1C8CA

Crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLAKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the chromosomal proteins Sso7d/Sac7d bound to DNA containing T-G mismatched base-pairs.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*TP*GP*AP*TP*CP*GP*C)-3'
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2000-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c8cA00
1O7ZA 2FJ2A 4HEDA 4X3SA 1WTPA 1CM9A 4XT1B 4ZAIA 5JJZA 4U68A 2NZ1D 2X6GA 2R3ZA 1M8AA 2KEDA 2Q8TA 1WTOA 1B53A 2XIWA 5CMDA 1ICWA 1HHVA 3I8ZA 5EQ0A 1ESRA 1HA6A 5T1IA 4HSVA 4CJ1B 5T1GA 5CBEE 3DEOA 1B50A 1HFGA 2BDNA 1JICA 4X3UA 3TZDA 4QUFA 2L1BA 3P7JA 1HFNA 4IUTA 1PDQA 2MJ8A 1QG7A 5D65A 1NR4A 1J9OA 1ILQA 2K04A 1NAPA 2HDMA 2EE1A 1F9QA 2RSNA 1C8CA 5E4XA 3SVMA 1F2LA 2HCCA 2HUGA 1AZPA 2M2LA 4R9WA 1QNKA 1U4PA 1IKLA 2K03A 1O80A 1XYIA 1B3AA 4ZLTF 2B2VA 1EL0A 1RTNA 4IUPA 2Q8RE 1NCVA 3I3CA 3KBXA 3LWEA 2HCIA 1G2TA 1ZXTA 4HAEA 1GUWA 3R93A 2K05A 2B2UC 1WTVA 1WD0A 2B2WC 2FINB 2K01A 4HCSA 4R8IA 2B2TA 1EIHA 5E4WC 3HP3A 4RWSC 1VMCA 2N88A 2VXWA 1WVLA 1LV9A 1X3PA 2SDFA 3KUPA 1EOTA 2X6LA 1B4OA 1U4RA 2FFKB 2KUMA 3MWYW 1PFNA 1BF4A 1WD1A 2H1EA 5EPLA 1O7YA 3I90A 1F9SA 1DOKA 2EOTA 4QUCA 1RJTA 3GV6A 1F9RA 2NYZD 2K1BA 4RA8A 1IL8A 1MI2A 1QE6A 4MHEA 3GV3A 4IUUA 4X3TA 1KNEA 1DZ1A 2FHTA 1XX8A 1RTOA 3H91A 4UAIA 5EJWA 1VMPA 2JYOA 1A15A 1JE4A 2MGSA 2N55A 2X69A 3IFDA 5COYA 1CA5A 2L9HA 1G91A 1ILPA 2L12A 1PLFA 3MTSA 3Q6SA 1AZQA 5EPJA 2B2VC 4CJ2C 1MGSA 3FDTA 3N52A 5AFWA 1B2TA 1RODA 4ZK9B 1S4ZA 3DEPA 2B2WA 1Q3LA 2IL8A 2J7ZA 2KEEA 2KVMA 2NWGA 1X32A 3ONAB 4ZKCB 1IKMA 1HRJA 3D6WA 2DY8A 4LMQD 1SSOA 5CBAE 1SDFA 4OIJA 4IUVA 2DY7A 4OIKA 4RAUC 1X3QA 2RA4A 4X3KA 4ZKBB 3G7LA 3FPUB 1AP0A 1E0BA 4XDXA 2RSOA 4NW2A 2KECA 1NR2A 3DM1A 1WTWA 2CVRA 1J8IA 3TN2A 4O42A 1WTXA 5EKIA 3I91A 1RHPA 2B2YA 1CA6A 5EPKA 2B2UA 2L11A 4CJ0B 2B2YC 2EPBA 1U4LA 1KNAA 1BNZA 1DOMA 2RVLA 1BO0A 1WTQA 2L4NA 4IUQA 2HDLA 4IURA 3QO2A 2FMMA 2MP1A 3F2UA 1DONA 3UI2A 1PFMA 2MPMA 1G2SA 2D9UA 1G6ZA 1ML0D 1EIGA 1HUMA 4XT3B 2KOLA 1PFBA 2K28A 1MSHA 5CORA 4MN3A 1WTRA 1SAPA 1MSGA 5DNFA 1F9PA 1BBXC 1HUNA 1U4MA 1EQTA 1DOLA 4DN4M 1TVXA 5D14A 2JP1A 2B2TC 3IL8A
chains in the Genus database with same CATH superfamily
4ZUIA 1EY6A 3EBEA 1RCVD 3ICEA 4DNRB 4K8JA 2E5LQ 1XMQQ 5C4ZA 1RIPA 5M3FG 1I4PA 5A2QL 1PDQA 3ZJYC 2E2IH 2F0KA 3MXPA 1NAPA 2YTVA 4KV6A 3D4DA 1LACA 4RMFA 4LFAQ 2DJFC 4BY7B 2ICIA 1TWGH 1I4HA 1HNXQ 3PV0A 3R93A 1EYCA 2FINB 2MFIA 4HCSA 4H7BA 5F2DA 1TU2B 1PTOC 3S2DH 1HNZL 4AYBG 1YHBA 4FDBA 1JJ2A 1PRTD 4F88A 2HIXA 1YNND 1CZWA 3I90A 5JEAH 4LF4L 3PO3G 2XSCA 1MI2A 1CKNA 1OXUA 3J81j 4FF3A 1FJGL 2VNUD 2RHSB 2EY6A 3GV3A 3OMGA 2KHJA 3QR8A 1V9PA 4KN4C 1NJIC 1IXRA 2O2LD 3BJUA 4FF2A 3FMCA 1AZQA 2JJQA 5GADC 3S16H 4TVAB 5CV7A 2NN6G 1S4ZA 4ZQ3A 1BVSA 4ZKCB 3I56A 4IFDI 2RDGA 1NNXA 2SEBD 1IL2A 1FL0A 2RCNA 4OIJA 1Z7TA 3LNNA 3K0YA 1VQ8A 4A3KG 1IYUA 5KYIA 3QIAA 1S3OA 3BVMA 2EXZA 3TN2A 3NPPA 1C4QA 4A3FB 1EQVA 2AKWB 3QG1A 4DUYQ 3Q22A 4X66Q 1HTPA 4JI1Q 3MAQA 1JOKA 1TWFB 4IPHA 4YWLA 2K5QA 3W5OA 1TR5A 2RDFA 1SXTA 4DV3L 5IGCA 1BCPC 1G6ZA 1ML0D 1HUMA 1II3A 2OT2A 4PNYA 3GO5A 2LMCB 1KQSA 2E8GA 1PZKD 1CQFA 4P71A 1Y1VB 5K5PA 2ENBA 1O7ZA 3RMHA 1HH2P 3ERQA 1EEFD 5J3BA 1SE4A 1B53A 1SYGA 2MQHA 4BY1B 1L1OB 1JOQA 4RGOS 5T1IA 2XWJB 1B50A 4JI0Q 3M7GA 2RKSA 2UUCL 1B1ZA 3KF6B 5CV9A 4A76A 3I4NG 1XMQL 4M8AA 2E5LL 4KHPQ 4LF8L 4L5SA 1STAA 1SYBA 1EU3A 1UE5A 1V8QA 1O7IA 2VUMB 1CKNB 1VQAA 3BU2A 1IYVA 2CCZA 2CW0D 3S15H 4IOCA 4DR6Q 2ES2A 1GUWA 5E1FA 2ZJRA 5E4WC 4K2LA 1FVIA 4ILWA 3STBC 4C3JH 1PH3A 2X6LA 1H95A 2KUMA 2F0TA 1O7YA 3PQIA 3U4VA 1D5MC 4QUCA 2K4KA 1IYJB 2V4DA 3BDCA 2EVBA 3NTKA 3D4RA 2K52A 1PMRA 4L5RC 4LF4Q 1CHQD 3H09A 5C4JB 4CJ2C 3HOUG 4BY1H 4YY3L 4B9WA 1ZEQX 1PH1A 2JEBI 3DHQA 4QY7A 1A3UA 2JA9A 2BDOA 4A3DH 3N6RA 2EJMA 1HZCA 2D2CC 1YHAA 4X3KA 3FPUB 1E0BA 2R61A 1Y1VH 2ID0A 3T13A 1YBYA 5ELBA 2QCPX 1K73C 4A3BB 1UAPA 1KAWA 1KIXA 4YCUA 3PGZA 1YVCA 2H5XA 1TT2A 3HOWG 2UXCQ 4CDFC 2JA6H 2CHBD 1EWHA 1EWCA 3M4PA 3I4MH 1EY9A 1CZGA 2KBNA 1DYQA 4K5WA 4BA2I 2EYFA 1WTRA 4RGNA 3FKIH 4IPDA 3S16B 1U4MA 2BH2A 4DN4M 4DV7L 1BXTA 3PUYA 5M5WH 1WTPA 3MEFA 4BWGB 1RD9D 2WKDA 1WTOA 3PIPA 3CD6A 1A3TA 4KHVA 4YWKA 1ICWA 4HSVA 4CJ1B 5KNCA 2QA4A 4X65Q 3VA5A 3HOZG 1VQBA 2Z6BA 2CWAA 4BXXH 5G3LD 4EGVA 3F2BA 1JB7A 1QG7A 3BDLA 1NR4A 4BY7G 2F0UA 3SR1A 1NTGA 4R9WA 3AFQA 3SE0A 1MJCA 2B2VA 1KLUD 3M7NA 1TWAH 2HCIA 5LL6X 1IW7D 2B2UC 3U9SA 4JI7Q 1RKNA 3PIOA 2B2TA 4BY7H 3TS2A 1RL2A 4DR7L 1A8VA 1VMCA 4A3JB 1WYDA 3AB9A 5M5XH 1SNCA 1GHKA 1JORA 2SDFA 2KCMA 4A3DG 2LKVA 3C3LA 3IKJA 1VQPA 4JBJA 1FNVA 1H9KA 3D4WA 1TWCH 1IBMQ 1LT3D 1DOKA 2EOTA 4PG3A 3OSOA 5BN5A 4XYQA 3WDNA 3K58A 1AEXA 1SYFA 4DV2L 5IT9c 2F0VA 3WOFA 1G91A 5I2YA 5GQOA 1STHA 4NP5A 3HOVH 1HNWQ 1JWSD 3E0JA 4QB4A 1KD1C 5K36G 2Y0SG 3EFXD 2XGTA 1Z9FA 3PIP3 2J7ZA 2J0TD 4IJHA 2NWGA 4XTCS 4DR2L 3U58A 1IKMA 1HR0W 1STBA 1QCBD 4ODGA 3OW7A 4RCOA 4LNQA 3K57A 1S5FD 5C0XH 4L63B 1NE3A 2F0NA 5JPNC 1PH6A 1ENAA 3K5OA 1JR0D 1J8IA 2MHVA 3U9OA 1Z6HA 4KKSA 5ELEA 2ZT9C 3I91A 1JMCA 5IY0A 4CDDC 3KK7A 1ENCA 2L11A 2N8NA 2DNEA 1X3FA 1KNAA 2R93H 3S2HH 2CH4A 2IWHA 4K0KQ 1Y14B 3K7UC 1P16A 2R92B 2JK8A 2FMMA 2XRQD 1TY0A 4CKCA 1XWEA 2JA6B 2HD3A 4DR7Q 5KNBA 4YHHL 1I6HH 3I72A 3GTOB 1MSHA 3M3YH 3RUZA 1B9NA 1EYDA 2JA7G 3GTGH 2A6HC 4LFCL 3GTQH 1FR3A 4HR7B 4PZ6A 4ALPA 4FYDA 1PHJA 2HHHL 4DUZQ 1M8AA 3AFPA 1CSPA 3FVQA 3L9AX 1DM0B 2UUAL 4DR1Q 2CW0C 1GOZA 3A55A 2R7ZB 3SDZA 2F0GA 4A3FH 2NTSA 1SBBB 2Z0SA 1ILQA 4LFAL 5E7NA 1WCMG 1I3QB 1U5KA 1I4QA 1T9HA 4X62L 4DV5Q 1TXYA 3GTPH 3G4SA 1MBYA 1SE8A 2WAQB 1WOCA 2K05A 2IW3A 5FJ8H 5IP7G 4OGQC 4RKBA 1XPRA 4HIKA 1KRSA 3I4NH 3GTLH 1L0XB 1XTDA 4PZ7A 1EFWA 1CT1D 1U4RA 4A3IH 1SYEA 1YZ6A 3NK9A 5C44G 1UE1A 4PQXA 4O0AA 4BBSH 1SMXA 2BE5D 2PPBC 4JI2Q 1VMPA 1D1IA 3HRZC 1BOSA 3J7YW 1A0IA 2EY5A 3BZCA 5IP9H 2ZTCA 1V1PB 4K5XA 2PQAA 1JCKB 4A3GG 5IWAL 5LMNL 4A3DB 3QWNA 1D5ZC 2KEEA 1STGA 2J4XA 4DFAA 3HOXG 3H3VH 3ULPA 3E9HA 2ZTDA 3NELA 4JI7L 1AFPA 2Z6KC 1L0YB 1GUTA 1MIUA 4F87A 4J1MA 1WTWA 1EYAA 2RDHA 3R8BA 3EIVA 2NVYB 4JBWA 2A68C 1Q1BA 4H02A 1RHPA 1SYDA 2KENA 2B2UA 2DJGC 3FP9A 4OELB 1RF2D 2AWNA 1OTCA 1UNSA 4ZCKA 4H44C 3A56A 1CFMA 5FLXc 3HOWH 1T5EA 2KCCA 3ER0A 5CORA 3EA6A 3OOCA 1HUNA 4LF5L 2PNRC 4GLAC 3CPFA 1SFOH 4DV1L 5D14A 1HZAA 2WB1E 1KXLA 3R2TA 2Q2HA 1JQYD 1W3SA 5IYDG 3CCSA 1PZID 4GKKQ 1HQMC 5IT9L 4JBKA 1XNQQ 2XIWA 3TSSA 2XWBB 4JI0L 3MXGA 2F52A 4MZ9A 4QUFA 5A35A 3HOYG 4KY7A 2MJ8A 3TMEA 4A3EG 4DV1Q 3PCOB 4KD4A 2VQFL 1S5ED 4DF7A 1BCPF 3H15A 5JAVA 3I4LA 3CC4A 3LGJA 3HOXB 4JI3Q 4ZLTF 4LFBL 3LWEA 2AHOB 1A2UA 2TMPA 3PUVA 1YNJD 1XMOQ 4DU9A 1SNOA 1C9OA 4A3IG 3TZUA 3W2DA 2R6GA 2OTLA 2F0DA 4LUZA 1LYLA 2H4OA 4OONA 3S14B 3FEWX 4GNXC 2LY7A 4HCEA 3M4OB 2CQAA 4HJ5A 1PH5A 4MHEA 3F1ZA 3K7AB 1PH2A 2MGSA 1A15A 4IFDH 2PQEA 4ME3A 3C1EA 3E5SA 3I7FA 3N52A 4RG1A 5C4XB 2XN9C 1D5XC 4X6AH 5C3EH 1NMFA 1E24A 3NENA 2NN6H 5IGFA 4DR6L 4XDXA 2I5HA 3NQIA 5IIFA 3HOZH 3NXWA 1TIID 3VR6A 1SMYD 5KRUA 1NY4A 3HZXA 1FYCA 3OIPA 4XQNA 1Q82C 3TP8A 2B2YC 2IT1A 4FF1A 1YJWA 1CUKA 2K50A 4Y7NH 1B7YB 1YJNA 3UI2A 3A7LA 1S5CD 2E2HH 4DV5L 2QGQA 3K59A 4LF7Q 3FKIG 4DK6C 3J7ZC 1B44D 2EXDA 3BVZA 1QJOA 3CU7A 2NVXH 3I4MG 5FO8B 2X6GA 2JN4A 3F8TA 1HJPA 4DR1L 5FO9B 3S2HB 4DV3Q 2XTIA 4K6DA 3EJIA 1ESRA 4UHVA 3O13A 2F0LA 3UDXA 4DUZL 2BDNA 1JICA 2BA0A 5K36H 4OXPA 4A3JG 1XNQL 1BUVT 3A7AB 1PA6A 3HEJA 3CHBD 4RHSA 2WACA 3VDYA 3PO3H 5EKLA 4JK1C 4N8X1 1OXVA 3CMAA 1B3AA 3CCEA 3JC66 3GTPB 1WI5A 1S5DD 4DAVA 5IYBH 1XPUA 3QB3A 1LTAD 1WD0A 2JXMB 1I4RA 1I3QH 3CC2A 4LF9L 4DV0Q 2N88A 1YNNC 5CV4A 4LF6L 3KF8A 3I4OA 4FXDA 1X65A 5IGBA 4JI8L 1PFNA 1BF4A 2O4XA 1W6KA 4P2CB 4J6HA 3JAML 3GV6A 2EJGC 5C3XA 4B3SQ 3BZDB 2D0OA 3OWFA 1XX8A 1R9TB 1PRTB 2N55A 4JI4L 2JA8G 1A6XA 1GVPA 3RD4A 2L12A 4DK0A 4PZ8A 1H9SA 3SK8A 1VQHA 5M3MG 2F0JA 1Q81C 4ZK9B 5IP7H 3U4ZA 1CKOA 4MTKA 4DR3L 2A73B 1JWUD 4CDCC 1N36L 1H9MA 5FLMH 2CQOA 4LMQD 3T1HQ 3PUXA 4PV1C 2DUDA 2F0EA 5C3WA 4L5QA 2IHEA 3CXCA 1EOVA 1IBKL 1FD7D 5C4JH 4QIWE 2KECA 3DM1A 1IBML 2VS1A 4A3BG 4L6TB 4A3KH 2A69C 3BDOA 1GJXA 2ZM6Q 1Y8OB 1Q46A 5I9PA 1R4PB 4KJOA 3ITPA 4NXNL 1AN8A 5BR8L 1L1OA 2AQ2B 3BYTB 2MP1A 3F2UA 1PFMA 1EY4A 4FO2A 5IYCG 3J80i 2HIVA 1VQ6A 3G6JB 1VQ9A 5GAGC 1X54A 3D3RA 1EWIA 4OX9Q 1BBXC 4Q5VA 4KKUA 2PZUA 2JP1A 3J80L 4HEDA 1QOHA 1CM9A 1YIJA 1X6OA 1PH9A 3CW2C 4ME5A 4FF4A 5ELOA 2VW9A 3K80C 4RGTA 2PI2A 2WAQG 4KMUC 3JAME 1CSQA 5FO7B 3PF4A 4JCVE 2K5HA 4DK3C 1LO5D 2KJXA 1J9OA 2K04A 3CCLA 4A3JH 1UUPA 2OTJA 3NP8A 2M2LA 4JV5Q 1SNMA 1Q86C 3OWEB 1QNKA 4EQNA 3KFUA 4P75A 3OW2A 3I73A 5EKKA 2EQSA 4AYBE 1NCVA 3I3CA 3T4AC 1EIFA 4HAEA 3RN2A 1VQLA 1TWCB 3J81E 1N32L 1X3GA 1VQCA 3TP7A 2XNAC 3UDIA 4DR4L 3IAYA 1C48A 2VXWA 2PNHA 5M3FH 1LV9A 2L0CA 3RNUA 3KUPA 1PYWD 1VQEA 2FFKB 5DM73 2Y0SB 4NXMQ 4BBRG 5IOCA 3GP7A 4C56C 3M4QA 2Z8LA 2VB3X 2GN5A 4QIWB 3KLWA 1IL8A 3E3XA 5I2XA 4KHZA 4X3TA 2F0QA 1JE4A 5M5WB 2VQEL 1CA5A 2QEXA 3MTSA 1PLFA 3G6EA 2O5JC 4GNXA 2L15A 4YY3Q 1KDCA 5AFWA 2EYOA 5IYCH 1ICFB 2IHFA 5C44H 2KVMA 4A3MG 3NBIA 4A93B 2WP8J 3FHWA 4ID6A 4OO1H 1H9RA 2K33A 1VDZA 2IX0A 1NR2A 3URYA 2ZJQA 1SR3A 3I2ZA 4A3KB 3UDGA 3T1YQ 5M3MB 2A68D 4NXML 1SLJA 2RVLA 1VQ5A 2D0PA 1Z47A 1E1TA 2E2JH 3MVVA 2HQEA 4KLKA 3MHBA 2UUAQ 4C3HB 4OEMB 4KKTA 4DR4Q 3KJPA 5JJLA 1G8ZD 2EYPA 5JEAJ 2IY5B 1SAPA 5DNFA 1YEZA 2F0SA 3I4MB 2L55A 3GD7A 2YU9B 2VY3A 3IL8A 2FJ2A 3AQQA 1TY2A 4C3IG 2KEDA 3MC0B 4DV4L 2Q8TA 2VZAA 3VR5A 1SROA 2A1AA 2WIIB 4B3RL 1A62A 5FKAC 3W1GA 3PIO3 2Q2UA 4O2DA 1HFNA 1EY0A 2RQXA 3AEVA 4DR5Q 1C8CA 2HDMA 2EE1A 1C0AA 4WFN3 3T1YL 1IW7C 2HQLA 1IKLA 3F2CA 4JOIC 4A93G 5GAEC 2K5VA 2AUJD 1X56A 1ZXTA 4JYAQ 4DNIA 4R4OA 2E2IB 1SFOB 5C0XJ 2K01A 3NTIA 3CCJA 4RWSC 1SRUA 3M4YA 1X55A 1D6EC 4JI5L 4KY5A 3H94A 2YV5A 2K6AA 2VL6A 2H1EA 2D5DA 2F1MA 5C0XG 2E76C 1SE3A 3WOEA 4PMCA 4CKBA 3F2DA 3HG9A 2R7DA 3PUZA 4IPGA 4H0LC 3C1FA 1PXUA 1Y8NB 3HOVG 3PO2G 3NTHA 1ASZA 1AE3A 1JB3A 3PUWA 4UP9A 3ZYYX 3KDFB 5LMNW 4FVMA 2YTXA 1P8LA 2B2WA 2IL8A 2UU9Q 2EY2A 2A69D 1D2BA 1TWAB 2DY8A 2FMCA 1SDFA 4GLVB 4OIKA 1VQGA 3K5NA 1EY5A 3NBHA 3GTJH 5KIXA 5M3FB 2VUMG 1S40A 2KHSA 3RZDH 4GOPB 1N33Q 2ZXPA 3DMUA 5DAUA 1PZJD 2EYLA 3TEHB 3A74A 5C6AA 4XQJA 2KA7A 4XT3B 2K28A 2XRSD 5DEHA 4LAAA 4J15A 1C7YA 2Z6KA 1QILA 4X3SA 2OQKA 4KD3A 4JI5Q 2M9VA 1EZ6A 3S24A 4E6IA 4HJ7A 4A3IB 5CMDA 5C4XH 3DWQA 5EQ0A 2UUCQ 1BBWA 2ASBA 2BA1A 4TRDA 1WCMH 1O7LA 4K6LA 1EIYB 3A54A 4X62Q 5IODA 4IALA 1LABA 2A74C 1I50B 2HCCA 2F3IA 2IX3A 1UE6A 3BG3A 4A3MH 3OYYA 1GM5A 3KBXA 4C2MH 1YNXA 1KAAA 3KDFA 1V1PA 5TSSA 4DV4Q 2PQAB 2KCNA 4GN4B 1LTSD 1O78A 3MWYW 1Y1VG 1R9TH 1PYSB 3P1HA 5BN4A 2A8VA 2K1BA 3S1NH 4C1NI 5I4DA 1GUOA 1LTTD 1CQVA 1LT4D 2X69A 1UE7A 5COYA 2L9HA 4UY8C 2F0PA 4JVZA 1I6HB 2A19A 5EBDA 5IGDA 5EPJA 3TREA 3TP6A 1PTOB 2R93B 1KC8C 4DV0L 3D6WA 1G6PA 4LWCA 2F0FA 4AIMA 2QW7A 2NVQB 3V2TA 4NW2A 1YI2A 4JI6Q 2E74C 3A8KE 4DR2Q 3W3AA 4YCVA 1SJED 5CGKA 3HKSA 4KTAA 3SGIA 4ZRZA 3LX0A 2L4NA 1E3PA 1VCIA 4B3ML 3E9IA 4MNOA 3MXNA 1HNZQ 3ULLA 1Y1WB 1FGBD 3NUCA 3CPWA 1TKWB 1MSGA 3TP5A 1EQTA 2ZXRA 4DK1A 3KLSA 5C5MA 4C2MB 4A3CH 5FK9C 4POGA 1KTKA 5JJZA 3GTMH 1EYGA 2NZ1D 4B3RQ 3NWTA 2DGYA 3NE5B 2K7VA 4OHJA 1A63A 2NN6I 4JI1L 3GQBA 4DXGA 3CRKC 1KL9A 3EQLC 1OO9B 4RH6A 1YITA 4HIDA 1TWFH 2GVAA 2K03A 4NB3A 4QL5A 4LF5Q 1TWHH 1RTNA 5M5YH 2F3VA 1VF5C 1XNRL 3IRBA 1K9MC 5CV5A 2D62A 2B8FA 2JA5B 2LXJA 1K0SA 4DV7Q 3J81c 2YTYA 4YIJA 1QVGA 3DXJC 1S72A 1SE2A 4B08A 4KI0A 2ZTEA 1W6JA 2MUYA 2EYHA 3I70A 1L0WA 1DZ1A 5LMUL 2F3WA 2Z4IA 4A3EH 4UAIA 1BBUA 4N9PA 4HIOA 3L0OA 4GZYC 4HMIA 1ILPA 1K8OA 1TS3A 3BS1A 1TS4A 1CKMA 3A0JA 5BN3A 3VA7A 1UWVA 2EYJA 3Q0AA 1YJ9A 4GKJQ 1QNUA 4GLXA 5IT9E 4NPSA 2VQEQ 2BE5C 3VR2A 1GUSA 2DY7A 4ZKBB 1X3QA 1N9WA 2AQ3B 1VQDA 4K2KA 3G71A 1Y8PB 2R7ZH 2F0OA 3KOJA 4G7OC 4BA1I 2F0HA 2VQFQ 3D0FA 2F0IA 1D7QA 1S5BD 1K28A 2K75A 3Q24A 2G9DA 1TS2A 5C3EG 4ULLA 4C3IB 3H0GH 3KYHC 4FXKC 2IX1A 1BDOA 3GTGB 3KF6A 2Q2IA 4WRDA 5FOBB 3CMEA 2Z9HA 3J80E 3RLFA 3HFZB 1Y1WH 3H3VI 1IHZA 5FJ8G 2NUCA 2IPKD 2PZWA 1CI3M 1DOLA 4R4CA 2UUBQ 1G51A 1QZHA 2UXBQ 2NZHA 1EY7A 1JJCB 4X65L 4A3GH 3H0GB 4JBMA 3M4OH 1Y1WG 1B9MA 5ELFA 5IP9G 5T1GA 5CBEE 4A3FG 2F0MA 3KF8B 2L1BA 2EYMA 3BYYB 4X64L 1N33L 4IUTA 2QF7A 2PO4A 1SEBD 1FGUA 4HMJA 5D65A 1XTCD 3QJYA 5M5XB 1LTGD 3DWPA 4G7HC 1ZKOA 4LK1C 4FP5D 3TRZA 3K7AH 3A8IE 1Q12A 2PMZE 1PRTC 1DCZA 4KHPL 1L2FA 1EU4A 1XYIA 4IUPA 4A3MB 4AQYL 2Q8RE 3Q8DA 5AJ3L 1CHPD 2DN8A 5BR8Q 3S14H 1XJVA 2NVYH 1JOOA 3CQZH 3H6MA 1UEBA 2WKCA 2ZM6L 1JJGA 1K8GA 5CC4A 5EPLA 2TSSA 1KDAA 2SNSA 3K6OA 5HY6A 1F9RA 1I94L 1YNJC 1QE6A 3MFYA 1I50H 4JI2L 4QF4A 5IE8A 2YU9H 2N78A 5J22A 3TQYA 4OL7A 2I46A 1B8AA 4XIGS 3VYRA 2BCOA 2E2DC 2WV6D 4DR3Q 3HGBA 1B2TA 4DUYL 4R1JA 3J7A5 1LTBD 5I6YA 3K5LA 1ONLA 1LM0A 5KYLA 1SSOA 4OO1G 4RAUC 3BZKA 1R4QB 1A3VA 1M1KC 3MA2B 1JE5A 2G9HD 5CYUA 1VF7A 1STYA 1BCPD 1Q8KA 1DGSA 4XXEA 1I94Q 2JA7H 2R7ZG 1IBLQ 4QQBX 3KBGA 4LF6Q 2JEAI 4A93H 3M85A 1I4GA 4DNTB 2EPBA 4CJ0B 5JEAG 2OWOA 5IYBG 2RBMA 1XNRQ 4N8FA 4CHTB 1DONA 2B3GA 4OWTB 5C0XI 3PO2B 4BY1G 3GTKB 3HOVB 1PV4A 2WINB 3DUZA 1N32Q 1VQNA 1SMYC 1V43A 2CWPA 3NBHB 5DLQE 5AJ3Q 3ND9A 4P72A 1F9PA 3S2DB 2QKIC 4WJ4A 4R4IA 1TS5A 3QOLA 4IFDJ 1RDPD 5FLXE 3S17B 1UEAB 4U68A 4DGZA 2K14A 2KCTA 3VYSA 4YHHQ 4C1NK 3MEHA 3S1MB 3JAMi 3T53B 1HHVA 5KEEA 3S1QB 1HA6A 4FNFA 2RCFA 3J81i 3NSWA 4CKEA 4M1UB 4DAMA 1OXSC 1Q7YC 1VQJA 1SNDA 3GTLB 4FXGC 5LL6S 1MJEA 5CR3A 2NB0A 3SK6A 1F9QA 3STBD 3T56B 1AZPA 1HZ9A 2UXDL 2I5MX 4A3EB 2QILA 5HGQA 1QB5D 2MO1A 3HKZB 3SHLA 5KGUA 3CF5A 3A5UA 2EJFC 5ELNA 4DV6Q 3S15B 4B3TQ 1Q8IA 4B3MQ 1WTVA 2B2WC 1E2ZA 3CCQA 1K8AC 1EIHA 2JE6I 1VQ4A 3HOZB 4UDUC 3CAMA 2A6EC 1PFSA 2I07B 1YHQA 1EOTA 3A8JE 2UXCL 1WD1A 1EZ8A 2PZTA 1A2TA 2LFNA 4C3JB 1K83B 1GUNA 4LUVA 2FHTA 4HJ8A 3HS0C 5EJWA 4C3HG 1IBKQ 2F0WA 1SN8A 2LXKA 4CDEC 3MFGA 1HR0L 3Q6SA 3H3VC 2B2VC 1HCZA 4G4KA 4G57A 2IJ0A 1N36Q 2PI2E 3DEPA 1HPCA 2E75C 5C5LA 1IZ6A 4R4TA 3ONAB 1GD7A 1F2YA 5JPMC 1MKHA 2QEJC 2E2JB 3GTMB 3CKIB 2XVSA 4IQZA 4O1NA 1VQKA 2WFWA 2K5NA 1B70B 4RFBA 4CGYB 4PMWA 5CV8A 4R8NA 4A3LH 4HJAA 1WTXA 4JV5L 3D31A 3PO2H 2HT1A 1HZBA 2QDLA 3R2IA 2Q8IB 4I65A 4CBVA 4YWMA 1NMGA 1WTQA 1BO0A 1F2ZA 3VR3A 1QUQB 4IURA 1XMOL 2N49A 3RR5A 5JOBA 2K5DA 2D9UA 2WB1G 4HN7A 1EIGA 3MZ5A 4Q0FA 1SNPA 2UXBL 2B29A 2C35B 3CRLC 3OMCA 3FKIB 1QZGA 1J6QA 3HOYH 1ESFA 1K3RA 1TVXA 4Z9CB 1I6VC 1M90C 1LTRD 4LF8Q 4K8IA 5JJKA 3HOUH 4WJWA 3GDEA 4UP7A 3SEBA 4GKKL 4IPCA 4B3TL 1E2WA 2I0QA 5D3IB 1SNQA 5GROA 2BOSA 4LUOA 2RSNA 4NKLA 3W1BA 4GN3B 4BBSG 1F2LA 2HUGA 2SNMA 1U4PA 1M4VA 5DM63 4V190 3K81C 4ZUJA 3PF5A 2CFMA 2OCEA 1G2TA 4KN7C 4HJ9A 1VQMA 1FNUA 4R8IA 4B9XA 4V0BA 3HP3A 1W2BA 4EVOA 3K0XA 3DWAA 2HHHQ 1AW7A 2E2HB 1X3EA 2NTTA 3GTJB 4Y7NB 4TQUS 5D3DA 1T5XD 4KK7A 2I5LX 1F9SA 4LFCQ 2NZOA 4JI4Q 4RA8A 1E1OA 2Z1CA 4GS3A 5FLMG 4UP8A 1KHIA 1SYCA 2LS01 3OIQA 4JC0A 4QGUA 1TQOA 1LT5D 4RKLA 5IGGA 3KLRA 3RLOA 1XXGA 1H9JA 2NVQH 4BS9A 4L8JA 4HIMA 3FDTA 3RLNA 4JI8Q 1U9RA 4DXFA 3UDFA 4DAPA 1QVFA 1QUQA 1VQIA 1HRJA 5JVG3 4LF9Q 3HKZG 4DKAC 1K8MA 1B3QA 1DXMA 2RA4A 4K14A 3EVQA 2VUMH 1PH7A 1ET6A 2CVRA 3HOYB 3I4NB 1E7ZA 3SK4A 3UE1A 1H9SB 3J81L 2QDBA 5JJIA 5EPKA 4QJFA 1QVCA 1HA5A 5ELDA 2PCFB 1LTLA 2ZJPA 3S1QH 3BVGA 1U4LA 1ZYRD 1DOMA 4NMZA 4OWXB 4JYAL 3VR4A 3VYUA 2EIFA 2OQ0A 1F77A 2MPMA 2ZXOA 4DV6L 5EBCA 3RN5A 4DV2Q 3C2PA 4YCWA 4BBRH 4MN3A 2B8GA 1HNXL 5J1ZA 1OXXK 1V1QA 1VS0A 3TS0A 4UPAA 2B2TC 4XT1B 4QMGA 3ULJA 2R3ZA 2FXQA 1OXTA 2MNAA 2WB1B 3I8ZA 5GAHC 4WORA 3M3YB 1BKBA 3DM3A 1HTLD 4BBSB 5E4XA 1KRTA 4XYOA 3NHHA 1GKHA 1LUZA 2R92H 1BCPB 1V1OA 2B39A 3LWUA 1PTOD 3CP0A 2VB2X 2MO0A 4K0KL 1DD2A 5EGTA 1E2VA 1LT6D 1XPOA 4DA2A 1X3PA 1B4OA 4EX5A 1GUGA 1TWHB 3CCVA 3OTOQ 4C3IH 5FLXL 4H13C 2GA4B 3PO3B 3S1MH 1Q1EA 2NYZD 4LW1A 4RGMA 2C9OA 3D8GA 4J8QA 5C44B 2F4VQ 4C3JG 3UE0A 3OPOA 2NVXB 3DLLA 4IFDG 3U50C 3R3OA 1SJHD 2NVTB 3P75A 4AYBB 1BR9A 1MGSA 3HOWB 5M9OA 1HNWL 4JW0A 1HQRD 2ALYB 4EQPA 1KABA 2K5WA 1N34Q 1NBWA 4A4IA 3MXNB 4IO9A 5CV6A 1HR0Q 1AP0A 1I4XA 3TDQA 2NVTH 2G5DA 4TKOB 3WWVA 4O42A 2F03A 1PTOF 3B6YA 3KJOA 2KHIA 4IUNA 3CCMA 3GTKH 4Y52H 3H0GG 3HOUB 1BNZA 4C3HH 1ET9A 2HDLA 4IOAA 3IFTA 3QO2A 1TWGB 1BQQT 1JWMD 4A3CG 1G2SA 4IN3A 1F2MA 4KJNA 1FNWA 2O5IC 2NBFA 1STNA 2JA7B 5C4HA 5JVH3 1D1KA 3TBIB 1E22A 4ZYSA 3OTOL 2L5TA 5ISRA 2UXDQ 3VYTA 1PH8A 1MHWC 2A6HD 3OHXC 2R92G 4DR5L 5C3EB 4N9TA 3J7AV 2JA5G 2A5HA 3TZDA 4X3UA 4A75A 3P7JA 2CKZB 2SOBA 3ND8A 4NDXA 3X3MA 1LTID 4GN5A 2WAQE 3S1NB 5EAYA 1J5EQ 4OX9L 3K8AA 3S1RB 3QOJA 3L3OC 2CH4W 2BH8A 2B63B 3FPPA 1EL0A 1PYBA 4RHRA 2N3SA 3GTQB 1EQRA 3CC7A 1EQQA 3RZOH 3AU7A 3SXHA 3NQTA 4IJLA 5IGEA 5IWAQ 5LMNQ 2UU9L 4A3LG 1Q90A 5C4XG 1PRTF 2R7FA 1DJRD 4S3SA 2OXPA 1VQ7A 4XQQA 4DAYB 2A6ED 1RJTA 2EDGA 5M3MH 3D6CA 3EROA 3HOXH 1CTMA 2M00A 4P73A 1KNEA 2LSSA 3CQZB 1RTOA 3H91A 3T1HL 3FRPB 2JYOA 4QCLA 1MD2D 2JQOA 3AMUA 4DPGA 2GVBA 1L1OC 4X66L 4MIUA 5E3FA 3E0EA 1RODA 2OEOA 3AYHB 1QWYA 5I6WA 3CCUA 1Q3LA 1AH9A 3V96A 2AQ1B 2V1CC 1ASYA 1ZYRC 3S9WA 4I7AA 1VQOA 1WFQA 4APVA 1GXDC 1I5FA 2RSOA 1X9NA 4BXXG 1Y69U 5KNDA 4EQOA 1CA6A 1PH4A 4A3GB 2ATWA 2Q2TA 4IZ8A 4MTNA 3KLSX 4IUQA 1D8LA 3A5ZB 1PTOH 2JSOA 2KQ3A 2RF4A 3P20A 3S17H 1U0LA 2KOLA 4L5TA 4ABNA 1N8RC 2PMZB 1FJGQ 3G48A 1EUJA 2JA8B 3JAMc 2AUKA 4U673 1JT8A 1EFID 2DNCA 1J5EL 2P5ZX 4TSSA 4F8MA 4ZAIA 1GHJA 1GO3E 2YYZA 1K0RA 3K5MA 4GOPA 5G3LF 1EEID 5LHY1 1KDBA 2Y0SE 1VQFA 3DEOA 1HFGA 4HSPA 2JA5H 1STEA 2ICEC 1PVOA 2PW7A 2EZVA 5L37A 1IBLL 3I55A 3M9BA 3SVMA 4DAYA 4LF7L 2B63G 2UUBL 1O80A 5J39A 4G7ZC 2R93G 3X3NA 1ENFA 4OWWB 3SK5A 5IYDH 1AE2A 4KY6A 4GNXB 4RCNA 1WVLA 4P74A 4NXNQ 4JI6L 3Q23A 2AWOA 3CCRA 3RZDB 3ERSX 1LLRD 2PYKA 1K3BC 4IUUA 2Z4HA 2JA6G 3IFDA 4K5VA 5ELCA 2AMCB 4JPBW 4A3BH 3PSIA 3J80c 4GOPC 4JOIA 5HURA 4OO1I 1NSNS 4I7ZC 3T16A 4POFA 4WJ3M 3MXUA 3T51B 4BBRB 1N34L 5I9OA 5H1SE 1NUCA 4GKJL 3GTOH 5M5YB 1KLGD 1WJJA 1X32A 5CBAE 2B63H 2OF1A 4IUVA 4R4QA 1CK1A 3NEMA 1JC7A 3G7LA 4EQ5A 4JG2A 4AQYQ 3EN2A 5LMUQ 2F4VL 2JA8H 1EY8A 3RZOB 4B3SL 3C46A 4HTHA 5EKIA 2B2YA 2EY1A 4AH6A 1WCMB 3V05A 4F7XA 2K32A 4X64Q 1G291 3NWSA 2PW5A 3J7AF 2RHQB 3L2PA 3S1RH 3PMFA 4PMBA 4JI3L 4LFBQ 5A2QE 1PFBA 3E6ZX 2F4IA 3L7ZC 5HGTA 3HKZE 1WTHA 4LJZC 5NUCA 1HXYD 1K83H 2C5CA
chains in the Genus database with same CATH topology
4ZUIA 1EY6A 1RCVD 4DNRB 4K8JA 5C4ZA 1I4PA 5A2QL 1PDQA 2F0KA 3MXPA 1NAPA 4KV6A 3D4DA 1LACA 4BY7B 2ICIA 1I4HA 3PV0A 3R93A 1EYCA 2FINB 4HCSA 4H7BA 5F2DA 1TU2B 1PTOC 1PRTD 4F88A 1YNND 1CZWA 3I90A 5JEAH 2XSCA 1MI2A 1OXUA 2VNUD 4FF3A 2EY6A 3GV3A 3OMGA 4KN4C 2O2LD 4FF2A 3FMCA 1AZQA 5CV7A 2NN6G 1S4ZA 4ZQ3A 4ZKCB 4IFDI 2RDGA 2SEBD 4OIJA 1Z7TA 3LNNA 3K0YA 1IYUA 5KYIA 3QIAA 3BVMA 2EXZA 3TN2A 3NPPA 1C4QA 4A3FB 1EQVA 3QG1A 3Q22A 1HTPA 3MAQA 1JOKA 1TWFB 2K5QA 1TR5A 2RDFA 1SXTA 5IGCA 1BCPC 1G6ZA 1ML0D 1HUMA 1II3A 2OT2A 4PNYA 3GO5A 2LMCB 1PZKD 1CQFA 1Y1VB 5K5PA 2ENBA 1O7ZA 3RMHA 3ERQA 1EEFD 1SE4A 1B53A 1SYGA 4BY1B 1JOQA 4RGOS 5T1IA 2XWJB 1B50A 3M7GA 2RKSA 1B1ZA 5CV9A 4M8AA 1STAA 1SYBA 1EU3A 2VUMB 1V8QA 1IYVA 2CW0D 1GUWA 5E1FA 5E4WC 4K2LA 4ILWA 2X6LA 2KUMA 2F0TA 1O7YA 1D5MC 4QUCA 2V4DA 3BDCA 2EVBA 3NTKA 3D4RA 1PMRA 1CHQD 3H09A 5C4JB 4CJ2C 4B9WA 1ZEQX 2JEBI 3DHQA 1A3UA 2BDOA 3N6RA 2EJMA 2D2CC 4X3KA 3FPUB 1E0BA 2R61A 2ID0A 3T13A 5ELBA 2QCPX 4A3BB 1UAPA 1TT2A 2CHBD 1EWHA 1EWCA 1EY9A 1CZGA 1DYQA 4K5WA 4BA2I 2EYFA 1WTRA 4RGNA 3S16B 1U4MA 4DN4M 1BXTA 3PUYA 1WTPA 4BWGB 1RD9D 2WKDA 1WTOA 1A3TA 4KHVA 1ICWA 4HSVA 4CJ1B 5KNCA 3VA5A 5G3LD 4EGVA 1QG7A 3BDLA 1NR4A 2F0UA 3SR1A 4R9WA 3SE0A 2B2VA 1KLUD 3M7NA 5LL6X 2HCIA 1IW7D 2B2UC 3U9SA 1RKNA 2B2TA 1VMCA 4A3JB 3AB9A 1SNCA 1GHKA 1JORA 2SDFA 2LKVA 3C3LA 3IKJA 1FNVA 1H9KA 3D4WA 1LT3D 1DOKA 2EOTA 3OSOA 5BN5A 4XYQA 3WDNA 3K58A 1AEXA 1SYFA 2F0VA 3WOFA 1G91A 5I2YA 1STHA 4NP5A 1JWSD 3E0JA 4QB4A 5K36G 3EFXD 3PIP3 2J7ZA 2J0TD 2NWGA 4XTCS 1IKMA 1STBA 1QCBD 3OW7A 4ODGA 4RCOA 3K57A 1S5FD 5C0XH 4L63B 2F0NA 5JPNC 1ENAA 3K5OA 1JR0D 1J8IA 2MHVA 3U9OA 1Z6HA 4KKSA 5ELEA 2ZT9C 3I91A 3KK7A 1ENCA 2L11A 2DNEA 1KNAA 2IWHA 2R92B 2FMMA 2XRQD 1TY0A 4CKCA 1XWEA 2JA6B 5KNBA 3I72A 3GTOB 1MSHA 3RUZA 1B9NA 1EYDA 2A6HC 1FR3A 4HR7B 4FYDA 1M8AA 3FVQA 3L9AX 1DM0B 2CW0C 1GOZA 3A55A 2R7ZB 3SDZA 2F0GA 2NTSA 1SBBB 1ILQA 1I3QB 1I4QA 1MBYA 2WAQB 2K05A 2IW3A 4OGQC 4RKBA 1L0XB 1CT1D 1U4RA 1SYEA 3NK9A 4PQXA 2BE5D 2PPBC 1VMPA 1D1IA 3HRZC 1BOSA 3J7YW 2EY5A 1V1PB 4K5XA 1JCKB 4A3DB 3QWNA 1D5ZC 2KEEA 1STGA 2J4XA 4DFAA 1AFPA 1L0YB 1GUTA 4F87A 4J1MA 1WTWA 1EYAA 2RDHA 3R8BA 2NVYB 4JBWA 2A68C 1Q1BA 1RHPA 1SYDA 2B2UA 1RF2D 2AWNA 1UNSA 4H44C 3A56A 1CFMA 1T5EA 2KCCA 5CORA 3EA6A 3OOCA 1HUNA 2PNRC 5D14A 3R2TA 1JQYD 1PZID 1HQMC 5IT9L 2XIWA 3TSSA 2XWBB 3MXGA 4QUFA 5A35A 4KY7A 2MJ8A 3TMEA 4KD4A 1S5ED 4DF7A 1BCPF 5JAVA 3I4LA 3HOXB 4ZLTF 3LWEA 2TMPA 1A2UA 3PUVA 1YNJD 4DU9A 1SNOA 3TZUA 3W2DA 2R6GA 2F0DA 2H4OA 3S14B 3FEWX 2LY7A 4HCEA 3M4OB 2CQAA 4MHEA 3K7AB 2MGSA 1A15A 4IFDH 2PQEA 3C1EA 3E5SA 3N52A 5C4XB 2XN9C 1D5XC 2NN6H 5IGFA 4XDXA 3NQIA 5IIFA 3NXWA 1TIID 5KRUA 1SMYD 3VR6A 3HZXA 1FYCA 3OIPA 4XQNA 3TP8A 2B2YC 2IT1A 4FF1A 3UI2A 3A7LA 1S5CD 3K59A 1B44D 3BVZA 1QJOA 3CU7A 5FO8B 2X6GA 5FO9B 3S2HB 4K6DA 3EJIA 1ESRA 3O13A 2F0LA 2BDNA 1JICA 2BA0A 5K36H 1BUVT 3A7AB 3HEJA 3CHBD 4RHSA 2WACA 5EKLA 4JK1C 1OXVA 1B3AA 3GTPB 1S5DD 4DAVA 3QB3A 1LTAD 1WD0A 2JXMB 1I4RA 2N88A 1YNNC 5CV4A 3KF8A 4FXDA 5IGBA 1PFNA 1BF4A 2O4XA 1W6KA 4P2CB 4J6HA 3JAML 3GV6A 2EJGC 5C3XA 3BZDB 3OWFA 1XX8A 1R9TB 1PRTB 2N55A 1A6XA 3RD4A 2L12A 4DK0A 1H9SA 3SK8A 2F0JA 4ZK9B 2A73B 1JWUD 1H9MA 4LMQD 3PUXA 4PV1C 2F0EA 5C3WA 1FD7D 2KECA 3DM1A 4L6TB 2A69C 3BDOA 1GJXA 1Y8OB 5I9PA 1R4PB 4KJOA 3ITPA 1AN8A 2AQ2B 3BYTB 2MP1A 3F2UA 1PFMA 1EY4A 4FO2A 3G6JB 3D3RA 1BBXC 4Q5VA 4KKUA 2PZUA 2JP1A 3J80L 4HEDA 1QOHA 1CM9A 4ME5A 4FF4A 4RGTA 3JAME 4KMUC 5FO7B 1LO5D 2KJXA 1J9OA 2K04A 1UUPA 3NP8A 2M2LA 1SNMA 3OWEB 1QNKA 4EQNA 3I73A 5EKKA 1NCVA 3I3CA 3T4AC 4HAEA 1TWCB 3J81E 3TP7A 2XNAC 3IAYA 1C48A 2VXWA 1LV9A 2L0CA 3KUPA 1PYWD 2FFKB 5DM73 2Y0SB 5IOCA 3GP7A 4C56C 2Z8LA 2VB3X 4QIWB 1IL8A 5I2XA 4KHZA 4X3TA 2F0QA 1JE4A 5M5WB 1CA5A 3MTSA 1PLFA 2O5JC 1KDCA 5AFWA 2EYOA 2KVMA 3NBIA 4A93B 2WP8J 4ID6A 4OO1H 1H9RA 2K33A 1VDZA 2IX0A 1NR2A 3URYA 4A3KB 5M3MB 2A68D 2RVLA 1Z47A 3MVVA 2HQEA 3MHBA 4C3HB 4KKTA 1G8ZD 2EYPA 5JEAJ 1SAPA 5DNFA 2F0SA 3I4MB 2L55A 3GD7A 2YU9B 3IL8A 2FJ2A 1TY2A 4C3IG 2KEDA 3MC0B 2Q8TA 3VR5A 2WIIB 5FKAC 3PIO3 1HFNA 1EY0A 2RQXA 1C8CA 2HDMA 2EE1A 4WFN3 1IW7C 1IKLA 2AUJD 1ZXTA 2E2IB 1SFOB 5C0XJ 2K01A 3NTIA 4RWSC 3M4YA 1D6EC 4KY5A 3H94A 2K6AA 2H1EA 2D5DA 2F1MA 5C0XG 2E76C 1SE3A 3WOEA 4PMCA 4CKBA 3HG9A 3PUZA 4H0LC 3C1FA 1PXUA 1Y8NB 3NTHA 1JB3A 3PUWA 3ZYYX 4FVMA 2B2WA 2IL8A 2EY2A 2A69D 1D2BA 1TWAB 2DY8A 2FMCA 1SDFA 4OIKA 3K5NA 1EY5A 3NBHA 5KIXA 5M3FB 2KHSA 2ZXPA 3DMUA 5DAUA 1PZJD 2EYLA 5C6AA 4XQJA 2KA7A 4XT3B 2K28A 2XRSD 5DEHA 4LAAA 1QILA 4X3SA 4KD3A 2M9VA 1EZ6A 4E6IA 4A3IB 5CMDA 3DWQA 5EQ0A 2BA1A 4TRDA 1O7LA 4K6LA 3A54A 5IODA 4IALA 1LABA 2A74C 1I50B 2HCCA 2IX3A 3BG3A 3KBXA 1KAAA 1V1PA 5TSSA 2KCNA 1LTSD 1O78A 3MWYW 3P1HA 5BN4A 2K1BA 4C1NI 5I4DA 1GUOA 1LTTD 1CQVA 1LT4D 2X69A 5COYA 2L9HA 2F0PA 1I6HB 5EBDA 5IGDA 5EPJA 3TP6A 1PTOB 2R93B 3D6WA 2F0FA 2NVQB 3V2TA 4NW2A 2E74C 3A8KE 3W3AA 1SJED 5CGKA 4KTAA 4ZRZA 3LX0A 2L4NA 1VCIA 3MXNA 1Y1WB 1FGBD 3NUCA 1TKWB 1MSGA 3TP5A 1EQTA 2ZXRA 4DK1A 3KLSA 5C5MA 4C2MB 5FK9C 1KTKA 5JJZA 2NZ1D 3NWTA 3NE5B 2K7VA 4OHJA 2NN6I 3GQBA 4DXGA 3CRKC 3EQLC 1OO9B 4RH6A 2K03A 1RTNA 2F3VA 1VF5C 5CV5A 2D62A 2B8FA 2JA5B 4YIJA 3DXJC 1SE2A 4B08A 4KI0A 1W6JA 2MUYA 2EYHA 3I70A 1DZ1A 2F3WA 2Z4IA 4UAIA 4N9PA 4GZYC 4HMIA 1ILPA 1K8OA 1TS3A 3BS1A 1TS4A 5BN3A 3VA7A 2EYJA 3Q0AA 1QNUA 5IT9E 2BE5C 3VR2A 1GUSA 2DY7A 4ZKBB 1X3QA 2AQ3B 4K2KA 1Y8PB 2F0OA 4G7OC 4BA1I 2F0HA 2F0IA 1S5BD 3Q24A 2G9DA 1TS2A 4ULLA 4C3IB 4FXKC 2IX1A 1BDOA 3GTGB 5FOBB 4WRDA 3J80E 3RLFA 1IHZA 2NUCA 2IPKD 2PZWA 1CI3M 1DOLA 1EY7A 3H0GB 1B9MA 5ELFA 5T1GA 5CBEE 2F0MA 2L1BA 2EYMA 3BYYB 4IUTA 2QF7A 2PO4A 1SEBD 4HMJA 5D65A 1XTCD 3QJYA 5M5XB 1LTGD 3DWPA 4G7HC 1ZKOA 4LK1C 4FP5D 3A8IE 1Q12A 1PRTC 1DCZA 1EU4A 1XYIA 4IUPA 4A3MB 2Q8RE 1CHPD 2DN8A 1JOOA 3H6MA 2WKCA 5CC4A 5EPLA 2TSSA 1KDAA 2SNSA 3K6OA 1F9RA 1YNJC 1QE6A 3MFYA 4QF4A 5J22A 4OL7A 2I46A 4XIGS 3VYRA 2BCOA 2E2DC 2WV6D 3HGBA 1B2TA 1LTBD 5I6YA 3K5LA 1ONLA 5KYLA 1SSOA 4OO1G 4RAUC 1R4QB 1A3VA 3MA2B 2G9HD 5CYUA 1VF7A 1STYA 1BCPD 4XXEA 3KBGA 2JEAI 3M85A 1I4GA 4DNTB 2EPBA 4CJ0B 5JEAG 2RBMA 4CHTB 1DONA 5C0XI 3PO2B 3GTKB 3HOVB 2WINB 3DUZA 1SMYC 1V43A 3ND9A 1F9PA 3S2DB 2QKIC 1TS5A 3QOLA 4IFDJ 1RDPD 5FLXE 3S17B 1UEAB 4U68A 4DGZA 3VYSA 4C1NK 3MEHA 3S1MB 3T53B 1HHVA 5KEEA 3S1QB 1HA6A 4FNFA 3NSWA 4CKEA 4M1UB 1OXSC 1SNDA 3GTLB 4FXGC 5LL6S 5CR3A 2NB0A 3SK6A 1F9QA 3T56B 1AZPA 4A3EB 2QILA 1QB5D 3HKZB 3SHLA 5KGUA 2EJFC 3S15B 1Q8IA 1WTVA 2B2WC 1E2ZA 1EIHA 2JE6I 3HOZB 4UDUC 2A6EC 2I07B 1EOTA 3A8JE 1WD1A 1EZ8A 2PZTA 1A2TA 4C3JB 2LFNA 1K83B 1GUNA 2FHTA 3HS0C 5EJWA 4C3HG 2F0WA 3MFGA 3Q6SA 3H3VC 2B2VC 1HCZA 4G4KA 4G57A 2IJ0A 3DEPA 1HPCA 2E75C 5C5LA 3ONAB 1F2YA 5JPMC 2QEJC 2E2JB 3GTMB 3CKIB 2XVSA 4IQZA 4O1NA 4CGYB 4RFBA 4PMWA 5CV8A 4R8NA 1WTXA 3D31A 3R2IA 2Q8IB 4I65A 4CBVA 1WTQA 1BO0A 1F2ZA 3VR3A 4IURA 5JOBA 2K5DA 2D9UA 4HN7A 1EIGA 3MZ5A 4Q0FA 1SNPA 3CRLC 3OMCA 3FKIB 1ESFA 1TVXA 4Z9CB 1I6VC 1LTRD 4K8IA 4WJWA 3SEBA 1E2WA 5D3IB 1SNQA 2BOSA 2RSNA 4NKLA 1F2LA 2HUGA 2SNMA 1U4PA 1M4VA 5DM63 4V190 4ZUJA 1G2TA 4KN7C 1FNUA 4R8IA 4B9XA 4V0BA 3HP3A 4EVOA 3DWAA 1AW7A 2E2HB 2NTTA 3GTJB 4Y7NB 4TQUS 5D3DA 1T5XD 4KK7A 1F9SA 4RA8A 2Z1CA 1SYCA 2LS01 3OIQA 1TQOA 1LT5D 4RKLA 5IGGA 3KLRA 1XXGA 1H9JA 4BS9A 4L8JA 3FDTA 1U9RA 4DXFA 4DAPA 1HRJA 5JVG3 1K8MA 1DXMA 2RA4A 4K14A 3EVQA 1ET6A 2CVRA 3HOYB 3I4NB 3SK4A 1H9SB 3J81L 2QDBA 5EPKA 5ELDA 1HA5A 2PCFB 3BVGA 1U4LA 1ZYRD 1DOMA 4NMZA 3VR4A 3VYUA 1F77A 2MPMA 2ZXOA 5EBCA 3C2PA 4MN3A 2B8GA 5J1ZA 1OXXK 2B2TC 4XT1B 4QMGA 2R3ZA 1OXTA 2WB1B 3I8ZA 4WORA 3M3YB 1HTLD 4BBSB 5E4XA 4XYOA 3NHHA 1BCPB 1V1OA 2B39A 3LWUA 1PTOD 2VB2X 1DD2A 5EGTA 1E2VA 1LT6D 4DA2A 1X3PA 1B4OA 1GUGA 1TWHB 5FLXL 4H13C 2GA4B 3PO3B 1Q1EA 2NYZD 4RGMA 2C9OA 3D8GA 4J8QA 5C44B 4C3JG 3OPOA 2NVXB 4IFDG 3R3OA 1SJHD 2NVTB 3P75A 4AYBB 1BR9A 1MGSA 3HOWB 5M9OA 1HQRD 4EQPA 1KABA 2K5WA 5CV6A 1AP0A 1I4XA 3TDQA 4TKOB 4O42A 2F03A 1PTOF 4IUNA 3HOUB 1BNZA 1ET9A 2HDLA 3IFTA 3QO2A 1TWGB 1BQQT 1JWMD 1G2SA 4IN3A 1F2MA 4KJNA 1FNWA 2O5IC 2NBFA 1STNA 2JA7B 5C4HA 5JVH3 1D1KA 3TBIB 4ZYSA 2L5TA 5ISRA 3VYTA 2A6HD 3OHXC 5C3EB 4N9TA 3J7AV 2A5HA 3TZDA 4X3UA 3P7JA 2SOBA 3ND8A 4NDXA 3X3MA 1LTID 3S1NB 3S1RB 3QOJA 3L3OC 1EL0A 2B63B 3FPPA 4RHRA 3GTQB 3AU7A 3SXHA 3NQTA 5IGEA 1Q90A 1PRTF 1DJRD 4S3SA 2OXPA 4XQQA 2A6ED 1RJTA 2EDGA 3D6CA 3EROA 1CTMA 2M00A 1KNEA 3CQZB 1RTOA 3H91A 3FRPB 2JYOA 4QCLA 1MD2D 3AMUA 4MIUA 5E3FA 1RODA 2OEOA 5I6WA 1QWYA 1Q3LA 3V96A 2AQ1B 1ZYRC 3S9WA 1GXDC 2RSOA 1Y69U 5KNDA 4EQOA 1CA6A 4A3GB 4IZ8A 3KLSX 4IUQA 1PTOH 2JSOA 2KQ3A 3P20A 2KOLA 4ABNA 2PMZB 2JA8B 2AUKA 4U673 1EFID 2DNCA 4TSSA 4F8MA 4ZAIA 1GHJA 2YYZA 3K5MA 5G3LF 1EEID 5LHY1 1KDBA 3DEOA 1HFGA 4HSPA 1STEA 2ICEC 2PW7A 2EZVA 3SVMA 4DAYA 1O80A 5J39A 4G7ZC 3X3NA 1ENFA 3SK5A 4KY6A 4RCNA 1WVLA 3Q23A 2AWOA 3RZDB 1LLRD 2PYKA 4IUUA 2Z4HA 3IFDA 4K5VA 5ELCA 5HURA 4OO1I 1NSNS 4I7ZC 3T16A 3MXUA 3T51B 4BBRB 5M5YB 5I9OA 1NUCA 1KLGD 1X32A 5CBAE 2OF1A 4IUVA 1CK1A 1JC7A 3G7LA 1EY8A 3RZOB 3C46A 4HTHA 5EKIA 2B2YA 2EY1A 1WCMB 3V05A 4F7XA 2K32A 1G291 3NWSA 2PW5A 3J7AF 3PMFA 4PMBA 5A2QE 1PFBA 3E6ZX 2F4IA 3L7ZC 5HGTA 4LJZC 5NUCA 1HXYD 2C5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7Z A;  2FJ2 A;  4HED A;  4X3S A;  1WTP A;  1CM9 A;  4XT1 B;  4ZAI A;  5JJZ A;  4U68 A;  2NZ1 D;  2X6G A;  2R3Z A;  1M8A A;  2KED A;  2Q8T A;  1WTO A;  1B53 A;  2XIW A;  5CMD A;  1ICW A;  1HHV A;  3I8Z A;  5EQ0 A;  1ESR A;  1HA6 A;  5T1I A;  4HSV A;  4CJ1 B;  5T1G A;  5CBE E;  3DEO A;  1B50 A;  1HFG A;  2BDN A;  1JIC A;  4X3U A;  3TZD A;  4QUF A;  2L1B A;  3P7J A;  1HFN A;  4IUT A;  1PDQ A;  2MJ8 A;  1QG7 A;  5D65 A;  1NR4 A;  1J9O A;  1ILQ A;  2K04 A;  1NAP A;  2HDM A;  2EE1 A;  1F9Q A;  2RSN A;  1C8C A;  5E4X A;  3SVM A;  1F2L A;  2HCC A;  2HUG A;  1AZP A;  2M2L A;  4R9W A;  1QNK A;  1U4P A;  1IKL A;  2K03 A;  1O80 A;  1XYI A;  1B3A A;  4ZLT F;  2B2V A;  1EL0 A;  1RTN A;  4IUP A;  2Q8R E;  1NCV A;  3I3C A;  3KBX A;  3LWE A;  2HCI A;  1G2T A;  1ZXT A;  4HAE A;  1GUW A;  3R93 A;  2K05 A;  2B2U C;  1WTV A;  1WD0 A;  2B2W C;  2FIN B;  2K01 A;  4HCS A;  4R8I A;  2B2T A;  1EIH A;  5E4W C;  3HP3 A;  4RWS C;  1VMC A;  2N88 A;  2VXW A;  1WVL A;  1LV9 A;  1X3P A;  2SDF A;  3KUP A;  1EOT A;  2X6L A;  1B4O A;  1U4R A;  2FFK B;  2KUM A;  3MWY W;  1PFN A;  1BF4 A;  1WD1 A;  2H1E A;  5EPL A;  1O7Y A;  3I90 A;  1F9S A;  1DOK A;  2EOT A;  4QUC A;  1RJT A;  3GV6 A;  1F9R A;  2NYZ D;  2K1B A;  4RA8 A;  1IL8 A;  1MI2 A;  1QE6 A;  4MHE A;  3GV3 A;  4IUU A;  4X3T A;  1KNE A;  1DZ1 A;  2FHT A;  1XX8 A;  1RTO A;  3H91 A;  4UAI A;  5EJW A;  1VMP A;  2JYO A;  1A15 A;  1JE4 A;  2MGS A;  2N55 A;  2X69 A;  3IFD A;  5COY A;  1CA5 A;  2L9H A;  1G91 A;  1ILP A;  2L12 A;  1PLF A;  3MTS A;  3Q6S A;  1AZQ A;  5EPJ A;  2B2V C;  4CJ2 C;  1MGS A;  3FDT A;  3N52 A;  5AFW A;  1B2T A;  1ROD A;  4ZK9 B;  1S4Z A;  3DEP A;  2B2W A;  1Q3L A;  2IL8 A;  2J7Z A;  2KEE A;  2KVM A;  2NWG A;  1X32 A;  3ONA B;  4ZKC B;  1IKM A;  1HRJ A;  3D6W A;  2DY8 A;  4LMQ D;  1SSO A;  5CBA E;  1SDF A;  4OIJ A;  4IUV A;  2DY7 A;  4OIK A;  4RAU C;  1X3Q A;  2RA4 A;  4X3K A;  4ZKB B;  3G7L A;  3FPU B;  1AP0 A;  1E0B A;  4XDX A;  2RSO A;  4NW2 A;  2KEC A;  1NR2 A;  3DM1 A;  1WTW A;  2CVR A;  1J8I A;  3TN2 A;  4O42 A;  1WTX A;  5EKI A;  3I91 A;  1RHP A;  2B2Y A;  1CA6 A;  5EPK A;  2B2U A;  2L11 A;  4CJ0 B;  2B2Y C;  2EPB A;  1U4L A;  1KNA A;  1BNZ A;  1DOM A;  2RVL A;  1BO0 A;  1WTQ A;  2L4N A;  4IUQ A;  2HDL A;  4IUR A;  3QO2 A;  2FMM A;  2MP1 A;  3F2U A;  1DON A;  3UI2 A;  1PFM A;  2MPM A;  1G2S A;  2D9U A;  1G6Z A;  1ML0 D;  1EIG A;  1HUM A;  4XT3 B;  2KOL A;  1PFB A;  2K28 A;  1MSH A;  5COR A;  4MN3 A;  1WTR A;  1SAP A;  1MSG A;  5DNF A;  1F9P A;  1BBX C;  1HUN A;  1U4M A;  1EQT A;  1DOL A;  4DN4 M;  1TVX A;  5D14 A;  2JP1 A;  2B2T C;  3IL8 A; 
#chains in the Genus database with same CATH topology
 4ZUI A;  1EY6 A;  3EBE A;  1RCV D;  3ICE A;  4DNR B;  4K8J A;  2E5L Q;  1XMQ Q;  5C4Z A;  1RIP A;  5M3F G;  1I4P A;  5A2Q L;  1PDQ A;  3ZJY C;  2E2I H;  2F0K A;  3MXP A;  1NAP A;  2YTV A;  4KV6 A;  3D4D A;  1LAC A;  4RMF A;  4LFA Q;  2DJF C;  4BY7 B;  2ICI A;  1TWG H;  1I4H A;  1HNX Q;  3PV0 A;  3R93 A;  1EYC A;  2FIN B;  2MFI A;  4HCS A;  4H7B A;  5F2D A;  1TU2 B;  1PTO C;  3S2D H;  1HNZ L;  4AYB G;  1YHB A;  4FDB A;  1JJ2 A;  1PRT D;  4F88 A;  2HIX A;  1YNN D;  1CZW A;  3I90 A;  5JEA H;  4LF4 L;  3PO3 G;  2XSC A;  1MI2 A;  1CKN A;  1OXU A;  3J81 j;  4FF3 A;  1FJG L;  2VNU D;  2RHS B;  2EY6 A;  3GV3 A;  3OMG A;  2KHJ A;  3QR8 A;  1V9P A;  4KN4 C;  1NJI C;  1IXR A;  2O2L D;  3BJU A;  4FF2 A;  3FMC A;  1AZQ A;  2JJQ A;  5GAD C;  3S16 H;  4TVA B;  5CV7 A;  2NN6 G;  1S4Z A;  4ZQ3 A;  1BVS A;  4ZKC B;  3I56 A;  4IFD I;  2RDG A;  1NNX A;  2SEB D;  1IL2 A;  1FL0 A;  2RCN A;  4OIJ A;  1Z7T A;  3LNN A;  3K0Y A;  1VQ8 A;  4A3K G;  1IYU A;  5KYI A;  3QIA A;  1S3O A;  3BVM A;  2EXZ A;  3TN2 A;  3NPP A;  1C4Q A;  4A3F B;  1EQV A;  2AKW B;  3QG1 A;  4DUY Q;  3Q22 A;  4X66 Q;  1HTP A;  4JI1 Q;  3MAQ A;  1JOK A;  1TWF B;  4IPH A;  4YWL A;  2K5Q A;  3W5O A;  1TR5 A;  2RDF A;  1SXT A;  4DV3 L;  5IGC A;  1BCP C;  1G6Z A;  1ML0 D;  1HUM A;  1II3 A;  2OT2 A;  4PNY A;  3GO5 A;  2LMC B;  1KQS A;  2E8G A;  1PZK D;  1CQF A;  4P71 A;  1Y1V B;  5K5P A;  2ENB A;  1O7Z A;  3RMH A;  1HH2 P;  3ERQ A;  1EEF D;  5J3B A;  1SE4 A;  1B53 A;  1SYG A;  2MQH A;  4BY1 B;  1L1O B;  1JOQ A;  4RGO S;  5T1I A;  2XWJ B;  1B50 A;  4JI0 Q;  3M7G A;  2RKS A;  2UUC L;  1B1Z A;  3KF6 B;  5CV9 A;  4A76 A;  3I4N G;  1XMQ L;  4M8A A;  2E5L L;  4KHP Q;  4LF8 L;  4L5S A;  1STA A;  1SYB A;  1EU3 A;  1UE5 A;  1V8Q A;  1O7I A;  2VUM B;  1CKN B;  1VQA A;  3BU2 A;  1IYV A;  2CCZ A;  2CW0 D;  3S15 H;  4IOC A;  4DR6 Q;  2ES2 A;  1GUW A;  5E1F A;  2ZJR A;  5E4W C;  4K2L A;  1FVI A;  4ILW A;  3STB C;  4C3J H;  1PH3 A;  2X6L A;  1H95 A;  2KUM A;  2F0T A;  1O7Y A;  3PQI A;  3U4V A;  1D5M C;  4QUC A;  2K4K A;  1IYJ B;  2V4D A;  3BDC A;  2EVB A;  3NTK A;  3D4R A;  2K52 A;  1PMR A;  4L5R C;  4LF4 Q;  1CHQ D;  3H09 A;  5C4J B;  4CJ2 C;  3HOU G;  4BY1 H;  4YY3 L;  4B9W A;  1ZEQ X;  1PH1 A;  2JEB I;  3DHQ A;  4QY7 A;  1A3U A;  2JA9 A;  2BDO A;  4A3D H;  3N6R A;  2EJM A;  1HZC A;  2D2C C;  1YHA A;  4X3K A;  3FPU B;  1E0B A;  2R61 A;  1Y1V H;  2ID0 A;  3T13 A;  1YBY A;  5ELB A;  2QCP X;  1K73 C;  4A3B B;  1UAP A;  1KAW A;  1KIX A;  4YCU A;  3PGZ A;  1YVC A;  2H5X A;  1TT2 A;  3HOW G;  2UXC Q;  4CDF C;  2JA6 H;  2CHB D;  1EWH A;  1EWC A;  3M4P A;  3I4M H;  1EY9 A;  1CZG A;  2KBN A;  1DYQ A;  4K5W A;  4BA2 I;  2EYF A;  1WTR A;  4RGN A;  3FKI H;  4IPD A;  3S16 B;  1U4M A;  2BH2 A;  4DN4 M;  4DV7 L;  1BXT A;  3PUY A;  5M5W H;  1WTP A;  3MEF A;  4BWG B;  1RD9 D;  2WKD A;  1WTO A;  3PIP A;  3CD6 A;  1A3T A;  4KHV A;  4YWK A;  1ICW A;  4HSV A;  4CJ1 B;  5KNC A;  2QA4 A;  4X65 Q;  3VA5 A;  3HOZ G;  1VQB A;  2Z6B A;  2CWA A;  4BXX H;  5G3L D;  4EGV A;  3F2B A;  1JB7 A;  1QG7 A;  3BDL A;  1NR4 A;  4BY7 G;  2F0U A;  3SR1 A;  1NTG A;  4R9W A;  3AFQ A;  3SE0 A;  1MJC A;  2B2V A;  1KLU D;  3M7N A;  1TWA H;  2HCI A;  5LL6 X;  1IW7 D;  2B2U C;  3U9S A;  4JI7 Q;  1RKN A;  3PIO A;  2B2T A;  4BY7 H;  3TS2 A;  1RL2 A;  4DR7 L;  1A8V A;  1VMC A;  4A3J B;  1WYD A;  3AB9 A;  5M5X H;  1SNC A;  1GHK A;  1JOR A;  2SDF A;  2KCM A;  4A3D G;  2LKV A;  3C3L A;  3IKJ A;  1VQP A;  4JBJ A;  1FNV A;  1H9K A;  3D4W A;  1TWC H;  1IBM Q;  1LT3 D;  1DOK A;  2EOT A;  4PG3 A;  3OSO A;  5BN5 A;  4XYQ A;  3WDN A;  3K58 A;  1AEX A;  1SYF A;  4DV2 L;  5IT9 c;  2F0V A;  3WOF A;  1G91 A;  5I2Y A;  5GQO A;  1STH A;  4NP5 A;  3HOV H;  1HNW Q;  1JWS D;  3E0J A;  4QB4 A;  1KD1 C;  5K36 G;  2Y0S G;  3EFX D;  2XGT A;  1Z9F A;  3PIP 3;  2J7Z A;  2J0T D;  4IJH A;  2NWG A;  4XTC S;  4DR2 L;  3U58 A;  1IKM A;  1HR0 W;  1STB A;  1QCB D;  4ODG A;  3OW7 A;  4RCO A;  4LNQ A;  3K57 A;  1S5F D;  5C0X H;  4L63 B;  1NE3 A;  2F0N A;  5JPN C;  1PH6 A;  1ENA A;  3K5O A;  1JR0 D;  1J8I A;  2MHV A;  3U9O A;  1Z6H A;  4KKS A;  5ELE A;  2ZT9 C;  3I91 A;  1JMC A;  5IY0 A;  4CDD C;  3KK7 A;  1ENC A;  2L11 A;  2N8N A;  2DNE A;  1X3F A;  1KNA A;  2R93 H;  3S2H H;  2CH4 A;  2IWH A;  4K0K Q;  1Y14 B;  3K7U C;  1P16 A;  2R92 B;  2JK8 A;  2FMM A;  2XRQ D;  1TY0 A;  4CKC A;  1XWE A;  2JA6 B;  2HD3 A;  4DR7 Q;  5KNB A;  4YHH L;  1I6H H;  3I72 A;  3GTO B;  1MSH A;  3M3Y H;  3RUZ A;  1B9N A;  1EYD A;  2JA7 G;  3GTG H;  2A6H C;  4LFC L;  3GTQ H;  1FR3 A;  4HR7 B;  4PZ6 A;  4ALP A;  4FYD A;  1PHJ A;  2HHH L;  4DUZ Q;  1M8A A;  3AFP A;  1CSP A;  3FVQ A;  3L9A X;  1DM0 B;  2UUA L;  4DR1 Q;  2CW0 C;  1GOZ A;  3A55 A;  2R7Z B;  3SDZ A;  2F0G A;  4A3F H;  2NTS A;  1SBB B;  2Z0S A;  1ILQ A;  4LFA L;  5E7N A;  1WCM G;  1I3Q B;  1U5K A;  1I4Q A;  1T9H A;  4X62 L;  4DV5 Q;  1TXY A;  3GTP H;  3G4S A;  1MBY A;  1SE8 A;  2WAQ B;  1WOC A;  2K05 A;  2IW3 A;  5FJ8 H;  5IP7 G;  4OGQ C;  4RKB A;  1XPR A;  4HIK A;  1KRS A;  3I4N H;  3GTL H;  1L0X B;  1XTD A;  4PZ7 A;  1EFW A;  1CT1 D;  1U4R A;  4A3I H;  1SYE A;  1YZ6 A;  3NK9 A;  5C44 G;  1UE1 A;  4PQX A;  4O0A A;  4BBS H;  1SMX A;  2BE5 D;  2PPB C;  4JI2 Q;  1VMP A;  1D1I A;  3HRZ C;  1BOS A;  3J7Y W;  1A0I A;  2EY5 A;  3BZC A;  5IP9 H;  2ZTC A;  1V1P B;  4K5X A;  2PQA A;  1JCK B;  4A3G G;  5IWA L;  5LMN L;  4A3D B;  3QWN A;  1D5Z C;  2KEE A;  1STG A;  2J4X A;  4DFA A;  3HOX G;  3H3V H;  3ULP A;  3E9H A;  2ZTD A;  3NEL A;  4JI7 L;  1AFP A;  2Z6K C;  1L0Y B;  1GUT A;  1MIU A;  4F87 A;  4J1M A;  1WTW A;  1EYA A;  2RDH A;  3R8B A;  3EIV A;  2NVY B;  4JBW A;  2A68 C;  1Q1B A;  4H02 A;  1RHP A;  1SYD A;  2KEN A;  2B2U A;  2DJG C;  3FP9 A;  4OEL B;  1RF2 D;  2AWN A;  1OTC A;  1UNS A;  4ZCK A;  4H44 C;  3A56 A;  1CFM A;  5FLX c;  3HOW H;  1T5E A;  2KCC A;  3ER0 A;  5COR A;  3EA6 A;  3OOC A;  1HUN A;  4LF5 L;  2PNR C;  4GLA C;  3CPF A;  1SFO H;  4DV1 L;  5D14 A;  1HZA A;  2WB1 E;  1KXL A;  3R2T A;  2Q2H A;  1JQY D;  1W3S A;  5IYD G;  3CCS A;  1PZI D;  4GKK Q;  1HQM C;  5IT9 L;  4JBK A;  1XNQ Q;  2XIW A;  3TSS A;  2XWB B;  4JI0 L;  3MXG A;  2F52 A;  4MZ9 A;  4QUF A;  5A35 A;  3HOY G;  4KY7 A;  2MJ8 A;  3TME A;  4A3E G;  4DV1 Q;  3PCO B;  4KD4 A;  2VQF L;  1S5E D;  4DF7 A;  1BCP F;  3H15 A;  5JAV A;  3I4L A;  3CC4 A;  3LGJ A;  3HOX B;  4JI3 Q;  4ZLT F;  4LFB L;  3LWE A;  2AHO B;  1A2U A;  2TMP A;  3PUV A;  1YNJ D;  1XMO Q;  4DU9 A;  1SNO A;  1C9O A;  4A3I G;  3TZU A;  3W2D A;  2R6G A;  2OTL A;  2F0D A;  4LUZ A;  1LYL A;  2H4O A;  4OON A;  3S14 B;  3FEW X;  4GNX C;  2LY7 A;  4HCE A;  3M4O B;  2CQA A;  4HJ5 A;  1PH5 A;  4MHE A;  3F1Z A;  3K7A B;  1PH2 A;  2MGS A;  1A15 A;  4IFD H;  2PQE A;  4ME3 A;  3C1E A;  3E5S A;  3I7F A;  3N52 A;  4RG1 A;  5C4X B;  2XN9 C;  1D5X C;  4X6A H;  5C3E H;  1NMF A;  1E24 A;  3NEN A;  2NN6 H;  5IGF A;  4DR6 L;  4XDX A;  2I5H A;  3NQI A;  5IIF A;  3HOZ H;  3NXW A;  1TII D;  3VR6 A;  1SMY D;  5KRU A;  1NY4 A;  3HZX A;  1FYC A;  3OIP A;  4XQN A;  1Q82 C;  3TP8 A;  2B2Y C;  2IT1 A;  4FF1 A;  1YJW A;  1CUK A;  2K50 A;  4Y7N H;  1B7Y B;  1YJN A;  3UI2 A;  3A7L A;  1S5C D;  2E2H H;  4DV5 L;  2QGQ A;  3K59 A;  4LF7 Q;  3FKI G;  4DK6 C;  3J7Z C;  1B44 D;  2EXD A;  3BVZ A;  1QJO A;  3CU7 A;  2NVX H;  3I4M G;  5FO8 B;  2X6G A;  2JN4 A;  3F8T A;  1HJP A;  4DR1 L;  5FO9 B;  3S2H B;  4DV3 Q;  2XTI A;  4K6D A;  3EJI A;  1ESR A;  4UHV A;  3O13 A;  2F0L A;  3UDX A;  4DUZ L;  2BDN A;  1JIC A;  2BA0 A;  5K36 H;  4OXP A;  4A3J G;  1XNQ L;  1BUV T;  3A7A B;  1PA6 A;  3HEJ A;  3CHB D;  4RHS A;  2WAC A;  3VDY A;  3PO3 H;  5EKL A;  4JK1 C;  4N8X 1;  1OXV A;  3CMA A;  1B3A A;  3CCE A;  3JC6 6;  3GTP B;  1WI5 A;  1S5D D;  4DAV A;  5IYB H;  1XPU A;  3QB3 A;  1LTA D;  1WD0 A;  2JXM B;  1I4R A;  1I3Q H;  3CC2 A;  4LF9 L;  4DV0 Q;  2N88 A;  1YNN C;  5CV4 A;  4LF6 L;  3KF8 A;  3I4O A;  4FXD A;  1X65 A;  5IGB A;  4JI8 L;  1PFN A;  1BF4 A;  2O4X A;  1W6K A;  4P2C B;  4J6H A;  3JAM L;  3GV6 A;  2EJG C;  5C3X A;  4B3S Q;  3BZD B;  2D0O A;  3OWF A;  1XX8 A;  1R9T B;  1PRT B;  2N55 A;  4JI4 L;  2JA8 G;  1A6X A;  1GVP A;  3RD4 A;  2L12 A;  4DK0 A;  4PZ8 A;  1H9S A;  3SK8 A;  1VQH A;  5M3M G;  2F0J A;  1Q81 C;  4ZK9 B;  5IP7 H;  3U4Z A;  1CKO A;  4MTK A;  4DR3 L;  2A73 B;  1JWU D;  4CDC C;  1N36 L;  1H9M A;  5FLM H;  2CQO A;  4LMQ D;  3T1H Q;  3PUX A;  4PV1 C;  2DUD A;  2F0E A;  5C3W A;  4L5Q A;  2IHE A;  3CXC A;  1EOV A;  1IBK L;  1FD7 D;  5C4J H;  4QIW E;  2KEC A;  3DM1 A;  1IBM L;  2VS1 A;  4A3B G;  4L6T B;  4A3K H;  2A69 C;  3BDO A;  1GJX A;  2ZM6 Q;  1Y8O B;  1Q46 A;  5I9P A;  1R4P B;  4KJO A;  3ITP A;  4NXN L;  1AN8 A;  5BR8 L;  1L1O A;  2AQ2 B;  3BYT B;  2MP1 A;  3F2U A;  1PFM A;  1EY4 A;  4FO2 A;  5IYC G;  3J80 i;  2HIV A;  1VQ6 A;  3G6J B;  1VQ9 A;  5GAG C;  1X54 A;  3D3R A;  1EWI A;  4OX9 Q;  1BBX C;  4Q5V A;  4KKU A;  2PZU A;  2JP1 A;  3J80 L;  4HED A;  1QOH A;  1CM9 A;  1YIJ A;  1X6O A;  1PH9 A;  3CW2 C;  4ME5 A;  4FF4 A;  5ELO A;  2VW9 A;  3K80 C;  4RGT A;  2PI2 A;  2WAQ G;  4KMU C;  3JAM E;  1CSQ A;  5FO7 B;  3PF4 A;  4JCV E;  2K5H A;  4DK3 C;  1LO5 D;  2KJX A;  1J9O A;  2K04 A;  3CCL A;  4A3J H;  1UUP A;  2OTJ A;  3NP8 A;  2M2L A;  4JV5 Q;  1SNM A;  1Q86 C;  3OWE B;  1QNK A;  4EQN A;  3KFU A;  4P75 A;  3OW2 A;  3I73 A;  5EKK A;  2EQS A;  4AYB E;  1NCV A;  3I3C A;  3T4A C;  1EIF A;  4HAE A;  3RN2 A;  1VQL A;  1TWC B;  3J81 E;  1N32 L;  1X3G A;  1VQC A;  3TP7 A;  2XNA C;  3UDI A;  4DR4 L;  3IAY A;  1C48 A;  2VXW A;  2PNH A;  5M3F H;  1LV9 A;  2L0C A;  3RNU A;  3KUP A;  1PYW D;  1VQE A;  2FFK B;  5DM7 3;  2Y0S B;  4NXM Q;  4BBR G;  5IOC A;  3GP7 A;  4C56 C;  3M4Q A;  2Z8L A;  2VB3 X;  2GN5 A;  4QIW B;  3KLW A;  1IL8 A;  3E3X A;  5I2X A;  4KHZ A;  4X3T A;  2F0Q A;  1JE4 A;  5M5W B;  2VQE L;  1CA5 A;  2QEX A;  3MTS A;  1PLF A;  3G6E A;  2O5J C;  4GNX A;  2L15 A;  4YY3 Q;  1KDC A;  5AFW A;  2EYO A;  5IYC H;  1ICF B;  2IHF A;  5C44 H;  2KVM A;  4A3M G;  3NBI A;  4A93 B;  2WP8 J;  3FHW A;  4ID6 A;  4OO1 H;  1H9R A;  2K33 A;  1VDZ A;  2IX0 A;  1NR2 A;  3URY A;  2ZJQ A;  1SR3 A;  3I2Z A;  4A3K B;  3UDG A;  3T1Y Q;  5M3M B;  2A68 D;  4NXM L;  1SLJ A;  2RVL A;  1VQ5 A;  2D0P A;  1Z47 A;  1E1T A;  2E2J H;  3MVV A;  2HQE A;  4KLK A;  3MHB A;  2UUA Q;  4C3H B;  4OEM B;  4KKT A;  4DR4 Q;  3KJP A;  5JJL A;  1G8Z D;  2EYP A;  5JEA J;  2IY5 B;  1SAP A;  5DNF A;  1YEZ A;  2F0S A;  3I4M B;  2L55 A;  3GD7 A;  2YU9 B;  2VY3 A;  3IL8 A;  2FJ2 A;  3AQQ A;  1TY2 A;  4C3I G;  2KED A;  3MC0 B;  4DV4 L;  2Q8T A;  2VZA A;  3VR5 A;  1SRO A;  2A1A A;  2WII B;  4B3R L;  1A62 A;  5FKA C;  3W1G A;  3PIO 3;  2Q2U A;  4O2D A;  1HFN A;  1EY0 A;  2RQX A;  3AEV A;  4DR5 Q;  1C8C A;  2HDM A;  2EE1 A;  1C0A A;  4WFN 3;  3T1Y L;  1IW7 C;  2HQL A;  1IKL A;  3F2C A;  4JOI C;  4A93 G;  5GAE C;  2K5V A;  2AUJ D;  1X56 A;  1ZXT A;  4JYA Q;  4DNI A;  4R4O A;  2E2I B;  1SFO B;  5C0X J;  2K01 A;  3NTI A;  3CCJ A;  4RWS C;  1SRU A;  3M4Y A;  1X55 A;  1D6E C;  4JI5 L;  4KY5 A;  3H94 A;  2YV5 A;  2K6A A;  2VL6 A;  2H1E A;  2D5D A;  2F1M A;  5C0X G;  2E76 C;  1SE3 A;  3WOE A;  4PMC A;  4CKB A;  3F2D A;  3HG9 A;  2R7D A;  3PUZ A;  4IPG A;  4H0L C;  3C1F A;  1PXU A;  1Y8N B;  3HOV G;  3PO2 G;  3NTH A;  1ASZ A;  1AE3 A;  1JB3 A;  3PUW A;  4UP9 A;  3ZYY X;  3KDF B;  5LMN W;  4FVM A;  2YTX A;  1P8L A;  2B2W A;  2IL8 A;  2UU9 Q;  2EY2 A;  2A69 D;  1D2B A;  1TWA B;  2DY8 A;  2FMC A;  1SDF A;  4GLV B;  4OIK A;  1VQG A;  3K5N A;  1EY5 A;  3NBH A;  3GTJ H;  5KIX A;  5M3F B;  2VUM G;  1S40 A;  2KHS A;  3RZD H;  4GOP B;  1N33 Q;  2ZXP A;  3DMU A;  5DAU A;  1PZJ D;  2EYL A;  3TEH B;  3A74 A;  5C6A A;  4XQJ A;  2KA7 A;  4XT3 B;  2K28 A;  2XRS D;  5DEH A;  4LAA A;  4J15 A;  1C7Y A;  2Z6K A;  1QIL A;  4X3S A;  2OQK A;  4KD3 A;  4JI5 Q;  2M9V A;  1EZ6 A;  3S24 A;  4E6I A;  4HJ7 A;  4A3I B;  5CMD A;  5C4X H;  3DWQ A;  5EQ0 A;  2UUC Q;  1BBW A;  2ASB A;  2BA1 A;  4TRD A;  1WCM H;  1O7L A;  4K6L A;  1EIY B;  3A54 A;  4X62 Q;  5IOD A;  4IAL A;  1LAB A;  2A74 C;  1I50 B;  2HCC A;  2F3I A;  2IX3 A;  1UE6 A;  3BG3 A;  4A3M H;  3OYY A;  1GM5 A;  3KBX A;  4C2M H;  1YNX A;  1KAA A;  3KDF A;  1V1P A;  5TSS A;  4DV4 Q;  2PQA B;  2KCN A;  4GN4 B;  1LTS D;  1O78 A;  3MWY W;  1Y1V G;  1R9T H;  1PYS B;  3P1H A;  5BN4 A;  2A8V A;  2K1B A;  3S1N H;  4C1N I;  5I4D A;  1GUO A;  1LTT D;  1CQV A;  1LT4 D;  2X69 A;  1UE7 A;  5COY A;  2L9H A;  4UY8 C;  2F0P A;  4JVZ A;  1I6H B;  2A19 A;  5EBD A;  5IGD A;  5EPJ A;  3TRE A;  3TP6 A;  1PTO B;  2R93 B;  1KC8 C;  4DV0 L;  3D6W A;  1G6P A;  4LWC A;  2F0F A;  4AIM A;  2QW7 A;  2NVQ B;  3V2T A;  4NW2 A;  1YI2 A;  4JI6 Q;  2E74 C;  3A8K E;  4DR2 Q;  3W3A A;  4YCV A;  1SJE D;  5CGK A;  3HKS A;  4KTA A;  3SGI A;  4ZRZ A;  3LX0 A;  2L4N A;  1E3P A;  1VCI A;  4B3M L;  3E9I A;  4MNO A;  3MXN A;  1HNZ Q;  3ULL A;  1Y1W B;  1FGB D;  3NUC A;  3CPW A;  1TKW B;  1MSG A;  3TP5 A;  1EQT A;  2ZXR A;  4DK1 A;  3KLS A;  5C5M A;  4C2M B;  4A3C H;  5FK9 C;  4POG A;  1KTK A;  5JJZ A;  3GTM H;  1EYG A;  2NZ1 D;  4B3R Q;  3NWT A;  2DGY A;  3NE5 B;  2K7V A;  4OHJ A;  1A63 A;  2NN6 I;  4JI1 L;  3GQB A;  4DXG A;  3CRK C;  1KL9 A;  3EQL C;  1OO9 B;  4RH6 A;  1YIT A;  4HID A;  1TWF H;  2GVA A;  2K03 A;  4NB3 A;  4QL5 A;  4LF5 Q;  1TWH H;  1RTN A;  5M5Y H;  2F3V A;  1VF5 C;  1XNR L;  3IRB A;  1K9M C;  5CV5 A;  2D62 A;  2B8F A;  2JA5 B;  2LXJ A;  1K0S A;  4DV7 Q;  3J81 c;  2YTY A;  4YIJ A;  1QVG A;  3DXJ C;  1S72 A;  1SE2 A;  4B08 A;  4KI0 A;  2ZTE A;  1W6J A;  2MUY A;  2EYH A;  3I70 A;  1L0W A;  1DZ1 A;  5LMU L;  2F3W A;  2Z4I A;  4A3E H;  4UAI A;  1BBU A;  4N9P A;  4HIO A;  3L0O A;  4GZY C;  4HMI A;  1ILP A;  1K8O A;  1TS3 A;  3BS1 A;  1TS4 A;  1CKM A;  3A0J A;  5BN3 A;  3VA7 A;  1UWV A;  2EYJ A;  3Q0A A;  1YJ9 A;  4GKJ Q;  1QNU A;  4GLX A;  5IT9 E;  4NPS A;  2VQE Q;  2BE5 C;  3VR2 A;  1GUS A;  2DY7 A;  4ZKB B;  1X3Q A;  1N9W A;  2AQ3 B;  1VQD A;  4K2K A;  3G71 A;  1Y8P B;  2R7Z H;  2F0O A;  3KOJ A;  4G7O C;  4BA1 I;  2F0H A;  2VQF Q;  3D0F A;  2F0I A;  1D7Q A;  1S5B D;  1K28 A;  2K75 A;  3Q24 A;  2G9D A;  1TS2 A;  5C3E G;  4ULL A;  4C3I B;  3H0G H;  3KYH C;  4FXK C;  2IX1 A;  1BDO A;  3GTG B;  3KF6 A;  2Q2I A;  4WRD A;  5FOB B;  3CME A;  2Z9H A;  3J80 E;  3RLF A;  3HFZ B;  1Y1W H;  3H3V I;  1IHZ A;  5FJ8 G;  2NUC A;  2IPK D;  2PZW A;  1CI3 M;  1DOL A;  4R4C A;  2UUB Q;  1G51 A;  1QZH A;  2UXB Q;  2NZH A;  1EY7 A;  1JJC B;  4X65 L;  4A3G H;  3H0G B;  4JBM A;  3M4O H;  1Y1W G;  1B9M A;  5ELF A;  5IP9 G;  5T1G A;  5CBE E;  4A3F G;  2F0M A;  3KF8 B;  2L1B A;  2EYM A;  3BYY B;  4X64 L;  1N33 L;  4IUT A;  2QF7 A;  2PO4 A;  1SEB D;  1FGU A;  4HMJ A;  5D65 A;  1XTC D;  3QJY A;  5M5X B;  1LTG D;  3DWP A;  4G7H C;  1ZKO A;  4LK1 C;  4FP5 D;  3TRZ A;  3K7A H;  3A8I E;  1Q12 A;  2PMZ E;  1PRT C;  1DCZ A;  4KHP L;  1L2F A;  1EU4 A;  1XYI A;  4IUP A;  4A3M B;  4AQY L;  2Q8R E;  3Q8D A;  5AJ3 L;  1CHP D;  2DN8 A;  5BR8 Q;  3S14 H;  1XJV A;  2NVY H;  1JOO A;  3CQZ H;  3H6M A;  1UEB A;  2WKC A;  2ZM6 L;  1JJG A;  1K8G A;  5CC4 A;  5EPL A;  2TSS A;  1KDA A;  2SNS A;  3K6O A;  5HY6 A;  1F9R A;  1I94 L;  1YNJ C;  1QE6 A;  3MFY A;  1I50 H;  4JI2 L;  4QF4 A;  5IE8 A;  2YU9 H;  2N78 A;  5J22 A;  3TQY A;  4OL7 A;  2I46 A;  1B8A A;  4XIG S;  3VYR A;  2BCO A;  2E2D C;  2WV6 D;  4DR3 Q;  3HGB A;  1B2T A;  4DUY L;  4R1J A;  3J7A 5;  1LTB D;  5I6Y A;  3K5L A;  1ONL A;  1LM0 A;  5KYL A;  1SSO A;  4OO1 G;  4RAU C;  3BZK A;  1R4Q B;  1A3V A;  1M1K C;  3MA2 B;  1JE5 A;  2G9H D;  5CYU A;  1VF7 A;  1STY A;  1BCP D;  1Q8K A;  1DGS A;  4XXE A;  1I94 Q;  2JA7 H;  2R7Z G;  1IBL Q;  4QQB X;  3KBG A;  4LF6 Q;  2JEA I;  4A93 H;  3M85 A;  1I4G A;  4DNT B;  2EPB A;  4CJ0 B;  5JEA G;  2OWO A;  5IYB G;  2RBM A;  1XNR Q;  4N8F A;  4CHT B;  1DON A;  2B3G A;  4OWT B;  5C0X I;  3PO2 B;  4BY1 G;  3GTK B;  3HOV B;  1PV4 A;  2WIN B;  3DUZ A;  1N32 Q;  1VQN A;  1SMY C;  1V43 A;  2CWP A;  3NBH B;  5DLQ E;  5AJ3 Q;  3ND9 A;  4P72 A;  1F9P A;  3S2D B;  2QKI C;  4WJ4 A;  4R4I A;  1TS5 A;  3QOL A;  4IFD J;  1RDP D;  5FLX E;  3S17 B;  1UEA B;  4U68 A;  4DGZ A;  2K14 A;  2KCT A;  3VYS A;  4YHH Q;  4C1N K;  3MEH A;  3S1M B;  3JAM i;  3T53 B;  1HHV A;  5KEE A;  3S1Q B;  1HA6 A;  4FNF A;  2RCF A;  3J81 i;  3NSW A;  4CKE A;  4M1U B;  4DAM A;  1OXS C;  1Q7Y C;  1VQJ A;  1SND A;  3GTL B;  4FXG C;  5LL6 S;  1MJE A;  5CR3 A;  2NB0 A;  3SK6 A;  1F9Q A;  3STB D;  3T56 B;  1AZP A;  1HZ9 A;  2UXD L;  2I5M X;  4A3E B;  2QIL A;  5HGQ A;  1QB5 D;  2MO1 A;  3HKZ B;  3SHL A;  5KGU A;  3CF5 A;  3A5U A;  2EJF C;  5ELN A;  4DV6 Q;  3S15 B;  4B3T Q;  1Q8I A;  4B3M Q;  1WTV A;  2B2W C;  1E2Z A;  3CCQ A;  1K8A C;  1EIH A;  2JE6 I;  1VQ4 A;  3HOZ B;  4UDU C;  3CAM A;  2A6E C;  1PFS A;  2I07 B;  1YHQ A;  1EOT A;  3A8J E;  2UXC L;  1WD1 A;  1EZ8 A;  2PZT A;  1A2T A;  2LFN A;  4C3J B;  1K83 B;  1GUN A;  4LUV A;  2FHT A;  4HJ8 A;  3HS0 C;  5EJW A;  4C3H G;  1IBK Q;  2F0W A;  1SN8 A;  2LXK A;  4CDE C;  3MFG A;  1HR0 L;  3Q6S A;  3H3V C;  2B2V C;  1HCZ A;  4G4K A;  4G57 A;  2IJ0 A;  1N36 Q;  2PI2 E;  3DEP A;  1HPC A;  2E75 C;  5C5L A;  1IZ6 A;  4R4T A;  3ONA B;  1GD7 A;  1F2Y A;  5JPM C;  1MKH A;  2QEJ C;  2E2J B;  3GTM B;  3CKI B;  2XVS A;  4IQZ A;  4O1N A;  1VQK A;  2WFW A;  2K5N A;  1B70 B;  4RFB A;  4CGY B;  4PMW A;  5CV8 A;  4R8N A;  4A3L H;  4HJA A;  1WTX A;  4JV5 L;  3D31 A;  3PO2 H;  2HT1 A;  1HZB A;  2QDL A;  3R2I A;  2Q8I B;  4I65 A;  4CBV A;  4YWM A;  1NMG A;  1WTQ A;  1BO0 A;  1F2Z A;  3VR3 A;  1QUQ B;  4IUR A;  1XMO L;  2N49 A;  3RR5 A;  5JOB A;  2K5D A;  2D9U A;  2WB1 G;  4HN7 A;  1EIG A;  3MZ5 A;  4Q0F A;  1SNP A;  2UXB L;  2B29 A;  2C35 B;  3CRL C;  3OMC A;  3FKI B;  1QZG A;  1J6Q A;  3HOY H;  1ESF A;  1K3R A;  1TVX A;  4Z9C B;  1I6V C;  1M90 C;  1LTR D;  4LF8 Q;  4K8I A;  5JJK A;  3HOU H;  4WJW A;  3GDE A;  4UP7 A;  3SEB A;  4GKK L;  4IPC A;  4B3T L;  1E2W A;  2I0Q A;  5D3I B;  1SNQ A;  5GRO A;  2BOS A;  4LUO A;  2RSN A;  4NKL A;  3W1B A;  4GN3 B;  4BBS G;  1F2L A;  2HUG A;  2SNM A;  1U4P A;  1M4V A;  5DM6 3;  4V19 0;  3K81 C;  4ZUJ A;  3PF5 A;  2CFM A;  2OCE A;  1G2T A;  4KN7 C;  4HJ9 A;  1VQM A;  1FNU A;  4R8I A;  4B9X A;  4V0B A;  3HP3 A;  1W2B A;  4EVO A;  3K0X A;  3DWA A;  2HHH Q;  1AW7 A;  2E2H B;  1X3E A;  2NTT A;  3GTJ B;  4Y7N B;  4TQU S;  5D3D A;  1T5X D;  4KK7 A;  2I5L X;  1F9S A;  4LFC Q;  2NZO A;  4JI4 Q;  4RA8 A;  1E1O A;  2Z1C A;  4GS3 A;  5FLM G;  4UP8 A;  1KHI A;  1SYC A;  2LS0 1;  3OIQ A;  4JC0 A;  4QGU A;  1TQO A;  1LT5 D;  4RKL A;  5IGG A;  3KLR A;  3RLO A;  1XXG A;  1H9J A;  2NVQ H;  4BS9 A;  4L8J A;  4HIM A;  3FDT A;  3RLN A;  4JI8 Q;  1U9R A;  4DXF A;  3UDF A;  4DAP A;  1QVF A;  1QUQ A;  1VQI A;  1HRJ A;  5JVG 3;  4LF9 Q;  3HKZ G;  4DKA C;  1K8M A;  1B3Q A;  1DXM A;  2RA4 A;  4K14 A;  3EVQ A;  2VUM H;  1PH7 A;  1ET6 A;  2CVR A;  3HOY B;  3I4N B;  1E7Z A;  3SK4 A;  3UE1 A;  1H9S B;  3J81 L;  2QDB A;  5JJI A;  5EPK A;  4QJF A;  1QVC A;  1HA5 A;  5ELD A;  2PCF B;  1LTL A;  2ZJP A;  3S1Q H;  3BVG A;  1U4L A;  1ZYR D;  1DOM A;  4NMZ A;  4OWX B;  4JYA L;  3VR4 A;  3VYU A;  2EIF A;  2OQ0 A;  1F77 A;  2MPM A;  2ZXO A;  4DV6 L;  5EBC A;  3RN5 A;  4DV2 Q;  3C2P A;  4YCW A;  4BBR H;  4MN3 A;  2B8G A;  1HNX L;  5J1Z A;  1OXX K;  1V1Q A;  1VS0 A;  3TS0 A;  4UPA A;  2B2T C;  4XT1 B;  4QMG A;  3ULJ A;  2R3Z A;  2FXQ A;  1OXT A;  2MNA A;  2WB1 B;  3I8Z A;  5GAH C;  4WOR A;  3M3Y B;  1BKB A;  3DM3 A;  1HTL D;  4BBS B;  5E4X A;  1KRT A;  4XYO A;  3NHH A;  1GKH A;  1LUZ A;  2R92 H;  1BCP B;  1V1O A;  2B39 A;  3LWU A;  1PTO D;  3CP0 A;  2VB2 X;  2MO0 A;  4K0K L;  1DD2 A;  5EGT A;  1E2V A;  1LT6 D;  1XPO A;  4DA2 A;  1X3P A;  1B4O A;  4EX5 A;  1GUG A;  1TWH B;  3CCV A;  3OTO Q;  4C3I H;  5FLX L;  4H13 C;  2GA4 B;  3PO3 B;  3S1M H;  1Q1E A;  2NYZ D;  4LW1 A;  4RGM A;  2C9O A;  3D8G A;  4J8Q A;  5C44 B;  2F4V Q;  4C3J G;  3UE0 A;  3OPO A;  2NVX B;  3DLL A;  4IFD G;  3U50 C;  3R3O A;  1SJH D;  2NVT B;  3P75 A;  4AYB B;  1BR9 A;  1MGS A;  3HOW B;  5M9O A;  1HNW L;  4JW0 A;  1HQR D;  2ALY B;  4EQP A;  1KAB A;  2K5W A;  1N34 Q;  1NBW A;  4A4I A;  3MXN B;  4IO9 A;  5CV6 A;  1HR0 Q;  1AP0 A;  1I4X A;  3TDQ A;  2NVT H;  2G5D A;  4TKO B;  3WWV A;  4O42 A;  2F03 A;  1PTO F;  3B6Y A;  3KJO A;  2KHI A;  4IUN A;  3CCM A;  3GTK H;  4Y52 H;  3H0G G;  3HOU B;  1BNZ A;  4C3H H;  1ET9 A;  2HDL A;  4IOA A;  3IFT A;  3QO2 A;  1TWG B;  1BQQ T;  1JWM D;  4A3C G;  1G2S A;  4IN3 A;  1F2M A;  4KJN A;  1FNW A;  2O5I C;  2NBF A;  1STN A;  2JA7 B;  5C4H A;  5JVH 3;  1D1K A;  3TBI B;  1E22 A;  4ZYS A;  3OTO L;  2L5T A;  5ISR A;  2UXD Q;  3VYT A;  1PH8 A;  1MHW C;  2A6H D;  3OHX C;  2R92 G;  4DR5 L;  5C3E B;  4N9T A;  3J7A V;  2JA5 G;  2A5H A;  3TZD A;  4X3U A;  4A75 A;  3P7J A;  2CKZ B;  2SOB A;  3ND8 A;  4NDX A;  3X3M A;  1LTI D;  4GN5 A;  2WAQ E;  3S1N B;  5EAY A;  1J5E Q;  4OX9 L;  3K8A A;  3S1R B;  3QOJ A;  3L3O C;  2CH4 W;  2BH8 A;  2B63 B;  3FPP A;  1EL0 A;  1PYB A;  4RHR A;  2N3S A;  3GTQ B;  1EQR A;  3CC7 A;  1EQQ A;  3RZO H;  3AU7 A;  3SXH A;  3NQT A;  4IJL A;  5IGE A;  5IWA Q;  5LMN Q;  2UU9 L;  4A3L G;  1Q90 A;  5C4X G;  1PRT F;  2R7F A;  1DJR D;  4S3S A;  2OXP A;  1VQ7 A;  4XQQ A;  4DAY B;  2A6E D;  1RJT A;  2EDG A;  5M3M H;  3D6C A;  3ERO A;  3HOX H;  1CTM A;  2M00 A;  4P73 A;  1KNE A;  2LSS A;  3CQZ B;  1RTO A;  3H91 A;  3T1H L;  3FRP B;  2JYO A;  4QCL A;  1MD2 D;  2JQO A;  3AMU A;  4DPG A;  2GVB A;  1L1O C;  4X66 L;  4MIU A;  5E3F A;  3E0E A;  1ROD A;  2OEO A;  3AYH B;  1QWY A;  5I6W A;  3CCU A;  1Q3L A;  1AH9 A;  3V96 A;  2AQ1 B;  2V1C C;  1ASY A;  1ZYR C;  3S9W A;  4I7A A;  1VQO A;  1WFQ A;  4APV A;  1GXD C;  1I5F A;  2RSO A;  1X9N A;  4BXX G;  1Y69 U;  5KND A;  4EQO A;  1CA6 A;  1PH4 A;  4A3G B;  2ATW A;  2Q2T A;  4IZ8 A;  4MTN A;  3KLS X;  4IUQ A;  1D8L A;  3A5Z B;  1PTO H;  2JSO A;  2KQ3 A;  2RF4 A;  3P20 A;  3S17 H;  1U0L A;  2KOL A;  4L5T A;  4ABN A;  1N8R C;  2PMZ B;  1FJG Q;  3G48 A;  1EUJ A;  2JA8 B;  3JAM c;  2AUK A;  4U67 3;  1JT8 A;  1EFI D;  2DNC A;  1J5E L;  2P5Z X;  4TSS A;  4F8M A;  4ZAI A;  1GHJ A;  1GO3 E;  2YYZ A;  1K0R A;  3K5M A;  4GOP A;  5G3L F;  1EEI D;  5LHY 1;  1KDB A;  2Y0S E;  1VQF A;  3DEO A;  1HFG A;  4HSP A;  2JA5 H;  1STE A;  2ICE C;  1PVO A;  2PW7 A;  2EZV A;  5L37 A;  1IBL L;  3I55 A;  3M9B A;  3SVM A;  4DAY A;  4LF7 L;  2B63 G;  2UUB L;  1O80 A;  5J39 A;  4G7Z C;  2R93 G;  3X3N A;  1ENF A;  4OWW B;  3SK5 A;  5IYD H;  1AE2 A;  4KY6 A;  4GNX B;  4RCN A;  1WVL A;  4P74 A;  4NXN Q;  4JI6 L;  3Q23 A;  2AWO A;  3CCR A;  3RZD B;  3ERS X;  1LLR D;  2PYK A;  1K3B C;  4IUU A;  2Z4H A;  2JA6 G;  3IFD A;  4K5V A;  5ELC A;  2AMC B;  4JPB W;  4A3B H;  3PSI A;  3J80 c;  4GOP C;  4JOI A;  5HUR A;  4OO1 I;  1NSN S;  4I7Z C;  3T16 A;  4POF A;  4WJ3 M;  3MXU A;  3T51 B;  4BBR B;  1N34 L;  5I9O A;  5H1S E;  1NUC A;  4GKJ L;  3GTO H;  5M5Y B;  1KLG D;  1WJJ A;  1X32 A;  5CBA E;  2B63 H;  2OF1 A;  4IUV A;  4R4Q A;  1CK1 A;  3NEM A;  1JC7 A;  3G7L A;  4EQ5 A;  4JG2 A;  4AQY Q;  3EN2 A;  5LMU Q;  2F4V L;  2JA8 H;  1EY8 A;  3RZO B;  4B3S L;  3C46 A;  4HTH A;  5EKI A;  2B2Y A;  2EY1 A;  4AH6 A;  1WCM B;  3V05 A;  4F7X A;  2K32 A;  4X64 Q;  1G29 1;  3NWS A;  2PW5 A;  3J7A F;  2RHQ B;  3L2P A;  3S1R H;  3PMF A;  4PMB A;  4JI3 L;  4LFB Q;  5A2Q E;  1PFB A;  3E6Z X;  2F4I A;  3L7Z C;  5HGT A;  3HKZ E;  1WTH A;  4LJZ C;  5NUC A;  1HXY D;  1K83 H;  2C5C A; 
#chains in the Genus database with same CATH homology
 4ZUI A;  1EY6 A;  1RCV D;  4DNR B;  4K8J A;  5C4Z A;  1I4P A;  5A2Q L;  1PDQ A;  2F0K A;  3MXP A;  1NAP A;  4KV6 A;  3D4D A;  1LAC A;  4BY7 B;  2ICI A;  1I4H A;  3PV0 A;  3R93 A;  1EYC A;  2FIN B;  4HCS A;  4H7B A;  5F2D A;  1TU2 B;  1PTO C;  1PRT D;  4F88 A;  1YNN D;  1CZW A;  3I90 A;  5JEA H;  2XSC A;  1MI2 A;  1OXU A;  2VNU D;  4FF3 A;  2EY6 A;  3GV3 A;  3OMG A;  4KN4 C;  2O2L D;  4FF2 A;  3FMC A;  1AZQ A;  5CV7 A;  2NN6 G;  1S4Z A;  4ZQ3 A;  4ZKC B;  4IFD I;  2RDG A;  2SEB D;  4OIJ A;  1Z7T A;  3LNN A;  3K0Y A;  1IYU A;  5KYI A;  3QIA A;  3BVM A;  2EXZ A;  3TN2 A;  3NPP A;  1C4Q A;  4A3F B;  1EQV A;  3QG1 A;  3Q22 A;  1HTP A;  3MAQ A;  1JOK A;  1TWF B;  2K5Q A;  1TR5 A;  2RDF A;  1SXT A;  5IGC A;  1BCP C;  1G6Z A;  1ML0 D;  1HUM A;  1II3 A;  2OT2 A;  4PNY A;  3GO5 A;  2LMC B;  1PZK D;  1CQF A;  1Y1V B;  5K5P A;  2ENB A;  1O7Z A;  3RMH A;  3ERQ A;  1EEF D;  1SE4 A;  1B53 A;  1SYG A;  4BY1 B;  1JOQ A;  4RGO S;  5T1I A;  2XWJ B;  1B50 A;  3M7G A;  2RKS A;  1B1Z A;  5CV9 A;  4M8A A;  1STA A;  1SYB A;  1EU3 A;  2VUM B;  1V8Q A;  1IYV A;  2CW0 D;  1GUW A;  5E1F A;  5E4W C;  4K2L A;  4ILW A;  2X6L A;  2KUM A;  2F0T A;  1O7Y A;  1D5M C;  4QUC A;  2V4D A;  3BDC A;  2EVB A;  3NTK A;  3D4R A;  1PMR A;  1CHQ D;  3H09 A;  5C4J B;  4CJ2 C;  4B9W A;  1ZEQ X;  2JEB I;  3DHQ A;  1A3U A;  2BDO A;  3N6R A;  2EJM A;  2D2C C;  4X3K A;  3FPU B;  1E0B A;  2R61 A;  2ID0 A;  3T13 A;  5ELB A;  2QCP X;  4A3B B;  1UAP A;  1TT2 A;  2CHB D;  1EWH A;  1EWC A;  1EY9 A;  1CZG A;  1DYQ A;  4K5W A;  4BA2 I;  2EYF A;  1WTR A;  4RGN A;  3S16 B;  1U4M A;  4DN4 M;  1BXT A;  3PUY A;  1WTP A;  4BWG B;  1RD9 D;  2WKD A;  1WTO A;  1A3T A;  4KHV A;  1ICW A;  4HSV A;  4CJ1 B;  5KNC A;  3VA5 A;  5G3L D;  4EGV A;  1QG7 A;  3BDL A;  1NR4 A;  2F0U A;  3SR1 A;  4R9W A;  3SE0 A;  2B2V A;  1KLU D;  3M7N A;  5LL6 X;  2HCI A;  1IW7 D;  2B2U C;  3U9S A;  1RKN A;  2B2T A;  1VMC A;  4A3J B;  3AB9 A;  1SNC A;  1GHK A;  1JOR A;  2SDF A;  2LKV A;  3C3L A;  3IKJ A;  1FNV A;  1H9K A;  3D4W A;  1LT3 D;  1DOK A;  2EOT A;  3OSO A;  5BN5 A;  4XYQ A;  3WDN A;  3K58 A;  1AEX A;  1SYF A;  2F0V A;  3WOF A;  1G91 A;  5I2Y A;  1STH A;  4NP5 A;  1JWS D;  3E0J A;  4QB4 A;  5K36 G;  3EFX D;  3PIP 3;  2J7Z A;  2J0T D;  2NWG A;  4XTC S;  1IKM A;  1STB A;  1QCB D;  3OW7 A;  4ODG A;  4RCO A;  3K57 A;  1S5F D;  5C0X H;  4L63 B;  2F0N A;  5JPN C;  1ENA A;  3K5O A;  1JR0 D;  1J8I A;  2MHV A;  3U9O A;  1Z6H A;  4KKS A;  5ELE A;  2ZT9 C;  3I91 A;  3KK7 A;  1ENC A;  2L11 A;  2DNE A;  1KNA A;  2IWH A;  2R92 B;  2FMM A;  2XRQ D;  1TY0 A;  4CKC A;  1XWE A;  2JA6 B;  5KNB A;  3I72 A;  3GTO B;  1MSH A;  3RUZ A;  1B9N A;  1EYD A;  2A6H C;  1FR3 A;  4HR7 B;  4FYD A;  1M8A A;  3FVQ A;  3L9A X;  1DM0 B;  2CW0 C;  1GOZ A;  3A55 A;  2R7Z B;  3SDZ A;  2F0G A;  2NTS A;  1SBB B;  1ILQ A;  1I3Q B;  1I4Q A;  1MBY A;  2WAQ B;  2K05 A;  2IW3 A;  4OGQ C;  4RKB A;  1L0X B;  1CT1 D;  1U4R A;  1SYE A;  3NK9 A;  4PQX A;  2BE5 D;  2PPB C;  1VMP A;  1D1I A;  3HRZ C;  1BOS A;  3J7Y W;  2EY5 A;  1V1P B;  4K5X A;  1JCK B;  4A3D B;  3QWN A;  1D5Z C;  2KEE A;  1STG A;  2J4X A;  4DFA A;  1AFP A;  1L0Y B;  1GUT A;  4F87 A;  4J1M A;  1WTW A;  1EYA A;  2RDH A;  3R8B A;  2NVY B;  4JBW A;  2A68 C;  1Q1B A;  1RHP A;  1SYD A;  2B2U A;  1RF2 D;  2AWN A;  1UNS A;  4H44 C;  3A56 A;  1CFM A;  1T5E A;  2KCC A;  5COR A;  3EA6 A;  3OOC A;  1HUN A;  2PNR C;  5D14 A;  3R2T A;  1JQY D;  1PZI D;  1HQM C;  5IT9 L;  2XIW A;  3TSS A;  2XWB B;  3MXG A;  4QUF A;  5A35 A;  4KY7 A;  2MJ8 A;  3TME A;  4KD4 A;  1S5E D;  4DF7 A;  1BCP F;  5JAV A;  3I4L A;  3HOX B;  4ZLT F;  3LWE A;  2TMP A;  1A2U A;  3PUV A;  1YNJ D;  4DU9 A;  1SNO A;  3TZU A;  3W2D A;  2R6G A;  2F0D A;  2H4O A;  3S14 B;  3FEW X;  2LY7 A;  4HCE A;  3M4O B;  2CQA A;  4MHE A;  3K7A B;  2MGS A;  1A15 A;  4IFD H;  2PQE A;  3C1E A;  3E5S A;  3N52 A;  5C4X B;  2XN9 C;  1D5X C;  2NN6 H;  5IGF A;  4XDX A;  3NQI A;  5IIF A;  3NXW A;  1TII D;  5KRU A;  1SMY D;  3VR6 A;  3HZX A;  1FYC A;  3OIP A;  4XQN A;  3TP8 A;  2B2Y C;  2IT1 A;  4FF1 A;  3UI2 A;  3A7L A;  1S5C D;  3K59 A;  1B44 D;  3BVZ A;  1QJO A;  3CU7 A;  5FO8 B;  2X6G A;  5FO9 B;  3S2H B;  4K6D A;  3EJI A;  1ESR A;  3O13 A;  2F0L A;  2BDN A;  1JIC A;  2BA0 A;  5K36 H;  1BUV T;  3A7A B;  3HEJ A;  3CHB D;  4RHS A;  2WAC A;  5EKL A;  4JK1 C;  1OXV A;  1B3A A;  3GTP B;  1S5D D;  4DAV A;  3QB3 A;  1LTA D;  1WD0 A;  2JXM B;  1I4R A;  2N88 A;  1YNN C;  5CV4 A;  3KF8 A;  4FXD A;  5IGB A;  1PFN A;  1BF4 A;  2O4X A;  1W6K A;  4P2C B;  4J6H A;  3JAM L;  3GV6 A;  2EJG C;  5C3X A;  3BZD B;  3OWF A;  1XX8 A;  1R9T B;  1PRT B;  2N55 A;  1A6X A;  3RD4 A;  2L12 A;  4DK0 A;  1H9S A;  3SK8 A;  2F0J A;  4ZK9 B;  2A73 B;  1JWU D;  1H9M A;  4LMQ D;  3PUX A;  4PV1 C;  2F0E A;  5C3W A;  1FD7 D;  2KEC A;  3DM1 A;  4L6T B;  2A69 C;  3BDO A;  1GJX A;  1Y8O B;  5I9P A;  1R4P B;  4KJO A;  3ITP A;  1AN8 A;  2AQ2 B;  3BYT B;  2MP1 A;  3F2U A;  1PFM A;  1EY4 A;  4FO2 A;  3G6J B;  3D3R A;  1BBX C;  4Q5V A;  4KKU A;  2PZU A;  2JP1 A;  3J80 L;  4HED A;  1QOH A;  1CM9 A;  4ME5 A;  4FF4 A;  4RGT A;  3JAM E;  4KMU C;  5FO7 B;  1LO5 D;  2KJX A;  1J9O A;  2K04 A;  1UUP A;  3NP8 A;  2M2L A;  1SNM A;  3OWE B;  1QNK A;  4EQN A;  3I73 A;  5EKK A;  1NCV A;  3I3C A;  3T4A C;  4HAE A;  1TWC B;  3J81 E;  3TP7 A;  2XNA C;  3IAY A;  1C48 A;  2VXW A;  1LV9 A;  2L0C A;  3KUP A;  1PYW D;  2FFK B;  5DM7 3;  2Y0S B;  5IOC A;  3GP7 A;  4C56 C;  2Z8L A;  2VB3 X;  4QIW B;  1IL8 A;  5I2X A;  4KHZ A;  4X3T A;  2F0Q A;  1JE4 A;  5M5W B;  1CA5 A;  3MTS A;  1PLF A;  2O5J C;  1KDC A;  5AFW A;  2EYO A;  2KVM A;  3NBI A;  4A93 B;  2WP8 J;  4ID6 A;  4OO1 H;  1H9R A;  2K33 A;  1VDZ A;  2IX0 A;  1NR2 A;  3URY A;  4A3K B;  5M3M B;  2A68 D;  2RVL A;  1Z47 A;  3MVV A;  2HQE A;  3MHB A;  4C3H B;  4KKT A;  1G8Z D;  2EYP A;  5JEA J;  1SAP A;  5DNF A;  2F0S A;  3I4M B;  2L55 A;  3GD7 A;  2YU9 B;  3IL8 A;  2FJ2 A;  1TY2 A;  4C3I G;  2KED A;  3MC0 B;  2Q8T A;  3VR5 A;  2WII B;  5FKA C;  3PIO 3;  1HFN A;  1EY0 A;  2RQX A;  1C8C A;  2HDM A;  2EE1 A;  4WFN 3;  1IW7 C;  1IKL A;  2AUJ D;  1ZXT A;  2E2I B;  1SFO B;  5C0X J;  2K01 A;  3NTI A;  4RWS C;  3M4Y A;  1D6E C;  4KY5 A;  3H94 A;  2K6A A;  2H1E A;  2D5D A;  2F1M A;  5C0X G;  2E76 C;  1SE3 A;  3WOE A;  4PMC A;  4CKB A;  3HG9 A;  3PUZ A;  4H0L C;  3C1F A;  1PXU A;  1Y8N B;  3NTH A;  1JB3 A;  3PUW A;  3ZYY X;  4FVM A;  2B2W A;  2IL8 A;  2EY2 A;  2A69 D;  1D2B A;  1TWA B;  2DY8 A;  2FMC A;  1SDF A;  4OIK A;  3K5N A;  1EY5 A;  3NBH A;  5KIX A;  5M3F B;  2KHS A;  2ZXP A;  3DMU A;  5DAU A;  1PZJ D;  2EYL A;  5C6A A;  4XQJ A;  2KA7 A;  4XT3 B;  2K28 A;  2XRS D;  5DEH A;  4LAA A;  1QIL A;  4X3S A;  4KD3 A;  2M9V A;  1EZ6 A;  4E6I A;  4A3I B;  5CMD A;  3DWQ A;  5EQ0 A;  2BA1 A;  4TRD A;  1O7L A;  4K6L A;  3A54 A;  5IOD A;  4IAL A;  1LAB A;  2A74 C;  1I50 B;  2HCC A;  2IX3 A;  3BG3 A;  3KBX A;  1KAA A;  1V1P A;  5TSS A;  2KCN A;  1LTS D;  1O78 A;  3MWY W;  3P1H A;  5BN4 A;  2K1B A;  4C1N I;  5I4D A;  1GUO A;  1LTT D;  1CQV A;  1LT4 D;  2X69 A;  5COY A;  2L9H A;  2F0P A;  1I6H B;  5EBD A;  5IGD A;  5EPJ A;  3TP6 A;  1PTO B;  2R93 B;  3D6W A;  2F0F A;  2NVQ B;  3V2T A;  4NW2 A;  2E74 C;  3A8K E;  3W3A A;  1SJE D;  5CGK A;  4KTA A;  4ZRZ A;  3LX0 A;  2L4N A;  1VCI A;  3MXN A;  1Y1W B;  1FGB D;  3NUC A;  1TKW B;  1MSG A;  3TP5 A;  1EQT A;  2ZXR A;  4DK1 A;  3KLS A;  5C5M A;  4C2M B;  5FK9 C;  1KTK A;  5JJZ A;  2NZ1 D;  3NWT A;  3NE5 B;  2K7V A;  4OHJ A;  2NN6 I;  3GQB A;  4DXG A;  3CRK C;  3EQL C;  1OO9 B;  4RH6 A;  2K03 A;  1RTN A;  2F3V A;  1VF5 C;  5CV5 A;  2D62 A;  2B8F A;  2JA5 B;  4YIJ A;  3DXJ C;  1SE2 A;  4B08 A;  4KI0 A;  1W6J A;  2MUY A;  2EYH A;  3I70 A;  1DZ1 A;  2F3W A;  2Z4I A;  4UAI A;  4N9P A;  4GZY C;  4HMI A;  1ILP A;  1K8O A;  1TS3 A;  3BS1 A;  1TS4 A;  5BN3 A;  3VA7 A;  2EYJ A;  3Q0A A;  1QNU A;  5IT9 E;  2BE5 C;  3VR2 A;  1GUS A;  2DY7 A;  4ZKB B;  1X3Q A;  2AQ3 B;  4K2K A;  1Y8P B;  2F0O A;  4G7O C;  4BA1 I;  2F0H A;  2F0I A;  1S5B D;  3Q24 A;  2G9D A;  1TS2 A;  4ULL A;  4C3I B;  4FXK C;  2IX1 A;  1BDO A;  3GTG B;  5FOB B;  4WRD A;  3J80 E;  3RLF A;  1IHZ A;  2NUC A;  2IPK D;  2PZW A;  1CI3 M;  1DOL A;  1EY7 A;  3H0G B;  1B9M A;  5ELF A;  5T1G A;  5CBE E;  2F0M A;  2L1B A;  2EYM A;  3BYY B;  4IUT A;  2QF7 A;  2PO4 A;  1SEB D;  4HMJ A;  5D65 A;  1XTC D;  3QJY A;  5M5X B;  1LTG D;  3DWP A;  4G7H C;  1ZKO A;  4LK1 C;  4FP5 D;  3A8I E;  1Q12 A;  1PRT C;  1DCZ A;  1EU4 A;  1XYI A;  4IUP A;  4A3M B;  2Q8R E;  1CHP D;  2DN8 A;  1JOO A;  3H6M A;  2WKC A;  5CC4 A;  5EPL A;  2TSS A;  1KDA A;  2SNS A;  3K6O A;  1F9R A;  1YNJ C;  1QE6 A;  3MFY A;  4QF4 A;  5J22 A;  4OL7 A;  2I46 A;  4XIG S;  3VYR A;  2BCO A;  2E2D C;  2WV6 D;  3HGB A;  1B2T A;  1LTB D;  5I6Y A;  3K5L A;  1ONL A;  5KYL A;  1SSO A;  4OO1 G;  4RAU C;  1R4Q B;  1A3V A;  3MA2 B;  2G9H D;  5CYU A;  1VF7 A;  1STY A;  1BCP D;  4XXE A;  3KBG A;  2JEA I;  3M85 A;  1I4G A;  4DNT B;  2EPB A;  4CJ0 B;  5JEA G;  2RBM A;  4CHT B;  1DON A;  5C0X I;  3PO2 B;  3GTK B;  3HOV B;  2WIN B;  3DUZ A;  1SMY C;  1V43 A;  3ND9 A;  1F9P A;  3S2D B;  2QKI C;  1TS5 A;  3QOL A;  4IFD J;  1RDP D;  5FLX E;  3S17 B;  1UEA B;  4U68 A;  4DGZ A;  3VYS A;  4C1N K;  3MEH A;  3S1M B;  3T53 B;  1HHV A;  5KEE A;  3S1Q B;  1HA6 A;  4FNF A;  3NSW A;  4CKE A;  4M1U B;  1OXS C;  1SND A;  3GTL B;  4FXG C;  5LL6 S;  5CR3 A;  2NB0 A;  3SK6 A;  1F9Q A;  3T56 B;  1AZP A;  4A3E B;  2QIL A;  1QB5 D;  3HKZ B;  3SHL A;  5KGU A;  2EJF C;  3S15 B;  1Q8I A;  1WTV A;  2B2W C;  1E2Z A;  1EIH A;  2JE6 I;  3HOZ B;  4UDU C;  2A6E C;  2I07 B;  1EOT A;  3A8J E;  1WD1 A;  1EZ8 A;  2PZT A;  1A2T A;  4C3J B;  2LFN A;  1K83 B;  1GUN A;  2FHT A;  3HS0 C;  5EJW A;  4C3H G;  2F0W A;  3MFG A;  3Q6S A;  3H3V C;  2B2V C;  1HCZ A;  4G4K A;  4G57 A;  2IJ0 A;  3DEP A;  1HPC A;  2E75 C;  5C5L A;  3ONA B;  1F2Y A;  5JPM C;  2QEJ C;  2E2J B;  3GTM B;  3CKI B;  2XVS A;  4IQZ A;  4O1N A;  4CGY B;  4RFB A;  4PMW A;  5CV8 A;  4R8N A;  1WTX A;  3D31 A;  3R2I A;  2Q8I B;  4I65 A;  4CBV A;  1WTQ A;  1BO0 A;  1F2Z A;  3VR3 A;  4IUR A;  5JOB A;  2K5D A;  2D9U A;  4HN7 A;  1EIG A;  3MZ5 A;  4Q0F A;  1SNP A;  3CRL C;  3OMC A;  3FKI B;  1ESF A;  1TVX A;  4Z9C B;  1I6V C;  1LTR D;  4K8I A;  4WJW A;  3SEB A;  1E2W A;  5D3I B;  1SNQ A;  2BOS A;  2RSN A;  4NKL A;  1F2L A;  2HUG A;  2SNM A;  1U4P A;  1M4V A;  5DM6 3;  4V19 0;  4ZUJ A;  1G2T A;  4KN7 C;  1FNU A;  4R8I A;  4B9X A;  4V0B A;  3HP3 A;  4EVO A;  3DWA A;  1AW7 A;  2E2H B;  2NTT A;  3GTJ B;  4Y7N B;  4TQU S;  5D3D A;  1T5X D;  4KK7 A;  1F9S A;  4RA8 A;  2Z1C A;  1SYC A;  2LS0 1;  3OIQ A;  1TQO A;  1LT5 D;  4RKL A;  5IGG A;  3KLR A;  1XXG A;  1H9J A;  4BS9 A;  4L8J A;  3FDT A;  1U9R A;  4DXF A;  4DAP A;  1HRJ A;  5JVG 3;  1K8M A;  1DXM A;  2RA4 A;  4K14 A;  3EVQ A;  1ET6 A;  2CVR A;  3HOY B;  3I4N B;  3SK4 A;  1H9S B;  3J81 L;  2QDB A;  5EPK A;  5ELD A;  1HA5 A;  2PCF B;  3BVG A;  1U4L A;  1ZYR D;  1DOM A;  4NMZ A;  3VR4 A;  3VYU A;  1F77 A;  2MPM A;  2ZXO A;  5EBC A;  3C2P A;  4MN3 A;  2B8G A;  5J1Z A;  1OXX K;  2B2T C;  4XT1 B;  4QMG A;  2R3Z A;  1OXT A;  2WB1 B;  3I8Z A;  4WOR A;  3M3Y B;  1HTL D;  4BBS B;  5E4X A;  4XYO A;  3NHH A;  1BCP B;  1V1O A;  2B39 A;  3LWU A;  1PTO D;  2VB2 X;  1DD2 A;  5EGT A;  1E2V A;  1LT6 D;  4DA2 A;  1X3P A;  1B4O A;  1GUG A;  1TWH B;  5FLX L;  4H13 C;  2GA4 B;  3PO3 B;  1Q1E A;  2NYZ D;  4RGM A;  2C9O A;  3D8G A;  4J8Q A;  5C44 B;  4C3J G;  3OPO A;  2NVX B;  4IFD G;  3R3O A;  1SJH D;  2NVT B;  3P75 A;  4AYB B;  1BR9 A;  1MGS A;  3HOW B;  5M9O A;  1HQR D;  4EQP A;  1KAB A;  2K5W A;  5CV6 A;  1AP0 A;  1I4X A;  3TDQ A;  4TKO B;  4O42 A;  2F03 A;  1PTO F;  4IUN A;  3HOU B;  1BNZ A;  1ET9 A;  2HDL A;  3IFT A;  3QO2 A;  1TWG B;  1BQQ T;  1JWM D;  1G2S A;  4IN3 A;  1F2M A;  4KJN A;  1FNW A;  2O5I C;  2NBF A;  1STN A;  2JA7 B;  5C4H A;  5JVH 3;  1D1K A;  3TBI B;  4ZYS A;  2L5T A;  5ISR A;  3VYT A;  2A6H D;  3OHX C;  5C3E B;  4N9T A;  3J7A V;  2A5H A;  3TZD A;  4X3U A;  3P7J A;  2SOB A;  3ND8 A;  4NDX A;  3X3M A;  1LTI D;  3S1N B;  3S1R B;  3QOJ A;  3L3O C;  1EL0 A;  2B63 B;  3FPP A;  4RHR A;  3GTQ B;  3AU7 A;  3SXH A;  3NQT A;  5IGE A;  1Q90 A;  1PRT F;  1DJR D;  4S3S A;  2OXP A;  4XQQ A;  2A6E D;  1RJT A;  2EDG A;  3D6C A;  3ERO A;  1CTM A;  2M00 A;  1KNE A;  3CQZ B;  1RTO A;  3H91 A;  3FRP B;  2JYO A;  4QCL A;  1MD2 D;  3AMU A;  4MIU A;  5E3F A;  1ROD A;  2OEO A;  5I6W A;  1QWY A;  1Q3L A;  3V96 A;  2AQ1 B;  1ZYR C;  3S9W A;  1GXD C;  2RSO A;  1Y69 U;  5KND A;  4EQO A;  1CA6 A;  4A3G B;  4IZ8 A;  3KLS X;  4IUQ A;  1PTO H;  2JSO A;  2KQ3 A;  3P20 A;  2KOL A;  4ABN A;  2PMZ B;  2JA8 B;  2AUK A;  4U67 3;  1EFI D;  2DNC A;  4TSS A;  4F8M A;  4ZAI A;  1GHJ A;  2YYZ A;  3K5M A;  5G3L F;  1EEI D;  5LHY 1;  1KDB A;  3DEO A;  1HFG A;  4HSP A;  1STE A;  2ICE C;  2PW7 A;  2EZV A;  3SVM A;  4DAY A;  1O80 A;  5J39 A;  4G7Z C;  3X3N A;  1ENF A;  3SK5 A;  4KY6 A;  4RCN A;  1WVL A;  3Q23 A;  2AWO A;  3RZD B;  1LLR D;  2PYK A;  4IUU A;  2Z4H A;  3IFD A;  4K5V A;  5ELC A;  5HUR A;  4OO1 I;  1NSN S;  4I7Z C;  3T16 A;  3MXU A;  3T51 B;  4BBR B;  5M5Y B;  5I9O A;  1NUC A;  1KLG D;  1X32 A;  5CBA E;  2OF1 A;  4IUV A;  1CK1 A;  1JC7 A;  3G7L A;  1EY8 A;  3RZO B;  3C46 A;  4HTH A;  5EKI A;  2B2Y A;  2EY1 A;  1WCM B;  3V05 A;  4F7X A;  2K32 A;  1G29 1;  3NWS A;  2PW5 A;  3J7A F;  3PMF A;  4PMB A;  5A2Q E;  1PFB A;  3E6Z X;  2F4I A;  3L7Z C;  5HGT A;  4LJZ C;  5NUC A;  1HXY D;  2C5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...