3ONA B;  2N88 A;  2HDM A;  1X3Q A;  2FMM A;  1WTV A;  4IUU A;  1RJT A;  2KUM A;  1CA5 A;  4HSV A;  3QO2 A;  3HP3 A;  1ZXT A;  2CVR A;  2KOL A;  1WTR A;  1B4O A;  1B50 A;  2B2Y C;  4CJ2 C;  1PLF A;  1J9O A;  1XX8 A;  4O42 A;  1KNA A;  1WTO A;  1DON A;  2R3Z A;  4R9W A;  1IKM A;  3KBX A;  1IKL A;  3IFD A;  5EJW A;  1F9Q A;  1XYI A;  1QNK A;  5D65 A;  4X3K A;  2FFK B;  1LV9 A;  1EIG A;  1G2S A;  2B2Y A;  2K1B A;  1X32 A;  1F9R A;  2BDN A;  1ICW A;  4U68 A;  4OIJ A;  1EIH A;  1U4L A;  1VMC A;  2L12 A;  2X6G A;  3I3C A;  4X3S A;  1C8C A;  2FIN B;  2EOT A;  4CJ0 B; 
#chains in the Genus database with same CATH topology
 5A2Q E;  1SSO A;  1YVC A;  2PQA B;  3AB9 A;  3HKZ B;  1CHQ D;  3S14 B;  4PQX A;  2YTY A;  4DAP A;  2RA4 A;  3SK4 A;  3TRZ A;  1QJO A;  3S1M B;  3CAM A;  3STB D;  3DWP A;  3S1R B;  2EE1 A;  2MUY A;  1I50 H;  1YHQ A;  1KQS A;  3O13 A;  1IYU A;  1K0S A;  4V19 0;  4DR5 L;  4JI2 Q;  1Q90 A;  1PH6 A;  2OT2 A;  2GVA A;  1LAB A;  1WCM G;  3W3A A;  4GN3 B;  3TEH B;  2Q2I A;  1AE3 A;  1QWY A;  5EPL A;  2JA5 G;  3U58 A;  1GKH A;  2B63 B;  1N34 L;  3H3V C;  3A8J E;  4DR2 L;  1JJ2 A;  2B2T A;  3CHB D;  4LF5 Q;  1AZP A;  3H0G B;  5JJZ A;  4DV3 Q;  1L1O C;  3T13 A;  1Q7Y C;  1P16 A;  3F2U A;  4DV4 L;  4A3J B;  1JB7 A;  1HRJ A;  4ZKB B;  4LNQ A;  1Q8I A;  2A6H C;  1EQR A;  4H13 C;  3K57 A;  1FNV A;  2XGT A;  1G91 A;  5CR3 A;  4IUV A;  1PRT B;  5IP9 H;  4A3K B;  1RKN A;  3UE0 A;  1JJG A;  4KY6 A;  4WJ3 M;  1RTO A;  2E2I H;  4A93 H;  4G7O C;  2NVT H;  4C3I H;  1HA6 A;  2F3V A;  3S2H B;  4DXF A;  4A3G B;  1HZC A;  1GUO A;  1V1P B;  4KK7 A;  5IWA Q;  1Z6H A;  2KBN A;  1IBM L;  2M2L A;  2ZJQ A;  1TWG H;  1ICF B;  4UY8 C;  2YYZ A;  2UUB L;  1LUZ A;  4R4C A;  2N78 A;  3SEB A;  1NSN S;  3NPP A;  3PO2 G;  1KL9 A;  3KUP A;  1SMX A;  5T1I A;  4HED A;  4ALP A;  1QIL A;  5KEE A;  4R8N A;  3PF4 A;  1EY0 A;  2XN9 C;  4HJA A;  4NW2 A;  3RUZ A;  3S1M H;  2CKZ B;  4C1N I;  1G2T A;  3VYR A;  4YHH L;  4BXX G;  3GTP B;  2ZJR A;  1L1O B;  1SE2 A;  5NUC A;  4CDE C;  2MQH A;  1WFQ A;  3KLS A;  1GUN A;  3NP8 A;  2B2Y C;  2EYM A;  5JEA H;  2O5J C;  3BVG A;  1B3Q A;  3OTO Q;  1IKM A;  1MIU A;  3DXJ C;  5D65 A;  3T56 B;  2R92 B;  4B3R L;  4K0K Q;  2BDN A;  5IOC A;  4QQB X;  3A54 A;  2ES2 A;  1QG7 A;  4LFB Q;  4X3T A;  2CH4 W;  5IYC H;  4OO1 H;  5T1G A;  3I4M H;  4LK1 C;  2IPK D;  1K8M A;  1JJC B;  4JV5 L;  1HR0 Q;  4IO9 A;  3I4N G;  3J7Y W;  3GV6 A;  5BR8 L;  5EGT A;  2JA9 A;  3ULP A;  1OXX K;  3WOE A;  3KJP A;  4G7Z C;  5BN3 A;  1O7Y A;  3J81 E;  5M3F B;  3S2H H;  2E8G A;  2B3G A;  2WFW A;  2K33 A;  4ZAI A;  1NMG A;  5HGQ A;  2QGQ A;  1BR9 A;  1FNU A;  3HOW G;  3PIP 3;  2KEE A;  4LWC A;  4QUC A;  4FO2 A;  2K4K A;  3ND8 A;  3S2D H;  2QEJ C;  3VR5 A;  3KF8 B;  5C5M A;  1RF2 D;  3VYS A;  2YU9 B;  2SNM A;  4F7X A;  1NR2 A;  3S9W A;  2A69 D;  4RWS C;  4OWT B;  2XIW A;  1SMY C;  2CQO A;  5IGD A;  3BS1 A;  4DKA C;  3M4O B;  3H91 A;  4RG1 A;  3AYH B;  5F2D A;  3GTP H;  1GVP A;  4LF7 L;  5FLX c;  1PRT F;  3K5O A;  4OIK A;  2IT1 A;  2ZT9 C;  1J6Q A;  1KRS A;  5C4J H;  2B8G A;  4ID6 A;  1EIF A;  1VQM A;  1PTO D;  4K8J A;  4EQN A;  1PFM A;  3S1N B;  5LL6 X;  5CV5 A;  1L0X B;  1BCP C;  3KK7 A;  1GUT A;  2NZ1 D;  4YCU A;  4EQP A;  4JI7 L;  2AQ1 B;  1XNQ Q;  5I6W A;  1TII D;  3CC7 A;  3HOX H;  4YY3 Q;  2KJX A;  2NUC A;  4A3B B;  5C3E G;  3I4O A;  1ENF A;  4BBS B;  3FKI H;  1GHK A;  1Q82 C;  3HOY B;  4LF8 L;  1EU3 A;  1YNN D;  2CH4 A;  2F4V Q;  3HOU B;  1WTO A;  1KNA A;  4BY1 B;  1B8A A;  2Z4H A;  1LV9 A;  3OPO A;  2R93 B;  3RMH A;  4X3S A;  1C8C A;  4JI6 L;  2K03 A;  4HMI A;  1DM0 B;  3R3O A;  5C44 B;  3MXN A;  5ELN A;  3F1Z A;  1DCZ A;  2H4O A;  1TS3 A;  2WAQ B;  4P74 A;  2VW9 A;  3U9S A;  5IGF A;  1BCP B;  2KHS A;  1D5X C;  4DXG A;  5M5X B;  1XMO Q;  3TZD A;  1FJG L;  1Q1E A;  1IL2 A;  2HUG A;  1JQY D;  3TZU A;  1NAP A;  4A3E G;  2VZA A;  5EBC A;  5IE8 A;  2UU9 Q;  2AQ2 B;  3KYH C;  4HMJ A;  2EXZ A;  3S1N H;  1N32 L;  5IYD H;  1H9S A;  2QW7 A;  1MD2 D;  1LAC A;  1DZ1 A;  4TQU S;  1SNM A;  2K04 A;  5IT9 c;  1B53 A;  5BN5 A;  3QIA A;  1AN8 A;  2I5L X;  4IFD G;  1EYD A;  4BWG B;  1VQL A;  4IPD A;  1SE3 A;  4DNR B;  2JEA I;  2G5D A;  1AH9 A;  2EYP A;  4IUQ A;  3SHL A;  5E3F A;  4OHJ A;  1HNW L;  2JP1 A;  1MJC A;  1GUS A;  2NB0 A;  3VR2 A;  3HOU H;  4ILW A;  4NXN Q;  4IUP A;  2AKW B;  4JI3 Q;  2RSO A;  1PH4 A;  1AW7 A;  4A3M B;  2Z0S A;  1JOO A;  1WTW A;  1HH2 P;  2IL8 A;  1LTR D;  2K50 A;  4UAI A;  4H7B A;  4ZCK A;  1W6K A;  4A3D B;  1B3A A;  2PO4 A;  5HY6 A;  3NTK A;  4OEL B;  1SNO A;  1WOC A;  2F0T A;  3HGB A;  1PFB A;  4LUO A;  4R8I A;  3CCR A;  3HOV B;  3S1Q B;  3HFZ B;  2IY5 B;  5CC4 A;  2EJG C;  1RD9 D;  5DM7 3;  3ONA B;  4L5Q A;  1PZJ D;  4B3T Q;  3HP3 A;  1SYB A;  1I4X A;  4DAM A;  1HTP A;  4IOA A;  4NDX A;  2E2H B;  3RN5 A;  3IFD A;  1LM0 A;  4M1U B;  4S3S A;  2F0K A;  3S15 H;  3D31 A;  1TWC B;  1HNZ Q;  1VQ4 A;  2OWO A;  1W3S A;  2HQL A;  4R1J A;  4A3F B;  2JN4 A;  2RKS A;  4C3H G;  1DXM A;  3UDF A;  1STG A;  3K5L A;  1HA5 A;  2CWA A;  1QCB D;  4KI0 A;  2L1B A;  4DR3 L;  4LW1 A;  2NN6 H;  2JEB I;  4LFA L;  2KA7 A;  1A2U A;  1TS4 A;  4OEM B;  2EPB A;  1WTH A;  1T5X D;  2JA7 H;  4DV2 Q;  4PZ7 A;  4IPC A;  3K0X A;  1Y1V H;  3FEW X;  5FLX L;  1M4V A;  4JI2 L;  2GA4 B;  1WD1 A;  3PO3 B;  3C2P A;  1I6H B;  4A3M H;  1A3T A;  3GTJ B;  1H9M A;  3DWA A;  1CKN B;  1KDB A;  1BKB A;  4G57 A;  2O4X A;  3IKJ A;  1UE7 A;  4DR1 Q;  3T1Y L;  1TQO A;  4PMC A;  4HJ7 A;  1GXD C;  4KN7 C;  4A93 G;  4B3S Q;  1OTC A;  5DLQ E;  1WTX A;  1G6P A;  4DV3 L;  2D62 A;  4KD4 A;  1IBL L;  2ZM6 Q;  1TY2 A;  1CUK A;  1U4P A;  4CHT B;  1Q1B A;  1CA6 A;  2F0S A;  1JOQ A;  1JWS D;  1O80 A;  4MZ9 A;  1EY7 A;  2DJF C;  2DUD A;  4V0B A;  4KN4 C;  5KRU A;  1TS5 A;  3HKZ G;  3L2P A;  1XPU A;  5D3D A;  1X3P A;  3P75 A;  2O2L D;  2A73 B;  2ZXR A;  1MSH A;  4A3F H;  4H0L C;  3M85 A;  2EYF A;  1CZW A;  3SDZ A;  1LT6 D;  2NZH A;  3DEP A;  3EBE A;  3A55 A;  5JEA G;  3GTO B;  2B63 G;  4B3M L;  4A4I A;  3DWQ A;  2IX1 A;  2AWN A;  3ULJ A;  1XMQ L;  5GAD C;  3H0G G;  2VB2 X;  3CXC A;  2A1A A;  2K5H A;  3AFQ A;  3DHQ A;  4JI8 Q;  4OL7 A;  4JI4 L;  4A3J G;  5IP7 G;  4BBR H;  1EFI D;  5KYI A;  2XSC A;  4HN7 A;  4A3K G;  3H6M A;  3OSO A;  3OTO L;  3LX0 A;  1B1Z A;  4JI1 L;  1DJR D;  3B6Y A;  5J39 A;  4DK0 A;  4LUZ A;  2F0J A;  3UDX A;  1VQN A;  4A3G G;  4POF A;  4JBW A;  1MBY A;  1HR0 W;  1ONL A;  3JAM i;  5IT9 L;  1KHI A;  3NQI A;  1MKH A;  5AFW A;  4ZUJ A;  1GO3 E;  3QOJ A;  2F52 A;  3MXN B;  1VQ7 A;  3PUW A;  1PTO H;  1P8L A;  1QZG A;  4KHP Q;  3QWN A;  4B9X A;  4AQY L;  1ET6 A;  3V96 A;  1STA A;  5K5P A;  3SVM A;  4IN3 A;  3N52 A;  2A6H D;  3K7A B;  1YJW A;  4PMW A;  1HXY D;  5JPN C;  4MTK A;  1O7Z A;  1J8I A;  2RQX A;  1K9M C;  3D4W A;  3VYU A;  1RCV D;  5AJ3 Q;  2R92 G;  4C3J B;  5C3X A;  5JJK A;  4DNI A;  4X65 Q;  1DD2 A;  4CBV A;  3MTS A;  4XQN A;  2VQF L;  1K28 A;  3OWF A;  3JAM c;  2VQE Q;  1STY A;  4IAL A;  4OX9 L;  1S5C D;  4DUY L;  1EYC A;  2E76 C;  4JI0 Q;  4XT1 B;  1VQP A;  4PV1 C;  3K59 A;  1E1O A;  2Z6K C;  1JE4 A;  5CYU A;  4GNX A;  1KDC A;  5CV9 A;  2VNU D;  1ZKO A;  4F88 A;  4LUV A;  2CW0 D;  1KNE A;  3M4Q A;  2PQE A;  3MWY W;  1H95 A;  5M3F G;  2F0V A;  3T1H L;  1SND A;  2L11 A;  3G48 A;  1YHB A;  4EVO A;  3K7U C;  5C0X J;  3W1B A;  2E5L L;  1TWA B;  1CTM A;  1WYD A;  4J1M A;  1KAA A;  3CD6 A;  1SEB D;  2XTI A;  1XNQ L;  3ICE A;  4QMG A;  1D2B A;  1T9H A;  4RKB A;  1TU2 B;  3K58 A;  2VXW A;  4B9W A;  2IX3 A;  1SNC A;  3MAQ A;  1I50 B;  1ZYR C;  3HG9 A;  2HDM A;  2IX0 A;  4GLA C;  3RZO B;  1RJT A;  4LF6 Q;  4A3L G;  2K6A A;  3PV0 A;  1D1I A;  4IFD J;  4C1N K;  3V05 A;  4QIW B;  2OQ0 A;  3F2D A;  1O7L A;  1J9O A;  1XX8 A;  3I73 A;  1UEA B;  3CCJ A;  3KBG A;  1F9Q A;  4X3K A;  3Q24 A;  2F0N A;  2A68 D;  4X6A H;  3P20 A;  4BA2 I;  4KV6 A;  4OIJ A;  3D4R A;  1R4P B;  3VR6 A;  3K7A H;  4GKJ L;  2JA8 B;  1PYB A;  4GLV B;  4KMU C;  2FXQ A;  1K8A C;  2L4N A;  5EPK A;  2LKV A;  1KXL A;  3VYT A;  1OXS C;  3J80 E;  3MHB A;  2JXM B;  1HNX L;  4LF9 L;  4IZ8 A;  2E2I B;  2UXD Q;  4BY7 G;  4C3I B;  3D8G A;  3NWT A;  1K3R A;  2EY5 A;  2HHH Q;  2OXP A;  1PZI D;  1V1Q A;  2K32 A;  4TVA B;  4K5X A;  4HIO A;  2WP8 J;  1EWH A;  2B2V C;  2AMC B;  2R7D A;  4JOI C;  5JPM C;  3KDF B;  1YNJ C;  1V8Q A;  1F2Y A;  4NB3 A;  5EKI A;  4A3B G;  3L0O A;  1YZ6 A;  4BBS G;  1TWA H;  5M5W B;  1PV4 A;  4KHZ A;  3HOY G;  1VQ5 A;  2UXC L;  1EL0 A;  4NKL A;  2MJ8 A;  4NXM L;  1F2M A;  3HOU G;  1X3E A;  4BY1 G;  4C2M B;  1A3U A;  1Q81 C;  4XQQ A;  3ULL A;  2R93 G;  1EQV A;  3RZO H;  4HCE A;  4L63 B;  1S4Z A;  3GTG H;  2B2W A;  4JI5 Q;  5C44 G;  1Y1W H;  4DU9 A;  1C9O A;  1A63 A;  3GO5 A;  4FVM A;  4X66 Q;  2WAQ G;  2QDB A;  1OXU A;  3M7G A;  3E0E A;  4DR4 L;  2R61 A;  4K2L A;  2JA8 H;  3SK6 A;  4LF4 Q;  4BA1 I;  4QJF A;  3UDI A;  4DV5 L;  1BBW A;  4JBK A;  1VDZ A;  3Q23 A;  4DV7 L;  3I4M B;  3MEH A;  1Y14 B;  4K5W A;  5M3M H;  3HKZ E;  2B2U A;  2I5H A;  2KVM A;  4WFN 3;  1JC7 A;  3D4D A;  1XJV A;  1VQ8 A;  1LT3 D;  1WTV A;  5FLM G;  2EIF A;  1ZXT A;  2RCF A;  1E22 A;  1BBU A;  3T4A C;  3K80 C;  5CV7 A;  3S24 A;  3S2D B;  4RGN A;  1IKL A;  1CK1 A;  2BDO A;  1A8V A;  1FYC A;  5M5W H;  4KD3 A;  3Q0A A;  4FF3 A;  3AU7 A;  1ICW A;  3G6E A;  1H9K A;  3I3C A;  1A0I A;  3V2T A;  5IYB G;  1Q86 C;  1XXG A;  1NR4 A;  4P71 A;  4C2M H;  2UXB Q;  3MFY A;  4A3M G;  1XNR Q;  4K8I A;  3EQL C;  1SBB B;  2F0H A;  2PNH A;  2Z6B A;  4FXK C;  1BVS A;  3G6J B;  5C4J B;  4A3D G;  4JYA Q;  3IL8 A;  2D5D A;  1WTP A;  1VQK A;  4GS3 A;  1QVF A;  2X69 A;  3GQB A;  3JAM L;  3HOZ H;  1FGU A;  3HOV G;  5I9P A;  2F0L A;  3HEJ A;  3A0J A;  1H9R A;  4A3I H;  3SK8 A;  1Y8N B;  2NVX H;  1X55 A;  1FVI A;  5EAY A;  5ELE A;  1R9T H;  4DV6 L;  3HOX B;  4NMZ A;  5CMD A;  2KED A;  4HID A;  3K5N A;  2WB1 B;  2H5X A;  3TQY A;  1VCI A;  2AQ3 B;  4AYB B;  1AFP A;  4DUZ L;  2R7Z H;  3FKI B;  2MGS A;  1EQQ A;  3J81 i;  1IW7 D;  5EQ0 A;  2A6E D;  1BDO A;  2WIN B;  2KEN A;  4XTC S;  1B7Y B;  1T5E A;  3GTQ H;  1WI5 A;  1X56 A;  1ROD A;  3FPU B;  1EIY B;  2NN6 I;  4CJ1 B;  1UAP A;  3TN2 A;  5C4Z A;  1UE1 A;  5LMN Q;  3CCL A;  2Z4I A;  1B9M A;  2DN8 A;  4JC0 A;  4DF7 A;  3S17 H;  3PO3 G;  2UUA L;  1QE6 A;  4P72 A;  2KCM A;  1UWV A;  1L0Y B;  2C35 B;  3E0J A;  2EYO A;  1JMC A;  3J7A F;  5K36 H;  4KY7 A;  2N88 A;  2BE5 D;  2ZTE A;  4UDU C;  2FMM A;  5A35 A;  2EJM A;  4B08 A;  4L5T A;  3QO2 A;  1HTL D;  3VR4 A;  3SK5 A;  3MZ5 A;  2KOL A;  2I46 A;  3J81 c;  3GD7 A;  1PHJ A;  5I2X A;  2KHJ A;  1EFW A;  1YIT A;  1DON A;  2PCF B;  3STB C;  1SJH D;  1A2T A;  3C3L A;  1EIG A;  2BH2 A;  3FPP A;  2HT1 A;  3PCO B;  2VUM B;  2EOT A;  1LTL A;  4UP7 A;  2RCN A;  1V43 A;  2QA4 A;  1X65 A;  1V1O A;  1HFN A;  1UE6 A;  4ZLT F;  1LTG D;  4GKK Q;  2P5Z X;  1GOZ A;  4QL5 A;  3MXU A;  3F2B A;  4OWW B;  1VQH A;  4JG2 A;  4GOP A;  1YJN A;  2PI2 A;  2JA6 H;  4HTH A;  3U4V A;  1BQQ T;  1FNW A;  2I5M X;  3I8Z A;  1N33 L;  2B2T C;  5DM6 3;  2XRQ D;  1EY4 A;  2AUK A;  3F8T A;  1L2F A;  1FGB D;  2Y0S B;  1ILQ A;  3X3N A;  1G29 1;  4LFC Q;  3G4S A;  2QF7 A;  1N9W A;  2F0O A;  1OO9 B;  4K6L A;  1ASZ A;  1Q3L A;  1J5E L;  2UUC L;  1PYW D;  4KKU A;  4FF4 A;  2NWG A;  5LMU Q;  4Z9C B;  3RLO A;  4Q5V A;  4IOC A;  2PNR C;  3UDG A;  5J3B A;  2EY1 A;  4X65 L;  1NJI C;  2PW5 A;  2BOS A;  5A2Q L;  2L55 A;  2YV5 A;  1WJJ A;  4UPA A;  5FK9 C;  5JVG 3;  4K2K A;  2DJG C;  1KDA A;  1EYA A;  4DV0 Q;  2GVB A;  1FR3 A;  1RHP A;  4JI0 L;  4XIG S;  4DV1 Q;  2EQS A;  4HJ9 A;  1E1T A;  3LWU A;  3S15 B;  4GLX A;  3NE5 B;  3TP5 A;  4X62 Q;  2F0F A;  2VUM H;  3KLW A;  5JJI A;  5KNB A;  4A3C H;  1VMP A;  3G71 A;  2CQA A;  2NBF A;  1LO5 D;  3I7F A;  3FHW A;  4FNF A;  2F0D A;  2FHT A;  5KIX A;  1PH3 A;  2WAQ E;  2PMZ B;  4ZK9 B;  2IJ0 A;  3RZD H;  1M1K C;  4DAY A;  1G51 A;  2JA7 B;  4WJW A;  1Y1V B;  1IHZ A;  1LTA D;  2K5V A;  1IBK L;  1LTI D;  5G3L F;  4C3J G;  1H9J A;  4G7H C;  3WDN A;  2R3Z A;  2KQ3 A;  1OXT A;  2BCO A;  1HQM C;  3NWS A;  5BN4 A;  1N34 Q;  1BUV T;  4DR2 Q;  1O78 A;  3PUZ A;  4I65 A;  2F0P A;  4KJO A;  4FYD A;  4IQZ A;  1BOS A;  1SAP A;  3MXG A;  1EZ8 A;  1SYD A;  4DV4 Q;  1WCM H;  3H09 A;  1N36 L;  1B9N A;  1K0R A;  2OCE A;  2A69 C;  1UE5 A;  2JA5 H;  2PPB C;  1LLR D;  1NY4 A;  5IIF A;  2K01 A;  1LT5 D;  4K6D A;  1EY5 A;  2WII B;  2M00 A;  2VB3 X;  3M9B A;  4X64 L;  1U0L A;  3OYY A;  1HNZ L;  2SOB A;  5C0X I;  1CZG A;  3E5S A;  3HRZ C;  4UHV A;  3A5U A;  2UUB Q;  3ERQ A;  3TME A;  3PF5 A;  1CHP D;  1SYG A;  1PTO C;  5JOB A;  3BU2 A;  3PUY A;  1Q46 A;  5EBD A;  4L5S A;  1W2B A;  1BCP F;  3NHH A;  1C48 A;  2Q2H A;  3X3M A;  2RF4 A;  2JA8 G;  3MFG A;  1VQI A;  4BBR B;  4YHH Q;  3CCM A;  2MO0 A;  3M3Y B;  4HJ5 A;  1WVL A;  4CKC A;  4DR6 Q;  5IP9 G;  2IW3 A;  3AQQ A;  4DGZ A;  3PQI A;  3CRL C;  2BA0 A;  1S5E D;  2NVY B;  1KD1 C;  3PO2 H;  2FJ2 A;  4LF5 L;  2C9O A;  4C3I G;  3J81 L;  3DEO A;  5ELD A;  1PH7 A;  1D5M C;  3CF5 A;  4P73 A;  1TY0 A;  3F2C A;  2DNC A;  3VDY A;  1S3O A;  2FMC A;  3Q22 A;  5JVH 3;  1YNN C;  3GTL H;  1LYL A;  1OXV A;  4BXX H;  3CCQ A;  2K28 A;  2SDF A;  2C5C A;  2K05 A;  4OXP A;  3CPW A;  2I0Q A;  4JV5 Q;  5IGB A;  2KUM A;  4RGM A;  5FO9 B;  5IWA L;  1I4H A;  1PTO B;  3TDQ A;  5BR8 Q;  5C3W A;  2B39 A;  4I7Z C;  4R9W A;  5DEH A;  1XWE A;  3KLS X;  1QNK A;  1PYS B;  2G9H D;  3LGJ A;  3NXW A;  1EIH A;  4TKO B;  5GQO A;  3MA2 B;  4N9P A;  2FIN B;  2MHV A;  3BYY B;  5EKK A;  4Y7N H;  4R4T A;  1B44 D;  5L37 A;  3E9I A;  4FXD A;  3BZD B;  1A3V A;  1YHA A;  2Z9H A;  5C4H A;  3HKS A;  4K14 A;  3GDE A;  3A8K E;  5IYC G;  1QZH A;  4YWK A;  3HOW H;  5E4W C;  4OO1 G;  1V1P A;  3I4M G;  3M3Y H;  1PRT D;  2L9H A;  2MP1 A;  4LF7 Q;  1JE5 A;  2CWP A;  1JOR A;  4YWM A;  4CDC C;  3OW7 A;  2NVY H;  1SYC A;  4K0K L;  2G9D A;  3BJU A;  5J22 A;  3ERS X;  1SE4 A;  4ZRZ A;  4LFB L;  3ZJY C;  3I2Z A;  1GM5 A;  1AZQ A;  2JYO A;  2F0E A;  5FOB B;  1LTT D;  3C1F A;  5CV6 A;  2ZJP A;  1HR0 L;  4JI7 Q;  2LSS A;  1IXR A;  4EGV A;  1TWH H;  4GZY C;  1L1O A;  3D6C A;  2L15 A;  1EY9 A;  4BS9 A;  4RGO S;  3SGI A;  1E24 A;  5JJL A;  1K8O A;  4IUN A;  3CU7 A;  1A6X A;  1TR5 A;  4KY5 A;  4LF8 Q;  1M8A A;  1ESF A;  2RVL A;  4H44 C;  3K5M A;  2F0M A;  1JWM D;  1ASY A;  2LXJ A;  3I91 A;  1QNU A;  4HCS A;  5EKL A;  1E2W A;  1CT1 D;  1ET9 A;  4J6H A;  1H9S B;  4JI6 Q;  2OEO A;  5C3E H;  5IY0 A;  2VL6 A;  4DK1 A;  1PVO A;  3W2D A;  1YIJ A;  5ELB A;  4OGQ C;  3HOX G;  1DGS A;  3A7L A;  4RKL A;  3R2I A;  4IJH A;  4KKS A;  4DPG A;  1SJE D;  1CQV A;  2WB1 G;  1PTO F;  1FJG Q;  3EN2 A;  2Q2T A;  4CJ2 C;  4AYB G;  2RDF A;  1RL2 A;  4DAY B;  4ZUI A;  4CDD C;  1K3B C;  1SLJ A;  3FKI G;  4KKT A;  2B2Y A;  1X32 A;  2E75 C;  1N32 Q;  5C5L A;  1FL0 A;  1WD0 A;  4GN5 A;  2VS1 A;  1Z9F A;  3AMU A;  4YY3 L;  4DR7 Q;  3PIO A;  2ID0 A;  3RNU A;  3EIV A;  2A19 A;  4I7A A;  3GTG B;  1UUP A;  4GKK L;  5C0X H;  3K6O A;  1L0W A;  1SDF A;  4A3E H;  3CKI B;  1Y1W B;  1EOV A;  5I9O A;  4M8A A;  1GUW A;  2F4V L;  2N3S A;  2DY7 A;  1LT4 D;  3GTK B;  3OWE B;  2HCI A;  5D3I B;  1HNW Q;  3C46 A;  2XNA C;  4XDX A;  4FF2 A;  3RR5 A;  4IFD H;  3FMC A;  2K7V A;  1CM9 A;  5G3L D;  5M3M B;  3I56 A;  3VA5 A;  3H3V I;  2KHI A;  1EZ6 A;  4IJL A;  2F3I A;  2JQO A;  5IYD G;  3SR1 A;  3LWE A;  1K83 B;  3IAY A;  3H15 A;  5J1Z A;  3SE0 A;  1XMO L;  3CQZ H;  4R4Q A;  1CFM A;  2VUM G;  3S16 B;  3D6W A;  3P1H A;  1QVC A;  4A3C G;  1DYQ A;  2UU9 L;  1HZ9 A;  4QIW E;  2Q8T A;  4EX5 A;  2F0Q A;  3L3O C;  1SMY D;  4DK6 C;  3KFU A;  1PH2 A;  3CCS A;  1Q8K A;  2O5I C;  3A5Z B;  3EVQ A;  5C6A A;  1I94 Q;  3UI2 A;  2Q8I B;  3EA6 A;  2X6L A;  4ODG A;  2KCC A;  2MFI A;  4XXE A;  4N8X 1;  1I5F A;  2ASB A;  2SEB D;  2EYH A;  3GTM H;  4P75 A;  1XTD A;  4G4K A;  2Y0S G;  3KJO A;  5HUR A;  3J7Z C;  2M9V A;  4HSP A;  1D6E C;  5ELO A;  1E3P A;  4DR3 Q;  1PZK D;  3J80 c;  3EFX D;  3A8I E;  1VQE A;  4HR7 B;  2LS0 1;  4LFA Q;  4NXN L;  4DA2 A;  1BCP D;  3GTK H;  3HOZ B;  4F8M A;  1W6J A;  2K75 A;  2RBM A;  4JI3 L;  2MO1 A;  3RLN A;  2EZV A;  4KLK A;  3TRE A;  4C3H H;  4A3I B;  1XYI A;  1TWF H;  4OON A;  2FFK B;  2NVX B;  1R9T B;  2ZTD A;  2L12 A;  2X6G A;  4PMB A;  1NBW A;  3T53 B;  4CJ0 B;  3CME A;  1HPC A;  3T1Y Q;  2PZW A;  1UEB A;  4ME3 A;  1K83 H;  4XYQ A;  2HIX A;  4MIU A;  1R4Q B;  2F03 A;  2R7Z B;  2K14 A;  3ND9 A;  5IGC A;  3GP7 A;  1IBL Q;  3S16 H;  1SNP A;  4B3T L;  3TS0 A;  3GTQ B;  5ELF A;  2JK8 A;  3TP6 A;  2NN6 G;  1C4Q A;  1IYV A;  1XPO A;  5IGE A;  1LTS D;  2N55 A;  1QUQ A;  1RTN A;  1KLU D;  1G8Z D;  5ISR A;  1F9P A;  2AHO B;  4JW0 A;  3NUC A;  1AEX A;  2JA7 G;  3QB3 A;  1SRU A;  4ZQ3 A;  4X3U A;  1Y1V G;  2OF1 A;  1X9N A;  2CCZ A;  4DNT B;  3S17 B;  1F2Z A;  2NTT A;  5COR A;  1JR0 D;  3BZC A;  2ZTC A;  4AH6 A;  1PH1 A;  4WJ4 A;  1KTK A;  2CW0 C;  2HCC A;  4A75 A;  3NK9 A;  5CV8 A;  3BVZ A;  3TP7 A;  2L5T A;  1E0B A;  1F9S A;  5JEA J;  1VQ6 A;  3CC2 A;  2EVB A;  4B3M Q;  3S14 H;  4DV2 L;  3OHX C;  4GNX C;  1XMQ Q;  1BNZ A;  1FD7 D;  4KHV A;  4AIM A;  3J7A V;  3S1R H;  2EY2 A;  3G7L A;  2PW7 A;  3L9A X;  4DR6 L;  4N9T A;  4JI4 Q;  1DOK A;  3OMC A;  1PH5 A;  1Q12 A;  1JOK A;  4DR1 L;  4MHE A;  1NUC A;  3DLL A;  5GAG C;  1WTQ A;  3I90 A;  4B3S L;  5CBE E;  1ILP A;  1HCZ A;  2B63 H;  4JI1 Q;  1SN8 A;  3UE1 A;  2EYL A;  1SFO B;  1VQB A;  1SYF A;  3H0G H;  3MEF A;  4H02 A;  2ZM6 L;  1HHV A;  5LL6 S;  4A3F G;  1CKM A;  1JT8 A;  2A68 C;  2D0P A;  1E2V A;  4FP5 D;  5FLX E;  4A3J H;  1ENA A;  1UNS A;  2E2D C;  5IP7 H;  2RHS B;  2JA6 B;  1HUM A;  3OIQ A;  5H1S E;  4IUU A;  3RLF A;  1X3F A;  3K81 C;  3HS0 C;  4A3K H;  4QGU A;  3WOF A;  1CKN A;  5DAU A;  3IRB A;  3H94 A;  1PLF A;  1VQC A;  3D3R A;  2SNS A;  3KBX A;  4A3G H;  4K5V A;  2V4D A;  3CMA A;  1SRO A;  4PNY A;  5KND A;  4GNX B;  4BBR G;  1G2S A;  2K1B A;  1F9R A;  4AQY Q;  2EYJ A;  2F1M A;  2ALY B;  1EEI D;  1I4G A;  2HDL A;  4LAA A;  4KTA A;  1CSP A;  4JBJ A;  2WB1 E;  2WKD A;  4JPB W;  3NEL A;  2VY3 A;  4AYB E;  5LHY 1;  2B29 A;  1D1K A;  5I4D A;  1ENC A;  4JI8 L;  5E1F A;  4ME5 A;  4O0A A;  1I6V C;  3H3V H;  5JAV A;  5COY A;  2OTL A;  2NVQ B;  2J4X A;  2VQF Q;  2L0C A;  2ZXP A;  3NEN A;  1BO0 A;  1JIC A;  2XRS D;  4WRD A;  2EDG A;  4JCV E;  4PG3 A;  4OX9 Q;  1B2T A;  1CSQ A;  5FKA C;  4YWL A;  4DUY Q;  1KLG D;  1SYE A;  1Z47 A;  4YCV A;  2I07 B;  3KF6 A;  3R8B A;  1GHJ A;  1PFS A;  1EOT A;  3OW2 A;  1SFO H;  2R92 H;  1CKO A;  1EWC A;  2RSN A;  3CPF A;  3CCE A;  1A15 A;  3T1H Q;  3BYT B;  1EY8 A;  1NCV A;  3KLR A;  2E5L Q;  2AUJ D;  4RH6 A;  4IUR A;  3RZD B;  2EXD A;  4UP8 A;  4BY7 B;  2B2W C;  2QKI C;  1VQD A;  3NEM A;  3HZX A;  5IGG A;  3VA7 A;  3P7J A;  1VQA A;  5FJ8 H;  2WAC A;  5E7N A;  2J0T D;  1I4P A;  2R6G A;  3Q6S A;  1IZ6 A;  5D14 A;  1VQO A;  5C4X B;  4KHP L;  2OTJ A;  1X54 A;  3M4P A;  3J80 L;  2ENB A;  5M3F H;  4HIK A;  4LMQ D;  4IPH A;  4POG A;  1I4Q A;  3A74 A;  4DFA A;  1XTC D;  4TSS A;  3FDT A;  5IT9 E;  3QG1 A;  2B2U C;  2QDL A;  2RDG A;  1SXT A;  3AFP A;  3BDO A;  3Q8D A;  2YU9 H;  1AP0 A;  4RAU C;  3PSI A;  5AJ3 L;  4GKJ Q;  5FO8 B;  3SXH A;  3D0F A;  3T16 A;  1PA6 A;  2E2J B;  3JC6 6;  1WCM B;  1S72 A;  4A3L H;  2VQE L;  1O7I A;  1EY6 A;  3BVM A;  3DM1 A;  1I3Q B;  3PUV A;  2JA5 B;  2NVQ H;  3M4O H;  1HNX Q;  4APV A;  1U9R A;  4LF9 Q;  1CA5 A;  1YI2 A;  5M5Y B;  2CVR A;  4XQJ A;  4WOR A;  5GRO A;  1A62 A;  4R4O A;  2MNA A;  4O42 A;  1HZB A;  1KAB A;  5EJW A;  5C0X G;  2Y0S E;  1QOH A;  2Q2U A;  1F77 A;  2F0G A;  4U68 A;  1SE8 A;  1U4L A;  1NE3 A;  3AEV A;  1N8R C;  4ABN A;  4BY7 H;  1I4R A;  2NTS A;  1PH8 A;  1EWI A;  4NXM Q;  2UXC Q;  2LMC B;  4DR7 L;  2BH8 A;  2JE6 I;  1U4R A;  3OIP A;  5KGU A;  1CQF A;  3DM3 A;  4LF6 L;  2B8F A;  2E74 C;  5I6Y A;  2Z1C A;  1MSG A;  2EJF C;  4DR5 Q;  3NSW A;  5C4X H;  4OWX B;  4A3B H;  4Y52 H;  3PO2 B;  3PIO 3;  1X6O A;  1Y69 U;  4BBS H;  5HGT A;  2MPM A;  3HOY H;  2A8V A;  1MJE A;  4RGT A;  3M4Y A;  4BY1 H;  1IW7 C;  2A6E C;  3GTL B;  3CC4 A;  1HUN A;  1S5F D;  4DR4 Q;  2HIV A;  2YTX A;  1E7Z A;  3EJI A;  1CI3 M;  3A56 A;  2QIL A;  1QUQ B;  2R93 H;  4XT3 B;  2E2J H;  3WWV A;  1Z7T A;  4DV5 Q;  1NNX A;  2PMZ E;  4DV7 Q;  2UXD L;  1I3Q H;  5C44 H;  2WKC A;  1MI2 A;  3NBH A;  1JB3 A;  1HFG A;  2HHH L;  4MN3 A;  1PDQ A;  5CV4 A;  4TRD A;  5M5Y H;  1BBX C;  3QR8 A;  2NZO A;  4IPG A;  1NMF A;  2N8N A;  3DMU A;  1C0A A;  1IBM Q;  2K5W A;  3W1G A;  1BF4 A;  5M5X H;  5KYL A;  4JBM A;  4YCW A;  2WV6 D;  1EQT A;  2EY6 A;  4Q0F A;  2BE5 C;  4FDB A;  1Y1W G;  1NTG A;  1QVG A;  3NTH A;  2TSS A;  1D7Q A;  3I4N B;  4Y7N B;  2Z6K A;  4NPS A;  4EQO A;  1SNQ A;  1I94 L;  2DY8 A;  1PXU A;  2IHE A;  4QUF A;  4FF1 A;  3DUZ A;  3QJY A;  2IHF A;  4C56 C;  2ZXO A;  4MTN A;  1EUJ A;  3R2T A;  1M90 C;  4L5R C;  5GAH C;  1D8L A;  1U5K A;  5FLM H;  1S5B D;  1TKW B;  3HOW B;  1MGS A;  1B70 B;  2RDH A;  4IFD I;  4L6T B;  4N8F A;  1IYJ B;  4JI5 L;  4YIJ A;  5M3M G;  1X3G A;  3U9O A;  4X66 L;  3KDF A;  3KOJ A;  5TSS A;  1ZEQ X;  2R7F A;  5IYB H;  2PQA A;  1K73 C;  4U67 3;  4LF4 L;  4B3R Q;  4ZYS A;  2RHQ B;  2K52 A;  4HJ8 A;  1GUG A;  1TT2 A;  2TMP A;  1ZYR D;  5M9O A;  2BA1 A;  2YTV A;  4QCL A;  2H1E A;  4FXG C;  3L7Z C;  1BXT A;  3RN2 A;  1TWH B;  4GOP C;  1VS0 A;  2CHB D;  2D0O A;  3BDL A;  4A3D H;  5GAE C;  4DV6 Q;  3PIP A;  2F3W A;  3CW2 C;  1PH9 A;  2KEC A;  3I72 A;  3N6R A;  2KCN A;  2HQE A;  3K0Y A;  3U50 C;  1EEF D;  3CP0 A;  3S1Q H;  5CBA E;  3PUX A;  3HOV H;  3I4L A;  3ERO A;  4R4I A;  4DUZ Q;  1ESR A;  1YNX A;  2D9U A;  2D2C C;  1ML0 D;  1HZA A;  2HD3 A;  3TSS A;  2GN5 A;  1PFN A;  3I4N H;  1SR3 A;  2E2H H;  2B2V A;  4JOI A;  3HOZ G;  1KIX A;  2UXB L;  2J7Z A;  2LFN A;  2NYZ D;  5C3E B;  1TWC H;  3MVV A;  1XNR L;  2K5Q A;  1KAW A;  3PGZ A;  3RD4 A;  2PZT A;  4A3I G;  3KF6 B;  4MNO A;  4QF4 A;  1VQG A;  2UUA Q;  2QEX A;  4JVZ A;  1STB A;  4EQ5 A;  4JYA L;  1STH A;  1YNJ D;  2LXK A;  4ZKC B;  3NBI A;  4J15 A;  4GOP B;  2F4I A;  1YBY A;  4RMF A;  3OOC A;  2R7Z G;  3U4Z A;  4UP9 A;  4ULL A;  3ZYY X;  3J81 j;  3PO3 H;  2LY7 A;  4CKE A;  4PZ8 A;  1I6H H;  5ELC A;  1E2Z A;  3GTJ H;  1QB5 D;  1YEZ A;  1Y8O B;  2IWH A;  1K8G A;  4A3E B;  2JSO A;  1TVX A;  2KCT A;  3JAM E;  1TS2 A;  4XYO A;  3M7N A;  1JCK B;  2F0W A;  5I2Y A;  4HSV A;  5LMN W;  5K36 G;  1EU4 A;  4QY7 A;  5LMN L;  1RIP A;  1N33 Q;  2PI2 E;  2A74 C;  1HQR D;  1VQF A;  1VMC A;  1KRT A;  1VQ9 A;  4P2C B;  3E6Z X;  4CKB A;  1KC8 C;  3CQZ B;  2QCP X;  1J5E Q;  3ER0 A;  2UUC Q;  2Z8L A;  4KJN A;  5FO7 B;  1YJ9 A;  2PZU A;  1LTB D;  3BDC A;  3GTO H;  3KF8 A;  1Y8P B;  1VF5 C;  5EPJ A;  2V1C C;  3T51 B;  1RDP D;  3VR3 A;  1D5Z C;  3TP8 A;  1G6Z A;  3E9H A;  2JA6 G;  4OO1 I;  1TXY A;  2DNE A;  3R93 A;  5CGK A;  5FJ8 G;  1V9P A;  1STN A;  1EYG A;  4LJZ C;  4L8J A;  3LNN A;  1HJP A;  4RHS A;  4RFB A;  5E4X A;  4HIM A;  2A5H A;  3GTM B;  2AWO A;  3PMF A;  1AE2 A;  3CCV A;  5DNF A;  3C1E A;  5KNC A;  4DN4 M;  4GN4 B;  1XPR A;  3NTI A;  2Q8R E;  3QOL A;  3BG3 A;  1IL8 A;  4J8Q A;  1F2L A;  2XWJ B;  1DOL A;  2XVS A;  3OMG A;  4RCN A;  2F0I A;  3TS2 A;  4CGY B;  3J7A 5;  4C3H B;  4PZ6 A;  4RCO A;  1JWU D;  2ICE C;  2ICI A;  1TWF B;  4O2D A;  3MXP A;  4RA8 A;  3NBH B;  1IBK Q;  4F87 A;  4LFC L;  1DOM A;  3FVQ A;  3IFT A;  4DAV A;  4A76 A;  3E3X A;  4CDF C;  4JK1 C;  3J80 i;  3URY A;  5LMU L;  1S40 A;  4O1N A;  2CFM A;  3MC0 B;  2XWB B;  3GV3 A;  3K8A A;  2N49 A;  1VQJ A;  4HAE A;  1U4M A;  2JJQ A;  3FP9 A;  4IUT A;  1VF7 A;  3I70 A;  3CRK C;  1X3Q A;  2PYK A;  4C3J H;  3CCU A;  3BZK A;  4DV0 L;  4NP5 A;  3W5O A;  2K5D A;  3TBI B;  1N36 Q;  4DV1 L;  2F0U A;  5IOD A;  4A93 B;  2NVT B;  3I55 A;  1WTR A;  1B4O A;  1B50 A;  4X62 L;  4E6I A;  1GD7 A;  1STE A;  3NQT A;  1PMR A;  1II3 A;  1MHW C;  2K5N A;  2DGY A;  3A7A B;  3FRP B;  2OQK A;  1GJX A;  1TWG B;  1PRT C;  3ITP A;  2ATW A;  1S5D D;  4DK3 C;  4X64 Q;  4RHR A;  5C4X G;  4QB4 A;  1C7Y A; 
#chains in the Genus database with same CATH homology
 5A2Q E;  1SSO A;  3AB9 A;  3HKZ B;  1CHQ D;  3S14 B;  4PQX A;  4DAP A;  2RA4 A;  3SK4 A;  1QJO A;  3S1M B;  3DWP A;  3S1R B;  2EE1 A;  2MUY A;  3O13 A;  1IYU A;  4V19 0;  1Q90 A;  2OT2 A;  1LAB A;  3W3A A;  1QWY A;  5EPL A;  2B63 B;  3H3V C;  3A8J E;  2B2T A;  3CHB D;  1AZP A;  3H0G B;  5JJZ A;  3T13 A;  3F2U A;  4A3J B;  1HRJ A;  4ZKB B;  1Q8I A;  2A6H C;  4H13 C;  3K57 A;  1FNV A;  1G91 A;  5CR3 A;  4IUV A;  1PRT B;  4A3K B;  1RKN A;  4KY6 A;  1RTO A;  4G7O C;  1HA6 A;  2F3V A;  3S2H B;  4DXF A;  4A3G B;  4KK7 A;  1GUO A;  1V1P B;  1Z6H A;  2M2L A;  2YYZ A;  3SEB A;  1NSN S;  3NPP A;  3KUP A;  5T1I A;  4HED A;  1QIL A;  5KEE A;  4R8N A;  1EY0 A;  2XN9 C;  4NW2 A;  3RUZ A;  1G2T A;  4C1N I;  3VYR A;  3GTP B;  1SE2 A;  5NUC A;  3KLS A;  1GUN A;  3NP8 A;  2B2Y C;  2EYM A;  5JEA H;  2O5J C;  3BVG A;  1IKM A;  3DXJ C;  5D65 A;  3T56 B;  2R92 B;  2BDN A;  5IOC A;  3A54 A;  1QG7 A;  4X3T A;  4OO1 H;  5T1G A;  4LK1 C;  2IPK D;  1K8M A;  3J7Y W;  3GV6 A;  5EGT A;  1OXX K;  3WOE A;  4G7Z C;  5BN3 A;  1O7Y A;  3J81 E;  5M3F B;  2K33 A;  4ZAI A;  1BR9 A;  1FNU A;  3PIP 3;  2KEE A;  4QUC A;  4FO2 A;  3ND8 A;  2QEJ C;  3VR5 A;  5C5M A;  1RF2 D;  3VYS A;  2YU9 B;  2SNM A;  4F7X A;  1NR2 A;  3S9W A;  2A69 D;  4RWS C;  2XIW A;  1SMY C;  5IGD A;  3BS1 A;  3M4O B;  3H91 A;  5F2D A;  1PRT F;  3K5O A;  4OIK A;  2IT1 A;  2ZT9 C;  2B8G A;  4ID6 A;  1PTO D;  4K8J A;  4EQN A;  1PFM A;  3S1N B;  5LL6 X;  5CV5 A;  1L0X B;  1BCP C;  3KK7 A;  1GUT A;  2NZ1 D;  4EQP A;  2AQ1 B;  5I6W A;  1TII D;  2KJX A;  2NUC A;  4A3B B;  1ENF A;  4BBS B;  1GHK A;  3HOY B;  1EU3 A;  1YNN D;  3HOU B;  1WTO A;  1KNA A;  4BY1 B;  2Z4H A;  1LV9 A;  3OPO A;  2R93 B;  3RMH A;  4X3S A;  1C8C A;  2K03 A;  4HMI A;  1DM0 B;  3R3O A;  5C44 B;  3MXN A;  1DCZ A;  2H4O A;  1TS3 A;  2WAQ B;  3U9S A;  5IGF A;  1BCP B;  2KHS A;  1D5X C;  4DXG A;  5M5X B;  3TZD A;  1Q1E A;  2HUG A;  1JQY D;  3TZU A;  1NAP A;  5EBC A;  2AQ2 B;  4HMJ A;  2EXZ A;  1H9S A;  1MD2 D;  1LAC A;  1DZ1 A;  4TQU S;  1SNM A;  2K04 A;  1B53 A;  5BN5 A;  3QIA A;  1AN8 A;  4IFD G;  1EYD A;  4BWG B;  1SE3 A;  4DNR B;  2JEA I;  2EYP A;  4IUQ A;  3SHL A;  5E3F A;  4OHJ A;  2JP1 A;  1GUS A;  2NB0 A;  3VR2 A;  4ILW A;  4IUP A;  2RSO A;  1AW7 A;  4A3M B;  1WTW A;  1JOO A;  2IL8 A;  1LTR D;  4UAI A;  4H7B A;  1W6K A;  4A3D B;  1B3A A;  2PO4 A;  3NTK A;  1SNO A;  2F0T A;  3HGB A;  1PFB A;  4R8I A;  3S1Q B;  3HOV B;  5CC4 A;  2EJG C;  1RD9 D;  5DM7 3;  3ONA B;  1PZJ D;  3HP3 A;  1SYB A;  1I4X A;  1HTP A;  4NDX A;  2E2H B;  3IFD A;  4M1U B;  4S3S A;  2F0K A;  3D31 A;  1TWC B;  4A3F B;  2RKS A;  4C3H G;  1DXM A;  1STG A;  3K5L A;  1HA5 A;  4KI0 A;  1QCB D;  2L1B A;  2NN6 H;  2JEB I;  2KA7 A;  1A2U A;  1TS4 A;  2EPB A;  1T5X D;  3FEW X;  5FLX L;  1M4V A;  2GA4 B;  1WD1 A;  3PO3 B;  3C2P A;  1I6H B;  1A3T A;  3GTJ B;  1H9M A;  3DWA A;  1KDB A;  4G57 A;  2O4X A;  3IKJ A;  1TQO A;  4PMC A;  1GXD C;  4KN7 C;  1WTX A;  2D62 A;  4KD4 A;  1TY2 A;  4CHT B;  1U4P A;  1Q1B A;  1CA6 A;  2F0S A;  1JOQ A;  1JWS D;  1O80 A;  1EY7 A;  4V0B A;  4KN4 C;  5KRU A;  1TS5 A;  5D3D A;  1X3P A;  3P75 A;  2O2L D;  2A73 B;  2ZXR A;  1MSH A;  4H0L C;  3M85 A;  2EYF A;  1CZW A;  3SDZ A;  1LT6 D;  3DEP A;  3A55 A;  5JEA G;  3GTO B;  3DWQ A;  2IX1 A;  2AWN A;  2VB2 X;  3DHQ A;  4OL7 A;  1EFI D;  5KYI A;  2XSC A;  4HN7 A;  3H6M A;  3OSO A;  3LX0 A;  1B1Z A;  1DJR D;  5J39 A;  4DK0 A;  2F0J A;  4JBW A;  1MBY A;  1ONL A;  5IT9 L;  3NQI A;  5AFW A;  4ZUJ A;  3QOJ A;  3PUW A;  1PTO H;  3QWN A;  4B9X A;  1ET6 A;  3V96 A;  1STA A;  5K5P A;  3SVM A;  4IN3 A;  3N52 A;  2A6H D;  3K7A B;  4PMW A;  1HXY D;  5JPN C;  1O7Z A;  1J8I A;  2RQX A;  3D4W A;  3VYU A;  1RCV D;  4C3J B;  5C3X A;  1DD2 A;  4CBV A;  3MTS A;  4XQN A;  3OWF A;  1STY A;  4IAL A;  1S5C D;  1EYC A;  2E76 C;  4XT1 B;  4PV1 C;  3K59 A;  1JE4 A;  5CYU A;  1KDC A;  5CV9 A;  2VNU D;  1ZKO A;  4F88 A;  2CW0 D;  1KNE A;  3MWY W;  2PQE A;  2F0V A;  1SND A;  2L11 A;  4EVO A;  5C0X J;  1TWA B;  1CTM A;  4J1M A;  1KAA A;  1SEB D;  4QMG A;  1D2B A;  4RKB A;  1TU2 B;  3K58 A;  2VXW A;  4B9W A;  2IX3 A;  1SNC A;  3MAQ A;  1I50 B;  1ZYR C;  3HG9 A;  2HDM A;  2IX0 A;  3RZO B;  1RJT A;  2K6A A;  3PV0 A;  1D1I A;  4IFD J;  4C1N K;  3V05 A;  4QIW B;  1O7L A;  1J9O A;  1XX8 A;  3I73 A;  1UEA B;  3KBG A;  1F9Q A;  4X3K A;  3Q24 A;  2F0N A;  2A68 D;  3P20 A;  4BA2 I;  4KV6 A;  4OIJ A;  3D4R A;  1R4P B;  3VR6 A;  2JA8 B;  4KMU C;  2L4N A;  5EPK A;  2LKV A;  3VYT A;  1OXS C;  3J80 E;  3MHB A;  2JXM B;  4IZ8 A;  2E2I B;  4C3I B;  3D8G A;  3NWT A;  2EY5 A;  2OXP A;  1PZI D;  2K32 A;  4K5X A;  2WP8 J;  1EWH A;  2B2V C;  5JPM C;  1YNJ C;  1V8Q A;  1F2Y A;  5EKI A;  5M5W B;  4KHZ A;  1EL0 A;  4NKL A;  2MJ8 A;  1F2M A;  4C2M B;  1A3U A;  4XQQ A;  1EQV A;  4HCE A;  4L63 B;  1S4Z A;  2B2W A;  4DU9 A;  3GO5 A;  4FVM A;  2QDB A;  1OXU A;  3M7G A;  2R61 A;  4K2L A;  3SK6 A;  4BA1 I;  1VDZ A;  3Q23 A;  3I4M B;  3MEH A;  4K5W A;  2B2U A;  2KVM A;  4WFN 3;  1JC7 A;  3D4D A;  1LT3 D;  1WTV A;  1ZXT A;  3T4A C;  5CV7 A;  3S2D B;  4RGN A;  1IKL A;  1CK1 A;  2BDO A;  1FYC A;  4KD3 A;  3Q0A A;  4FF3 A;  3AU7 A;  1ICW A;  1H9K A;  3I3C A;  3V2T A;  1XXG A;  1NR4 A;  3MFY A;  4K8I A;  3EQL C;  1SBB B;  2F0H A;  4FXK C;  3G6J B;  5C4J B;  3IL8 A;  2D5D A;  1WTP A;  2X69 A;  3GQB A;  3JAM L;  5I9P A;  2F0L A;  3HEJ A;  1H9R A;  3SK8 A;  1Y8N B;  5ELE A;  3HOX B;  4NMZ A;  5CMD A;  2KED A;  3K5N A;  2WB1 B;  1VCI A;  2AQ3 B;  4AYB B;  1AFP A;  3FKI B;  2MGS A;  1IW7 D;  5EQ0 A;  2A6E D;  1BDO A;  2WIN B;  4XTC S;  1T5E A;  1ROD A;  3FPU B;  2NN6 I;  4CJ1 B;  1UAP A;  3TN2 A;  5C4Z A;  2Z4I A;  1B9M A;  2DN8 A;  4DF7 A;  1QE6 A;  1L0Y B;  3E0J A;  2EYO A;  3J7A F;  5K36 H;  4KY7 A;  2N88 A;  2BE5 D;  4UDU C;  2FMM A;  5A35 A;  2EJM A;  4B08 A;  3QO2 A;  1HTL D;  3VR4 A;  3SK5 A;  3MZ5 A;  2KOL A;  2I46 A;  3GD7 A;  5I2X A;  1DON A;  2PCF B;  1SJH D;  1A2T A;  3C3L A;  1EIG A;  3FPP A;  2VUM B;  2EOT A;  1V43 A;  1V1O A;  1HFN A;  4ZLT F;  1LTG D;  1GOZ A;  3MXU A;  4HTH A;  1BQQ T;  1FNW A;  3I8Z A;  2B2T C;  5DM6 3;  2XRQ D;  1EY4 A;  2AUK A;  1FGB D;  2Y0S B;  1ILQ A;  3X3N A;  1G29 1;  2QF7 A;  4K6L A;  2F0O A;  1OO9 B;  1Q3L A;  1PYW D;  4KKU A;  4FF4 A;  2NWG A;  4Z9C B;  4Q5V A;  2PNR C;  2EY1 A;  2PW5 A;  2BOS A;  5A2Q L;  2L55 A;  5FK9 C;  5JVG 3;  4K2K A;  1KDA A;  1EYA A;  1FR3 A;  1RHP A;  4XIG S;  3LWU A;  3S15 B;  3NE5 B;  3TP5 A;  2F0F A;  5KNB A;  1VMP A;  2CQA A;  2NBF A;  1LO5 D;  4FNF A;  2F0D A;  2FHT A;  5KIX A;  2PMZ B;  4ZK9 B;  2IJ0 A;  4DAY A;  2JA7 B;  4WJW A;  1Y1V B;  1IHZ A;  1LTA D;  1LTI D;  5G3L F;  4C3J G;  1H9J A;  4G7H C;  3WDN A;  2R3Z A;  2KQ3 A;  1OXT A;  2BCO A;  1HQM C;  3NWS A;  5BN4 A;  1BUV T;  1O78 A;  3PUZ A;  4I65 A;  2F0P A;  4KJO A;  4FYD A;  4IQZ A;  1BOS A;  1SAP A;  3MXG A;  1EZ8 A;  1SYD A;  3H09 A;  1B9N A;  2A69 C;  2PPB C;  1LLR D;  5IIF A;  2K01 A;  1LT5 D;  4K6D A;  1EY5 A;  2WII B;  2M00 A;  2VB3 X;  2SOB A;  5C0X I;  1CZG A;  3E5S A;  3HRZ C;  3ERQ A;  3TME A;  1CHP D;  1SYG A;  1PTO C;  5JOB A;  3PUY A;  5EBD A;  1BCP F;  3NHH A;  1C48 A;  3X3M A;  3MFG A;  4BBR B;  3M3Y B;  1WVL A;  4CKC A;  2IW3 A;  4DGZ A;  3CRL C;  2BA0 A;  1S5E D;  2NVY B;  2FJ2 A;  2C9O A;  4C3I G;  3J81 L;  3DEO A;  5ELD A;  1D5M C;  1TY0 A;  2DNC A;  2FMC A;  3Q22 A;  5JVH 3;  1YNN C;  1OXV A;  2K28 A;  2SDF A;  2C5C A;  2K05 A;  5IGB A;  2KUM A;  4RGM A;  5FO9 B;  1I4H A;  1PTO B;  3TDQ A;  5C3W A;  2B39 A;  4I7Z C;  4R9W A;  5DEH A;  1XWE A;  3KLS X;  1QNK A;  2G9H D;  3NXW A;  1EIH A;  4TKO B;  3MA2 B;  4N9P A;  2FIN B;  2MHV A;  3BYY B;  5EKK A;  1B44 D;  4FXD A;  3BZD B;  1A3V A;  5C4H A;  4K14 A;  3A8K E;  5E4W C;  4OO1 G;  1V1P A;  1PRT D;  2L9H A;  2MP1 A;  1JOR A;  3OW7 A;  1SYC A;  2G9D A;  5J22 A;  1SE4 A;  4ZRZ A;  1AZQ A;  2JYO A;  2F0E A;  5FOB B;  1LTT D;  3C1F A;  5CV6 A;  4EGV A;  4GZY C;  3D6C A;  1EY9 A;  4BS9 A;  4RGO S;  1K8O A;  4IUN A;  3CU7 A;  1A6X A;  1TR5 A;  4KY5 A;  1M8A A;  1ESF A;  2RVL A;  4H44 C;  3K5M A;  2F0M A;  1JWM D;  3I91 A;  1QNU A;  4HCS A;  5EKL A;  1E2W A;  1CT1 D;  1ET9 A;  4J6H A;  1H9S B;  2OEO A;  4DK1 A;  3W2D A;  5ELB A;  4OGQ C;  3A7L A;  4RKL A;  3R2I A;  4KKS A;  1SJE D;  1CQV A;  1PTO F;  4CJ2 C;  2RDF A;  4ZUI A;  4KKT A;  2B2Y A;  1X32 A;  2E75 C;  5C5L A;  1WD0 A;  3AMU A;  2ID0 A;  3GTG B;  1UUP A;  5C0X H;  3K6O A;  1SDF A;  3CKI B;  1Y1W B;  5I9O A;  4M8A A;  1GUW A;  2DY7 A;  1LT4 D;  3GTK B;  3OWE B;  2HCI A;  5D3I B;  3C46 A;  2XNA C;  4XDX A;  4FF2 A;  4IFD H;  3FMC A;  2K7V A;  1CM9 A;  5G3L D;  5M3M B;  3VA5 A;  1EZ6 A;  3SR1 A;  3LWE A;  1K83 B;  3IAY A;  5J1Z A;  3SE0 A;  1CFM A;  3S16 B;  3D6W A;  3P1H A;  1DYQ A;  2Q8T A;  2F0Q A;  3L3O C;  1SMY D;  2O5I C;  3EVQ A;  5C6A A;  3UI2 A;  2Q8I B;  3EA6 A;  2X6L A;  4ODG A;  2KCC A;  4XXE A;  2SEB D;  2EYH A;  4G4K A;  5HUR A;  2M9V A;  4HSP A;  1D6E C;  1PZK D;  3EFX D;  3A8I E;  4HR7 B;  2LS0 1;  4DA2 A;  1BCP D;  3HOZ B;  4F8M A;  1W6J A;  2RBM A;  2EZV A;  4A3I B;  1XYI A;  2FFK B;  2NVX B;  1R9T B;  2L12 A;  2X6G A;  4PMB A;  3T53 B;  4CJ0 B;  1HPC A;  2PZW A;  4XYQ A;  4MIU A;  1R4Q B;  2F03 A;  2R7Z B;  3ND9 A;  5IGC A;  3GP7 A;  1SNP A;  3GTQ B;  5ELF A;  3TP6 A;  2NN6 G;  1C4Q A;  1IYV A;  5IGE A;  1LTS D;  2N55 A;  1RTN A;  1KLU D;  1G8Z D;  5ISR A;  1F9P A;  3NUC A;  1AEX A;  3QB3 A;  4ZQ3 A;  4X3U A;  2OF1 A;  4DNT B;  3S17 B;  1F2Z A;  2NTT A;  5COR A;  1JR0 D;  1KTK A;  2CW0 C;  2HCC A;  3NK9 A;  5CV8 A;  3BVZ A;  3TP7 A;  2L5T A;  1E0B A;  5JEA J;  1F9S A;  2EVB A;  3OHX C;  1BNZ A;  1FD7 D;  4KHV A;  3J7A V;  2EY2 A;  3G7L A;  2PW7 A;  3L9A X;  4N9T A;  1DOK A;  3OMC A;  1Q12 A;  1JOK A;  4MHE A;  1NUC A;  1WTQ A;  3I90 A;  5CBE E;  1ILP A;  1HCZ A;  1SFO B;  2EYL A;  1SYF A;  1HHV A;  5LL6 S;  2A68 C;  5FLX E;  1E2V A;  4FP5 D;  1ENA A;  1UNS A;  2E2D C;  2JA6 B;  1HUM A;  3OIQ A;  4IUU A;  3RLF A;  3HS0 C;  3WOF A;  5DAU A;  3H94 A;  1PLF A;  3D3R A;  2SNS A;  3KBX A;  4K5V A;  2V4D A;  4PNY A;  5KND A;  1G2S A;  2K1B A;  1F9R A;  2EYJ A;  2F1M A;  4LAA A;  1EEI D;  1I4G A;  2HDL A;  4KTA A;  2WKD A;  5LHY 1;  1D1K A;  5I4D A;  1ENC A;  5E1F A;  4ME5 A;  1I6V C;  5JAV A;  5COY A;  2NVQ B;  2J4X A;  2L0C A;  2ZXP A;  1BO0 A;  1JIC A;  2XRS D;  4WRD A;  2EDG A;  1B2T A;  5FKA C;  1KLG D;  1SYE A;  1Z47 A;  2I07 B;  3R8B A;  1GHJ A;  1EOT A;  1EWC A;  2RSN A;  1A15 A;  3BYT B;  1EY8 A;  1NCV A;  3KLR A;  2AUJ D;  4RH6 A;  4IUR A;  3RZD B;  4BY7 B;  2B2W C;  2QKI C;  5IGG A;  3VA7 A;  3HZX A;  3P7J A;  2WAC A;  2J0T D;  1I4P A;  2R6G A;  3Q6S A;  5D14 A;  5C4X B;  3J80 L;  2ENB A;  4LMQ D;  1I4Q A;  4DFA A;  1XTC D;  4TSS A;  3FDT A;  5IT9 E;  3QG1 A;  2B2U C;  2RDG A;  1SXT A;  3BDO A;  1AP0 A;  4RAU C;  5FO8 B;  3SXH A;  3T16 A;  2E2J B;  1WCM B;  1EY6 A;  3BVM A;  3DM1 A;  1I3Q B;  3PUV A;  2JA5 B;  1U9R A;  1CA5 A;  5M5Y B;  2CVR A;  4XQJ A;  4WOR A;  4O42 A;  1KAB A;  5EJW A;  5C0X G;  1QOH A;  1F77 A;  2F0G A;  4U68 A;  1U4L A;  4ABN A;  1I4R A;  2NTS A;  2LMC B;  2JE6 I;  1U4R A;  3OIP A;  5KGU A;  1CQF A;  2B8F A;  2E74 C;  5I6Y A;  2Z1C A;  1MSG A;  2EJF C;  3NSW A;  3PO2 B;  3PIO 3;  1Y69 U;  5HGT A;  2MPM A;  4RGT A;  3M4Y A;  1IW7 C;  2A6E C;  3GTL B;  1HUN A;  1S5F D;  3EJI A;  1CI3 M;  3A56 A;  2QIL A;  4XT3 B;  1Z7T A;  2WKC A;  1MI2 A;  3NBH A;  1JB3 A;  1HFG A;  4MN3 A;  1PDQ A;  5CV4 A;  4TRD A;  1BBX C;  3DMU A;  2K5W A;  1BF4 A;  5KYL A;  2WV6 D;  1EQT A;  2EY6 A;  4Q0F A;  2BE5 C;  3NTH A;  2TSS A;  3I4N B;  4Y7N B;  4EQO A;  1SNQ A;  2DY8 A;  1PXU A;  4QUF A;  4FF1 A;  3DUZ A;  3QJY A;  4C56 C;  2ZXO A;  3R2T A;  1S5B D;  1TKW B;  3HOW B;  1MGS A;  2RDH A;  4IFD I;  4L6T B;  4YIJ A;  3U9O A;  5TSS A;  1ZEQ X;  4U67 3;  4ZYS A;  1GUG A;  1TT2 A;  2TMP A;  1ZYR D;  5M9O A;  2BA1 A;  4QCL A;  2H1E A;  4FXG C;  3L7Z C;  1BXT A;  1TWH B;  2CHB D;  3BDL A;  2F3W A;  2KEC A;  3I72 A;  3N6R A;  2KCN A;  2HQE A;  3K0Y A;  1EEF D;  5CBA E;  3PUX A;  3I4L A;  3ERO A;  1ESR A;  2D9U A;  2D2C C;  1ML0 D;  3TSS A;  1PFN A;  2B2V A;  2J7Z A;  2LFN A;  2NYZ D;  5C3E B;  3MVV A;  2K5Q A;  3RD4 A;  2PZT A;  4QF4 A;  1STB A;  1STH A;  1YNJ D;  4ZKC B;  3NBI A;  2F4I A;  3OOC A;  4ULL A;  3ZYY X;  2LY7 A;  4CKE A;  5ELC A;  1E2Z A;  1QB5 D;  1Y8O B;  2IWH A;  4A3E B;  2JSO A;  1TVX A;  3JAM E;  1TS2 A;  4XYO A;  3M7N A;  1JCK B;  2F0W A;  5I2Y A;  4HSV A;  5K36 G;  1EU4 A;  2A74 C;  1HQR D;  1VMC A;  4P2C B;  3E6Z X;  4CKB A;  3CQZ B;  2QCP X;  2Z8L A;  4KJN A;  5FO7 B;  2PZU A;  1LTB D;  3BDC A;  3KF8 A;  1Y8P B;  1VF5 C;  5EPJ A;  3T51 B;  1RDP D;  3VR3 A;  1D5Z C;  3TP8 A;  1G6Z A;  4OO1 I;  2DNE A;  3R93 A;  5CGK A;  1STN A;  4LJZ C;  4L8J A;  3LNN A;  4RHS A;  4RFB A;  5E4X A;  2A5H A;  3GTM B;  2AWO A;  3PMF A;  5DNF A;  3C1E A;  5KNC A;  4DN4 M;  3NTI A;  2Q8R E;  3QOL A;  3BG3 A;  1IL8 A;  4J8Q A;  1F2L A;  2XWJ B;  1DOL A;  2XVS A;  3OMG A;  4RCN A;  2F0I A;  4CGY B;  4C3H B;  4RCO A;  1JWU D;  2ICE C;  2ICI A;  1TWF B;  3MXP A;  4RA8 A;  4F87 A;  1DOM A;  3FVQ A;  3IFT A;  4DAV A;  4JK1 C;  3URY A;  4O1N A;  3MC0 B;  2XWB B;  3GV3 A;  4HAE A;  1U4M A;  4IUT A;  1VF7 A;  3I70 A;  3CRK C;  1X3Q A;  2PYK A;  4NP5 A;  2K5D A;  3TBI B;  2F0U A;  5IOD A;  4A93 B;  2NVT B;  1WTR A;  1B4O A;  1B50 A;  4E6I A;  1STE A;  3NQT A;  1PMR A;  1II3 A;  3A7A B;  3FRP B;  1GJX A;  1TWG B;  1PRT C;  3ITP A;  1S5D D;  4RHR A;  4QB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...