1C8CA

Crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLAKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the chromosomal proteins Sso7d/Sac7d bound to DNA containing T-G mismatched base-pairs.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*TP*GP*AP*TP*CP*GP*C)-3'
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2000-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c8cA00
3N52A 1G91A 1X3PA 1F9SA 2B2VC 2HCIA 3FDTA 1HFGA 2KEEA 1EOTA 1BBXC 2FJ2A 2K1BA 1Q3LA 4QUCA 1AZPA 2MPMA 1B2TA 4O42A 1U4MA 1S4ZA 2VXWA 2K01A 3G7LA 3MTSA 1DZ1A 1J9OA 1ML0D 2CVRA 2R3ZA 4LMQD 4ZLTF 1C8CA 2SDFA 1PDQA 1ICWA 2HDLA 1NR2A 5CBEE 4ZAIA 1VMPA 2B2WC 2K05A 1HA6A 1HUMA 4ZKCB 1SDFA 1AP0A 1F2LA 4IUQA 4NW2A 1GUWA 2B2UC 2J7ZA 2B2WA 1RJTA 2K28A 4R9WA 5T1IA 1WTPA 4ZK9B 1O80A 2B2YC 4QUFA 5CMDA 1JICA 2L12A 3I90A 5CORA 4R8IA 3DEOA 1LV9A 1EIGA 2Q8TA 1WTOA 2EE1A 1KNAA 1VMCA 4X3UA 2L4NA 1HHVA 1WTQA 3GV6A 5EPKA 1XX8A 3DM1A 1A15A 3R93A 3ONAB 5T1GA 1DONA 1RTNA 1M8AA 2MGSA 1PLFA 1BNZA 1MSGA 1WD1A 5EPJA 5CBAE 1XYIA 3H91A 1HUNA 2FINB 1O7ZA 3IL8A 1QNKA 3HP3A 4HSVA 1DOLA 1SSOA 2K04A 2RVLA 3I8ZA 3IFDA 4U68A 4IUVA 2H1EA 5EPLA 5E4XA 1MI2A 4X3TA 3F2UA 4MN3A 2N88A 1WTRA 1F9QA 2KVMA 2JP1A 3P7JA 2FFKB 2JYOA 5EQ0A 1WVLA 2L11A 1MSHA 2N55A 1RTOA 1F9RA 2KECA 4HAEA 4RWSC 1WTWA 3D6WA 1PFBA 2B2YA 2Q8RE 1DOMA 2FHTA 4MHEA 5D65A 2B2TC 2X6GA 3DEPA 1ILQA 4CJ2C 2MP1A 1NCVA 1O7YA 5EJWA 2X69A 4RAUC 3SVMA 1QG7A 2RSOA 1WD0A 1RODA 2DY7A 1IKMA 1PFNA 1X32A 1PFMA 4XDXA 2XIWA 5EKIA 2D9UA 1NR4A 4OIKA 2KUMA 3I91A 1G6ZA 3GV3A 1KNEA 1IL8A 2FMMA 1EL0A 4X3SA 1DOKA 1E0BA 1BF4A 4IUUA 2NWGA 1NAPA 2RA4A 2B2VA 2DY8A 3MWYW 1F9PA 1SAPA 2MJ8A 4HCSA 4UAIA 2HDMA 4IUPA 1BO0A 3QO2A 1WTXA 1G2SA 1U4PA 2EPBA 1CA5A 1CA6A 4ZKBB 3I3CA 1ILPA 4IURA 5D14A 1ESRA 2NYZD 3LWEA 4HEDA 1U4RA 1HRJA 2KEDA 4XT3B 2M2LA 2KOLA 4OIJA 3UI2A 1EQTA 1B50A 1B53A 1QE6A 1G2TA 1U4LA 2L9HA 1X3QA 3KUPA 4XT1B 5COYA 1MGSA 2L1BA 3Q6SA 4X3KA 4IUTA 4DN4M 3TN2A 2BDNA 1EIHA 1J8IA 1ZXTA 3TZDA 5JJZA 3KBXA 4RA8A 2HCCA 1B3AA 1HFNA 2HUGA 2NZ1D 2RSNA 5DNFA 4CJ0B 1WTVA 2B2UA 2EOTA 4CJ1B 1RHPA 1AZQA 2B2TA 1B4OA 1CM9A 5AFWA 1IKLA 2IL8A 2X6LA 1JE4A 1TVXA 2K03A 3FPUB 5E4WC
chains in the Genus database with same CATH superfamily
5I2XA 2PW5A 4TKOB 4K8JA 3GTQH 2VB3X 4DV1L 4UP7A 2SDFA 5IY0A 3F2CA 4BWGB 4A3IH 4F87A 5IYCG 4HSPA 1PTOH 1S40A 1GUWA 1LTTD 4L6TB 1LTLA 1K73C 1G8ZD 2JEAI 2CKZB 2R7DA 4IQZA 5G3LF 4QUFA 1KIXA 1SE2A 3ULJA 2R7ZG 1WCMG 2EQSA 3GTLH 3TZUA 1XTCD 3KF8B 1R9TH 1HHVA 3A7AB 4AYBB 4DUZL 2XTIA 4X62Q 2XSCA 4AYBG 1K8GA 2J4XA 3H91A 2OF1A 5IYBG 3ERSX 1VQ4A 2HHHL 4HSVA 4U68A 4BBRB 2IJ0A 3VR6A 4DAYB 2YU9H 3EN2A 4A3GH 1AH9A 1AE3A 1JR0D 2JP1A 3CAMA 1K3BC 2SOBA 2ZT9C 1VQOA 3D6WA 1HNZL 4MIUA 1JQYD 5C4JH 1F2YA 5JEAG 2UXBL 4KD4A 1KAAA 4ODGA 4HIKA 2SNSA 1QG7A 1FD7D 1H9KA 2XIWA 4IALA 1EY8A 2EXZA 3KJOA 2CQAA 4K2KA 2A1AA 4K0KL 2R6GA 1I4XA 4IJLA 1EL0A 1DOKA 2IY5B 1PTOB 2Q2IA 3K7UC 3HOWH 5KEEA 1B9NA 2LKVA 3KLWA 4LFCL 3BVGA 1IYUA 2MUYA 1G2SA 5FLXL 1L2FA 2PW7A 1GHKA 2NYZD 4XIGS 1VDZA 5IGBA 1QVCA 2F0EA 5IP7H 2NTSA 1TS2A 3D6CA 2L55A 3J81E 4OO1I 4POFA 4BY1B 4DXGA 3KLSA 3K57A 2R92H 2PMZE 1QILA 4RA8A 3GTQB 2RSNA 4L8JA 5C0XI 3J80c 4JYAQ 1NSNS 2RBMA 5DM63 4CJ1B 1ESFA 3RZDH 3I72A 1VQDA 3TS2A 1TS3A 2AWNA 3X3NA 1IBKQ 1A0IA 3N52A 4IOAA 3JC66 3CRLC 1B2TA 4QJFA 1KC8C 4C3IH 4G7HC 4IUNA 4DV6Q 2B8GA 5CV5A 2NTTA 3KOJA 2GVBA 1C7YA 2EY6A 3CCQA 4K5WA 5C5MA 1FJGQ 1STNA 1D1IA 3OWEB 2I5HA 4QF4A 4HN7A 1W6KA 1K8AC 4H7BA 5CORA 3A8IE 3MEFA 1EIGA 4GOPC 3BG3A 3QJYA 4DR6L 1YJ9A 1W6JA 4AIMA 5A2QE 3RZOB 3I73A 1SYDA 3JAML 2YTVA 1S5DD 4RFBA 3FRPB 3FP9A 2OEOA 2ZXPA 4A3LG 2I46A 1NNXA 2BDOA 4AQYQ 1QZGA 4CKEA 1TWAB 4RG1A 1A8VA 5EPLA 2VW9A 1N34Q 1MIUA 2VQFL 3BZDB 1K28A 5E3FA 1XJVA 1O78A 1SMYD 1MSHA 4A3CH 2F3WA 2EDGA 1I6VC 2YV5A 4UPAA 2F0LA 4JI1Q 4QY7A 5D3DA 3KLRA 4A3FB 2H4OA 1JORA 2B8FA 1RDPD 2X69A 4CGYB 3SVMA 1WD0A 1ZKOA 5C44G 3J81i 1SRUA 3TREA 1C4QA 3OIQA 1QZHA 3A7LA 1ET9A 1A6XA 5I2YA 2JK8A 4X66L 3QB3A 1VS0A 4B08A 2ASBA 1F9PA 4N8X1 1ILPA 4A3BB 1KLGD 3I2ZA 3GO5A 2UXDL 2F3VA 3IAYA 1U4RA 1QJOA 3ICEA 1CUKA 1SROA 2WB1B 2F0NA 1PRTF 4IN3A 4JI2Q 1C0AA 3LGJA 1NBWA 4KN4C 1RIPA 4YWLA 1CQFA 2R7ZH 4F88A 5M5YB 1LUZA 2A68C 4B3TQ 4LF6L 4L5RC 3A56A 2B2TA 3U4VA 4X65L 3IFTA 1FGUA 4DAVA 3PO3G 1I4PA 2F0TA 3M4PA 1KXLA 1PVOA 1XTDA 3NQTA 4RCOA 2FJ2A 2NUCA 2XN9C 3FHWA 1S4ZA 1X9NA 3K80C 1NR2A 3MZ5A 3SE0A 1AP0A 5C3XA 2ZJPA 4IUQA 2EY5A 1A3TA 2B29A 5CMDA 1NJIC 3DWQA 3CHBD 2K5QA 3CP0A 2F4VQ 3PUWA 4JI5L 3GTKB 1XMQQ 5EPKA 3PGZA 2ZJQA 1Y14B 3NK9A 3ITPA 3GTPB 1KAWA 4HCEA 1EZ8A 5CBAE 1Z9FA 1HH2P 4DK3C 3CRKC 3PUZA 2K04A 4NP5A 4DAPA 1X6OA 4OEMB 1TIID 2Z9HA 4XQNA 4DNRB 4X3TA 3F2UA 4MN3A 3FPPA 3S1MH 3R3OA 2WAQB 4JOIA 3K5NA 3S15B 1H9MA 1ILQA 2D62A 4KKSA 1D6EC 5JVH3 3S14H 1TWCH 4DV6L 3A0JA 5IGDA 3CXCA 4GKJQ 1HXYD 1G6ZA 1XNRL 3BDLA 2FMMA 4GNXB 1BQQT 4IUUA 1B9MA 5IT9L 1NAPA 1S5BD 1TKWB 2EXDA 4QGUA 1BO0A 4ZYSA 2GVAA 1PMRA 1YEZA 2B63B 4JI7L 2VUMB 2RCNA 2EZVA 2F0SA 4C2MB 1CKNA 5BN3A 1U4LA 3URYA 5COYA 2Y0SG 4C3HG 3E0JA 2A69D 4G57A 1B44D 4V0BA 2JA6H 4A3BH 1SBBB 1SYGA 1AW7A 1ZXTA 4IZ8A 1GUSA 1YI2A 2HCCA 3OIPA 4GZYC 2LMCB 5EGTA 1XWEA 1II3A 3GTOH 1N33Q 1LO5D 3OHXC 2JA5B 1D5XC 4YY3L 1W3SA 3F8TA 1E1TA 4JI4L 5GROA 5IE8A 1D7QA 5C3EB 2VXWA 2CVRA 2R3ZA 1B8AA 2KA7A 4UDUC 1C8CA 1EYGA 2HDLA 5C5LA 4PZ6A 2ZTDA 2O2LD 5JEAJ 2LXJA 4ID6A 3K0YA 1E3PA 3D4WA 4ZK9B 3CF5A 2NBFA 4JI0Q 1XNQL 2EYFA 1SNCA 1GHJA 2NZOA 4OWTB 5A2QL 2Q8TA 1L1OA 3QOLA 3W1BA 4IFDI 1HNXQ 4LF9Q 4A3FG 4CKBA 3TS0A 1XX8A 5GAEC 1RTNA 1DXMA 5JPNC 3ZJYC 4LAAA 1KQSA 3B6YA 2ALYB 2IW3A 1YNJD 3I8ZA 3ER0A 5EAYA 2FFKB 3M3YH 4XXEA 1EFID 1VQMA 2A5HA 4C3JG 2C9OA 4A3LH 1IYJB 1HJPA 3T1YQ 4BS9A 4A3JB 4PZ7A 4A3IG 3Q0AA 2ID0A 1IKMA 1OXTA 3MA2B 5E1FA 5ELFA 3NE5B 3AQQA 3I4MH 1S5CD 3VR3A 1BF4A 4H13C 5LL6S 3J7YW 2ZXRA 3S14B 1K83B 1LM0A 3HGBA 4KY6A 1UE7A 1H9SA 1VF5C 1NMGA 2Y0SB 5M5WB 3EA6A 4C3HB 1SR3A 2NN6I 2PNHA 1PH8A 1LTGD 3HOZH 3W1GA 5LMUQ 4F8MA 1IBML 4XT1B 3ND9A 1V1QA 5CV7A 1R9TB 4X3KA 4IUTA 4Y7NB 1N36Q 2EYOA 2WB1E 2ICEC 2AKWB 1STHA 3E0EA 3WDNA 4HIMA 4N9PA 2JE6I 1T9HA 3FPUB 3H3VH 3L7ZC 1LTSD 1PXUA 2B63G 2VUMG 3NUCA 1J5EL 3HOVH 2KEEA 4DUYL 3T53B 3GDEA 4CDDC 5J39A 1CK1A 3H6MA 2O4XA 1HUMA 2KCMA 4A93H 1SDFA 2JA5H 2EIFA 4G7OC 2OTJA 1I4GA 4R9WA 1WTPA 4FF4A 4L5SA 1O80A 2B2YC 3UDIA 1JCKB 4UY8C 2NVQB 2WIIB 1IBMQ 4RKBA 4DV5L 4GLAC 5F2DA 3S1QB 3CKIB 4X66Q 4LF4Q 1I3QB 2Z8LA 5M5WH 1A15A 5CV6A 3KK7A 1Y1WH 2MQHA 3BS1A 3J7ZC 3M7NA 1LT6D 5JVG3 1R4QB 2EJGC 1VQ7A 5EPJA 4BY1H 2WAQG 3RN2A 3BU2A 2FINB 3IFDA 4R8NA 3D3RA 4NPSA 2H1EA 4DAMA 3D8GA 1SJHD 1IW7C 1D5ZC 1TWCB 3I4OA 1F9QA 4DK0A 1L1OB 2E2IH 2QA4A 4K6LA 1PRTD 2EYPA 4Z9CB 5J3BA 5IGFA 1EY0A 1MKHA 2BA0A 1KDCA 4X65Q 4IFDH 1B1ZA 1QUQB 2Q2TA 3H94A 3OMCA 5K36G 4QL5A 4LF6Q 4OXPA 2KUMA 2ICIA 3AFQA 3M4YA 1X55A 2QKIC 3L0OA 4KY5A 2VQEQ 2K32A 3CC4A 3D31A 4C2MH 3BZCA 3MXUA 3UDGA 2IX3A 4KI0A 1JMCA 1OTCA 2R7FA 4KJOA 1FR3A 4XQJA 2KEDA 4IPGA 3PUVA 2F4IA 3AEVA 1B50A 3SK8A 1BUVT 2WP8J 1X3QA 1L0XB 2WKCA 3Q6SA 3PUXA 2K52A 4Y52H 1EIHA 1G51A 1K0SA 5C4ZA 1OXSC 3BVZA 4RKLA 1HFNA 1CHQD 3PMFA 4CJ0B 2NVXH 4FDBA 1F2MA 1AFPA 1VQHA 2C35B 2A6ED 2WB1G 2X6LA 4YCUA 3DUZA 4I7AA 4TSSA 5EKLA 5M5XB 1Q90A 1STGA 3M3YB 2E76C 1IBLQ 1FVIA 3H09A 3J81L 1EU4A 1U4MA 1QNUA 3W3AA 1NY4A 3QWNA 1DZ1A 3VDYA 4TQUS 2R93H 1PDQA 5CBEE 2GN5A 1EY6A 5J1ZA 5IODA 1F77A 3S1NH 3K8AA 1BBWA 5KNBA 1HCZA 5FJ8H 3GTKH 1LV9A 2BCOA 4B3RQ 5DM73 4DV2L 1PH5A 3E9HA 3ULPA 2J0TD 3PCOB 5ISRA 1FNVA 5BR8Q 1ZYRC 1UEAB 2NVTB 2K5WA 1E2ZA 4O1NA 3M85A 1PTOF 2TSSA 4V190 3TEHB 5C4HA 1YJWA 4H0LC 4RGMA 4FXGC 2KECA 3A5UA 1B70B 2QDBA 4YCWA 2EYHA 2B3GA 4BBSB 1SYFA 1HR0Q 2DY7A 1PFNA 1LABA 2ATWA 5LMUL 2JA5G 5M5XH 3TDQA 4JI4Q 2ZM6L 3KYHC 1EOVA 4JVZA 4DK1A 2MO0A 2E2JB 5C0XJ 3CC7A 3HOXG 3V96A 2QILA 3CC2A 3QO2A 1HA5A 2B63H 2VUMH 4ZKBB 1FGBD 2IT1A 4NKLA 1SNOA 4GKJL 5A35A 1VQPA 3HKZE 4CDCC 3S1QH 1EY4A 4ZUIA 3STBD 1GJXA 2M9VA 2KCCA 1BOSA 2QEXA 1DCZA 3BDOA 1JWMD 3UE0A 2HIXA 2A8VA 4OWWB 1YZ6A 4LUVA 3EIVA 2OWOA 4DNIA 1EWIA 3PO2G 2YTXA 2K03A 4YHHQ 4P75A 2F1MA 2HIVA 3VA7A 1WFQA 2DJFC 4AYBE 3S15H 3SXHA 1Y1VB 1XXGA 1SEBD 3OMGA 1SMXA 4JI3L 3CCMA 1CQVA 4GS3A 2K5NA 3AU7A 1E7ZA 2PCFB 4NB3A 1PYWD 3RD4A 1XMOQ 3PIP3 4DR5L 2XWBB 4NW2A 4JI8Q 3K81C 3KBGA 2B2WA 5J22A 2OQKA 1SYBA 1JICA 1I4HA 5ELBA 4JOIC 3MAQA 3U58A 3NWSA 4R8IA 4NXNL 1WTOA 1X3FA 2EE1A 2AWOA 4C3HH 1TR5A 4X3UA 1GKHA 3T4AC 2Q2UA 2R92B 5T1GA 1K8OA 3OYYA 3L9AX 1F2ZA 2OXPA 1WD1A 1XYIA 4DGZA 4C1NK 3M4OH 1WJJA 3GTMH 1DOLA 5FK9C 3C1EA 4P71A 4X6AH 4IUVA 3ZYYX 1V1OA 2N88A 1MD2D 1STBA 3J7AV 4K14A 5M3FB 5KNDA 4DV1Q 2K75A 5FLXc 2E75C 4E6IA 2BE5D 4NXML 5DAUA 2N55A 4JBWA 1UWVA 1ASYA 1TWGH 4A3JH 1YNNC 3DM3A 5AJ3Q 1W2BA 2OQ0A 2LXKA 2UUBQ 3VR5A 3R2TA 3TP7A 1S5FD 4PG3A 4B3SQ 2NVQH 1NR4A 4JV5Q 2K5DA 5GAHC 1SE3A 1TS4A 2MNAA 5KGUA 5C3EH 1E0BA 1M1KC 1H9RA 2G5DA 4EX5A 2Q2HA 3MWYW 1PHJA 3STBC 2I07B 4IUPA 1ENCA 3HFZB 1CHPD 4WORA 3G48A 3J80i 2RDHA 4A3MG 3Q8DA 1GUGA 1HRJA 2ZTEA 4OIJA 3MXNB 3UI2A 4OELB 4TVAB 1IBLL 1Z6HA 1QE6A 4G4KA 3I55A 1KDAA 4DN4M 2K7VA 1SYCA 1U5KA 4LF8L 3ERQA 1I4QA 5NUCA 1A3VA 2BH2A 3VA5A 1HNWL 3U9SA 1WTVA 4X62L 3FVQA 1RJTA 3I4LA 2KQ3A 3GTOB 4BXXG 1IXRA 1JB7A 4J15A 2JQOA 4QUCA 1HQRD 2V4DA 4ALPA 4PQXA 2PQEA 4LMQD 3HOXB 3DXJC 4HJ9A 1KD1C 4WRDA 4KJNA 1E2WA 2J7ZA 1RL2A 3DHQA 3FMCA 3E9IA 1OXVA 2CFMA 1TXYA 3A8JE 1BCPF 3HOUG 1L1OC 4BY7H 3HOWG 3OWFA 4O2DA 3A74A 2Z4IA 3R93A 4KHPQ 3ONAB 3TSSA 2MGSA 1PZKD 4P74A 1EQVA 2B39A 4ABNA 3WOFA 1PH1A 1HUNA 5FKAC 3AB9A 3HP3A 4KLKA 2IX1A 3H3VC 1S3OA 1TS5A 2P5ZX 2RDGA 5BN5A 1FYCA 2AUKA 1PA6A 3HOUH 4APVA 5JOBA 1PRTC 2NN6G 4I65A 1EWHA 4CBVA 3TMEA 1RCVD 3T13A 3GP7A 1Y8PB 3H0GH 4RAUC 1PH9A 1T5EA 4ILWA 4X64Q 5TSSA 4DR3L 4FF3A 1X32A 1STYA 5EKIA 1TQOA 1TY2A 3K7AH 2XRSD 1JJGA 1YIJA 1DGSA 2KHJA 1HQMC 1B3QA 3AFPA 1D5MC 1JOQA 5BR8L 2MJ8A 1BXTA 4FP5D 1XNQQ 4ZUJA 1VQ5A 2PQAA 4IURA 3NTKA 1XPOA 3P20A 4GKKL 2JA6G 2F0QA 4C3JH 3OTOL 4B3RL 1HPCA 3CQZH 2YTYA 3TP8A 4A3EH 1AEXA 2F0MA 4KD3A 2JA8H 1EQQA 1FL0A 3NP8A 1I4RA 4A3GG 1B7YB 2TMPA 1TWGB 3A55A 4X64L 2RHQB 2A6EC 3W5OA 5M5YH 1RHPA 5JEAH 3MHBA 5KYIA 1YNND 1HNXL 4EGVA 1Q86C 1BDOA 4KY7A 2RQXA 2EYJA 4JPBW 1QVFA 2R93B 3HOVB 5GQOA 1J9OA 1X56A 4ZAIA 5IP9G 2ZXOA 4C3IG 4K8IA 4ZKCB 5T1IA 4QMGA 5EBCA 2K50A 2I0QA 4DR7Q 2AQ3B 2JJQA 3G71A 1IYVA 2PNRC 4UP9A 1CI3M 4BBRG 3I4MB 3SR1A 3EQLC 2LS01 2JSOA 4HR7B 1OXUA 3QIAA 3W2DA 3K5OA 3K6OA 4UP8A 4IOCA 3EBEA 3DM1A 4LF7Q 4RCNA 4R4QA 3C3LA 2R92G 4FXDA 3NWTA 4OONA 3VR4A 1O7ZA 2PPBC 3SEBA 1CKNB 3S16H 1I6HH 1JE5A 4MTKA 1WCMB 4NDXA 3SDZA 3K59A 2R7ZB 3NBIA 4UHVA 1E1OA 2WV6D 3V05A 4JI6L 2NVXB 3M7GA 3SHLA 1KDBA 4A93G 2AQ1B 1V43A 5LMNQ 1SYEA 1X54A 2PO4A 2UU9Q 3EJIA 2QCPX 3OOCA 4EQNA 3JAME 1VQJA 3NENA 5EJWA 5LHY1 1YHBA 3L2PA 1NUCA 1J5EQ 2YYZA 2FMCA 2PI2A 4A3DB 1YVCA 1BR9A 1XMQL 3J80L 3BVMA 2K5HA 4K5VA 5CC4A 1L0WA 4JI8L 2BA1A 2AMCB 4HMIA 1CA6A 3GTLB 2RKSA 3I3CA 4HJ5A 4KKTA 1SNPA 5DLQE 4KHPL 4XT3B 2XWJB 3GTMB 3RMHA 1N8RC 3NELA 4AQYL 2LSSA 3SK6A 4BY7B 3K5MA 2JA6B 1G2TA 1Z47A 2BE5C 3KDFB 2NVTH 3RUZA 1A2UA 5JJZA 5L37A 2F4VL 1M90C 1WTHA 3PUYA 2UUAQ 2VS1A 4DR1Q 4EQOA 4GN3B 1AZQA 4JI1L 1EYDA 4ME3A 2HQEA 5C6AA 2K6AA 1A63A 3HRZC 2HQLA 1EY9A 2D0PA 1Z7TA 1EOTA 1SNQA 2PMZB 3F2DA 2MPMA 3RLFA 4O42A 4HIDA 3BJUA 3G7LA 1SXTA 4KHVA 1ML0D 1NE3A 4RHSA 3AMUA 3CCJA 3HOYH 2FXQA 2DJGC 3P1HA 1IHZA 3CCLA 4QQBX 5IGEA 2K28A 3BYTB 4K2LA 2CHBD 1YBYA 3U4ZA 3T16A 4JI3Q 1CFMA 5IGGA 5C0XG 1KNAA 5IWAL 4WFN3 4QB4A 2OTLA 1BBUA 2EJFC 4A3EG 5JJKA 3S17H 3PIPA 4JI2L 1A62A 4EQPA 3C46A 4DV7L 3RLOA 5KRUA 3GQBA 4K6DA 4OX9Q 3VYTA 1K3RA 4CDEC 2G9DA 2RVLA 1FNWA 1HTLD 4U673 4DV4L 3H3VI 5E4XA 5C0XH 2R61A 4GN4B 2ZJRA 1SFOH 2Q8IB 4ME5A 1WVLA 2O5IC 2N49A 3FKIH 4IFDG 1WTWA 2CH4A 2FHTA 4P73A 5IOCA 5D65A 2A73B 1EU3A 4M8AA 3NBHB 4JBKA 3C2PA 5IIFA 1M4VA 4JI0L 2RSOA 4QIWE 3JAMc 4DU9A 1LT4D 3MFGA 1TWHH 3EROA 1L0YB 5ELDA 4RGOS 3OPOA 4XTCS 1CTMA 1WOCA 1GUNA 5BN4A 5K5PA 2EY1A 3PF5A 1V9PA 3T51B 4XYOA 3J7A5 2A69C 2DY8A 3HKZB 4HCSA 2JA8B 5C3WA 3C1FA 5HURA 1HZAA 3OTOQ 1ESRA 3BYYB 3OW7A 4JV5L 2VNUD 4HEDA 1VQLA 4N8FA 1D2BA 2Z1CA 1EQTA 1GUOA 3NHHA 3GTPH 3HG9A 2L9HA 1CZGA 2L1BA 4ULLA 2F0DA 3HOZB 1DD2A 2BDNA 4OGQC 2MHVA 4BA2I 4NXMQ 4BBRH 3CCUA 4PV1C 2KCNA 4KMUC 1I5FA 2UXBQ 4HMJA 3SK4A 2WAQE 1VQCA 2F3IA 1CT1D 4A3KG 1SN8A 2L0CA 3H0GB 5HGQA 1F9SA 2PYKA 4MNOA 1JT8A 4XQQA 2HT1A 4CHTB 3I70A 1UUPA 2K01A 1ET6A 2DGYA 3SGIA 3K58A 4DR7L 3CU7A 4HJ8A 2B2UC 5M3FG 1TWFH 4A3DH 4A76A 5JJLA 2QW7A 1LT5D 3D4DA 2IWHA 2L4NA 1WI5A 1WTQA 1YJNA 2OCEA 2O5JC 4R4CA 1EZ6A 2DNEA 4LFAL 1Q1BA 2GA4B 1UEBA 1ASZA 4Y7NH 1SE4A 2CQOA 1CSPA 1EEFD 4LF5L 5LMNL 4RMFA 1X3EA 1XPRA 2XGTA 5AJ3L 1OXXK 1F9RA 2Z4HA 2A6HD 3PIO3 2DUDA 1DOMA 4DXFA 2K5VA 4MHEA 3RNUA 2B2TC 1MJCA 5C4XG 1H9SB 2JEBI 2E2JH 1UAPA 1VQGA 1YHAA 4J6HA 2D5DA 2SNMA 2D9UA 4OIKA 2E5LL 3I91A 3HOXH 4L5QA 2EY2A 4NMZA 4OX9L 1DJRD 2AHOB 4X3SA 4WJ4A 3PO2B 4FVMA 4LFAQ 1SAPA 1KHIA 4DR3Q 1K83H 1CA5A 2Y0SE 3G6JB 1A3UA 2UU9L 1DM0B 2QEJC 1V1PA 1EY5A 1ZEQX 3J81c 3ND8A 4KV6A 4DR4Q 2BH8A 4DAYA 3KJPA 2E8GA 1MGSA 3I4NH 3MFYA 2UXCQ 1KL9A 3AYHB 3TN2A 1QCBD 2CH4W 1J8IA 3KBXA 3DWAA 3O13A 4M1UB 1JWUD 2F0VA 2MO1A 3NXWA 4LF7L 1IL2A 1B4OA 1CSQA 5M9OA 5AFWA 1JE4A 5C44H 3HZXA 1FNUA 5C4JB 5E7NA 1NTGA 1PTOC 5IYBH 1S72A 1QOHA 4EVOA 1K0RA 5HGTA 1VQIA 4YY3Q 3S1RH 4JW0A 1PYBA 2K05A 2IHEA 2F0UA 1KRSA 1N32L 4IPHA 3S17B 1STEA 1G6PA 1LTBD 1H95A 4A3IB 3PO2H 3PSIA 1BCPB 1EY7A 4CDFC 1DONA 1EUJA 1QWYA 3CQZB 1AE2A 4C3JB 1BNZA 1MBYA 2CWPA 1Y1WG 3OSOA 4DR2L 5LMNW 2A6HC 1GO3E 4LF4L 4C56C 1TU2B 2Z6KA 3PF4A 4YCVA 1BKBA 2CCZA 4R4TA 2Z0SA 2JYOA 3P75A 4DR1L 2F0OA 5IWAQ 4NXNQ 2X6GA 1MHWC 1C48A 1N33L 1LYLA 1KLUD 2F03A 1SNDA 2IX0A 4LNQA 1GM5A 4P72A 3PV0A 1K9MC 4B9XA 5K36H 1N36L 3GV3A 4FF2A 4RH6A 4JC0A 1JWSD 1PYSB 3T1HQ 4LF5Q 5C3EG 3K0XA 1TWHB 4OWXB 1U9RA 1XPUA 1TWFB 3JAMi 4DV4Q 1SE8A 2JA7H 1LT3D 2WFWA 1H9JA 1JOKA 4KK7A 4DV7Q 4GNXA 3GD7A 5M3FH 2CWAA 3OW2A 3TP6A 5ELOA 1D8LA 1YHQA 1UE6A 4HIOA 1G291 2BOSA 1PTOD 2WINB 4OO1G 4DF7A 2HUGA 2EOTA 3QG1A 1STAA 1V1PB 3NBHA 5ELNA 4POGA 1CKMA 3G6EA 2IL8A 1PH4A 4KTAA 5FO8B 4F7XA 2K14A 4JK1C 4KHZA 1BBXC 1EIFA 1DYQA 4GOPA 1BCPD 4LJZC 1AZPA 4R1JA 5FOBB 2I5MX 3T1YL 1I50H 4JI7Q 3UDXA 2PI2E 5FLMG 3J80E 1I50B 2VQEL 1CKOA 3NTIA 1GXDC 4JCVE 1P16A 3HKSA 3TP5A 2L12A 5JAVA 3I56A 1VQ8A 3D4RA 1YITA 3DEOA 3IKJA 4JYAL 3EFXD 5C4XH 2F0KA 1T5XD 1XNRQ 2F0FA 1SJED 2KJXA 5C4XB 5FJ8G 3UDFA 4DV0Q 4L5TA 2LY7A 1ICFB 3CPFA 4YHHL 1JJCB 4LK1C 4BA1I 3MXGA 3LWUA 4I7ZC 3LX0A 2H5XA 2SEBD 5GAGC 4A4IA 1RF2D 4DV5Q 4ZRZA 2B2YA 5FLXE 3Q24A 3HS0C 2D2CC 3E5SA 4CJ2C 4L63B 1NCVA 1YNJC 4KN7C 2A19A 2EJMA 4OO1H 3I4MG 2IHFA 4TRDA 4A3KB 1JC7A 3M9BA 5CYUA 4DUYQ 1KRTA 3R8BA 5KIXA 2JN4A 2AUJD 4H44C 1Y8NB 5GADC 3G4SA 4O0AA 2RA4A 1J6QA 1I3QH 1LLRD 1VQBA 3CPWA 2VQFQ 3J81j 3BZKA 4HJAA 3J7AF 3HOZG 1IBKL 2KOLA 3QR8A 2OT2A 4PMBA 1B53A 1P8LA 4DUZQ 1VQNA 2UUAL 2PZUA 3E3XA 4LFBL 2F0WA 2E2DC 3HKZG 5I6WA 5IT9E 4OHJA 4A3GB 5DNFA 3KF6B 5I9PA 1K8MA 2B2UA 1SFOB 1I6HB 5CV9A 5IP7G 2EYLA 1CM9A 1TVXA 2KBNA 1Q82C 2B2VC 2HCIA 4A3BG 1Q3LA 1EYAA 3ULLA 4GNXC 4BBSH 1VQ6A 2EVBA 1Q46A 4A3JG 4H02A 2KCTA 1EIYB 4DV3L 3DMUA 5EKKA 4YWMA 4DK6C 3GTJH 3Q23A 1Y8OB 3E6ZX 5ELEA 1S5ED 3H15A 3CCVA 4LUZA 3RN5A 4A3CG 1TT2A 2JA7B 1ZYRD 3GTGH 1IZ6A 3U9OA 3VR2A 1Y1WB 1WCMH 4B3SL 4LFBQ 4DNTB 3FKIG 1AN8A 1N9WA 2KHIA 2PQAB 3MC0B 1MSGA 2CW0D 1I94L 2WKDA 3CCRA 1QNKA 4FXKC 2F0HA 1ENAA 3Q22A 5IYDG 1EQRA 2E2IB 2XVSA 4IPDA 1N34L 1SLJA 4MTNA 2ZTCA 1VCIA 4FNFA 1RTOA 4HAEA 4RWSC 3SK5A 1HNWQ 1MJEA 2Q8RE 2Z6KC 1ENFA 3DEPA 2UXCL 1O7LA 4B9WA 4GLXA 4FYDA 3PQIA 2RDFA 4K5XA 3CW2C 4P2CB 4XYQA 1PFMA 4EQ5A 1PZID 4B3ML 3MXNA 1A2TA 2VB2X 2D0OA 3VYRA 3WWVA 4IO9A 1HNZQ 1C9OA 1E24A 3EVQA 3MVVA 5CV8A 5DEHA 4JI6Q 4J8QA 4UAIA 2HDMA 1U0LA 1U4PA 2L15A 4LF8Q 4G7ZC 1JOOA 5D14A 1GUTA 1QUQA 4BY1G 1PH7A 5I4DA 2NVYB 4J1MA 4PMWA 3F2BA 2M2LA 1VQEA 2MFIA 2WACA 3KUPA 4FO2A 2N78A 3KF8A 3RR5A 1WYDA 4LFCQ 2N8NA 4MZ9A 3S16B 1XMOL 5H1SE 3FEWX 5KNCA 4QIWB 3LNNA 3NEMA 3NPPA 1B3AA 1JB3A 4A3FH 5IYCH 2QF7A 4A75A 4PMCA 1NMFA 4IPCA 4ZQ3A 1IKLA 4RHRA 5FO7B 4DPGA 3TZDA 2YU9B 4JI5Q 4A3DG 1G91A 1X3PA 2NN6H 1BVSA 1IW7D 1VF7A 2QDLA 2K1BA 2V1CC 3T1HL 5ELCA 1HR0W 4BXXH 4JBMA 1E2VA 1PFSA 1Y1VH 3KF6A 1Q8IA 1V8QA 3X3MA 2EYMA 4A93B 4HJ7A 2UUCQ 2CW0C 5LL6X 5D3IB 3M4OB 1PRTB 2K33A 1HZBA 3GTJB 1VMCA 3CMAA 4ZCKA 4WJ3M 4B3MQ 1KABA 2VY3A 4PZ8A 4B3TL 3CD6A 1PLFA 2JA9A 3S2DH 2L5TA 2F0IA 3VYSA 1TWAH 2ZM6Q 4RGTA 1VQKA 3IL8A 2F0GA 4DR6Q 1SSOA 4HTHA 2VL6A 4DV2Q 4CKCA 1HR0L 2Z6BA 4Q5VA 2N3SA 2KVMA 2PZTA 3P7JA 4JG2A 3T56B 4LW1A 5IGCA 3S24A 2L11A 1LACA 1LTID 3U50C 4GOPB 4N9TA 2R93G 1E22A 2E2HH 2K4KA 3S2HB 3WOEA 2ENBA 2UUCL 4IJHA 4DV3Q 1RODA 2KENA 1Q8KA 3PO3H 5EBDA 3H0GG 3HEJA 3IRBA 4C1NI 5IT9c 1N32Q 2UUBL 3PO3B 3S1RB 4GLVB 1KNEA 3UE1A 3GTGB 3K7AB 4RGNA 1EEID 1IL8A 1HZ9A 4C3IB 3S1NB 3CCSA 2NWGA 3DLLA 4DKAC 3HOVG 5I9OA 3PIOA 3LWEA 2HD3A 4YIJA 5JJIA 1Y1VG 4DR2Q 2NVYH 2NZHA 4PNYA 1Q1EA 1EFWA 1OO9B 1KTKA 5CGKA 3D0FA 3S1MB 2NB0A 1JJ2A 4K0KQ 5IYDH 1UE5A 3TBIB 3RLNA 3I4NB 2F52A 2DN8A 2JA8G 1UE1A 1YNXA 2HHHQ 1GVPA 3KLSX 3N6RA 4AH6A 3MXPA 4DV0L 1VQ9A 3CMEA 4S3SA 3CCEA 1UNSA 2G9HD 2AQ2B 5HY6A 4LF9L 1BCPC 1GD7A 5C44B 3FDTA 1Q81C 3TQYA 1HFGA 1X65A 3A54A 3MTSA 4A3KH 1X3GA 1FJGL 4LWCA 3HOYB 4ZLTF 1HTPA 1ICWA 3S2HH 2E2HB 1O7IA 1VMPA 2B2WC 2XNAC 1HA6A 2E5LQ 1F2LA 3KFUA 1EWCA 2F0JA 1SNMA 2RF4A 3VYUA 1D1KA 5IP9H 1PV4A 3I90A 4QCLA 1RD9D 2I5LX 1Y69U 2UXDQ 2C5CA 4BBSG 5CV4A 2LFNA 4GN5A 4FF1A 1RKNA 3GV6A 5M3MG 1I94Q 2RCFA 4A3MH 2DNCA 1M8AA 2A74C 3TRZA 4A3EB 4DFAA 4DR4L 1VQFA 1PZJD 2M00A 3BDCA 4R4OA 2ES2A 4KKUA 1MI2A 4JBJA 3S9WA 1WTRA 2E74C 3M4QA 3L3OC 5EQ0A 1QVGA 1QB5D 1TY0A 5M3MH 3A8KE 1PFBA 3A5ZB 3FKIB 5M3MB 5FO9B 3V2TA 2MP1A 5FLMH 3RZDB 1O7YA 3HOWB 2QGQA 3MEHA 3HOUB 4WJWA 2RHSB 4XDXA 2JA7G 2IPKD 2KHSA 1ONLA 1Q7YC 3KDFA 4YWKA 1VQAA 3RZOH 2B2VA 3HOYG 4LUOA 3R2IA 1WTXA 4GKKQ 5CR3A 2EPBA 4IFDJ 1HZCA 1PH2A 4OL7A 4DR5Q 5KYLA 2VZAA 3NQIA 3K5LA 4BY7G 2XRQD 4R4IA 3DWPA 3NTHA 2PZWA 1PH6A 2JXMB 4A3MB 4DA2A 1EYCA 1GOZA 4Q0FA 1LTAD 3S2DB 3I4NG 2NZ1D 5G3LD 3NSWA 2F0PA 1Q12A 1CZWA 3I7FA 1PH3A 1R4PB 1LTRD 2A68D 3QOJA 5I6YA 1SMYC 5JPMC 3F1ZA 5E4WC
chains in the Genus database with same CATH topology
5I2XA 2PW5A 4TKOB 4K8JA 2VB3X 2SDFA 4BWGB 4F87A 4HSPA 1PTOH 1GUWA 1LTTD 4L6TB 1G8ZD 2JEAI 5G3LF 4IQZA 4QUFA 1SE2A 3TZUA 1XTCD 1HHVA 3A7AB 4AYBB 2XSCA 2J4XA 3H91A 2OF1A 4HSVA 4U68A 4BBRB 2IJ0A 3VR6A 1JR0D 2JP1A 2SOBA 2ZT9C 3D6WA 4MIUA 1JQYD 1F2YA 5JEAG 4KD4A 1KAAA 4ODGA 2SNSA 1QG7A 1FD7D 1H9KA 2XIWA 4IALA 1EY8A 2EXZA 2CQAA 4K2KA 2R6GA 1I4XA 1EL0A 1DOKA 1PTOB 5KEEA 1B9NA 2LKVA 3BVGA 1IYUA 2MUYA 1G2SA 5FLXL 2PW7A 1GHKA 2NYZD 4XIGS 1VDZA 5IGBA 2F0EA 2NTSA 1TS2A 3D6CA 2L55A 3J81E 4OO1I 4BY1B 4DXGA 3KLSA 3K57A 1QILA 4RA8A 3GTQB 2RSNA 4L8JA 5C0XI 1NSNS 2RBMA 5DM63 4CJ1B 1ESFA 3I72A 1TS3A 2AWNA 3X3NA 3N52A 3CRLC 1B2TA 4G7HC 4IUNA 2B8GA 5CV5A 2NTTA 2EY6A 4K5WA 5C5MA 1STNA 1D1IA 3OWEB 4QF4A 4HN7A 1W6KA 4H7BA 5CORA 3A8IE 1EIGA 3BG3A 3QJYA 1W6JA 5A2QE 3RZOB 3I73A 1SYDA 3JAML 1S5DD 4RFBA 3FRPB 2OEOA 2ZXPA 2I46A 2BDOA 4CKEA 1TWAB 5EPLA 3BZDB 5E3FA 1O78A 1SMYD 1MSHA 2F3WA 2EDGA 1I6VC 2F0LA 5D3DA 3KLRA 4A3FB 2H4OA 1JORA 2B8FA 1RDPD 2X69A 4CGYB 3SVMA 1WD0A 1ZKOA 1C4QA 3OIQA 3A7LA 1ET9A 1A6XA 5I2YA 3QB3A 4B08A 1F9PA 1ILPA 4A3BB 1KLGD 3GO5A 2F3VA 3IAYA 1U4RA 1QJOA 2WB1B 2F0NA 1PRTF 4IN3A 4KN4C 1CQFA 4F88A 5M5YB 2A68C 3A56A 2B2TA 3IFTA 4DAVA 1I4PA 2F0TA 3NQTA 4RCOA 2FJ2A 2NUCA 2XN9C 1S4ZA 1NR2A 3MZ5A 3SE0A 1AP0A 5C3XA 4IUQA 2EY5A 1A3TA 5CMDA 3DWQA 3CHBD 2K5QA 3PUWA 3GTKB 5EPKA 3NK9A 3ITPA 3GTPB 4HCEA 1EZ8A 5CBAE 3CRKC 3PUZA 2K04A 4NP5A 4DAPA 1TIID 4XQNA 4DNRB 4X3TA 3F2UA 3FPPA 4MN3A 3R3OA 2WAQB 3K5NA 3S15B 1H9MA 1ILQA 2D62A 4KKSA 1D6EC 5JVH3 5IGDA 1HXYD 1G6ZA 3BDLA 2FMMA 1BQQT 4IUUA 1B9MA 5IT9L 1NAPA 1S5BD 1TKWB 1BO0A 4ZYSA 1PMRA 2B63B 2VUMB 2EZVA 2F0SA 4C2MB 5BN3A 4C3HG 1U4LA 5COYA 3URYA 3E0JA 2A69D 4G57A 1B44D 4V0BA 1SBBB 1SYGA 1AW7A 1ZXTA 4IZ8A 1GUSA 2HCCA 3OIPA 4GZYC 2LMCB 5EGTA 1XWEA 1II3A 1LO5D 3OHXC 2JA5B 1D5XC 5C3EB 2VXWA 2CVRA 2R3ZA 2KA7A 4UDUC 1C8CA 2HDLA 5C5LA 2O2LD 5JEAJ 4ID6A 3K0YA 3D4WA 4ZK9B 2NBFA 2EYFA 1SNCA 1GHJA 5A2QL 2Q8TA 3QOLA 4IFDI 4CKBA 1XX8A 1RTNA 1DXMA 5JPNC 4LAAA 2IW3A 1YNJD 3I8ZA 2FFKB 4XXEA 1EFID 2A5HA 4C3JG 2C9OA 4BS9A 4A3JB 3Q0AA 2ID0A 1IKMA 1OXTA 3MA2B 5E1FA 5ELFA 3NE5B 1S5CD 3VR3A 1BF4A 4H13C 5LL6S 3J7YW 2ZXRA 3S14B 1K83B 3HGBA 4KY6A 1H9SA 1VF5C 2Y0SB 5M5WB 3EA6A 4C3HB 2NN6I 1LTGD 4F8MA 4XT1B 3ND9A 5CV7A 1R9TB 4X3KA 4IUTA 4Y7NB 2EYOA 2ICEC 1STHA 3WDNA 4N9PA 2JE6I 3FPUB 3L7ZC 1LTSD 1PXUA 3NUCA 2KEEA 3T53B 5J39A 1CK1A 3H6MA 2O4XA 1HUMA 1SDFA 4G7OC 1I4GA 4R9WA 1WTPA 4FF4A 1O80A 2B2YC 2NVQB 1JCKB 2WIIB 4RKBA 5F2DA 3S1QB 3CKIB 1I3QB 2Z8LA 1A15A 5CV6A 3KK7A 3BS1A 3M7NA 1LT6D 5JVG3 1R4QB 2EJGC 5EPJA 2FINB 3IFDA 4R8NA 3D3RA 2H1EA 3D8GA 1SJHD 1IW7C 1D5ZC 1TWCB 1F9QA 4DK0A 4K6LA 1PRTD 2EYPA 4Z9CB 5IGFA 1EY0A 2BA0A 1KDCA 4IFDH 1B1ZA 3H94A 3OMCA 5K36G 2KUMA 2ICIA 3M4YA 2QKIC 4KY5A 2K32A 3D31A 3MXUA 2IX3A 4KI0A 4KJOA 1FR3A 4XQJA 2KEDA 3PUVA 2F4IA 1B50A 3SK8A 1BUVT 2WP8J 1X3QA 1L0XB 2WKCA 3Q6SA 3PUXA 1EIHA 5C4ZA 1OXSC 3BVZA 4RKLA 1HFNA 1CHQD 3PMFA 4CJ0B 1F2MA 1AFPA 2A6ED 2X6LA 3DUZA 4TSSA 5EKLA 5M5XB 1Q90A 1STGA 3M3YB 2E76C 3H09A 3J81L 1EU4A 1U4MA 1QNUA 3W3AA 3QWNA 1DZ1A 4TQUS 1PDQA 5CBEE 1EY6A 5J1ZA 5IODA 1F77A 5KNBA 1HCZA 1LV9A 2BCOA 5DM73 2J0TD 5ISRA 1FNVA 1ZYRC 1UEAB 2NVTB 2K5WA 1E2ZA 4O1NA 3M85A 1PTOF 2TSSA 4V190 5C4HA 4H0LC 4RGMA 4FXGC 2KECA 2QDBA 2EYHA 4BBSB 1SYFA 2DY7A 1PFNA 1LABA 3TDQA 4DK1A 2E2JB 5C0XJ 3V96A 2QILA 3QO2A 1HA5A 4ZKBB 1FGBD 2IT1A 4NKLA 1SNOA 5A35A 1EY4A 4ZUIA 1GJXA 2M9VA 2KCCA 1BOSA 1DCZA 3BDOA 1JWMD 2F1MA 3VA7A 3SXHA 1Y1VB 1XXGA 1SEBD 3OMGA 1CQVA 3AU7A 2PCFB 1PYWD 3RD4A 3PIP3 2XWBB 4NW2A 3KBGA 2B2WA 5J22A 1SYBA 1JICA 1I4HA 5ELBA 3MAQA 3NWSA 4R8IA 1WTOA 2EE1A 2AWOA 1TR5A 4X3UA 3T4AC 2R92B 5T1GA 1K8OA 3L9AX 1F2ZA 2OXPA 1WD1A 1XYIA 4DGZA 4C1NK 1DOLA 5FK9C 3C1EA 4IUVA 3ZYYX 1V1OA 2N88A 1MD2D 1STBA 3J7AV 4K14A 5M3FB 5KNDA 2E75C 4E6IA 2BE5D 5DAUA 2N55A 4JBWA 1YNNC 3VR5A 3R2TA 3TP7A 1S5FD 1NR4A 2K5DA 1SE3A 1TS4A 5KGUA 1E0BA 1H9RA 3MWYW 2I07B 4IUPA 1ENCA 1CHPD 4WORA 2RDHA 1GUGA 1HRJA 4OIJA 3UI2A 1Z6HA 1QE6A 4G4KA 1KDAA 4DN4M 2K7VA 1SYCA 3ERQA 1I4QA 5NUCA 1A3VA 3VA5A 3U9SA 1WTVA 3FVQA 1RJTA 3I4LA 2KQ3A 3GTOB 4QUCA 1HQRD 2V4DA 4PQXA 2PQEA 4LMQD 3HOXB 3DXJC 4WRDA 2J7ZA 1E2WA 4KJNA 3DHQA 3FMCA 1OXVA 3A8JE 1BCPF 3OWFA 2Z4IA 3R93A 3ONAB 3TSSA 2MGSA 1PZKD 1EQVA 2B39A 4ABNA 3WOFA 1HUNA 5FKAC 3AB9A 3HP3A 2IX1A 3H3VC 1TS5A 2RDGA 5BN5A 1FYCA 2AUKA 5JOBA 1PRTC 2NN6G 4I65A 4CBVA 1EWHA 3TMEA 1RCVD 3T13A 3GP7A 1Y8PB 4RAUC 1T5EA 4ILWA 5TSSA 4FF3A 1X32A 1STYA 5EKIA 1TQOA 1TY2A 2XRSD 1HQMC 1D5MC 1JOQA 2MJ8A 1BXTA 4FP5D 4ZUJA 4IURA 3NTKA 3P20A 2F0QA 1HPCA 3TP8A 1AEXA 2F0MA 4KD3A 3NP8A 1I4RA 2TMPA 1TWGB 3A55A 2A6EC 1RHPA 5JEAH 3MHBA 5KYIA 1YNND 4EGVA 1BDOA 4KY7A 2RQXA 2EYJA 2R93B 3HOVB 1J9OA 4ZAIA 2ZXOA 4C3IG 4K8IA 4ZKCB 5T1IA 4QMGA 5EBCA 2AQ3B 1IYVA 2PNRC 1CI3M 3I4MB 3SR1A 3EQLC 2LS01 2JSOA 4HR7B 1OXUA 3QIAA 3W2DA 3K5OA 3K6OA 3DM1A 4RCNA 3C3LA 4FXDA 3NWTA 3VR4A 1O7ZA 2PPBC 3SEBA 4NDXA 1WCMB 3SDZA 3K59A 2R7ZB 3NBIA 2WV6D 3V05A 2NVXB 3M7GA 3SHLA 1KDBA 2AQ1B 1V43A 1SYEA 2PO4A 3EJIA 2QCPX 3OOCA 4EQNA 3JAME 5EJWA 5LHY1 1NUCA 2YYZA 2FMCA 4A3DB 1BR9A 3J80L 3BVMA 4K5VA 5CC4A 2BA1A 4HMIA 1CA6A 3GTLB 2RKSA 3I3CA 4KKTA 1SNPA 4XT3B 2XWJB 3GTMB 3RMHA 3SK6A 4BY7B 3K5MA 2JA6B 1G2TA 1Z47A 2BE5C 3RUZA 1A2UA 5JJZA 3PUYA 4EQOA 1AZQA 1EYDA 2HQEA 5C6AA 2K6AA 3HRZC 1EY9A 1Z7TA 1EOTA 1SNQA 2PMZB 2MPMA 3RLFA 4O42A 3G7LA 1SXTA 4KHVA 1ML0D 4RHSA 3AMUA 3P1HA 1IHZA 5IGEA 2K28A 3BYTB 4K2LA 2CHBD 3T16A 1CFMA 5IGGA 5C0XG 1KNAA 4WFN3 4QB4A 2EJFC 4EQPA 3C46A 5KRUA 3GQBA 4K6DA 3VYTA 2G9DA 2RVLA 1FNWA 1HTLD 4U673 5E4XA 5C0XH 2R61A 2Q8IB 4ME5A 1WVLA 2O5IC 4IFDG 1WTWA 2FHTA 5IOCA 5D65A 2A73B 1EU3A 4M8AA 3C2PA 5IIFA 1M4VA 2RSOA 4DU9A 1LT4D 3MFGA 3EROA 1L0YB 5ELDA 4RGOS 3OPOA 4XTCS 1CTMA 1GUNA 5BN4A 5K5PA 2EY1A 3T51B 4XYOA 2A69C 2DY8A 3HKZB 4HCSA 2JA8B 5C3WA 3C1FA 5HURA 1ESRA 3BYYB 3OW7A 2VNUD 4HEDA 1D2BA 2Z1CA 1EQTA 1GUOA 3NHHA 3HG9A 2L9HA 1CZGA 2L1BA 4ULLA 2F0DA 3HOZB 1DD2A 2BDNA 4OGQC 2MHVA 4BA2I 4PV1C 2KCNA 4KMUC 4HMJA 3SK4A 1CT1D 2L0CA 3H0GB 1F9SA 2PYKA 4XQQA 4CHTB 3I70A 1UUPA 2K01A 1ET6A 3K58A 3CU7A 2B2UC 1LT5D 3D4DA 2IWHA 2L4NA 1WTQA 2O5JC 1EZ6A 2DNEA 1Q1BA 2GA4B 1SE4A 1EEFD 1OXXK 1F9RA 2Z4HA 2A6HD 3PIO3 1DOMA 4DXFA 4MHEA 2B2TC 1H9SB 2JEBI 1UAPA 4J6HA 2D5DA 2SNMA 2D9UA 4OIKA 3I91A 2EY2A 4NMZA 1DJRD 4X3SA 3PO2B 4FVMA 1SAPA 1CA5A 3G6JB 1A3UA 1DM0B 2QEJC 1V1PA 1EY5A 1ZEQX 3ND8A 4KV6A 4DAYA 1MGSA 3MFYA 3TN2A 1QCBD 1J8IA 3KBXA 3DWAA 3O13A 4M1UB 1JWUD 2F0VA 3NXWA 1B4OA 5M9OA 5AFWA 1JE4A 3HZXA 1FNUA 5C4JB 1PTOC 1QOHA 4EVOA 5HGTA 2K05A 2F0UA 3S17B 1STEA 1LTBD 4A3IB 1BCPB 1EY7A 1DONA 1QWYA 3CQZB 4C3JB 1BNZA 1MBYA 3OSOA 2A6HC 4C56C 1TU2B 2JYOA 3P75A 2F0OA 2X6GA 1C48A 1KLUD 2F03A 1SNDA 2IX0A 3PV0A 5K36H 4B9XA 3GV3A 4FF2A 4RH6A 1JWSD 1TWHB 1U9RA 1TWFB 1LT3D 1H9JA 1JOKA 4KK7A 3GD7A 3TP6A 1G291 2BOSA 1PTOD 2WINB 4OO1G 4DF7A 2HUGA 2EOTA 3QG1A 1STAA 1V1PB 3NBHA 2IL8A 4KTAA 5FO8B 4F7XA 4JK1C 4KHZA 1BBXC 1DYQA 1BCPD 4LJZC 1AZPA 5FOBB 3J80E 1I50B 3NTIA 1GXDC 3TP5A 2L12A 5JAVA 3D4RA 3DEOA 3IKJA 3EFXD 2F0KA 1T5XD 2F0FA 1SJED 2KJXA 5C4XB 2LY7A 4LK1C 4BA1I 3MXGA 3LWUA 4I7ZC 3LX0A 2SEBD 1RF2D 4ZRZA 2B2YA 5FLXE 3Q24A 3HS0C 2D2CC 3E5SA 4CJ2C 4L63B 1NCVA 1YNJC 4KN7C 2EJMA 4OO1H 4TRDA 4A3KB 1JC7A 5CYUA 3R8BA 5KIXA 2AUJD 4H44C 1Y8NB 2RA4A 1LLRD 3J7AF 2KOLA 2OT2A 4PMBA 1B53A 2PZUA 2F0WA 2E2DC 5I6WA 5IT9E 4OHJA 4A3GB 5DNFA 5I9PA 1K8MA 2B2UA 1SFOB 1I6HB 5CV9A 2EYLA 1CM9A 1TVXA 2B2VC 2HCIA 1Q3LA 1EYAA 2EVBA 3DMUA 5EKKA 3Q23A 1Y8OB 3E6ZX 5ELEA 1S5ED 1TT2A 2JA7B 1ZYRD 3U9OA 3VR2A 1Y1WB 4DNTB 1AN8A 3MC0B 1MSGA 2CW0D 2WKDA 1QNKA 4FXKC 2F0HA 1ENAA 3Q22A 2E2IB 2XVSA 1SMYC 1VCIA 4FNFA 1RTOA 4HAEA 4RWSC 3SK5A 2Q8RE 1ENFA 3DEPA 1O7LA 4B9WA 4FYDA 2RDFA 4K5XA 4P2CB 4XYQA 1PFMA 1PZID 3MXNA 1A2TA 2VB2X 3VYRA 3EVQA 3MVVA 5CV8A 5DEHA 4J8QA 4UAIA 2HDMA 1U4PA 4G7ZC 1JOOA 5D14A 1GUTA 5I4DA 2NVYB 4J1MA 4PMWA 2M2LA 2WACA 3KUPA 4FO2A 3KF8A 3S16B 3FEWX 5KNCA 4QIWB 3LNNA 3NPPA 1B3AA 1JB3A 2QF7A 4PMCA 4ZQ3A 1IKLA 4RHRA 5FO7B 2YU9B 3TZDA 1G91A 1X3PA 2NN6H 1IW7D 1VF7A 2K1BA 5ELCA 1E2VA 1Q8IA 1V8QA 3X3MA 2EYMA 4A93B 2CW0C 5LL6X 5D3IB 3M4OB 1PRTB 2K33A 3GTJB 1VMCA 1KABA 1PLFA 2L5TA 2F0IA 3VYSA 4RGTA 3IL8A 2F0GA 1SSOA 4HTHA 4CKCA 4Q5VA 3T56B 2KVMA 2PZTA 3P7JA 5IGCA 2L11A 1LACA 1LTID 4N9TA 3S2HB 3WOEA 2ENBA 1RODA 5EBDA 3HEJA 4C1NI 3PO3B 3S1RB 1KNEA 3GTGB 3K7AB 4RGNA 1EEID 1IL8A 4C3IB 3S1NB 2NWGA 5I9OA 3LWEA 4YIJA 4PNYA 1Q1EA 1OO9B 1KTKA 5CGKA 3S1MB 2NB0A 3I4NB 3TBIB 2DN8A 3KLSX 3N6RA 3MXPA 4S3SA 1UNSA 2G9HD 2AQ2B 1BCPC 5C44B 3FDTA 1HFGA 3A54A 3MTSA 3HOYB 4ZLTF 1HTPA 1ICWA 2E2HB 1VMPA 2B2WC 2XNAC 1HA6A 1F2LA 1EWCA 2F0JA 1SNMA 3VYUA 1D1KA 3I90A 4QCLA 1RD9D 1Y69U 2C5CA 5CV4A 2LFNA 4FF1A 1RKNA 3GV6A 2DNCA 1M8AA 2A74C 4A3EB 4DFAA 1PZJD 2M00A 3BDCA 4KKUA 1MI2A 3S9WA 1WTRA 2E74C 3L3OC 5EQ0A 1QB5D 1TY0A 3A8KE 1PFBA 3FKIB 5M3MB 5FO9B 3V2TA 2MP1A 3RZDB 1O7YA 3HOWB 3MEHA 3HOUB 4WJWA 4XDXA 2IPKD 2KHSA 1ONLA 2B2VA 3R2IA 1WTXA 5CR3A 2EPBA 4IFDJ 4OL7A 5KYLA 3NQIA 3K5LA 2XRQD 3DWPA 3NTHA 2PZWA 2JXMB 4A3MB 4DA2A 1EYCA 1GOZA 4Q0FA 1LTAD 3S2DB 2NZ1D 5G3LD 3NSWA 2F0PA 1Q12A 1CZWA 1R4PB 1LTRD 2A68D 3QOJA 5I6YA 2K03A 5JPMC 5E4WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N52 A;  1G91 A;  1X3P A;  1F9S A;  2B2V C;  2HCI A;  3FDT A;  1HFG A;  2KEE A;  1EOT A;  1BBX C;  2FJ2 A;  2K1B A;  1Q3L A;  4QUC A;  1AZP A;  2MPM A;  1B2T A;  4O42 A;  1U4M A;  1S4Z A;  2VXW A;  2K01 A;  3G7L A;  3MTS A;  1DZ1 A;  1J9O A;  1ML0 D;  2CVR A;  2R3Z A;  4LMQ D;  4ZLT F;  1C8C A;  2SDF A;  1PDQ A;  1ICW A;  2HDL A;  1NR2 A;  5CBE E;  4ZAI A;  1VMP A;  2B2W C;  2K05 A;  1HA6 A;  1HUM A;  4ZKC B;  1SDF A;  1AP0 A;  1F2L A;  4IUQ A;  4NW2 A;  1GUW A;  2B2U C;  2J7Z A;  2B2W A;  1RJT A;  2K28 A;  4R9W A;  5T1I A;  1WTP A;  4ZK9 B;  1O80 A;  2B2Y C;  4QUF A;  5CMD A;  1JIC A;  2L12 A;  3I90 A;  5COR A;  4R8I A;  3DEO A;  1LV9 A;  1EIG A;  2Q8T A;  1WTO A;  2EE1 A;  1KNA A;  1VMC A;  4X3U A;  2L4N A;  1HHV A;  1WTQ A;  3GV6 A;  5EPK A;  1XX8 A;  3DM1 A;  1A15 A;  3R93 A;  3ONA B;  5T1G A;  1DON A;  1RTN A;  1M8A A;  2MGS A;  1PLF A;  1BNZ A;  1MSG A;  1WD1 A;  5EPJ A;  5CBA E;  1XYI A;  3H91 A;  1HUN A;  2FIN B;  1O7Z A;  3IL8 A;  1QNK A;  3HP3 A;  4HSV A;  1DOL A;  1SSO A;  2K04 A;  2RVL A;  3I8Z A;  3IFD A;  4U68 A;  4IUV A;  2H1E A;  5EPL A;  5E4X A;  1MI2 A;  4X3T A;  3F2U A;  4MN3 A;  2N88 A;  1WTR A;  1F9Q A;  2KVM A;  2JP1 A;  3P7J A;  2FFK B;  2JYO A;  5EQ0 A;  1WVL A;  2L11 A;  1MSH A;  2N55 A;  1RTO A;  1F9R A;  2KEC A;  4HAE A;  4RWS C;  1WTW A;  3D6W A;  1PFB A;  2B2Y A;  2Q8R E;  1DOM A;  2FHT A;  4MHE A;  5D65 A;  2B2T C;  2X6G A;  3DEP A;  1ILQ A;  4CJ2 C;  2MP1 A;  1NCV A;  1O7Y A;  5EJW A;  2X69 A;  4RAU C;  3SVM A;  1QG7 A;  2RSO A;  1WD0 A;  1ROD A;  2DY7 A;  1IKM A;  1PFN A;  1X32 A;  1PFM A;  4XDX A;  2XIW A;  5EKI A;  2D9U A;  1NR4 A;  4OIK A;  2KUM A;  3I91 A;  1G6Z A;  3GV3 A;  1KNE A;  1IL8 A;  2FMM A;  1EL0 A;  4X3S A;  1DOK A;  1E0B A;  1BF4 A;  4IUU A;  2NWG A;  1NAP A;  2RA4 A;  2B2V A;  2DY8 A;  3MWY W;  1F9P A;  1SAP A;  2MJ8 A;  4HCS A;  4UAI A;  2HDM A;  4IUP A;  1BO0 A;  3QO2 A;  1WTX A;  1G2S A;  1U4P A;  2EPB A;  1CA5 A;  1CA6 A;  4ZKB B;  3I3C A;  1ILP A;  4IUR A;  5D14 A;  1ESR A;  2NYZ D;  3LWE A;  4HED A;  1U4R A;  1HRJ A;  2KED A;  4XT3 B;  2M2L A;  2KOL A;  4OIJ A;  3UI2 A;  1EQT A;  1B50 A;  1B53 A;  1QE6 A;  1G2T A;  1U4L A;  2L9H A;  1X3Q A;  3KUP A;  4XT1 B;  5COY A;  1MGS A;  2L1B A;  3Q6S A;  4X3K A;  4IUT A;  4DN4 M;  3TN2 A;  2BDN A;  1EIH A;  1J8I A;  1ZXT A;  3TZD A;  5JJZ A;  3KBX A;  4RA8 A;  2HCC A;  1B3A A;  1HFN A;  2HUG A;  2NZ1 D;  2RSN A;  5DNF A;  4CJ0 B;  1WTV A;  2B2U A;  2EOT A;  4CJ1 B;  1RHP A;  1AZQ A;  2B2T A;  1B4O A;  1CM9 A;  5AFW A;  1IKL A;  2IL8 A;  2X6L A;  1JE4 A;  1TVX A;  2K03 A;  3FPU B;  5E4W C; 
#chains in the Genus database with same CATH topology
 5I2X A;  2PW5 A;  4TKO B;  4K8J A;  3GTQ H;  2VB3 X;  4DV1 L;  4UP7 A;  2SDF A;  5IY0 A;  3F2C A;  4BWG B;  4A3I H;  4F87 A;  5IYC G;  4HSP A;  1PTO H;  1S40 A;  1GUW A;  1LTT D;  4L6T B;  1LTL A;  1K73 C;  1G8Z D;  2JEA I;  2CKZ B;  2R7D A;  4IQZ A;  5G3L F;  4QUF A;  1KIX A;  1SE2 A;  3ULJ A;  2R7Z G;  1WCM G;  2EQS A;  3GTL H;  3TZU A;  1XTC D;  3KF8 B;  1R9T H;  1HHV A;  3A7A B;  4AYB B;  4DUZ L;  2XTI A;  4X62 Q;  2XSC A;  4AYB G;  1K8G A;  2J4X A;  3H91 A;  2OF1 A;  5IYB G;  3ERS X;  1VQ4 A;  2HHH L;  4HSV A;  4U68 A;  4BBR B;  2IJ0 A;  3VR6 A;  4DAY B;  2YU9 H;  3EN2 A;  4A3G H;  1AH9 A;  1AE3 A;  1JR0 D;  2JP1 A;  3CAM A;  1K3B C;  2SOB A;  2ZT9 C;  1VQO A;  3D6W A;  1HNZ L;  4MIU A;  1JQY D;  5C4J H;  1F2Y A;  5JEA G;  2UXB L;  4KD4 A;  1KAA A;  4ODG A;  4HIK A;  2SNS A;  1QG7 A;  1FD7 D;  1H9K A;  2XIW A;  4IAL A;  1EY8 A;  2EXZ A;  3KJO A;  2CQA A;  4K2K A;  2A1A A;  4K0K L;  2R6G A;  1I4X A;  4IJL A;  1EL0 A;  1DOK A;  2IY5 B;  1PTO B;  2Q2I A;  3K7U C;  3HOW H;  5KEE A;  1B9N A;  2LKV A;  3KLW A;  4LFC L;  3BVG A;  1IYU A;  2MUY A;  1G2S A;  5FLX L;  1L2F A;  2PW7 A;  1GHK A;  2NYZ D;  4XIG S;  1VDZ A;  5IGB A;  1QVC A;  2F0E A;  5IP7 H;  2NTS A;  1TS2 A;  3D6C A;  2L55 A;  3J81 E;  4OO1 I;  4POF A;  4BY1 B;  4DXG A;  3KLS A;  3K57 A;  2R92 H;  2PMZ E;  1QIL A;  4RA8 A;  3GTQ B;  2RSN A;  4L8J A;  5C0X I;  3J80 c;  4JYA Q;  1NSN S;  2RBM A;  5DM6 3;  4CJ1 B;  1ESF A;  3RZD H;  3I72 A;  1VQD A;  3TS2 A;  1TS3 A;  2AWN A;  3X3N A;  1IBK Q;  1A0I A;  3N52 A;  4IOA A;  3JC6 6;  3CRL C;  1B2T A;  4QJF A;  1KC8 C;  4C3I H;  4G7H C;  4IUN A;  4DV6 Q;  2B8G A;  5CV5 A;  2NTT A;  3KOJ A;  2GVB A;  1C7Y A;  2EY6 A;  3CCQ A;  4K5W A;  5C5M A;  1FJG Q;  1STN A;  1D1I A;  3OWE B;  2I5H A;  4QF4 A;  4HN7 A;  1W6K A;  1K8A C;  4H7B A;  5COR A;  3A8I E;  3MEF A;  1EIG A;  4GOP C;  3BG3 A;  3QJY A;  4DR6 L;  1YJ9 A;  1W6J A;  4AIM A;  5A2Q E;  3RZO B;  3I73 A;  1SYD A;  3JAM L;  2YTV A;  1S5D D;  4RFB A;  3FRP B;  3FP9 A;  2OEO A;  2ZXP A;  4A3L G;  2I46 A;  1NNX A;  2BDO A;  4AQY Q;  1QZG A;  4CKE A;  1TWA B;  4RG1 A;  1A8V A;  5EPL A;  2VW9 A;  1N34 Q;  1MIU A;  2VQF L;  3BZD B;  1K28 A;  5E3F A;  1XJV A;  1O78 A;  1SMY D;  1MSH A;  4A3C H;  2F3W A;  2EDG A;  1I6V C;  2YV5 A;  4UPA A;  2F0L A;  4JI1 Q;  4QY7 A;  5D3D A;  3KLR A;  4A3F B;  2H4O A;  1JOR A;  2B8F A;  1RDP D;  2X69 A;  4CGY B;  3SVM A;  1WD0 A;  1ZKO A;  5C44 G;  3J81 i;  1SRU A;  3TRE A;  1C4Q A;  3OIQ A;  1QZH A;  3A7L A;  1ET9 A;  1A6X A;  5I2Y A;  2JK8 A;  4X66 L;  3QB3 A;  1VS0 A;  4B08 A;  2ASB A;  1F9P A;  4N8X 1;  1ILP A;  4A3B B;  1KLG D;  3I2Z A;  3GO5 A;  2UXD L;  2F3V A;  3IAY A;  1U4R A;  1QJO A;  3ICE A;  1CUK A;  1SRO A;  2WB1 B;  2F0N A;  1PRT F;  4IN3 A;  4JI2 Q;  1C0A A;  3LGJ A;  1NBW A;  4KN4 C;  1RIP A;  4YWL A;  1CQF A;  2R7Z H;  4F88 A;  5M5Y B;  1LUZ A;  2A68 C;  4B3T Q;  4LF6 L;  4L5R C;  3A56 A;  2B2T A;  3U4V A;  4X65 L;  3IFT A;  1FGU A;  4DAV A;  3PO3 G;  1I4P A;  2F0T A;  3M4P A;  1KXL A;  1PVO A;  1XTD A;  3NQT A;  4RCO A;  2FJ2 A;  2NUC A;  2XN9 C;  3FHW A;  1S4Z A;  1X9N A;  3K80 C;  1NR2 A;  3MZ5 A;  3SE0 A;  1AP0 A;  5C3X A;  2ZJP A;  4IUQ A;  2EY5 A;  1A3T A;  2B29 A;  5CMD A;  1NJI C;  3DWQ A;  3CHB D;  2K5Q A;  3CP0 A;  2F4V Q;  3PUW A;  4JI5 L;  3GTK B;  1XMQ Q;  5EPK A;  3PGZ A;  2ZJQ A;  1Y14 B;  3NK9 A;  3ITP A;  3GTP B;  1KAW A;  4HCE A;  1EZ8 A;  5CBA E;  1Z9F A;  1HH2 P;  4DK3 C;  3CRK C;  3PUZ A;  2K04 A;  4NP5 A;  4DAP A;  1X6O A;  4OEM B;  1TII D;  2Z9H A;  4XQN A;  4DNR B;  4X3T A;  3F2U A;  4MN3 A;  3FPP A;  3S1M H;  3R3O A;  2WAQ B;  4JOI A;  3K5N A;  3S15 B;  1H9M A;  1ILQ A;  2D62 A;  4KKS A;  1D6E C;  5JVH 3;  3S14 H;  1TWC H;  4DV6 L;  3A0J A;  5IGD A;  3CXC A;  4GKJ Q;  1HXY D;  1G6Z A;  1XNR L;  3BDL A;  2FMM A;  4GNX B;  1BQQ T;  4IUU A;  1B9M A;  5IT9 L;  1NAP A;  1S5B D;  1TKW B;  2EXD A;  4QGU A;  1BO0 A;  4ZYS A;  2GVA A;  1PMR A;  1YEZ A;  2B63 B;  4JI7 L;  2VUM B;  2RCN A;  2EZV A;  2F0S A;  4C2M B;  1CKN A;  5BN3 A;  1U4L A;  3URY A;  5COY A;  2Y0S G;  4C3H G;  3E0J A;  2A69 D;  4G57 A;  1B44 D;  4V0B A;  2JA6 H;  4A3B H;  1SBB B;  1SYG A;  1AW7 A;  1ZXT A;  4IZ8 A;  1GUS A;  1YI2 A;  2HCC A;  3OIP A;  4GZY C;  2LMC B;  5EGT A;  1XWE A;  1II3 A;  3GTO H;  1N33 Q;  1LO5 D;  3OHX C;  2JA5 B;  1D5X C;  4YY3 L;  1W3S A;  3F8T A;  1E1T A;  4JI4 L;  5GRO A;  5IE8 A;  1D7Q A;  5C3E B;  2VXW A;  2CVR A;  2R3Z A;  1B8A A;  2KA7 A;  4UDU C;  1C8C A;  1EYG A;  2HDL A;  5C5L A;  4PZ6 A;  2ZTD A;  2O2L D;  5JEA J;  2LXJ A;  4ID6 A;  3K0Y A;  1E3P A;  3D4W A;  4ZK9 B;  3CF5 A;  2NBF A;  4JI0 Q;  1XNQ L;  2EYF A;  1SNC A;  1GHJ A;  2NZO A;  4OWT B;  5A2Q L;  2Q8T A;  1L1O A;  3QOL A;  3W1B A;  4IFD I;  1HNX Q;  4LF9 Q;  4A3F G;  4CKB A;  3TS0 A;  1XX8 A;  5GAE C;  1RTN A;  1DXM A;  5JPN C;  3ZJY C;  4LAA A;  1KQS A;  3B6Y A;  2ALY B;  2IW3 A;  1YNJ D;  3I8Z A;  3ER0 A;  5EAY A;  2FFK B;  3M3Y H;  4XXE A;  1EFI D;  1VQM A;  2A5H A;  4C3J G;  2C9O A;  4A3L H;  1IYJ B;  1HJP A;  3T1Y Q;  4BS9 A;  4A3J B;  4PZ7 A;  4A3I G;  3Q0A A;  2ID0 A;  1IKM A;  1OXT A;  3MA2 B;  5E1F A;  5ELF A;  3NE5 B;  3AQQ A;  3I4M H;  1S5C D;  3VR3 A;  1BF4 A;  4H13 C;  5LL6 S;  3J7Y W;  2ZXR A;  3S14 B;  1K83 B;  1LM0 A;  3HGB A;  4KY6 A;  1UE7 A;  1H9S A;  1VF5 C;  1NMG A;  2Y0S B;  5M5W B;  3EA6 A;  4C3H B;  1SR3 A;  2NN6 I;  2PNH A;  1PH8 A;  1LTG D;  3HOZ H;  3W1G A;  5LMU Q;  4F8M A;  1IBM L;  4XT1 B;  3ND9 A;  1V1Q A;  5CV7 A;  1R9T B;  4X3K A;  4IUT A;  4Y7N B;  1N36 Q;  2EYO A;  2WB1 E;  2ICE C;  2AKW B;  1STH A;  3E0E A;  3WDN A;  4HIM A;  4N9P A;  2JE6 I;  1T9H A;  3FPU B;  3H3V H;  3L7Z C;  1LTS D;  1PXU A;  2B63 G;  2VUM G;  3NUC A;  1J5E L;  3HOV H;  2KEE A;  4DUY L;  3T53 B;  3GDE A;  4CDD C;  5J39 A;  1CK1 A;  3H6M A;  2O4X A;  1HUM A;  2KCM A;  4A93 H;  1SDF A;  2JA5 H;  2EIF A;  4G7O C;  2OTJ A;  1I4G A;  4R9W A;  1WTP A;  4FF4 A;  4L5S A;  1O80 A;  2B2Y C;  3UDI A;  1JCK B;  4UY8 C;  2NVQ B;  2WII B;  1IBM Q;  4RKB A;  4DV5 L;  4GLA C;  5F2D A;  3S1Q B;  3CKI B;  4X66 Q;  4LF4 Q;  1I3Q B;  2Z8L A;  5M5W H;  1A15 A;  5CV6 A;  3KK7 A;  1Y1W H;  2MQH A;  3BS1 A;  3J7Z C;  3M7N A;  1LT6 D;  5JVG 3;  1R4Q B;  2EJG C;  1VQ7 A;  5EPJ A;  4BY1 H;  2WAQ G;  3RN2 A;  3BU2 A;  2FIN B;  3IFD A;  4R8N A;  3D3R A;  4NPS A;  2H1E A;  4DAM A;  3D8G A;  1SJH D;  1IW7 C;  1D5Z C;  1TWC B;  3I4O A;  1F9Q A;  4DK0 A;  1L1O B;  2E2I H;  2QA4 A;  4K6L A;  1PRT D;  2EYP A;  4Z9C B;  5J3B A;  5IGF A;  1EY0 A;  1MKH A;  2BA0 A;  1KDC A;  4X65 Q;  4IFD H;  1B1Z A;  1QUQ B;  2Q2T A;  3H94 A;  3OMC A;  5K36 G;  4QL5 A;  4LF6 Q;  4OXP A;  2KUM A;  2ICI A;  3AFQ A;  3M4Y A;  1X55 A;  2QKI C;  3L0O A;  4KY5 A;  2VQE Q;  2K32 A;  3CC4 A;  3D31 A;  4C2M H;  3BZC A;  3MXU A;  3UDG A;  2IX3 A;  4KI0 A;  1JMC A;  1OTC A;  2R7F A;  4KJO A;  1FR3 A;  4XQJ A;  2KED A;  4IPG A;  3PUV A;  2F4I A;  3AEV A;  1B50 A;  3SK8 A;  1BUV T;  2WP8 J;  1X3Q A;  1L0X B;  2WKC A;  3Q6S A;  3PUX A;  2K52 A;  4Y52 H;  1EIH A;  1G51 A;  1K0S A;  5C4Z A;  1OXS C;  3BVZ A;  4RKL A;  1HFN A;  1CHQ D;  3PMF A;  4CJ0 B;  2NVX H;  4FDB A;  1F2M A;  1AFP A;  1VQH A;  2C35 B;  2A6E D;  2WB1 G;  2X6L A;  4YCU A;  3DUZ A;  4I7A A;  4TSS A;  5EKL A;  5M5X B;  1Q90 A;  1STG A;  3M3Y B;  2E76 C;  1IBL Q;  1FVI A;  3H09 A;  3J81 L;  1EU4 A;  1U4M A;  1QNU A;  3W3A A;  1NY4 A;  3QWN A;  1DZ1 A;  3VDY A;  4TQU S;  2R93 H;  1PDQ A;  5CBE E;  2GN5 A;  1EY6 A;  5J1Z A;  5IOD A;  1F77 A;  3S1N H;  3K8A A;  1BBW A;  5KNB A;  1HCZ A;  5FJ8 H;  3GTK H;  1LV9 A;  2BCO A;  4B3R Q;  5DM7 3;  4DV2 L;  1PH5 A;  3E9H A;  3ULP A;  2J0T D;  3PCO B;  5ISR A;  1FNV A;  5BR8 Q;  1ZYR C;  1UEA B;  2NVT B;  2K5W A;  1E2Z A;  4O1N A;  3M85 A;  1PTO F;  2TSS A;  4V19 0;  3TEH B;  5C4H A;  1YJW A;  4H0L C;  4RGM A;  4FXG C;  2KEC A;  3A5U A;  1B70 B;  2QDB A;  4YCW A;  2EYH A;  2B3G A;  4BBS B;  1SYF A;  1HR0 Q;  2DY7 A;  1PFN A;  1LAB A;  2ATW A;  5LMU L;  2JA5 G;  5M5X H;  3TDQ A;  4JI4 Q;  2ZM6 L;  3KYH C;  1EOV A;  4JVZ A;  4DK1 A;  2MO0 A;  2E2J B;  5C0X J;  3CC7 A;  3HOX G;  3V96 A;  2QIL A;  3CC2 A;  3QO2 A;  1HA5 A;  2B63 H;  2VUM H;  4ZKB B;  1FGB D;  2IT1 A;  4NKL A;  1SNO A;  4GKJ L;  5A35 A;  1VQP A;  3HKZ E;  4CDC C;  3S1Q H;  1EY4 A;  4ZUI A;  3STB D;  1GJX A;  2M9V A;  2KCC A;  1BOS A;  2QEX A;  1DCZ A;  3BDO A;  1JWM D;  3UE0 A;  2HIX A;  2A8V A;  4OWW B;  1YZ6 A;  4LUV A;  3EIV A;  2OWO A;  4DNI A;  1EWI A;  3PO2 G;  2YTX A;  2K03 A;  4YHH Q;  4P75 A;  2F1M A;  2HIV A;  3VA7 A;  1WFQ A;  2DJF C;  4AYB E;  3S15 H;  3SXH A;  1Y1V B;  1XXG A;  1SEB D;  3OMG A;  1SMX A;  4JI3 L;  3CCM A;  1CQV A;  4GS3 A;  2K5N A;  3AU7 A;  1E7Z A;  2PCF B;  4NB3 A;  1PYW D;  3RD4 A;  1XMO Q;  3PIP 3;  4DR5 L;  2XWB B;  4NW2 A;  4JI8 Q;  3K81 C;  3KBG A;  2B2W A;  5J22 A;  2OQK A;  1SYB A;  1JIC A;  1I4H A;  5ELB A;  4JOI C;  3MAQ A;  3U58 A;  3NWS A;  4R8I A;  4NXN L;  1WTO A;  1X3F A;  2EE1 A;  2AWO A;  4C3H H;  1TR5 A;  4X3U A;  1GKH A;  3T4A C;  2Q2U A;  2R92 B;  5T1G A;  1K8O A;  3OYY A;  3L9A X;  1F2Z A;  2OXP A;  1WD1 A;  1XYI A;  4DGZ A;  4C1N K;  3M4O H;  1WJJ A;  3GTM H;  1DOL A;  5FK9 C;  3C1E A;  4P71 A;  4X6A H;  4IUV A;  3ZYY X;  1V1O A;  2N88 A;  1MD2 D;  1STB A;  3J7A V;  4K14 A;  5M3F B;  5KND A;  4DV1 Q;  2K75 A;  5FLX c;  2E75 C;  4E6I A;  2BE5 D;  4NXM L;  5DAU A;  2N55 A;  4JBW A;  1UWV A;  1ASY A;  1TWG H;  4A3J H;  1YNN C;  3DM3 A;  5AJ3 Q;  1W2B A;  2OQ0 A;  2LXK A;  2UUB Q;  3VR5 A;  3R2T A;  3TP7 A;  1S5F D;  4PG3 A;  4B3S Q;  2NVQ H;  1NR4 A;  4JV5 Q;  2K5D A;  5GAH C;  1SE3 A;  1TS4 A;  2MNA A;  5KGU A;  5C3E H;  1E0B A;  1M1K C;  1H9R A;  2G5D A;  4EX5 A;  2Q2H A;  3MWY W;  1PHJ A;  3STB C;  2I07 B;  4IUP A;  1ENC A;  3HFZ B;  1CHP D;  4WOR A;  3G48 A;  3J80 i;  2RDH A;  4A3M G;  3Q8D A;  1GUG A;  1HRJ A;  2ZTE A;  4OIJ A;  3MXN B;  3UI2 A;  4OEL B;  4TVA B;  1IBL L;  1Z6H A;  1QE6 A;  4G4K A;  3I55 A;  1KDA A;  4DN4 M;  2K7V A;  1SYC A;  1U5K A;  4LF8 L;  3ERQ A;  1I4Q A;  5NUC A;  1A3V A;  2BH2 A;  3VA5 A;  1HNW L;  3U9S A;  1WTV A;  4X62 L;  3FVQ A;  1RJT A;  3I4L A;  2KQ3 A;  3GTO B;  4BXX G;  1IXR A;  1JB7 A;  4J15 A;  2JQO A;  4QUC A;  1HQR D;  2V4D A;  4ALP A;  4PQX A;  2PQE A;  4LMQ D;  3HOX B;  3DXJ C;  4HJ9 A;  1KD1 C;  4WRD A;  4KJN A;  1E2W A;  2J7Z A;  1RL2 A;  3DHQ A;  3FMC A;  3E9I A;  1OXV A;  2CFM A;  1TXY A;  3A8J E;  1BCP F;  3HOU G;  1L1O C;  4BY7 H;  3HOW G;  3OWF A;  4O2D A;  3A74 A;  2Z4I A;  3R93 A;  4KHP Q;  3ONA B;  3TSS A;  2MGS A;  1PZK D;  4P74 A;  1EQV A;  2B39 A;  4ABN A;  3WOF A;  1PH1 A;  1HUN A;  5FKA C;  3AB9 A;  3HP3 A;  4KLK A;  2IX1 A;  3H3V C;  1S3O A;  1TS5 A;  2P5Z X;  2RDG A;  5BN5 A;  1FYC A;  2AUK A;  1PA6 A;  3HOU H;  4APV A;  5JOB A;  1PRT C;  2NN6 G;  4I65 A;  1EWH A;  4CBV A;  3TME A;  1RCV D;  3T13 A;  3GP7 A;  1Y8P B;  3H0G H;  4RAU C;  1PH9 A;  1T5E A;  4ILW A;  4X64 Q;  5TSS A;  4DR3 L;  4FF3 A;  1X32 A;  1STY A;  5EKI A;  1TQO A;  1TY2 A;  3K7A H;  2XRS D;  1JJG A;  1YIJ A;  1DGS A;  2KHJ A;  1HQM C;  1B3Q A;  3AFP A;  1D5M C;  1JOQ A;  5BR8 L;  2MJ8 A;  1BXT A;  4FP5 D;  1XNQ Q;  4ZUJ A;  1VQ5 A;  2PQA A;  4IUR A;  3NTK A;  1XPO A;  3P20 A;  4GKK L;  2JA6 G;  2F0Q A;  4C3J H;  3OTO L;  4B3R L;  1HPC A;  3CQZ H;  2YTY A;  3TP8 A;  4A3E H;  1AEX A;  2F0M A;  4KD3 A;  2JA8 H;  1EQQ A;  1FL0 A;  3NP8 A;  1I4R A;  4A3G G;  1B7Y B;  2TMP A;  1TWG B;  3A55 A;  4X64 L;  2RHQ B;  2A6E C;  3W5O A;  5M5Y H;  1RHP A;  5JEA H;  3MHB A;  5KYI A;  1YNN D;  1HNX L;  4EGV A;  1Q86 C;  1BDO A;  4KY7 A;  2RQX A;  2EYJ A;  4JPB W;  1QVF A;  2R93 B;  3HOV B;  5GQO A;  1J9O A;  1X56 A;  4ZAI A;  5IP9 G;  2ZXO A;  4C3I G;  4K8I A;  4ZKC B;  5T1I A;  4QMG A;  5EBC A;  2K50 A;  2I0Q A;  4DR7 Q;  2AQ3 B;  2JJQ A;  3G71 A;  1IYV A;  2PNR C;  4UP9 A;  1CI3 M;  4BBR G;  3I4M B;  3SR1 A;  3EQL C;  2LS0 1;  2JSO A;  4HR7 B;  1OXU A;  3QIA A;  3W2D A;  3K5O A;  3K6O A;  4UP8 A;  4IOC A;  3EBE A;  3DM1 A;  4LF7 Q;  4RCN A;  4R4Q A;  3C3L A;  2R92 G;  4FXD A;  3NWT A;  4OON A;  3VR4 A;  1O7Z A;  2PPB C;  3SEB A;  1CKN B;  3S16 H;  1I6H H;  1JE5 A;  4MTK A;  1WCM B;  4NDX A;  3SDZ A;  3K59 A;  2R7Z B;  3NBI A;  4UHV A;  1E1O A;  2WV6 D;  3V05 A;  4JI6 L;  2NVX B;  3M7G A;  3SHL A;  1KDB A;  4A93 G;  2AQ1 B;  1V43 A;  5LMN Q;  1SYE A;  1X54 A;  2PO4 A;  2UU9 Q;  3EJI A;  2QCP X;  3OOC A;  4EQN A;  3JAM E;  1VQJ A;  3NEN A;  5EJW A;  5LHY 1;  1YHB A;  3L2P A;  1NUC A;  1J5E Q;  2YYZ A;  2FMC A;  2PI2 A;  4A3D B;  1YVC A;  1BR9 A;  1XMQ L;  3J80 L;  3BVM A;  2K5H A;  4K5V A;  5CC4 A;  1L0W A;  4JI8 L;  2BA1 A;  2AMC B;  4HMI A;  1CA6 A;  3GTL B;  2RKS A;  3I3C A;  4HJ5 A;  4KKT A;  1SNP A;  5DLQ E;  4KHP L;  4XT3 B;  2XWJ B;  3GTM B;  3RMH A;  1N8R C;  3NEL A;  4AQY L;  2LSS A;  3SK6 A;  4BY7 B;  3K5M A;  2JA6 B;  1G2T A;  1Z47 A;  2BE5 C;  3KDF B;  2NVT H;  3RUZ A;  1A2U A;  5JJZ A;  5L37 A;  2F4V L;  1M90 C;  1WTH A;  3PUY A;  2UUA Q;  2VS1 A;  4DR1 Q;  4EQO A;  4GN3 B;  1AZQ A;  4JI1 L;  1EYD A;  4ME3 A;  2HQE A;  5C6A A;  2K6A A;  1A63 A;  3HRZ C;  2HQL A;  1EY9 A;  2D0P A;  1Z7T A;  1EOT A;  1SNQ A;  2PMZ B;  3F2D A;  2MPM A;  3RLF A;  4O42 A;  4HID A;  3BJU A;  3G7L A;  1SXT A;  4KHV A;  1ML0 D;  1NE3 A;  4RHS A;  3AMU A;  3CCJ A;  3HOY H;  2FXQ A;  2DJG C;  3P1H A;  1IHZ A;  3CCL A;  4QQB X;  5IGE A;  2K28 A;  3BYT B;  4K2L A;  2CHB D;  1YBY A;  3U4Z A;  3T16 A;  4JI3 Q;  1CFM A;  5IGG A;  5C0X G;  1KNA A;  5IWA L;  4WFN 3;  4QB4 A;  2OTL A;  1BBU A;  2EJF C;  4A3E G;  5JJK A;  3S17 H;  3PIP A;  4JI2 L;  1A62 A;  4EQP A;  3C46 A;  4DV7 L;  3RLO A;  5KRU A;  3GQB A;  4K6D A;  4OX9 Q;  3VYT A;  1K3R A;  4CDE C;  2G9D A;  2RVL A;  1FNW A;  1HTL D;  4U67 3;  4DV4 L;  3H3V I;  5E4X A;  5C0X H;  2R61 A;  4GN4 B;  2ZJR A;  1SFO H;  2Q8I B;  4ME5 A;  1WVL A;  2O5I C;  2N49 A;  3FKI H;  4IFD G;  1WTW A;  2CH4 A;  2FHT A;  4P73 A;  5IOC A;  5D65 A;  2A73 B;  1EU3 A;  4M8A A;  3NBH B;  4JBK A;  3C2P A;  5IIF A;  1M4V A;  4JI0 L;  2RSO A;  4QIW E;  3JAM c;  4DU9 A;  1LT4 D;  3MFG A;  1TWH H;  3ERO A;  1L0Y B;  5ELD A;  4RGO S;  3OPO A;  4XTC S;  1CTM A;  1WOC A;  1GUN A;  5BN4 A;  5K5P A;  2EY1 A;  3PF5 A;  1V9P A;  3T51 B;  4XYO A;  3J7A 5;  2A69 C;  2DY8 A;  3HKZ B;  4HCS A;  2JA8 B;  5C3W A;  3C1F A;  5HUR A;  1HZA A;  3OTO Q;  1ESR A;  3BYY B;  3OW7 A;  4JV5 L;  2VNU D;  4HED A;  1VQL A;  4N8F A;  1D2B A;  2Z1C A;  1EQT A;  1GUO A;  3NHH A;  3GTP H;  3HG9 A;  2L9H A;  1CZG A;  2L1B A;  4ULL A;  2F0D A;  3HOZ B;  1DD2 A;  2BDN A;  4OGQ C;  2MHV A;  4BA2 I;  4NXM Q;  4BBR H;  3CCU A;  4PV1 C;  2KCN A;  4KMU C;  1I5F A;  2UXB Q;  4HMJ A;  3SK4 A;  2WAQ E;  1VQC A;  2F3I A;  1CT1 D;  4A3K G;  1SN8 A;  2L0C A;  3H0G B;  5HGQ A;  1F9S A;  2PYK A;  4MNO A;  1JT8 A;  4XQQ A;  2HT1 A;  4CHT B;  3I70 A;  1UUP A;  2K01 A;  1ET6 A;  2DGY A;  3SGI A;  3K58 A;  4DR7 L;  3CU7 A;  4HJ8 A;  2B2U C;  5M3F G;  1TWF H;  4A3D H;  4A76 A;  5JJL A;  2QW7 A;  1LT5 D;  3D4D A;  2IWH A;  2L4N A;  1WI5 A;  1WTQ A;  1YJN A;  2OCE A;  2O5J C;  4R4C A;  1EZ6 A;  2DNE A;  4LFA L;  1Q1B A;  2GA4 B;  1UEB A;  1ASZ A;  4Y7N H;  1SE4 A;  2CQO A;  1CSP A;  1EEF D;  4LF5 L;  5LMN L;  4RMF A;  1X3E A;  1XPR A;  2XGT A;  5AJ3 L;  1OXX K;  1F9R A;  2Z4H A;  2A6H D;  3PIO 3;  2DUD A;  1DOM A;  4DXF A;  2K5V A;  4MHE A;  3RNU A;  2B2T C;  1MJC A;  5C4X G;  1H9S B;  2JEB I;  2E2J H;  1UAP A;  1VQG A;  1YHA A;  4J6H A;  2D5D A;  2SNM A;  2D9U A;  4OIK A;  2E5L L;  3I91 A;  3HOX H;  4L5Q A;  2EY2 A;  4NMZ A;  4OX9 L;  1DJR D;  2AHO B;  4X3S A;  4WJ4 A;  3PO2 B;  4FVM A;  4LFA Q;  1SAP A;  1KHI A;  4DR3 Q;  1K83 H;  1CA5 A;  2Y0S E;  3G6J B;  1A3U A;  2UU9 L;  1DM0 B;  2QEJ C;  1V1P A;  1EY5 A;  1ZEQ X;  3J81 c;  3ND8 A;  4KV6 A;  4DR4 Q;  2BH8 A;  4DAY A;  3KJP A;  2E8G A;  1MGS A;  3I4N H;  3MFY A;  2UXC Q;  1KL9 A;  3AYH B;  3TN2 A;  1QCB D;  2CH4 W;  1J8I A;  3KBX A;  3DWA A;  3O13 A;  4M1U B;  1JWU D;  2F0V A;  2MO1 A;  3NXW A;  4LF7 L;  1IL2 A;  1B4O A;  1CSQ A;  5M9O A;  5AFW A;  1JE4 A;  5C44 H;  3HZX A;  1FNU A;  5C4J B;  5E7N A;  1NTG A;  1PTO C;  5IYB H;  1S72 A;  1QOH A;  4EVO A;  1K0R A;  5HGT A;  1VQI A;  4YY3 Q;  3S1R H;  4JW0 A;  1PYB A;  2K05 A;  2IHE A;  2F0U A;  1KRS A;  1N32 L;  4IPH A;  3S17 B;  1STE A;  1G6P A;  1LTB D;  1H95 A;  4A3I B;  3PO2 H;  3PSI A;  1BCP B;  1EY7 A;  4CDF C;  1DON A;  1EUJ A;  1QWY A;  3CQZ B;  1AE2 A;  4C3J B;  1BNZ A;  1MBY A;  2CWP A;  1Y1W G;  3OSO A;  4DR2 L;  5LMN W;  2A6H C;  1GO3 E;  4LF4 L;  4C56 C;  1TU2 B;  2Z6K A;  3PF4 A;  4YCV A;  1BKB A;  2CCZ A;  4R4T A;  2Z0S A;  2JYO A;  3P75 A;  4DR1 L;  2F0O A;  5IWA Q;  4NXN Q;  2X6G A;  1MHW C;  1C48 A;  1N33 L;  1LYL A;  1KLU D;  2F03 A;  1SND A;  2IX0 A;  4LNQ A;  1GM5 A;  4P72 A;  3PV0 A;  1K9M C;  4B9X A;  5K36 H;  1N36 L;  3GV3 A;  4FF2 A;  4RH6 A;  4JC0 A;  1JWS D;  1PYS B;  3T1H Q;  4LF5 Q;  5C3E G;  3K0X A;  1TWH B;  4OWX B;  1U9R A;  1XPU A;  1TWF B;  3JAM i;  4DV4 Q;  1SE8 A;  2JA7 H;  1LT3 D;  2WFW A;  1H9J A;  1JOK A;  4KK7 A;  4DV7 Q;  4GNX A;  3GD7 A;  5M3F H;  2CWA A;  3OW2 A;  3TP6 A;  5ELO A;  1D8L A;  1YHQ A;  1UE6 A;  4HIO A;  1G29 1;  2BOS A;  1PTO D;  2WIN B;  4OO1 G;  4DF7 A;  2HUG A;  2EOT A;  3QG1 A;  1STA A;  1V1P B;  3NBH A;  5ELN A;  4POG A;  1CKM A;  3G6E A;  2IL8 A;  1PH4 A;  4KTA A;  5FO8 B;  4F7X A;  2K14 A;  4JK1 C;  4KHZ A;  1BBX C;  1EIF A;  1DYQ A;  4GOP A;  1BCP D;  4LJZ C;  1AZP A;  4R1J A;  5FOB B;  2I5M X;  3T1Y L;  1I50 H;  4JI7 Q;  3UDX A;  2PI2 E;  5FLM G;  3J80 E;  1I50 B;  2VQE L;  1CKO A;  3NTI A;  1GXD C;  4JCV E;  1P16 A;  3HKS A;  3TP5 A;  2L12 A;  5JAV A;  3I56 A;  1VQ8 A;  3D4R A;  1YIT A;  3DEO A;  3IKJ A;  4JYA L;  3EFX D;  5C4X H;  2F0K A;  1T5X D;  1XNR Q;  2F0F A;  1SJE D;  2KJX A;  5C4X B;  5FJ8 G;  3UDF A;  4DV0 Q;  4L5T A;  2LY7 A;  1ICF B;  3CPF A;  4YHH L;  1JJC B;  4LK1 C;  4BA1 I;  3MXG A;  3LWU A;  4I7Z C;  3LX0 A;  2H5X A;  2SEB D;  5GAG C;  4A4I A;  1RF2 D;  4DV5 Q;  4ZRZ A;  2B2Y A;  5FLX E;  3Q24 A;  3HS0 C;  2D2C C;  3E5S A;  4CJ2 C;  4L63 B;  1NCV A;  1YNJ C;  4KN7 C;  2A19 A;  2EJM A;  4OO1 H;  3I4M G;  2IHF A;  4TRD A;  4A3K B;  1JC7 A;  3M9B A;  5CYU A;  4DUY Q;  1KRT A;  3R8B A;  5KIX A;  2JN4 A;  2AUJ D;  4H44 C;  1Y8N B;  5GAD C;  3G4S A;  4O0A A;  2RA4 A;  1J6Q A;  1I3Q H;  1LLR D;  1VQB A;  3CPW A;  2VQF Q;  3J81 j;  3BZK A;  4HJA A;  3J7A F;  3HOZ G;  1IBK L;  2KOL A;  3QR8 A;  2OT2 A;  4PMB A;  1B53 A;  1P8L A;  4DUZ Q;  1VQN A;  2UUA L;  2PZU A;  3E3X A;  4LFB L;  2F0W A;  2E2D C;  3HKZ G;  5I6W A;  5IT9 E;  4OHJ A;  4A3G B;  5DNF A;  3KF6 B;  5I9P A;  1K8M A;  2B2U A;  1SFO B;  1I6H B;  5CV9 A;  5IP7 G;  2EYL A;  1CM9 A;  1TVX A;  2KBN A;  1Q82 C;  2B2V C;  2HCI A;  4A3B G;  1Q3L A;  1EYA A;  3ULL A;  4GNX C;  4BBS H;  1VQ6 A;  2EVB A;  1Q46 A;  4A3J G;  4H02 A;  2KCT A;  1EIY B;  4DV3 L;  3DMU A;  5EKK A;  4YWM A;  4DK6 C;  3GTJ H;  3Q23 A;  1Y8O B;  3E6Z X;  5ELE A;  1S5E D;  3H15 A;  3CCV A;  4LUZ A;  3RN5 A;  4A3C G;  1TT2 A;  2JA7 B;  1ZYR D;  3GTG H;  1IZ6 A;  3U9O A;  3VR2 A;  1Y1W B;  1WCM H;  4B3S L;  4LFB Q;  4DNT B;  3FKI G;  1AN8 A;  1N9W A;  2KHI A;  2PQA B;  3MC0 B;  1MSG A;  2CW0 D;  1I94 L;  2WKD A;  3CCR A;  1QNK A;  4FXK C;  2F0H A;  1ENA A;  3Q22 A;  5IYD G;  1EQR A;  2E2I B;  2XVS A;  4IPD A;  1N34 L;  1SLJ A;  4MTN A;  2ZTC A;  1VCI A;  4FNF A;  1RTO A;  4HAE A;  4RWS C;  3SK5 A;  1HNW Q;  1MJE A;  2Q8R E;  2Z6K C;  1ENF A;  3DEP A;  2UXC L;  1O7L A;  4B9W A;  4GLX A;  4FYD A;  3PQI A;  2RDF A;  4K5X A;  3CW2 C;  4P2C B;  4XYQ A;  1PFM A;  4EQ5 A;  1PZI D;  4B3M L;  3MXN A;  1A2T A;  2VB2 X;  2D0O A;  3VYR A;  3WWV A;  4IO9 A;  1HNZ Q;  1C9O A;  1E24 A;  3EVQ A;  3MVV A;  5CV8 A;  5DEH A;  4JI6 Q;  4J8Q A;  4UAI A;  2HDM A;  1U0L A;  1U4P A;  2L15 A;  4LF8 Q;  4G7Z C;  1JOO A;  5D14 A;  1GUT A;  1QUQ A;  4BY1 G;  1PH7 A;  5I4D A;  2NVY B;  4J1M A;  4PMW A;  3F2B A;  2M2L A;  1VQE A;  2MFI A;  2WAC A;  3KUP A;  4FO2 A;  2N78 A;  3KF8 A;  3RR5 A;  1WYD A;  4LFC Q;  2N8N A;  4MZ9 A;  3S16 B;  1XMO L;  5H1S E;  3FEW X;  5KNC A;  4QIW B;  3LNN A;  3NEM A;  3NPP A;  1B3A A;  1JB3 A;  4A3F H;  5IYC H;  2QF7 A;  4A75 A;  4PMC A;  1NMF A;  4IPC A;  4ZQ3 A;  1IKL A;  4RHR A;  5FO7 B;  4DPG A;  3TZD A;  2YU9 B;  4JI5 Q;  4A3D G;  1G91 A;  1X3P A;  2NN6 H;  1BVS A;  1IW7 D;  1VF7 A;  2QDL A;  2K1B A;  2V1C C;  3T1H L;  5ELC A;  1HR0 W;  4BXX H;  4JBM A;  1E2V A;  1PFS A;  1Y1V H;  3KF6 A;  1Q8I A;  1V8Q A;  3X3M A;  2EYM A;  4A93 B;  4HJ7 A;  2UUC Q;  2CW0 C;  5LL6 X;  5D3I B;  3M4O B;  1PRT B;  2K33 A;  1HZB A;  3GTJ B;  1VMC A;  3CMA A;  4ZCK A;  4WJ3 M;  4B3M Q;  1KAB A;  2VY3 A;  4PZ8 A;  4B3T L;  3CD6 A;  1PLF A;  2JA9 A;  3S2D H;  2L5T A;  2F0I A;  3VYS A;  1TWA H;  2ZM6 Q;  4RGT A;  1VQK A;  3IL8 A;  2F0G A;  4DR6 Q;  1SSO A;  4HTH A;  2VL6 A;  4DV2 Q;  4CKC A;  1HR0 L;  2Z6B A;  4Q5V A;  2N3S A;  2KVM A;  2PZT A;  3P7J A;  4JG2 A;  3T56 B;  4LW1 A;  5IGC A;  3S24 A;  2L11 A;  1LAC A;  1LTI D;  3U50 C;  4GOP B;  4N9T A;  2R93 G;  1E22 A;  2E2H H;  2K4K A;  3S2H B;  3WOE A;  2ENB A;  2UUC L;  4IJH A;  4DV3 Q;  1ROD A;  2KEN A;  1Q8K A;  3PO3 H;  5EBD A;  3H0G G;  3HEJ A;  3IRB A;  4C1N I;  5IT9 c;  1N32 Q;  2UUB L;  3PO3 B;  3S1R B;  4GLV B;  1KNE A;  3UE1 A;  3GTG B;  3K7A B;  4RGN A;  1EEI D;  1IL8 A;  1HZ9 A;  4C3I B;  3S1N B;  3CCS A;  2NWG A;  3DLL A;  4DKA C;  3HOV G;  5I9O A;  3PIO A;  3LWE A;  2HD3 A;  4YIJ A;  5JJI A;  1Y1V G;  4DR2 Q;  2NVY H;  2NZH A;  4PNY A;  1Q1E A;  1EFW A;  1OO9 B;  1KTK A;  5CGK A;  3D0F A;  3S1M B;  2NB0 A;  1JJ2 A;  4K0K Q;  5IYD H;  1UE5 A;  3TBI B;  3RLN A;  3I4N B;  2F52 A;  2DN8 A;  2JA8 G;  1UE1 A;  1YNX A;  2HHH Q;  1GVP A;  3KLS X;  3N6R A;  4AH6 A;  3MXP A;  4DV0 L;  1VQ9 A;  3CME A;  4S3S A;  3CCE A;  1UNS A;  2G9H D;  2AQ2 B;  5HY6 A;  4LF9 L;  1BCP C;  1GD7 A;  5C44 B;  3FDT A;  1Q81 C;  3TQY A;  1HFG A;  1X65 A;  3A54 A;  3MTS A;  4A3K H;  1X3G A;  1FJG L;  4LWC A;  3HOY B;  4ZLT F;  1HTP A;  1ICW A;  3S2H H;  2E2H B;  1O7I A;  1VMP A;  2B2W C;  2XNA C;  1HA6 A;  2E5L Q;  1F2L A;  3KFU A;  1EWC A;  2F0J A;  1SNM A;  2RF4 A;  3VYU A;  1D1K A;  5IP9 H;  1PV4 A;  3I90 A;  4QCL A;  1RD9 D;  2I5L X;  1Y69 U;  2UXD Q;  2C5C A;  4BBS G;  5CV4 A;  2LFN A;  4GN5 A;  4FF1 A;  1RKN A;  3GV6 A;  5M3M G;  1I94 Q;  2RCF A;  4A3M H;  2DNC A;  1M8A A;  2A74 C;  3TRZ A;  4A3E B;  4DFA A;  4DR4 L;  1VQF A;  1PZJ D;  2M00 A;  3BDC A;  4R4O A;  2ES2 A;  4KKU A;  1MI2 A;  4JBJ A;  3S9W A;  1WTR A;  2E74 C;  3M4Q A;  3L3O C;  5EQ0 A;  1QVG A;  1QB5 D;  1TY0 A;  5M3M H;  3A8K E;  1PFB A;  3A5Z B;  3FKI B;  5M3M B;  5FO9 B;  3V2T A;  2MP1 A;  5FLM H;  3RZD B;  1O7Y A;  3HOW B;  2QGQ A;  3MEH A;  3HOU B;  4WJW A;  2RHS B;  4XDX A;  2JA7 G;  2IPK D;  2KHS A;  1ONL A;  1Q7Y C;  3KDF A;  4YWK A;  1VQA A;  3RZO H;  2B2V A;  3HOY G;  4LUO A;  3R2I A;  1WTX A;  4GKK Q;  5CR3 A;  2EPB A;  4IFD J;  1HZC A;  1PH2 A;  4OL7 A;  4DR5 Q;  5KYL A;  2VZA A;  3NQI A;  3K5L A;  4BY7 G;  2XRQ D;  4R4I A;  3DWP A;  3NTH A;  2PZW A;  1PH6 A;  2JXM B;  4A3M B;  4DA2 A;  1EYC A;  1GOZ A;  4Q0F A;  1LTA D;  3S2D B;  3I4N G;  2NZ1 D;  5G3L D;  3NSW A;  2F0P A;  1Q12 A;  1CZW A;  3I7F A;  1PH3 A;  1R4P B;  1LTR D;  2A68 D;  3QOJ A;  5I6Y A;  1SMY C;  5JPM C;  3F1Z A;  5E4W C; 
#chains in the Genus database with same CATH homology
 5I2X A;  2PW5 A;  4TKO B;  4K8J A;  2VB3 X;  2SDF A;  4BWG B;  4F87 A;  4HSP A;  1PTO H;  1GUW A;  1LTT D;  4L6T B;  1G8Z D;  2JEA I;  5G3L F;  4IQZ A;  4QUF A;  1SE2 A;  3TZU A;  1XTC D;  1HHV A;  3A7A B;  4AYB B;  2XSC A;  2J4X A;  3H91 A;  2OF1 A;  4HSV A;  4U68 A;  4BBR B;  2IJ0 A;  3VR6 A;  1JR0 D;  2JP1 A;  2SOB A;  2ZT9 C;  3D6W A;  4MIU A;  1JQY D;  1F2Y A;  5JEA G;  4KD4 A;  1KAA A;  4ODG A;  2SNS A;  1QG7 A;  1FD7 D;  1H9K A;  2XIW A;  4IAL A;  1EY8 A;  2EXZ A;  2CQA A;  4K2K A;  2R6G A;  1I4X A;  1EL0 A;  1DOK A;  1PTO B;  5KEE A;  1B9N A;  2LKV A;  3BVG A;  1IYU A;  2MUY A;  1G2S A;  5FLX L;  2PW7 A;  1GHK A;  2NYZ D;  4XIG S;  1VDZ A;  5IGB A;  2F0E A;  2NTS A;  1TS2 A;  3D6C A;  2L55 A;  3J81 E;  4OO1 I;  4BY1 B;  4DXG A;  3KLS A;  3K57 A;  1QIL A;  4RA8 A;  3GTQ B;  2RSN A;  4L8J A;  5C0X I;  1NSN S;  2RBM A;  5DM6 3;  4CJ1 B;  1ESF A;  3I72 A;  1TS3 A;  2AWN A;  3X3N A;  3N52 A;  3CRL C;  1B2T A;  4G7H C;  4IUN A;  2B8G A;  5CV5 A;  2NTT A;  2EY6 A;  4K5W A;  5C5M A;  1STN A;  1D1I A;  3OWE B;  4QF4 A;  4HN7 A;  1W6K A;  4H7B A;  5COR A;  3A8I E;  1EIG A;  3BG3 A;  3QJY A;  1W6J A;  5A2Q E;  3RZO B;  3I73 A;  1SYD A;  3JAM L;  1S5D D;  4RFB A;  3FRP B;  2OEO A;  2ZXP A;  2I46 A;  2BDO A;  4CKE A;  1TWA B;  5EPL A;  3BZD B;  5E3F A;  1O78 A;  1SMY D;  1MSH A;  2F3W A;  2EDG A;  1I6V C;  2F0L A;  5D3D A;  3KLR A;  4A3F B;  2H4O A;  1JOR A;  2B8F A;  1RDP D;  2X69 A;  4CGY B;  3SVM A;  1WD0 A;  1ZKO A;  1C4Q A;  3OIQ A;  3A7L A;  1ET9 A;  1A6X A;  5I2Y A;  3QB3 A;  4B08 A;  1F9P A;  1ILP A;  4A3B B;  1KLG D;  3GO5 A;  2F3V A;  3IAY A;  1U4R A;  1QJO A;  2WB1 B;  2F0N A;  1PRT F;  4IN3 A;  4KN4 C;  1CQF A;  4F88 A;  5M5Y B;  2A68 C;  3A56 A;  2B2T A;  3IFT A;  4DAV A;  1I4P A;  2F0T A;  3NQT A;  4RCO A;  2FJ2 A;  2NUC A;  2XN9 C;  1S4Z A;  1NR2 A;  3MZ5 A;  3SE0 A;  1AP0 A;  5C3X A;  4IUQ A;  2EY5 A;  1A3T A;  5CMD A;  3DWQ A;  3CHB D;  2K5Q A;  3PUW A;  3GTK B;  5EPK A;  3NK9 A;  3ITP A;  3GTP B;  4HCE A;  1EZ8 A;  5CBA E;  3CRK C;  3PUZ A;  2K04 A;  4NP5 A;  4DAP A;  1TII D;  4XQN A;  4DNR B;  4X3T A;  3F2U A;  3FPP A;  4MN3 A;  3R3O A;  2WAQ B;  3K5N A;  3S15 B;  1H9M A;  1ILQ A;  2D62 A;  4KKS A;  1D6E C;  5JVH 3;  5IGD A;  1HXY D;  1G6Z A;  3BDL A;  2FMM A;  1BQQ T;  4IUU A;  1B9M A;  5IT9 L;  1NAP A;  1S5B D;  1TKW B;  1BO0 A;  4ZYS A;  1PMR A;  2B63 B;  2VUM B;  2EZV A;  2F0S A;  4C2M B;  5BN3 A;  4C3H G;  1U4L A;  5COY A;  3URY A;  3E0J A;  2A69 D;  4G57 A;  1B44 D;  4V0B A;  1SBB B;  1SYG A;  1AW7 A;  1ZXT A;  4IZ8 A;  1GUS A;  2HCC A;  3OIP A;  4GZY C;  2LMC B;  5EGT A;  1XWE A;  1II3 A;  1LO5 D;  3OHX C;  2JA5 B;  1D5X C;  5C3E B;  2VXW A;  2CVR A;  2R3Z A;  2KA7 A;  4UDU C;  1C8C A;  2HDL A;  5C5L A;  2O2L D;  5JEA J;  4ID6 A;  3K0Y A;  3D4W A;  4ZK9 B;  2NBF A;  2EYF A;  1SNC A;  1GHJ A;  5A2Q L;  2Q8T A;  3QOL A;  4IFD I;  4CKB A;  1XX8 A;  1RTN A;  1DXM A;  5JPN C;  4LAA A;  2IW3 A;  1YNJ D;  3I8Z A;  2FFK B;  4XXE A;  1EFI D;  2A5H A;  4C3J G;  2C9O A;  4BS9 A;  4A3J B;  3Q0A A;  2ID0 A;  1IKM A;  1OXT A;  3MA2 B;  5E1F A;  5ELF A;  3NE5 B;  1S5C D;  3VR3 A;  1BF4 A;  4H13 C;  5LL6 S;  3J7Y W;  2ZXR A;  3S14 B;  1K83 B;  3HGB A;  4KY6 A;  1H9S A;  1VF5 C;  2Y0S B;  5M5W B;  3EA6 A;  4C3H B;  2NN6 I;  1LTG D;  4F8M A;  4XT1 B;  3ND9 A;  5CV7 A;  1R9T B;  4X3K A;  4IUT A;  4Y7N B;  2EYO A;  2ICE C;  1STH A;  3WDN A;  4N9P A;  2JE6 I;  3FPU B;  3L7Z C;  1LTS D;  1PXU A;  3NUC A;  2KEE A;  3T53 B;  5J39 A;  1CK1 A;  3H6M A;  2O4X A;  1HUM A;  1SDF A;  4G7O C;  1I4G A;  4R9W A;  1WTP A;  4FF4 A;  1O80 A;  2B2Y C;  2NVQ B;  1JCK B;  2WII B;  4RKB A;  5F2D A;  3S1Q B;  3CKI B;  1I3Q B;  2Z8L A;  1A15 A;  5CV6 A;  3KK7 A;  3BS1 A;  3M7N A;  1LT6 D;  5JVG 3;  1R4Q B;  2EJG C;  5EPJ A;  2FIN B;  3IFD A;  4R8N A;  3D3R A;  2H1E A;  3D8G A;  1SJH D;  1IW7 C;  1D5Z C;  1TWC B;  1F9Q A;  4DK0 A;  4K6L A;  1PRT D;  2EYP A;  4Z9C B;  5IGF A;  1EY0 A;  2BA0 A;  1KDC A;  4IFD H;  1B1Z A;  3H94 A;  3OMC A;  5K36 G;  2KUM A;  2ICI A;  3M4Y A;  2QKI C;  4KY5 A;  2K32 A;  3D31 A;  3MXU A;  2IX3 A;  4KI0 A;  4KJO A;  1FR3 A;  4XQJ A;  2KED A;  3PUV A;  2F4I A;  1B50 A;  3SK8 A;  1BUV T;  2WP8 J;  1X3Q A;  1L0X B;  2WKC A;  3Q6S A;  3PUX A;  1EIH A;  5C4Z A;  1OXS C;  3BVZ A;  4RKL A;  1HFN A;  1CHQ D;  3PMF A;  4CJ0 B;  1F2M A;  1AFP A;  2A6E D;  2X6L A;  3DUZ A;  4TSS A;  5EKL A;  5M5X B;  1Q90 A;  1STG A;  3M3Y B;  2E76 C;  3H09 A;  3J81 L;  1EU4 A;  1U4M A;  1QNU A;  3W3A A;  3QWN A;  1DZ1 A;  4TQU S;  1PDQ A;  5CBE E;  1EY6 A;  5J1Z A;  5IOD A;  1F77 A;  5KNB A;  1HCZ A;  1LV9 A;  2BCO A;  5DM7 3;  2J0T D;  5ISR A;  1FNV A;  1ZYR C;  1UEA B;  2NVT B;  2K5W A;  1E2Z A;  4O1N A;  3M85 A;  1PTO F;  2TSS A;  4V19 0;  5C4H A;  4H0L C;  4RGM A;  4FXG C;  2KEC A;  2QDB A;  2EYH A;  4BBS B;  1SYF A;  2DY7 A;  1PFN A;  1LAB A;  3TDQ A;  4DK1 A;  2E2J B;  5C0X J;  3V96 A;  2QIL A;  3QO2 A;  1HA5 A;  4ZKB B;  1FGB D;  2IT1 A;  4NKL A;  1SNO A;  5A35 A;  1EY4 A;  4ZUI A;  1GJX A;  2M9V A;  2KCC A;  1BOS A;  1DCZ A;  3BDO A;  1JWM D;  2F1M A;  3VA7 A;  3SXH A;  1Y1V B;  1XXG A;  1SEB D;  3OMG A;  1CQV A;  3AU7 A;  2PCF B;  1PYW D;  3RD4 A;  3PIP 3;  2XWB B;  4NW2 A;  3KBG A;  2B2W A;  5J22 A;  1SYB A;  1JIC A;  1I4H A;  5ELB A;  3MAQ A;  3NWS A;  4R8I A;  1WTO A;  2EE1 A;  2AWO A;  1TR5 A;  4X3U A;  3T4A C;  2R92 B;  5T1G A;  1K8O A;  3L9A X;  1F2Z A;  2OXP A;  1WD1 A;  1XYI A;  4DGZ A;  4C1N K;  1DOL A;  5FK9 C;  3C1E A;  4IUV A;  3ZYY X;  1V1O A;  2N88 A;  1MD2 D;  1STB A;  3J7A V;  4K14 A;  5M3F B;  5KND A;  2E75 C;  4E6I A;  2BE5 D;  5DAU A;  2N55 A;  4JBW A;  1YNN C;  3VR5 A;  3R2T A;  3TP7 A;  1S5F D;  1NR4 A;  2K5D A;  1SE3 A;  1TS4 A;  5KGU A;  1E0B A;  1H9R A;  3MWY W;  2I07 B;  4IUP A;  1ENC A;  1CHP D;  4WOR A;  2RDH A;  1GUG A;  1HRJ A;  4OIJ A;  3UI2 A;  1Z6H A;  1QE6 A;  4G4K A;  1KDA A;  4DN4 M;  2K7V A;  1SYC A;  3ERQ A;  1I4Q A;  5NUC A;  1A3V A;  3VA5 A;  3U9S A;  1WTV A;  3FVQ A;  1RJT A;  3I4L A;  2KQ3 A;  3GTO B;  4QUC A;  1HQR D;  2V4D A;  4PQX A;  2PQE A;  4LMQ D;  3HOX B;  3DXJ C;  4WRD A;  2J7Z A;  1E2W A;  4KJN A;  3DHQ A;  3FMC A;  1OXV A;  3A8J E;  1BCP F;  3OWF A;  2Z4I A;  3R93 A;  3ONA B;  3TSS A;  2MGS A;  1PZK D;  1EQV A;  2B39 A;  4ABN A;  3WOF A;  1HUN A;  5FKA C;  3AB9 A;  3HP3 A;  2IX1 A;  3H3V C;  1TS5 A;  2RDG A;  5BN5 A;  1FYC A;  2AUK A;  5JOB A;  1PRT C;  2NN6 G;  4I65 A;  4CBV A;  1EWH A;  3TME A;  1RCV D;  3T13 A;  3GP7 A;  1Y8P B;  4RAU C;  1T5E A;  4ILW A;  5TSS A;  4FF3 A;  1X32 A;  1STY A;  5EKI A;  1TQO A;  1TY2 A;  2XRS D;  1HQM C;  1D5M C;  1JOQ A;  2MJ8 A;  1BXT A;  4FP5 D;  4ZUJ A;  4IUR A;  3NTK A;  3P20 A;  2F0Q A;  1HPC A;  3TP8 A;  1AEX A;  2F0M A;  4KD3 A;  3NP8 A;  1I4R A;  2TMP A;  1TWG B;  3A55 A;  2A6E C;  1RHP A;  5JEA H;  3MHB A;  5KYI A;  1YNN D;  4EGV A;  1BDO A;  4KY7 A;  2RQX A;  2EYJ A;  2R93 B;  3HOV B;  1J9O A;  4ZAI A;  2ZXO A;  4C3I G;  4K8I A;  4ZKC B;  5T1I A;  4QMG A;  5EBC A;  2AQ3 B;  1IYV A;  2PNR C;  1CI3 M;  3I4M B;  3SR1 A;  3EQL C;  2LS0 1;  2JSO A;  4HR7 B;  1OXU A;  3QIA A;  3W2D A;  3K5O A;  3K6O A;  3DM1 A;  4RCN A;  3C3L A;  4FXD A;  3NWT A;  3VR4 A;  1O7Z A;  2PPB C;  3SEB A;  4NDX A;  1WCM B;  3SDZ A;  3K59 A;  2R7Z B;  3NBI A;  2WV6 D;  3V05 A;  2NVX B;  3M7G A;  3SHL A;  1KDB A;  2AQ1 B;  1V43 A;  1SYE A;  2PO4 A;  3EJI A;  2QCP X;  3OOC A;  4EQN A;  3JAM E;  5EJW A;  5LHY 1;  1NUC A;  2YYZ A;  2FMC A;  4A3D B;  1BR9 A;  3J80 L;  3BVM A;  4K5V A;  5CC4 A;  2BA1 A;  4HMI A;  1CA6 A;  3GTL B;  2RKS A;  3I3C A;  4KKT A;  1SNP A;  4XT3 B;  2XWJ B;  3GTM B;  3RMH A;  3SK6 A;  4BY7 B;  3K5M A;  2JA6 B;  1G2T A;  1Z47 A;  2BE5 C;  3RUZ A;  1A2U A;  5JJZ A;  3PUY A;  4EQO A;  1AZQ A;  1EYD A;  2HQE A;  5C6A A;  2K6A A;  3HRZ C;  1EY9 A;  1Z7T A;  1EOT A;  1SNQ A;  2PMZ B;  2MPM A;  3RLF A;  4O42 A;  3G7L A;  1SXT A;  4KHV A;  1ML0 D;  4RHS A;  3AMU A;  3P1H A;  1IHZ A;  5IGE A;  2K28 A;  3BYT B;  4K2L A;  2CHB D;  3T16 A;  1CFM A;  5IGG A;  5C0X G;  1KNA A;  4WFN 3;  4QB4 A;  2EJF C;  4EQP A;  3C46 A;  5KRU A;  3GQB A;  4K6D A;  3VYT A;  2G9D A;  2RVL A;  1FNW A;  1HTL D;  4U67 3;  5E4X A;  5C0X H;  2R61 A;  2Q8I B;  4ME5 A;  1WVL A;  2O5I C;  4IFD G;  1WTW A;  2FHT A;  5IOC A;  5D65 A;  2A73 B;  1EU3 A;  4M8A A;  3C2P A;  5IIF A;  1M4V A;  2RSO A;  4DU9 A;  1LT4 D;  3MFG A;  3ERO A;  1L0Y B;  5ELD A;  4RGO S;  3OPO A;  4XTC S;  1CTM A;  1GUN A;  5BN4 A;  5K5P A;  2EY1 A;  3T51 B;  4XYO A;  2A69 C;  2DY8 A;  3HKZ B;  4HCS A;  2JA8 B;  5C3W A;  3C1F A;  5HUR A;  1ESR A;  3BYY B;  3OW7 A;  2VNU D;  4HED A;  1D2B A;  2Z1C A;  1EQT A;  1GUO A;  3NHH A;  3HG9 A;  2L9H A;  1CZG A;  2L1B A;  4ULL A;  2F0D A;  3HOZ B;  1DD2 A;  2BDN A;  4OGQ C;  2MHV A;  4BA2 I;  4PV1 C;  2KCN A;  4KMU C;  4HMJ A;  3SK4 A;  1CT1 D;  2L0C A;  3H0G B;  1F9S A;  2PYK A;  4XQQ A;  4CHT B;  3I70 A;  1UUP A;  2K01 A;  1ET6 A;  3K58 A;  3CU7 A;  2B2U C;  1LT5 D;  3D4D A;  2IWH A;  2L4N A;  1WTQ A;  2O5J C;  1EZ6 A;  2DNE A;  1Q1B A;  2GA4 B;  1SE4 A;  1EEF D;  1OXX K;  1F9R A;  2Z4H A;  2A6H D;  3PIO 3;  1DOM A;  4DXF A;  4MHE A;  2B2T C;  1H9S B;  2JEB I;  1UAP A;  4J6H A;  2D5D A;  2SNM A;  2D9U A;  4OIK A;  3I91 A;  2EY2 A;  4NMZ A;  1DJR D;  4X3S A;  3PO2 B;  4FVM A;  1SAP A;  1CA5 A;  3G6J B;  1A3U A;  1DM0 B;  2QEJ C;  1V1P A;  1EY5 A;  1ZEQ X;  3ND8 A;  4KV6 A;  4DAY A;  1MGS A;  3MFY A;  3TN2 A;  1QCB D;  1J8I A;  3KBX A;  3DWA A;  3O13 A;  4M1U B;  1JWU D;  2F0V A;  3NXW A;  1B4O A;  5M9O A;  5AFW A;  1JE4 A;  3HZX A;  1FNU A;  5C4J B;  1PTO C;  1QOH A;  4EVO A;  5HGT A;  2K05 A;  2F0U A;  3S17 B;  1STE A;  1LTB D;  4A3I B;  1BCP B;  1EY7 A;  1DON A;  1QWY A;  3CQZ B;  4C3J B;  1BNZ A;  1MBY A;  3OSO A;  2A6H C;  4C56 C;  1TU2 B;  2JYO A;  3P75 A;  2F0O A;  2X6G A;  1C48 A;  1KLU D;  2F03 A;  1SND A;  2IX0 A;  3PV0 A;  5K36 H;  4B9X A;  3GV3 A;  4FF2 A;  4RH6 A;  1JWS D;  1TWH B;  1U9R A;  1TWF B;  1LT3 D;  1H9J A;  1JOK A;  4KK7 A;  3GD7 A;  3TP6 A;  1G29 1;  2BOS A;  1PTO D;  2WIN B;  4OO1 G;  4DF7 A;  2HUG A;  2EOT A;  3QG1 A;  1STA A;  1V1P B;  3NBH A;  2IL8 A;  4KTA A;  5FO8 B;  4F7X A;  4JK1 C;  4KHZ A;  1BBX C;  1DYQ A;  1BCP D;  4LJZ C;  1AZP A;  5FOB B;  3J80 E;  1I50 B;  3NTI A;  1GXD C;  3TP5 A;  2L12 A;  5JAV A;  3D4R A;  3DEO A;  3IKJ A;  3EFX D;  2F0K A;  1T5X D;  2F0F A;  1SJE D;  2KJX A;  5C4X B;  2LY7 A;  4LK1 C;  4BA1 I;  3MXG A;  3LWU A;  4I7Z C;  3LX0 A;  2SEB D;  1RF2 D;  4ZRZ A;  2B2Y A;  5FLX E;  3Q24 A;  3HS0 C;  2D2C C;  3E5S A;  4CJ2 C;  4L63 B;  1NCV A;  1YNJ C;  4KN7 C;  2EJM A;  4OO1 H;  4TRD A;  4A3K B;  1JC7 A;  5CYU A;  3R8B A;  5KIX A;  2AUJ D;  4H44 C;  1Y8N B;  2RA4 A;  1LLR D;  3J7A F;  2KOL A;  2OT2 A;  4PMB A;  1B53 A;  2PZU A;  2F0W A;  2E2D C;  5I6W A;  5IT9 E;  4OHJ A;  4A3G B;  5DNF A;  5I9P A;  1K8M A;  2B2U A;  1SFO B;  1I6H B;  5CV9 A;  2EYL A;  1CM9 A;  1TVX A;  2B2V C;  2HCI A;  1Q3L A;  1EYA A;  2EVB A;  3DMU A;  5EKK A;  3Q23 A;  1Y8O B;  3E6Z X;  5ELE A;  1S5E D;  1TT2 A;  2JA7 B;  1ZYR D;  3U9O A;  3VR2 A;  1Y1W B;  4DNT B;  1AN8 A;  3MC0 B;  1MSG A;  2CW0 D;  2WKD A;  1QNK A;  4FXK C;  2F0H A;  1ENA A;  3Q22 A;  2E2I B;  2XVS A;  1SMY C;  1VCI A;  4FNF A;  1RTO A;  4HAE A;  4RWS C;  3SK5 A;  2Q8R E;  1ENF A;  3DEP A;  1O7L A;  4B9W A;  4FYD A;  2RDF A;  4K5X A;  4P2C B;  4XYQ A;  1PFM A;  1PZI D;  3MXN A;  1A2T A;  2VB2 X;  3VYR A;  3EVQ A;  3MVV A;  5CV8 A;  5DEH A;  4J8Q A;  4UAI A;  2HDM A;  1U4P A;  4G7Z C;  1JOO A;  5D14 A;  1GUT A;  5I4D A;  2NVY B;  4J1M A;  4PMW A;  2M2L A;  2WAC A;  3KUP A;  4FO2 A;  3KF8 A;  3S16 B;  3FEW X;  5KNC A;  4QIW B;  3LNN A;  3NPP A;  1B3A A;  1JB3 A;  2QF7 A;  4PMC A;  4ZQ3 A;  1IKL A;  4RHR A;  5FO7 B;  2YU9 B;  3TZD A;  1G91 A;  1X3P A;  2NN6 H;  1IW7 D;  1VF7 A;  2K1B A;  5ELC A;  1E2V A;  1Q8I A;  1V8Q A;  3X3M A;  2EYM A;  4A93 B;  2CW0 C;  5LL6 X;  5D3I B;  3M4O B;  1PRT B;  2K33 A;  3GTJ B;  1VMC A;  1KAB A;  1PLF A;  2L5T A;  2F0I A;  3VYS A;  4RGT A;  3IL8 A;  2F0G A;  1SSO A;  4HTH A;  4CKC A;  4Q5V A;  3T56 B;  2KVM A;  2PZT A;  3P7J A;  5IGC A;  2L11 A;  1LAC A;  1LTI D;  4N9T A;  3S2H B;  3WOE A;  2ENB A;  1ROD A;  5EBD A;  3HEJ A;  4C1N I;  3PO3 B;  3S1R B;  1KNE A;  3GTG B;  3K7A B;  4RGN A;  1EEI D;  1IL8 A;  4C3I B;  3S1N B;  2NWG A;  5I9O A;  3LWE A;  4YIJ A;  4PNY A;  1Q1E A;  1OO9 B;  1KTK A;  5CGK A;  3S1M B;  2NB0 A;  3I4N B;  3TBI B;  2DN8 A;  3KLS X;  3N6R A;  3MXP A;  4S3S A;  1UNS A;  2G9H D;  2AQ2 B;  1BCP C;  5C44 B;  3FDT A;  1HFG A;  3A54 A;  3MTS A;  3HOY B;  4ZLT F;  1HTP A;  1ICW A;  2E2H B;  1VMP A;  2B2W C;  2XNA C;  1HA6 A;  1F2L A;  1EWC A;  2F0J A;  1SNM A;  3VYU A;  1D1K A;  3I90 A;  4QCL A;  1RD9 D;  1Y69 U;  2C5C A;  5CV4 A;  2LFN A;  4FF1 A;  1RKN A;  3GV6 A;  2DNC A;  1M8A A;  2A74 C;  4A3E B;  4DFA A;  1PZJ D;  2M00 A;  3BDC A;  4KKU A;  1MI2 A;  3S9W A;  1WTR A;  2E74 C;  3L3O C;  5EQ0 A;  1QB5 D;  1TY0 A;  3A8K E;  1PFB A;  3FKI B;  5M3M B;  5FO9 B;  3V2T A;  2MP1 A;  3RZD B;  1O7Y A;  3HOW B;  3MEH A;  3HOU B;  4WJW A;  4XDX A;  2IPK D;  2KHS A;  1ONL A;  2B2V A;  3R2I A;  1WTX A;  5CR3 A;  2EPB A;  4IFD J;  4OL7 A;  5KYL A;  3NQI A;  3K5L A;  2XRQ D;  3DWP A;  3NTH A;  2PZW A;  2JXM B;  4A3M B;  4DA2 A;  1EYC A;  1GOZ A;  4Q0F A;  1LTA D;  3S2D B;  2NZ1 D;  5G3L D;  3NSW A;  2F0P A;  1Q12 A;  1CZW A;  1R4P B;  1LTR D;  2A68 D;  3QOJ A;  5I6Y A;  2K03 A;  5JPM C;  5E4W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...