1C8CA

Crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
b'MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLAKQKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*AP*TP*CP*GP*C)-3'
publication title Crystal structures of the chromosomal proteins Sso7d/Sac7d bound to DNA containing T-G mismatched base-pairs.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2000-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c8cA00
1F9RA 1PFNA 1A15A 4IUVA 4RAUC 3UI2A 1BNZA 2RVLA 4X3TA 1M8AA 1KNAA 1RTNA 3IL8A 2SDFA 5DNFA 4R8IA 5CMDA 2FFKB 1NAPA 1EL0A 4DN4M 1PFMA 1QNKA 1SDFA 1S4ZA 3P7JA 4IURA 1EIHA 1TVXA 1J9OA 1O7ZA 5EQ0A 1WTOA 4HAEA 1CA5A 1NR2A 2IL8A 3HP3A 2X69A 4HEDA 2DY7A 1WTRA 1EQTA 1IKLA 2JYOA 2K04A 3QO2A 2HCIA 2HDMA 4ZLTF 1PFBA 1WTPA 1XX8A 2FJ2A 4XT1B 4MHEA 2RA4A 4QUCA 1U4MA 2HUGA 1B4OA 1ESRA 2DY8A 2Q8TA 1HA6A 2NZ1D 5CBEE 1G91A 2B2VA 1C8CA 2EE1A 1ICWA 2JP1A 2KECA 1ILPA 1DOLA 1MGSA 1SSOA 1VMCA 3H91A 2K05A 2B2TA 1HFGA 1U4PA 1BO0A 1DONA 2N55A 2KOLA 2L1BA 2N88A 1GUWA 1MI2A 1WTVA 1ML0D 1VMPA 1X3PA 1NR4A 2L9HA 4CJ1B 4O42A 2K03A 2X6LA 1RTOA 3KUPA 2MGSA 5CBAE 3DEOA 1G2TA 1HUNA 1B3AA 3I91A 4XDXA 1Q3LA 4CJ2C 4X3KA 2B2VC 2FHTA 5T1IA 3SVMA 5E4XA 2B2WA 3GV6A 3TZDA 3I90A 4UAIA 1B2TA 1G6ZA 1NCVA 2B2TC 2RSOA 5COYA 1SAPA 2KUMA 2XIWA 4NW2A 1JE4A 2FINB 2M2LA 5JJZA 1RHPA 5EKIA 2HCCA 4ZK9B 3GV3A 1F9SA 3KBXA 1G2SA 1EIGA 2B2UA 4R9WA 1KNEA 1X32A 3MWYW 1WD1A 1MSHA 5EPKA 4IUUA 1B50A 2B2WC 1B53A 1O7YA 2H1EA 5CORA 4OIKA 5T1GA 1AZQA 1CM9A 1RODA 2VXWA 1BBXC 1ZXTA 4IUPA 2K01A 2Q8RE 2X6GA 1EOTA 3IFDA 2NYZD 2KEDA 2L11A 2K1BA 2L4NA 4ZKBB 5D14A 2B2UC 1F9PA 1RJTA 2KEEA 3F2UA 3I3CA 1BF4A 1IKMA 2D9UA 4LMQD 5EPLA 2KVMA 2MJ8A 2FMMA 5EJWA 3FPUB 1WD0A 3LWEA 3N52A 4MN3A 1XYIA 4HCSA 2CVRA 1ILQA 1O80A 2L12A 4RWSC 5AFWA 3MTSA 1F9QA 3ONAB 1MSGA 2HDLA 1HUMA 1JICA 2NWGA 2RSNA 3FDTA 1QG7A 4OIJA 1AP0A 1J8IA 1WTWA 1AZPA 1DZ1A 4XT3B 1HFNA 2R3ZA 2B2YA 4U68A 1LV9A 4X3UA 2EOTA 1E0BA 1QE6A 5EPJA 4ZKCB 4CJ0B 4IUQA 1F2LA 3DEPA 3I8ZA 4X3SA 3TN2A 1WVLA 5D65A 1WTXA 3D6WA 1PLFA 2EPBA 1IL8A 2J7ZA 2K28A 4HSVA 2BDNA 1U4RA 1HHVA 1X3QA 1HRJA 3DM1A 3R93A 1WTQA 4IUTA 4RA8A 1CA6A 4ZAIA 4QUFA 1DOKA 2MP1A 2MPMA 3G7LA 3Q6SA 1U4LA 5E4WC 1PDQA 1DOMA 2B2YC
chains in the Genus database with same CATH superfamily
3CCLA 2NVTB 3WOFA 3I73A 1B9NA 4ME5A 4TVAB 4IFDI 1A3TA 5IGCA 1DD2A 3EN2A 1QILA 3STBD 1M1KC 1SR3A 3E0EA 4A3EG 1WTOA 1E1TA 4RG1A 3BDLA 1YEZA 3H94A 3GO5A 1EFWA 3M3YB 4DV6Q 2RF4A 1ET6A 1HNZQ 1NNXA 1VQAA 4DV0L 4QUCA 1U4MA 3MXUA 2KCNA 3S9WA 4C3IB 3T4AC 4GOPB 4JI4Q 3KLRA 2RDFA 2F0VA 3F2DA 1IW7C 1SYGA 3M4QA 3GTGH 1UE5A 2B2TA 2UXDQ 4DA2A 1H9RA 1YNXA 2N55A 4DR2Q 3S2HB 1YHQA 3RUZA 1SFOH 1STYA 3GTPB 1GUWA 2WB1G 1XNRQ 3S14B 3W1GA 1EYAA 2MGSA 4K8JA 2PQEA 2ZTEA 3I91A 4HJ7A 3AU7A 4DV2Q 5ELCA 4IQZA 3M4PA 3Q8DA 1E7ZA 1WCMH 2JA8B 3CQZB 4X65L 3I90A 4JBKA 3I4MB 4C56C 3K5NA 3M7GA 5M3FB 5LL6X 4IOCA 3TP6A 4KJOA 1K83B 2JEBI 4QIWE 1EEID 5JJZA 1D5MC 3H6MA 1PH6A 1VQ7A 4CKEA 4L5QA 1Q8KA 4LF9L 2EYJA 1JR0D 3A56A 3WWVA 3M4OH 1SLJA 3VYTA 4N9TA 4X64Q 4HIDA 2VB2X 4ULLA 4DV1Q 5EPKA 2XRQD 4L8JA 3J81E 1PRTD 5JVG3 4BBSG 2K01A 3CCRA 4DUZL 4CHTB 2PI2A 1Y8NB 3RZDB 2L4NA 4PZ6A 5D14A 1PMRA 1F9PA 5E7NA 1FJGQ 1BF4A 4LF4Q 3PSIA 2EYPA 4YCUA 1TWFH 5EJWA 2M9VA 4HCSA 2ZM6L 4BY7G 4JYAQ 1V1PB 4JPBW 1XPUA 5IY0A 4KHPL 3HOZG 1F9QA 2SEBD 3A5ZB 4EQ5A 5I6YA 2MUYA 1ZEQX 3S17B 1AP0A 1VQLA 2K7VA 1WTWA 4XT3B 2F0DA 2WACA 5M3MH 2N8NA 3NENA 1R4QB 4DV4L 3QJYA 2RHQB 3DM1A 1LTTD 1LTLA 1SE4A 1SN8A 4CDDC 1KHIA 4KD4A 1DOKA 2MP1A 3PUVA 1FGBD 2EDGA 4K5VA 1EIFA 3D3RA 3WDNA 4DV0Q 2XNAC 3J80i 4HIMA 4KLKA 2UUCL 3K58A 3D8GA 3MEFA 5IT9c 1PFMA 3SR1A 5C6AA 1EIHA 5FO8B 2ENBA 1ONLA 2IL8A 1IXRA 1ASYA 2X69A 4H0LC 1KLUD 4A3IG 1B9MA 1PA6A 1L0YB 1SRUA 4AYBB 4BY1G 1GVPA 2RA4A 5IGEA 2E2IB 1CSQA 5C5MA 4ODGA 4X65Q 1KABA 3J7A5 1HCZA 5IYCH 3H91A 5C3XA 2R7DA 2MQHA 3VA5A 2OTLA 5E3FA 3W3AA 2IT1A 2IHFA 4LF9Q 3E3XA 1EWIA 4RHRA 3MEHA 3JAML 4X3KA 1PZID 1YNJD 4R8NA 2GVBA 4I7ZC 4A3KH 2EXDA 4ZCKA 2QILA 1BOSA 4DUZQ 1ZKOA 3H0GB 3I4NH 4AH6A 3GTLH 4X66Q 3EBEA 2R7ZB 2PMZB 1VQ9A 4RHSA 1PRTF 4YCWA 2NVYH 1F2ZA 1YHAA 2R92H 3I55A 2A19A 5IGDA 4JI3L 2ZM6Q 1D6EC 3HKZE 4KHPQ 1A6XA 4F87A 3OW2A 5LL6S 1BBXC 3VR5A 4ABNA 3TDQA 3J7ZC 2JE6I 3P1HA 2VW9A 1R9TB 4BBRH 3P20A 1STGA 4LF6L 3BZCA 3T51B 2C5CA 4MTNA 4DV4Q 4NPSA 3RMHA 1L1OC 4RWSC 3PO3H 3HZXA 1CHQD 1B8AA 4GOPC 3HOVH 3K57A 4L5RC 3BVZA 4GNXB 1CZWA 1JCKB 3L7ZC 3FKIB 3UDGA 1I4RA 2UUCQ 3W5OA 1SYFA 1EY8A 1HHVA 5ELFA 1HRJA 1MJEA 1I94Q 4IUTA 1BDOA 4ZAIA 3OYYA 1EQQA 5HGTA 1JMCA 3T1HL 1YVCA 1CI3M 1I6HH 1IYJB 1EY6A 1UUPA 2K5WA 2A73B 1QVCA 5KGUA 3PIO3 5ELEA 3JAMi 1S5FD 5JEAG 4HEDA 4PG3A 2R93B 1E22A 1SNOA 1PFBA 5IGGA 3TZUA 1U0LA 1SSOA 2L55A 1FL0A 2A68C 4UPAA 4GLAC 1H9MA 2FXQA 2N88A 1GO3E 1HZBA 3CRKC 2IW3A 2Z9HA 1YITA 2X6LA 1RTOA 4DR1L 4A3GH 1UE7A 1SYEA 3C2PA 4RGTA 3BZKA 5CV6A 4JI5L 2XIWA 5DM73 4FF2A 1MJCA 5M5XB 3TMEA 4BXXH 3HKZG 4LF6Q 4R9WA 2R6GA 1N36L 4HIKA 1Y1VB 2ICEC 2KBNA 3OMCA 3GTQB 4C3JB 1H95A 3ZJYC 1CM9A 4EQOA 2WKDA 1QJOA 3HG9A 2L11A 1EQRA 2EQSA 4PNYA 2DJFC 1VQMA 3I3CA 4JG2A 1K3BC 1U9RA 1KC8C 1X65A 1KDBA 1IHZA 3TP7A 4I65A 1PH8A 2L0CA 3TREA 4F7XA 1KDAA 1QZGA 1MSGA 2RDGA 1X56A 2RSNA 4A3EB 4JBWA 3S1NH 1UNSA 1VQKA 3TS2A 3T1HQ 2ATWA 1LV9A 2F52A 4RH6A 3NTHA 1GUTA 4X3SA 2GN5A 2UUAL 2WAQE 2RQXA 1E2ZA 2AHOB 1I5FA 1SE8A 2NZOA 3H09A 5I9OA 5E4WC 3OW7A 1TWAH 2JA8G 4DGZA 1F9RA 4DR3L 4KK7A 4RAUC 2WB1B 5M3FG 3S15H 4AQYL 2EXZA 1VQIA 1WI5A 1OXXK 4PV1C 4LF8L 5CMDA 2JA7H 3VYUA 2IWHA 3LNNA 1EL0A 3K8AA 1Y1WH 3VR6A 5IWAL 2PW7A 2SNMA 4JOIA 4N9PA 1B70B 2YTVA 4UDUC 1JOQA 1O7IA 1SE3A 1H9SA 5BN5A 3M85A 1SMYD 3ULJA 2NVQB 3A7AB 3H15A 1PZKD 4JW0A 3CMEA 4JI5Q 1U4PA 4Y7NB 3KDFA 1DONA 1SNQA 2QA4A 1KAWA 4XYOA 1VF5C 2ZTDA 2KCCA 4A3CH 2NN6H 5ISRA 3NE5B 3S2DH 1DGSA 1N36Q 3BG3A 3CHBD 4P71A 5I2XA 3G6EA 1YZ6A 1JB3A 3EVQA 4GNXC 1KQSA 3HOUH 1NMFA 3AFQA 3CCVA 2E8GA 2B2WA 2PCFB 5BR8L 4BA1I 5IP9G 1N8RC 1ZYRD 5M5WB 5CV4A 5C3EB 5C4XB 3CCJA 2J4XA 2DJGC 5EKLA 1WTHA 2NZHA 3HOYG 2B2UA 3PQIA 1V43A 1PYSB 1X3EA 1WD1A 3BDCA 2UU9Q 3LGJA 4CGYB 1OXUA 1AZQA 3GTKB 2PI2E 3GTJH 2F4IA 2PQAA 2A6ED 1C0AA 2UUAQ 5EPLA 1J5EL 2VQEL 4HMIA 3QOJA 2L12A 4A3MH 3CF5A 2OXPA 1HUMA 3K7AB 2CQOA 1LTAD 4CDEC 4OXPA 4QF4A 1N33L 1VQOA 2WAQG 4H13C 1S40A 4AQYQ 4X62L 1I4PA 5EPJA 4IFDG 4LF8Q 1CQVA 4YWLA 1GUOA 5C4HA 5D65A 5FLMH 3KF8A 3T53B 1HZ9A 3RZOH 4QQBX 5IWAQ 3SK6A 4RA8A 3I56A 2EIFA 5AJ3L 5KYLA 1VDZA 2VUMH 5HGQA 3H0GG 4IJHA 3CC2A 1K0SA 4K6LA 2R7ZG 4QIWB 1HNXL 3OHXC 4MIUA 4C2MB 2OQKA 1X55A 4GLXA 4BBSH 2F03A 4Z9CB 2VQFL 4C1NK 4PMCA 3E0JA 2WKCA 1E24A 1E2WA 4ILWA 2EYLA 2HUGA 2JA5B 1ESRA 5J39A 4LFCQ 1G91A 1KLGD 5KNBA 5C4ZA 3K5MA 3TSSA 5C4JH 1GUNA 2B39A 2QCPX 4ZRZA 5BR8Q 1YIJA 4TSSA 3E5SA 3Q24A 4M8AA 1G51A 4BY7H 1XNQL 5G3LD 3OPOA 3ITPA 3R3OA 4NP5A 1WTVA 4GS3A 1NR4A 3OOCA 1L1OA 1X54A 2F0KA 2F0NA 1BQQT 3DEOA 2R7FA 1HPCA 1T9HA 2IHEA 2K4KA 2P5ZX 1KRTA 5E4XA 3GV6A 3FKIG 3S1MH 4KY5A 3F8TA 2A74C 1SMXA 5COYA 2EYFA 1LT5D 2ZXOA 1I50H 1RHPA 3CC4A 4JI2L 1CKMA 4HMJA 4FNFA 2LXJA 2K32A 5FLXE 3KLSX 1J5EQ 3F2CA 4KHVA 2CCZA 3E6ZX 4DV6L 4ZUJA 4JI1L 4G7OC 2PW5A 2X6GA 2K5DA 1N33Q 4A93G 1Q81C 3M7NA 1JC7A 1IW7D 1JOKA 3RD4A 4X62Q 2A8VA 4A3IH 1Q82C 1K8MA 5CR3A 5DLQE 2PO4A 2K14A 1BR9A 2R93G 4FF4A 2F0QA 4G7ZC 1CZGA 1CQFA 3MHBA 5AJ3Q 4FF3A 3D0FA 4RCOA 4A75A 5EAYA 1F2LA 1HNXQ 1F2YA 3J7AV 2D0OA 2EPBA 3PO2G 2YYZA 3RN2A 5KIXA 1GD7A 3G7LA 4ZQ3A 2VQFQ 2PQAB 5JVH3 3UI2A 1G291 5D3DA 3S1RB 3G71A 3CPWA 1TVXA 1J9OA 3MVVA 4BA2I 3AFPA 1XNQQ 1NY4A 1N9WA 1Y1VG 2HHHL 2NVXB 4B3RL 2SOBA 1D7QA 3V05A 2Z6BA 4FXDA 1STHA 4C3JG 1EY7A 4MHEA 3G48A 1GJXA 2IPKD 2OTJA 2B2VA 5G3LF 1C8CA 3UDIA 1VMCA 4PZ7A 2K75A 3H3VC 4JI2Q 4A3DB 2WFWA 1K73C 4GLVB 4O42A 1PRTB 1W6JA 2RCFA 2A69C 4C1NI 2FHTA 1SNMA 1STNA 4DR7L 3TQYA 4JI1Q 1NCVA 3GP7A 1BVSA 2AUJD 3V96A 2KUMA 3OMGA 1AE2A 5JOBA 5FLXc 1KDCA 5D3IB 2E2JH 4ZK9B 1SE2A 1A3UA 1X9NA 4R4CA 2Z8LA 3PGZA 1W3SA 3J80L 2WP8J 2KA7A 2KHJA 2K33A 1AE3A 2UXBL 3SGIA 2ZJPA 3E9HA 1XPOA 4XQJA 3K5OA 1JB7A 1XXGA 1PVOA 3TEHB 3OIQA 3T13A 3IFDA 4BS9A 4O0AA 4FXGC 1I4XA 1TXYA 1PTOC 4EQPA 1RJTA 5ELNA 2NB0A 2D9UA 1DM0B 4RKLA 2EJFC 2KVMA 2ZT9C 3FEWX 1SNCA 3LWEA 2BOSA 3NTIA 3ONAB 3VDYA 5J1ZA 2PYKA 4YHHQ 3U4ZA 2EOTA 4C3HH 5LMNL 5LMNW 4A76A 3CRLC 4CJ0B 3SK5A 4TQUS 2AUKA 1QWYA 4J6HA 4X66L 1WTQA 2MO1A 2HHHQ 3X3NA 2E76C 4B3RQ 2BH8A 1ASZA 4DAYB 3X3MA 1A15A 1QZHA 1RTNA 1CSPA 5C3EG 1NAPA 1VQNA 5C4XG 4FXKC 3PIPA 4J1MA 3SDZA 4K14A 3P7JA 1QVGA 3I4NB 3I4LA 3L2PA 2NVTH 2AQ3B 2O5IC 4APVA 3EIVA 2OQ0A 1Q86C 2K6AA 1QUQB 3QO2A 1ENAA 2NUCA 1PH7A 2BDOA 3HOYB 4RGMA 3RR5A 3R8BA 2H4OA 4DR7Q 4RCNA 3M3YH 4E6IA 3PF4A 5IYBH 2CWAA 4JBJA 3HOXB 2K05A 1YNNC 2AQ2B 3U9OA 1Z6HA 1H9KA 2NTTA 5HY6A 4BBRB 1FR3A 4C3IH 2E2HB 1EY0A 4DR6L 1I94L 3CCEA 1SJED 2BA1A 3PO3B 3S2HH 1FGUA 2UXBQ 3KBGA 3GTPH 3STBC 4UAIA 3HOVB 2VNUD 1LTBD 4GKKL 1SAPA 3S14H 2JN4A 3MXNB 1QCBD 1ICFB 2WAQB 3NWSA 3CQZH 2JA8H 3I4MH 3NBIA 1B7YB 3MWYW 5M3FH 1TS5A 4DV7Q 1K83H 1B53A 4OEMB 4CBVA 5T1GA 2GVAA 1M90C 2K5QA 1KXLA 4JI6Q 5JJKA 2ZTCA 5KRUA 3W1BA 2F3VA 5LMNQ 2XVSA 2Z6KA 4LNQA 1VQ6A 2EVBA 1SYBA 2NN6I 5KNDA 3N6RA 3PUWA 1VQJA 1SJHD 3RZDH 2JA5G 3J81c 1JICA 3FDTA 1DZ1A 2ZXPA 1EU4A 2Q2HA 3BVGA 1HQRD 2B2YA 4O1NA 3CC7A 4LJZC 3G4SA 4MNOA 2OF1A 4YWMA 5IGBA 2Q8IB 4KN4C 5FJ8G 4B3TL 4V190 4Y52H 1RL2A 3U4VA 2CQAA 4LUOA 5IP9H 1PDQA 4B3SL 4IUVA 3KLSA 2Z1CA 1M8AA 3SK4A 1KD1C 4R8IA 1Q12A 3FPPA 3HS0C 2QEJC 1Z9FA 2FMCA 5ELBA 4BWGB 4MZ9A 1EOVA 1GM5A 4DV5L 2HT1A 5BN3A 3S1QH 4HAEA 3K59A 2LY7A 2DY7A 2YU9B 5IYDH 1WTPA 1LT6D 4DR6Q 1XX8A 1EIYB 4JBMA 3BDOA 3NK9A 4UY8C 4WORA 1P8LA 2JJQA 2VS1A 4GKKQ 3GTOB 1K8AC 3CU7A 2E2IH 3QOLA 1FNVA 2BE5C 5GAHC 1BCPD 2RKSA 4A93B 4JK1C 1UE6A 3BZDB 5H1SE 3KUPA 4JVZA 5IIFA 4S3SA 4EGVA 3AMUA 4GN4B 1TWCB 4K8IA 1CTMA 1UE1A 1G6ZA 1LTGD 3E9IA 3CW2C 4K2KA 2WIIB 3KBXA 1VQ8A 3J7YW 2O2LD 3J80E 1N34L 4OO1H 2KHSA 4DR5L 1X32A 2XTIA 1SNPA 2LSSA 4DK6C 3VR3A 1SYCA 3H0GH 4G4KA 1O78A 2R7ZH 1XPRA 3PO2B 3IRBA 1C48A 1WCMG 3HKSA 4IUPA 3HOWH 3T56B 2KJXA 2Y0SB 1V1QA 2K1BA 3KF6A 3PUXA 4K2LA 5I6WA 1QB5D 3S15B 3NBHA 1CKNA 1YNJC 4B3TQ 2F0UA 4DPGA 4POGA 2DNCA 4DAPA 3U58A 1R9TH 3F2BA 4A3BB 2QDBA 2F0LA 1TS4A 4LFBQ 4B3SQ 1JJCB 3KOJA 3HFZB 4HJ8A 3L3OC 3QWNA 1E0BA 4ZKCB 4KJNA 3Q23A 4A3DG 3HGBA 1C7YA 1TS2A 1Q1BA 4DR4L 1Z47A 4DV5Q 1CFMA 1K28A 1YHBA 1EUJA 4UP7A 4A3JH 3FKIH 5CV7A 1JQYD 1STAA 4GZYC 4MN3A 1W6KA 2LXKA 4OL7A 2UU9L 5C44B 1SROA 1BNZA 1UEBA 5HURA 2SDFA 2FFKB 4DN4M 1LTID 4KTAA 4IURA 1PH9A 4XIGS 4NXMQ 1NR2A 2CH4A 2O5JC 1STEA 4RFBA 5EKKA 2HDMA 3HEJA 4HSPA 2M00A 2YV5A 4Q0FA 5CBEE 1DYQA 1A8VA 2EE1A 1BCPF 2R93H 4FDBA 4IPGA 4IPCA 1HFGA 3GTJB 3NELA 4P73A 3HRZC 3NSWA 4KD3A 2RCNA 4CJ1B 3A74A 1N34Q 2XSCA 4JI8L 2AQ1B 1OXSC 2F0JA 2A6HD 4DR5Q 4KY6A 2XWBB 3PF5A 2B2TC 1GHKA 2JXMB 3J80c 4DNRB 4R4IA 3VR2A 1G2SA 3OTOL 5JPNC 1S72A 1AH9A 2JA6H 1Y69U 2PNRC 3URYA 2QW7A 3RZOB 3K81C 4DFAA 3A0JA 5M5XH 5CORA 4DK3C 3CCMA 1L0WA 2ALYB 3JAME 5TSSA 4JI0L 4WJ4A 4A3FH 1NUCA 1Y1VH 4OONA 1TIID 4LFCL 3CP0A 2B8FA 3I4NG 3F2UA 3GTQH 4C3JH 2MJ8A 5IE8A 2OEOA 4DR4Q 3U50C 2CHBD 5A2QL 2IX3A 1XMOL 5LMUL 5C0XG 4LF7L 1KL9A 3ND8A 4K0KL 3PIOA 3UDFA 1VQ5A 1UEAB 2CW0C 4PMBA 4JV5L 2F4VL 3HOXG 2WINB 1FVIA 1QE6A 4QCLA 2OT2A 3DEPA 3ER0A 1YJWA 4A3EH 5IT9L 4BBRG 4UHVA 3I7FA 3PO3G 3KF6B 1Q90A 5C3WA 4IOAA 3NBHB 3HOVG 1HNWL 2F3IA 2L15A 4GN5A 4R4OA 4OWTB 1KNAA 3IL8A 3D31A 3S1MB 1KTKA 1EZ8A 1P16A 3S16B 4R4QA 1JWSD 3DM3A 1CA5A 3L0OA 4OHJA 4FYDA 4YCVA 2CH4W 4B08A 2AMCB 3C1FA 4PMWA 4JI8Q 2BCOA 5E1FA 4LF5L 2F0TA 1B4OA 1FNWA 5JAVA 1HA6A 3A8JE 3ERSX 4DNIA 1ICWA 1Y8PB 1E1OA 1LYLA 3ND9A 1TKWB 5CC4A 3A54A 2Y0SE 3FMCA 4LK1C 3OTOQ 1ML0D 2NVQH 1VQCA 3Q22A 3U9SA 1I3QB 1LO5D 1Y14B 1B3AA 1YJ9A 3KFUA 4CDCC 3M9BA 4Y7NH 1ESFA 3CXCA 5J3BA 2ICIA 4P72A 1TWGB 5FO9B 1EY5A 4N8X1 2RSOA 4JI0Q 2XGTA 3I70A 3ICEA 5EKIA 2AWNA 1GUGA 4O2DA 2OCEA 4ID6A 2AWOA 2F0WA 3CMAA 4IJLA 2IJ0A 2BA0A 3A8KE 1KNEA 4OELB 1IYUA 5DAUA 3JAMc 4FF1A 5CYUA 4P75A 3HOZH 5M5WH 4WFN3 1XMOQ 5LMUQ 2H1EA 2F1MA 3MXPA 3CKIB 4YWKA 2V1CC 5C4XH 4LF7Q 4IALA 4K0KQ 2K5HA 4GOPA 2ES2A 4PZ8A 2F4VQ 4JV5Q 5KEEA 1RF2D 3EROA 4BXXG 1L0XB 4IO9A 4HN7A 4QMGA 2B63B 1TR5A 2FMMA 3GTKH 3FVQA 1TWHB 3N52A 3OSOA 1TS3A 1X3GA 1NMGA 4OGQC 3MTSA 1H9SB 1J8IA 4DXGA 5I9PA 2K50A 1HNWQ 4LUZA 5M5YB 3GTMB 3H3VH 3OWEB 3NXWA 4KMUC 4JC0A 1YJNA 3KDFB 1WVLA 1WTXA 3K7AH 2EYHA 2K28A 4POFA 1U4RA 4P74A 2I46A 4L5TA 3GDEA 4ME3A 1V1OA 2PPBC 2A1AA 3RN5A 2MPMA 2VZAA 2UXCL 4RKBA 4BY1H 4KHZA 2A6EC 2KOLA 4LF5Q 4X3TA 1HR0L 1OO9B 3R2IA 1MBYA 2AKWB 1PTOD 4DK0A 1I4HA 1BBUA 2RDHA 3J7AF 4J8QA 4LFAL 3O13A 3QR8A 5IODA 1RDPD 4B9WA 3KLWA 3GTGB 1V1PA 1ENFA 2HCIA 5A35A 3FRPB 4DK1A 4KY7A 1SFOB 1PTOH 2NZ1D 2PZTA 4C2MH 2Y0SG 3NP8A 2JP1A 1DOLA 1LT4D 1MGSA 4YHHL 1EWHA 1S5CD 2ASBA 3TP5A 1Y1WG 3ERQA 1WCMB 1T5XD 1C4QA 3MFGA 2L1BA 2JA5H 5EGTA 2B8GA 1MI2A 2LS01 3K80C 2B29A 1RKNA 1WJJA 3MC0B 3TBIB 1S3OA 5EBCA 4A3BG 4WJ3M 1A63A 3JC66 3SE0A 3FP9A 3CCQA 3M4OB 5L37A 1D5XC 4I7AA 4DKAC 5GADC 1TQOA 4XXEA 5FJ8H 2PZUA 5ELDA 4HCEA 4JI7L 3KF8B 4HTHA 2E75C 2NN6G 2Z0SA 1B50A 1LABA 1O7YA 2QDLA 1OXTA 5C44G 1TWFB 1D2BA 2QF7A 2VL6A 2XRSD 1Q8IA 2F0FA 4ZKBB 4A3LG 3NQIA 1K9MC 5A2QE 3C46A 2Q2TA 1NSNS 1PXUA 4YY3Q 4DXFA 4EVOA 4CKBA 5M3MB 2K5VA 4OIJA 2UXCQ 1WOCA 2N49A 4NXNL 5ELOA 1E3PA 2WV6D 3F1ZA 1IL2A 2ID0A 5C5LA 4H44C 1HR0Q 5I2YA 5IT9E 3BU2A 1PH1A 1OXVA 1STBA 3MXGA 4HSVA 4HR7B 4OO1I 5JEAH 1IBML 1L1OB 4LFAQ 2E2DC 1HZAA 1W2BA 4R4TA 3DUZA 1K3RA 4A3MG 4DV7L 1EQVA 1PTOF 1AFPA 1OTCA 4JI6L 1XMQL 3NHHA 5FLMG 1LACA 3DXJC 2N3SA 3S24A 2IY5B 3S1RH 2F0GA 3AEVA 2K5NA 2FJ2A 1D8LA 1A62A 3AB9A 3A5UA 5GAGC 1CT1D 4GNXA 2NVXH 2VUMG 3DWQA 2I5MX 1IBLL 1TT2A 2KHIA 4JOIC 2IX0A 3G6JB 4YIJA 4A3KB 4JI7Q 1JE5A 1X3PA 5CV8A 2EYOA 1JT8A 1PFSA 3P75A 1HUNA 3QB3A 3T1YL 1Q3LA 4CJ2C 3GTLB 5JJIA 3C1EA 4A3DH 2LKVA 5J22A 1JOOA 2NVYB 2R92B 3C3LA 4KN7C 4B3ML 2FINB 2M2LA 5KNCA 1HJPA 4X6AH 5IP7G 3GQBA 3K7UC 4WRDA 1D5ZC 2PNHA 2SNSA 1FD7D 5CGKA 2ZJRA 2C35B 2DGYA 1JWUD 5FKAC 4CDFC 4HIOA 2F0OA 2B2WC 4Q5VA 1BBWA 3NEMA 4QL5A 5GQOA 2R61A 3MFYA 3D6CA 4NXNQ 4NB3A 1K0RA 2DNEA 3KK7A 2J0TD 2KEDA 2B2UC 1MKHA 2TMPA 3KJPA 2BE5D 3IKJA 4OWXB 1AN8A 4K5XA 1WD0A 4DF7A 1IBMQ 3S1QB 1DXMA 1SXTA 1ILQA 1LLRD 4DAMA 3EQLC 4LWCA 2KCTA 5JEAJ 3VYRA 3RLNA 3K6OA 4IUNA 2R3ZA 1Q1EA 4U68A 1PZJD 1F2MA 4TKOB 3RLOA 4UP9A 4KKTA 1ET9A 3IAYA 2E74C 1I6HB 1XMQQ 1X3QA 2EY2A 1YI2A 2A68D 3BYYB 4DV3L 4HJ9A 3B6YA 3NQTA 1BUVT 1U4LA 3QIAA 4L5SA 1DOMA 5DM63 4RMFA 4CKCA 2DUDA 5K36G 2HQEA 3I2ZA 4LW1A 1IBLQ 4XYQA 1U5KA 4ZUIA 1RIPA 2BH2A 1BCPB 1BXTA 4RGNA 2G9DA 3PCOB 4J15A 2NTSA 4B9XA 1QNUA 2HQLA 1N32L 1EY9A 1IKLA 2JYOA 3S17H 1PRTC 4XT1B 3T1YQ 3DWPA 1O7LA 1X3FA 3DWAA 5I4DA 2Q8TA 2DY8A 2CFMA 4H02A 3WOEA 2TSSA 3SEBA 4LFBL 3HOWB 4A3GB 4B3MQ 1AEXA 4HJ5A 2B63G 5C0XH 4QGUA 3HOYH 2EY5A 1EYGA 1RD9D 3HOXH 4KV6A 2F0MA 4N8FA 3T16A 5T1IA 3SVMA 2I0QA 1HTPA 2A5HA 2KCMA 5EBDA 2E2HH 2K52A 5NUCA 2OWOA 2HCCA 1D1IA 2ZXRA 1D1KA 3AQQA 5IOCA 1TY0A 4NXML 1VQGA 4IUUA 4RGOS 3M4YA 1G8ZD 4A3JB 1SBBB 3CAMA 3W2DA 1LTSD 1RODA 1FNUA 1KIXA 3RNUA 2NYZD 4IFDH 3TRZA 2XN9C 1IKMA 5FO7B 3S1NB 3SHLA 1PHJA 3BS1A 5JJLA 2B3GA 4L63B 3D4WA 3I4OA 3ZYYX 2EY6A 4NDXA 2CVRA 3MA2B 4DV3Q 2CKZB 3BVMA 2QEXA 4EQNA 1HFNA 1LT3D 4JCVE 4WJWA 3MAQA 4X3UA 1NJIC 4R1JA 1I6VC 1NBWA 1TWAB 2DN8A 3DHQA 3K0XA 1Q7YC 1T5EA 1C9OA 2UUBL 2JA7B 4DNTB 2C9OA 4L6TB 1Y1WB 1N32Q 1B3QA 1EEFD 1CUKA 3RLFA 5GAEC 4GN3B 3D4RA 1A2TA 2RVLA 1VQEA 1J6QA 1VF7A 1S5BD 2O4XA 4C3HG 2G5DA 1Q46A 1QNKA 1S4ZA 5EQ0A 2D0PA 4JI3Q 1EFID 3KJOA 2JA6B 2K04A 3PUYA 4ZLTF 5C0XJ 2Q2IA 3NTKA 4FO2A 1QVFA 1GUSA 2CW0D 3H3VI 3S2DB 3R2TA 1IBKL 2KECA 2YU9H 5M9OA 3BYTB 4P2CB 4A3FB 4UP8A 3HOUB 4NKLA 5FLXL 2G9HD 5IGFA 2L9HA 1VMPA 1CKOA 1CK1A 1MD2D 1I4GA 1XJVA 1LTRD 5M3MG 4H7BA 4QJFA 2MHVA 3GTOH 2F0HA 2B2VC 3A55A 1SYDA 3MZ5A 1B2TA 4TRDA 4A93H 2JEAI 3IFTA 1EZ6A 4NW2A 1KAAA 1RCVD 5IYBG 2EYMA 1TWCH 1VQDA 1S5DD 4IFDJ 4C3IG 3PUZA 1VQFA 1HTLD 1I4QA 3K5LA 2L5TA 4AYBE 2N78A 1V8QA 3EJIA 5BN4A 1K8OA 1XWEA 3LX0A 1EOTA 4XQNA 1BCPC 1GXDC 1XTDA 4A3MB 2E5LL 4LUVA 2F3WA 5KYIA 2EZVA 4LMQD 4PQXA 3PO2H 3FPUB 2I5LX 5IYCG 3I4MG 2UUBQ 5AFWA 4XQQA 3TP8A 4FVMA 1MHWC 2HDLA 3EA6A 3DMUA 1HZCA 4IZ8A 1G6PA 1H9JA 3CCUA 1HH2P 4IUQA 3TN2A 4A3KG 4A3BH 2PMZE 4NMZA 1PLFA 2I5HA 4DR1Q 2BDNA 2VUMB 2I07B 1NTGA 3SXHA 4K5WA 5JPMC 1TU2B 1UWVA 1KRSA 3QG1A 1PFNA 1VQBA 2R92G 4BBSB 4ALPA 3Q0AA 5DNFA 2RBMA 4IPHA 1IBKQ 4XTCS 1B1ZA 1SDFA 1PH2A 1HXYD 2ZJQA 1IYVA 1O7ZA 2HD3A 5C44H 3HP3A 5C4JB 4LAAA 1SEBD 1MIUA 1EQTA 4K6DA 4BY7B 3HOZB 2F0EA 4A3LH 1PYWD 1EU3A 1ILPA 2KQ3A 1HA5A 1A2UA 1BO0A 1CKNB 1R4PB 2KENA 1PH5A 3K0YA 4EX5A 1PH3A 1TY2A 1V9PA 2K03A 1G2TA 1I50B 4XDXA 5IYDG 1VQPA 5GROA 2Q2UA 5FOBB 2HIXA 1K8GA 4FP5D 4QB4A 3J81j 2F0PA 3D4DA 2JA9A 1WFQA 2YTYA 3GV3A 2E5LQ 4AYBG 1EIGA 3FHWA 1AW7A 1MSHA 4DR3Q 4KKUA 3PV0A 4A3IB 2HIVA 3AYHB 2RHSB 4BY1B 3J81L 2JQOA 2VXWA 1A0IA 3CCSA 2Z4HA 3DLLA 1EWCA 5K5PA 4DUYL 3NPPA 3UE0A 2A6HC 5LHY1 4OO1G 3CD6A 3A8IE 2YTXA 5DEHA 1CHPD 4ZYSA 1VCIA 1AZPA 2MO0A 1SMYC 3OIPA 1X6OA 4U673 2Z6KC 3HOWG 1PTOB 5C3EH 4A3GG 1GHJA 3VA7A 2QGQA 1WYDA 3D6WA 1IL8A 5CV5A 2LMCB 3A7LA 3SK8A 3ULPA 2NBFA 5FK9C 1Y8OB 1GOZA 2Z4IA 3TS0A 2B2YC 1LM0A 5IP7H 4KI0A 2VB3X 4DAVA 1ZYRC 4GKJL 4OX9L 2A69D 1VS0A 1ENCA 3LWUA 2D62A 1B44D 1JWMD 4F88A 3NWTA 3UE1A 1YBYA 1S5ED 5CV9A 1DCZA 2EJGC 4A3JG 1WTRA 4M1UB 3S16H 1M4VA 1PV4A 2EJMA 4YY3L 4G57A 1HQMC 3GD7A 1L2FA 3I72A 2MFIA 1SNDA 2VQEQ 4G7HC 4DU9A 1HR0W 4AIMA 2LFNA 2VY3A 5CBAE 3J81i 2F0SA 1HNZL 1EYCA 3PIP3 1GKHA 3PMFA 1PYBA 2E2JB 2EY1A 4DAYA 4OWWB 1JJGA 5F2DA 2WB1E 4JI4L 3TZDA 2QKIC 4F8MA 1A3VA 2F0IA 1F77A 1EY4A 1QOHA 3CPFA 2UXDL 1I3QH 1JE4A 1Z7TA 4DR2L 2D5DA 4DUYQ 1E2VA 3UDXA 1DJRD 1F9SA 1XNRL 1TWGH 2JA7G 4KKSA 3OWFA 2JK8A 2XWJB 4DV2L 5K36H 4IPDA 1II3A 4A4IA 1QUQA 1VQ4A 4QY7A 4OIKA 1NE3A 1ZXTA 4HJAA 1JORA 2Q8RE 3L9AX 3VYSA 2KEEA 1UAPA 5C0XI 1VQHA 1FYCA 3V2TA 2IX1A 2MNAA 4X64L 4DV1L 2JA6G 1XYIA 4IN3A 4C3HB 1EYDA 1PH4A 1XTCD 1O80A 1IZ6A 2PZWA 4MTKA 2NWGA 4A3CG 1QG7A 2B63H 2V4DA 2H5XA 1JJ2A 1TWHH 2D2CC 1BKBA 4A3FG 2CWPA 3KYHC 1FJGL 4GKJQ 4OX9Q 3HOUG 4LF4L 3I8ZA 3MXNA 3EFXD 2J7ZA 3VR4A 4V0BA 3HKZB 3R93A 3ULLA 5M5YH 1CA6A 3GTMH 4JYAL 1YNND 2JSOA 1LUZA 3NUCA 3Q6SA 3BJUA 4QUFA 2GA4B
chains in the Genus database with same CATH topology
2NVTB 3WOFA 3I73A 1B9NA 4ME5A 4IFDI 1A3TA 5IGCA 1DD2A 1QILA 1WTOA 3BDLA 3H94A 3GO5A 3M3YB 1ET6A 4QUCA 1U4MA 3MXUA 2KCNA 3S9WA 4C3IB 3T4AC 3KLRA 2RDFA 2F0VA 1IW7C 1SYGA 2B2TA 4DA2A 1H9RA 3S2HB 2N55A 3RUZA 1STYA 3GTPB 1GUWA 3S14B 1EYAA 2MGSA 4K8JA 2PQEA 3I91A 3AU7A 5ELCA 4IQZA 2JA8B 3CQZB 3I90A 3I4MB 4C56C 3K5NA 3M7GA 5M3FB 5LL6X 3TP6A 4KJOA 1K83B 2JEBI 5JJZA 1EEID 1D5MC 3H6MA 4CKEA 2EYJA 1JR0D 3A56A 3VYTA 4N9TA 2VB2X 4ULLA 5EPKA 2XRQD 4L8JA 3J81E 1PRTD 5JVG3 2K01A 4CHTB 1Y8NB 3RZDB 2L4NA 5D14A 1PMRA 1F9PA 1BF4A 2EYPA 5EJWA 2M9VA 4HCSA 1V1PB 1F9QA 2SEBD 5I6YA 2MUYA 1ZEQX 3S17B 1AP0A 2K7VA 1WTWA 4XT3B 2F0DA 2WACA 1R4QB 3QJYA 3DM1A 1SE4A 4KD4A 1DOKA 2MP1A 3PUVA 1FGBD 2EDGA 4K5VA 3D3RA 3WDNA 2XNAC 3K58A 3D8GA 1PFMA 3SR1A 5C6AA 1EIHA 5FO8B 2ENBA 1ONLA 2IL8A 2X69A 4H0LC 1KLUD 1B9MA 1L0YB 4AYBB 2E2IB 2RA4A 5IGEA 5C5MA 4ODGA 1KABA 1HCZA 3H91A 5C3XA 3VA5A 5E3FA 3W3AA 2IT1A 4RHRA 3MEHA 3JAML 4X3KA 1PZID 1YNJD 4R8NA 4I7ZC 2QILA 1BOSA 1ZKOA 3H0GB 2R7ZB 2PMZB 4RHSA 1PRTF 1F2ZA 5IGDA 1D6EC 1A6XA 4F87A 5LL6S 1BBXC 3VR5A 4ABNA 3TDQA 2JE6I 3P1HA 1R9TB 3P20A 1STGA 3T51B 2C5CA 3RMHA 4RWSC 3HZXA 1CHQD 3K57A 3BVZA 1CZWA 1JCKB 3L7ZC 3FKIB 1I4RA 1SYFA 1EY8A 1HHVA 5ELFA 1HRJA 4IUTA 1BDOA 4ZAIA 5HGTA 1CI3M 1EY6A 1UUPA 2K5WA 2A73B 5KGUA 3PIO3 5ELEA 1S5FD 5JEAG 4HEDA 2R93B 1SNOA 1PFBA 5IGGA 3TZUA 1SSOA 2L55A 2A68C 1H9MA 2N88A 3CRKC 2IW3A 2X6LA 1RTOA 1SYEA 3C2PA 4RGTA 5CV6A 2XIWA 5DM73 4FF2A 5M5XB 3TMEA 4R9WA 2R6GA 1Y1VB 2ICEC 3OMCA 3GTQB 4C3JB 1CM9A 4EQOA 2WKDA 1QJOA 3HG9A 2L11A 4PNYA 3I3CA 1U9RA 1KDBA 1IHZA 3TP7A 4I65A 2L0CA 4F7XA 1KDAA 1MSGA 2RDGA 2RSNA 4A3EB 4JBWA 1UNSA 1LV9A 4RH6A 3NTHA 1GUTA 4X3SA 2RQXA 1E2ZA 3H09A 5I9OA 5E4WC 3OW7A 4DGZA 1F9RA 4KK7A 4RAUC 2WB1B 2EXZA 1OXXK 4PV1C 5CMDA 3VYUA 2IWHA 3LNNA 1EL0A 3VR6A 2PW7A 2SNMA 4N9PA 4UDUC 1JOQA 1SE3A 1H9SA 5BN5A 3M85A 1SMYD 2NVQB 3A7AB 1PZKD 1U4PA 4Y7NB 1DONA 1SNQA 4XYOA 1VF5C 2KCCA 2NN6H 5ISRA 3NE5B 3BG3A 3CHBD 5I2XA 1JB3A 3EVQA 2B2WA 2PCFB 4BA1I 1ZYRD 5M5WB 5CV4A 5C3EB 5C4XB 2J4XA 5EKLA 2B2UA 1V43A 1WD1A 3BDCA 4CGYB 1OXUA 1AZQA 3GTKB 2F4IA 2A6ED 5EPLA 4HMIA 3QOJA 2L12A 2OXPA 1HUMA 3K7AB 1LTAD 4QF4A 4H13C 1I4PA 5EPJA 4IFDG 1CQVA 1GUOA 5C4HA 5D65A 3KF8A 3T53B 3SK6A 4RA8A 5KYLA 1VDZA 4K6LA 4QIWB 3OHXC 4MIUA 4C2MB 2F03A 4Z9CB 4C1NK 4PMCA 3E0JA 2WKCA 1E2WA 4ILWA 2EYLA 2HUGA 2JA5B 1ESRA 5J39A 1G91A 1KLGD 5KNBA 5C4ZA 3K5MA 3TSSA 1GUNA 2B39A 2QCPX 4ZRZA 4TSSA 3E5SA 3Q24A 4M8AA 5G3LD 3OPOA 3ITPA 3R3OA 4NP5A 1WTVA 1NR4A 3OOCA 2F0KA 2F0NA 1BQQT 3DEOA 1HPCA 5E4XA 3GV6A 4KY5A 2A74C 5COYA 2EYFA 1LT5D 2ZXOA 1RHPA 4HMJA 4FNFA 2K32A 5FLXE 3KLSX 4KHVA 3E6ZX 4ZUJA 4G7OC 2PW5A 2X6GA 2K5DA 3M7NA 1JC7A 1IW7D 1JOKA 3RD4A 1K8MA 5CR3A 2PO4A 1BR9A 4FF4A 2F0QA 4G7ZC 1CZGA 1CQFA 3MHBA 4FF3A 4RCOA 1F2LA 1F2YA 3J7AV 2EPBA 2YYZA 5KIXA 3G7LA 4ZQ3A 5JVH3 3UI2A 1G291 5D3DA 3S1RB 1TVXA 1J9OA 3MVVA 4BA2I 2NVXB 2SOBA 3V05A 4FXDA 1STHA 4C3JG 1EY7A 4MHEA 1GJXA 2IPKD 2B2VA 5G3LF 1C8CA 1VMCA 3H3VC 4A3DB 4O42A 1PRTB 1W6JA 4C1NI 2A69C 2FHTA 1SNMA 1STNA 3V96A 1NCVA 3GP7A 2AUJD 2KUMA 3OMGA 5JOBA 1KDCA 5D3IB 4ZK9B 1SE2A 1A3UA 2Z8LA 3J80L 2WP8J 2KA7A 2K33A 4XQJA 3K5OA 1XXGA 3OIQA 3T13A 3IFDA 4BS9A 4FXGC 1I4XA 1PTOC 4EQPA 1RJTA 2NB0A 2D9UA 1DM0B 4RKLA 2EJFC 2KVMA 2ZT9C 3FEWX 1SNCA 3LWEA 2BOSA 3NTIA 3ONAB 5J1ZA 2PYKA 2EOTA 3CRLC 4CJ0B 3SK5A 4TQUS 2AUKA 1QWYA 4J6HA 1WTQA 3X3NA 2E76C 3X3MA 1A15A 1RTNA 1NAPA 4FXKC 4J1MA 3SDZA 4K14A 3P7JA 3I4NB 3I4LA 2AQ3B 2O5IC 2K6AA 3QO2A 1ENAA 2NUCA 2BDOA 3HOYB 4RGMA 3R8BA 2H4OA 4RCNA 4E6IA 3HOXB 2K05A 1YNNC 2AQ2B 3U9OA 1Z6HA 1H9KA 2NTTA 4BBRB 1FR3A 2E2HB 1EY0A 1SJED 2BA1A 3PO3B 3KBGA 2VNUD 4UAIA 3HOVB 1LTBD 1SAPA 1QCBD 2WAQB 3NWSA 3NBIA 3MWYW 1TS5A 1B53A 4CBVA 5T1GA 2K5QA 5KRUA 2F3VA 2XVSA 2EVBA 1SYBA 2NN6I 5KNDA 3N6RA 3PUWA 1SJHD 1JICA 3FDTA 1DZ1A 2ZXPA 1EU4A 3BVGA 1HQRD 2B2YA 4O1NA 4LJZC 2OF1A 5IGBA 2Q8IB 4KN4C 4V190 2CQAA 1PDQA 4IUVA 3KLSA 2Z1CA 1M8AA 3SK4A 4R8IA 1Q12A 3FPPA 3HS0C 2QEJC 2FMCA 5ELBA 4BWGB 5BN3A 4HAEA 3K59A 2LY7A 2DY7A 2YU9B 1WTPA 1LT6D 1XX8A 3BDOA 3NK9A 4WORA 3GTOB 3CU7A 3QOLA 1FNVA 2BE5C 1BCPD 2RKSA 4A93B 4JK1C 3BZDB 3KUPA 5IIFA 4S3SA 4EGVA 3AMUA 1TWCB 4K8IA 1CTMA 1G6ZA 1LTGD 4K2KA 2WIIB 3KBXA 3J7YW 2O2LD 3J80E 4OO1H 2KHSA 1X32A 1SNPA 3VR3A 1SYCA 4G4KA 1O78A 3PO2B 1C48A 4IUPA 3T56B 2KJXA 2Y0SB 3PUXA 2K1BA 3S15B 4K2LA 5I6WA 1QB5D 3NBHA 1YNJC 2F0UA 2DNCA 4DAPA 4A3BB 2QDBA 2F0LA 1TS4A 3L3OC 3QWNA 1E0BA 4ZKCB 4KJNA 3Q23A 3HGBA 1TS2A 1Q1BA 1Z47A 1CFMA 5CV7A 1JQYD 1STAA 4GZYC 4MN3A 1W6KA 4OL7A 5C44B 1BNZA 5HURA 2SDFA 2FFKB 4DN4M 1LTID 4KTAA 4IURA 4XIGS 1NR2A 2O5JC 1STEA 4RFBA 5EKKA 2HDMA 3HEJA 4HSPA 2M00A 4Q0FA 5CBEE 1DYQA 2EE1A 1BCPF 1HFGA 3GTJB 3HRZC 3NSWA 4KD3A 4CJ1B 2XSCA 2AQ1B 1OXSC 2F0JA 2A6HD 4KY6A 2XWBB 2B2TC 1GHKA 2JXMB 4DNRB 3VR2A 1G2SA 5JPNC 1Y69U 2PNRC 3URYA 3RZOB 4DFAA 5CORA 3JAME 5TSSA 1NUCA 1TIID 2B8FA 3F2UA 2MJ8A 2OEOA 2CHBD 5A2QL 2IX3A 5C0XG 3ND8A 1UEAB 2CW0C 4PMBA 2WINB 1QE6A 4QCLA 2OT2A 3DEPA 5IT9L 1Q90A 5C3WA 1KNAA 3IL8A 3D31A 3S1MB 1KTKA 1EZ8A 3S16B 1JWSD 1CA5A 4OHJA 4FYDA 4B08A 3C1FA 4PMWA 2BCOA 5E1FA 2F0TA 1B4OA 1FNWA 5JAVA 1HA6A 3A8JE 1ICWA 1Y8PB 3ND9A 1TKWB 5CC4A 3A54A 3FMCA 4LK1C 1ML0D 3Q22A 3U9SA 1I3QB 1LO5D 1B3AA 1ESFA 2ICIA 1TWGB 5FO9B 1EY5A 2RSOA 3I70A 5EKIA 2AWNA 1GUGA 4ID6A 2AWOA 2F0WA 2IJ0A 2BA0A 3A8KE 1KNEA 1IYUA 5DAUA 4FF1A 5CYUA 4WFN3 2H1EA 2F1MA 3MXPA 3CKIB 4IALA 5KEEA 1RF2D 3EROA 1L0XB 2B63B 4QMGA 4HN7A 1TR5A 2FMMA 3FVQA 1TWHB 3N52A 3OSOA 1TS3A 4OGQC 3MTSA 1H9SB 1J8IA 4DXGA 5I9PA 5M5YB 3GTMB 3OWEB 3NXWA 4KMUC 1WVLA 1WTXA 2EYHA 2K28A 1U4RA 2I46A 1V1OA 2PPBC 2MPMA 4RKBA 4KHZA 2A6EC 2KOLA 4X3TA 1OO9B 3R2IA 1MBYA 4DK0A 1PTOD 1I4HA 2RDHA 3J7AF 4J8QA 3O13A 5IODA 1RDPD 4B9WA 3GTGB 1V1PA 1ENFA 2HCIA 5A35A 3FRPB 4DK1A 4KY7A 1SFOB 1PTOH 2NZ1D 2PZTA 3NP8A 2JP1A 1DOLA 1LT4D 1MGSA 1EWHA 1S5CD 3TP5A 3ERQA 1WCMB 1T5XD 1C4QA 3MFGA 2L1BA 5EGTA 2B8GA 1MI2A 2LS01 1RKNA 3MC0B 3TBIB 5EBCA 3SE0A 3M4OB 1D5XC 1TQOA 4XXEA 2PZUA 5ELDA 4HCEA 4HTHA 2E75C 2NN6G 1B50A 1LABA 1O7YA 1OXTA 1TWFB 1D2BA 2QF7A 2XRSD 1Q8IA 2F0FA 4ZKBB 3NQIA 5A2QE 3C46A 1NSNS 1PXUA 4DXFA 4EVOA 4CKBA 5M3MB 4OIJA 2WV6D 2ID0A 5C5LA 4H44C 5I2YA 5IT9E 1OXVA 1STBA 3MXGA 4HSVA 4HR7B 4OO1I 5JEAH 2E2DC 3DUZA 1EQVA 1PTOF 1AFPA 3NHHA 1LACA 3DXJC 2F0GA 2FJ2A 3AB9A 1CT1D 3DWQA 1TT2A 2IX0A 3G6JB 4YIJA 4A3KB 1X3PA 5CV8A 2EYOA 3P75A 1HUNA 3QB3A 1Q3LA 4CJ2C 3GTLB 3C1EA 2LKVA 5J22A 1JOOA 2NVYB 2R92B 3C3LA 4KN7C 2FINB 2M2LA 5KNCA 3GQBA 4WRDA 1D5ZC 2SNSA 5CGKA 1FD7D 1JWUD 5FKAC 2F0OA 2B2WC 4Q5VA 2R61A 3MFYA 3D6CA 2DNEA 3KK7A 2J0TD 2KEDA 2B2UC 2TMPA 2BE5D 3IKJA 1AN8A 4K5XA 1WD0A 4DF7A 3S1QB 1DXMA 1SXTA 1ILQA 1LLRD 3EQLC 5JEAJ 3VYRA 3K6OA 4IUNA 2R3ZA 1Q1EA 4U68A 1PZJD 1F2MA 4TKOB 4KKTA 1ET9A 3IAYA 2E74C 1I6HB 1X3QA 2EY2A 2A68D 3BYYB 3NQTA 1BUVT 1U4LA 3QIAA 1DOMA 5DM63 4CKCA 5K36G 2HQEA 4XYQA 4ZUIA 1BCPB 1BXTA 4RGNA 2G9DA 2NTSA 4B9XA 1QNUA 1EY9A 1IKLA 2JYOA 1PRTC 4XT1B 3DWPA 1O7LA 3DWAA 5I4DA 2Q8TA 2DY8A 3WOEA 2TSSA 3SEBA 3HOWB 4A3GB 1AEXA 5C0XH 2EY5A 1RD9D 4KV6A 2F0MA 3T16A 5T1IA 3SVMA 1HTPA 2A5HA 5EBDA 5NUCA 2HCCA 1D1IA 2ZXRA 1D1KA 5IOCA 1TY0A 4IUUA 4RGOS 3M4YA 1G8ZD 4A3JB 1SBBB 3W2DA 1LTSD 1RODA 1FNUA 2NYZD 4IFDH 2XN9C 1IKMA 5FO7B 3S1NB 3SHLA 3BS1A 4L63B 3D4WA 3ZYYX 2EY6A 4NDXA 2CVRA 3MA2B 3BVMA 4EQNA 1HFNA 1LT3D 4WJWA 3MAQA 4X3UA 1I6VC 1TWAB 2DN8A 3DHQA 1T5EA 2JA7B 4DNTB 2C9OA 4L6TB 1Y1WB 1EEFD 3RLFA 3D4RA 1A2TA 2RVLA 1VF7A 1S5BD 2O4XA 4C3HG 1QNKA 1S4ZA 5EQ0A 1EFID 2JA6B 2K04A 3PUYA 4ZLTF 5C0XJ 3NTKA 4FO2A 1GUSA 2CW0D 3S2DB 3R2TA 2KECA 5M9OA 3BYTB 4P2CB 4A3FB 3HOUB 4NKLA 5FLXL 2G9HD 5IGFA 2L9HA 1VMPA 1CK1A 1MD2D 1I4GA 1LTRD 4H7BA 2MHVA 2F0HA 2B2VC 3A55A 1SYDA 3MZ5A 1B2TA 4TRDA 2JEAI 3IFTA 1EZ6A 4NW2A 1KAAA 1RCVD 2EYMA 1S5DD 4IFDJ 4C3IG 3PUZA 1HTLD 1I4QA 3K5LA 2L5TA 1V8QA 3EJIA 5BN4A 1K8OA 1XWEA 3LX0A 1EOTA 4XQNA 1BCPC 1GXDC 4A3MB 2F3WA 5KYIA 2EZVA 4LMQD 4PQXA 3FPUB 5AFWA 4XQQA 3TP8A 4FVMA 2HDLA 3EA6A 3DMUA 4IZ8A 1H9JA 4IUQA 3TN2A 4NMZA 1PLFA 2BDNA 2VUMB 2I07B 3SXHA 4K5WA 5JPMC 1TU2B 3QG1A 1PFNA 4BBSB 3Q0AA 5DNFA 2RBMA 4XTCS 1B1ZA 1SDFA 1HXYD 1IYVA 1O7ZA 3HP3A 5C4JB 4LAAA 1SEBD 4K6DA 1EQTA 4BY7B 3HOZB 2F0EA 1PYWD 1EU3A 1ILPA 1HA5A 1A2UA 2KQ3A 1BO0A 1R4PB 3K0YA 1TY2A 2K03A 1G2TA 1I50B 4XDXA 5FOBB 4FP5D 4QB4A 2F0PA 3D4DA 3GV3A 1EIGA 1AW7A 1MSHA 4KKUA 3PV0A 4A3IB 4BY1B 3J81L 2VXWA 2Z4HA 1EWCA 5K5PA 3NPPA 2A6HC 5LHY1 4OO1G 3A8IE 5DEHA 1CHPD 4ZYSA 1VCIA 1AZPA 1SMYC 3OIPA 4U673 1PTOB 1GHJA 3VA7A 3D6WA 1IL8A 5CV5A 2LMCB 3A7LA 3SK8A 2NBFA 5FK9C 1Y8OB 1GOZA 2Z4IA 2B2YC 4KI0A 2VB3X 4DAVA 1ZYRC 2A69D 1ENCA 3LWUA 2D62A 1B44D 1JWMD 4F88A 3NWTA 1S5ED 5CV9A 1DCZA 2EJGC 1WTRA 4M1UB 1M4VA 2EJMA 4G57A 1HQMC 3GD7A 3I72A 1SNDA 4G7HC 4DU9A 2LFNA 5CBAE 2F0SA 1EYCA 3PIP3 3PMFA 2E2JB 2EY1A 4DAYA 5F2DA 3TZDA 2QKIC 4F8MA 1A3VA 2F0IA 1F77A 1EY4A 1QOHA 1JE4A 1Z7TA 2D5DA 1E2VA 1DJRD 1F9SA 4KKSA 3OWFA 2XWJB 5K36H 1II3A 4OIKA 1ZXTA 1JORA 2Q8RE 3L9AX 3VYSA 2KEEA 1UAPA 5C0XI 1FYCA 3V2TA 2IX1A 1XYIA 4IN3A 4C3HB 1EYDA 1XTCD 1O80A 2PZWA 2NWGA 1QG7A 2V4DA 2D2CC 3I8ZA 3MXNA 3EFXD 2J7ZA 3VR4A 4V0BA 3HKZB 3R93A 1CA6A 1YNND 2JSOA 3NUCA 3Q6SA 1LTTD 4QUFA 2GA4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9R A;  1PFN A;  1A15 A;  4IUV A;  4RAU C;  3UI2 A;  1BNZ A;  2RVL A;  4X3T A;  1M8A A;  1KNA A;  1RTN A;  3IL8 A;  2SDF A;  5DNF A;  4R8I A;  5CMD A;  2FFK B;  1NAP A;  1EL0 A;  4DN4 M;  1PFM A;  1QNK A;  1SDF A;  1S4Z A;  3P7J A;  4IUR A;  1EIH A;  1TVX A;  1J9O A;  1O7Z A;  5EQ0 A;  1WTO A;  4HAE A;  1CA5 A;  1NR2 A;  2IL8 A;  3HP3 A;  2X69 A;  4HED A;  2DY7 A;  1WTR A;  1EQT A;  1IKL A;  2JYO A;  2K04 A;  3QO2 A;  2HCI A;  2HDM A;  4ZLT F;  1PFB A;  1WTP A;  1XX8 A;  2FJ2 A;  4XT1 B;  4MHE A;  2RA4 A;  4QUC A;  1U4M A;  2HUG A;  1B4O A;  1ESR A;  2DY8 A;  2Q8T A;  1HA6 A;  2NZ1 D;  5CBE E;  1G91 A;  2B2V A;  1C8C A;  2EE1 A;  1ICW A;  2JP1 A;  2KEC A;  1ILP A;  1DOL A;  1MGS A;  1SSO A;  1VMC A;  3H91 A;  2K05 A;  2B2T A;  1HFG A;  1U4P A;  1BO0 A;  1DON A;  2N55 A;  2KOL A;  2L1B A;  2N88 A;  1GUW A;  1MI2 A;  1WTV A;  1ML0 D;  1VMP A;  1X3P A;  1NR4 A;  2L9H A;  4CJ1 B;  4O42 A;  2K03 A;  2X6L A;  1RTO A;  3KUP A;  2MGS A;  5CBA E;  3DEO A;  1G2T A;  1HUN A;  1B3A A;  3I91 A;  4XDX A;  1Q3L A;  4CJ2 C;  4X3K A;  2B2V C;  2FHT A;  5T1I A;  3SVM A;  5E4X A;  2B2W A;  3GV6 A;  3TZD A;  3I90 A;  4UAI A;  1B2T A;  1G6Z A;  1NCV A;  2B2T C;  2RSO A;  5COY A;  1SAP A;  2KUM A;  2XIW A;  4NW2 A;  1JE4 A;  2FIN B;  2M2L A;  5JJZ A;  1RHP A;  5EKI A;  2HCC A;  4ZK9 B;  3GV3 A;  1F9S A;  3KBX A;  1G2S A;  1EIG A;  2B2U A;  4R9W A;  1KNE A;  1X32 A;  3MWY W;  1WD1 A;  1MSH A;  5EPK A;  4IUU A;  1B50 A;  2B2W C;  1B53 A;  1O7Y A;  2H1E A;  5COR A;  4OIK A;  5T1G A;  1AZQ A;  1CM9 A;  1ROD A;  2VXW A;  1BBX C;  1ZXT A;  4IUP A;  2K01 A;  2Q8R E;  2X6G A;  1EOT A;  3IFD A;  2NYZ D;  2KED A;  2L11 A;  2K1B A;  2L4N A;  4ZKB B;  5D14 A;  2B2U C;  1F9P A;  1RJT A;  2KEE A;  3F2U A;  3I3C A;  1BF4 A;  1IKM A;  2D9U A;  4LMQ D;  5EPL A;  2KVM A;  2MJ8 A;  2FMM A;  5EJW A;  3FPU B;  1WD0 A;  3LWE A;  3N52 A;  4MN3 A;  1XYI A;  4HCS A;  2CVR A;  1ILQ A;  1O80 A;  2L12 A;  4RWS C;  5AFW A;  3MTS A;  1F9Q A;  3ONA B;  1MSG A;  2HDL A;  1HUM A;  1JIC A;  2NWG A;  2RSN A;  3FDT A;  1QG7 A;  4OIJ A;  1AP0 A;  1J8I A;  1WTW A;  1AZP A;  1DZ1 A;  4XT3 B;  1HFN A;  2R3Z A;  2B2Y A;  4U68 A;  1LV9 A;  4X3U A;  2EOT A;  1E0B A;  1QE6 A;  5EPJ A;  4ZKC B;  4CJ0 B;  4IUQ A;  1F2L A;  3DEP A;  3I8Z A;  4X3S A;  3TN2 A;  1WVL A;  5D65 A;  1WTX A;  3D6W A;  1PLF A;  2EPB A;  1IL8 A;  2J7Z A;  2K28 A;  4HSV A;  2BDN A;  1U4R A;  1HHV A;  1X3Q A;  1HRJ A;  3DM1 A;  3R93 A;  1WTQ A;  4IUT A;  4RA8 A;  1CA6 A;  4ZAI A;  4QUF A;  1DOK A;  2MP1 A;  2MPM A;  3G7L A;  3Q6S A;  1U4L A;  5E4W C;  1PDQ A;  1DOM A;  2B2Y C; 
#chains in the Genus database with same CATH topology
 3CCL A;  2NVT B;  3WOF A;  3I73 A;  1B9N A;  4ME5 A;  4TVA B;  4IFD I;  1A3T A;  5IGC A;  1DD2 A;  3EN2 A;  1QIL A;  3STB D;  1M1K C;  1SR3 A;  3E0E A;  4A3E G;  1WTO A;  1E1T A;  4RG1 A;  3BDL A;  1YEZ A;  3H94 A;  3GO5 A;  1EFW A;  3M3Y B;  4DV6 Q;  2RF4 A;  1ET6 A;  1HNZ Q;  1NNX A;  1VQA A;  4DV0 L;  4QUC A;  1U4M A;  3MXU A;  2KCN A;  3S9W A;  4C3I B;  3T4A C;  4GOP B;  4JI4 Q;  3KLR A;  2RDF A;  2F0V A;  3F2D A;  1IW7 C;  1SYG A;  3M4Q A;  3GTG H;  1UE5 A;  2B2T A;  2UXD Q;  4DA2 A;  1H9R A;  1YNX A;  2N55 A;  4DR2 Q;  3S2H B;  1YHQ A;  3RUZ A;  1SFO H;  1STY A;  3GTP B;  1GUW A;  2WB1 G;  1XNR Q;  3S14 B;  3W1G A;  1EYA A;  2MGS A;  4K8J A;  2PQE A;  2ZTE A;  3I91 A;  4HJ7 A;  3AU7 A;  4DV2 Q;  5ELC A;  4IQZ A;  3M4P A;  3Q8D A;  1E7Z A;  1WCM H;  2JA8 B;  3CQZ B;  4X65 L;  3I90 A;  4JBK A;  3I4M B;  4C56 C;  3K5N A;  3M7G A;  5M3F B;  5LL6 X;  4IOC A;  3TP6 A;  4KJO A;  1K83 B;  2JEB I;  4QIW E;  1EEI D;  5JJZ A;  1D5M C;  3H6M A;  1PH6 A;  1VQ7 A;  4CKE A;  4L5Q A;  1Q8K A;  4LF9 L;  2EYJ A;  1JR0 D;  3A56 A;  3WWV A;  3M4O H;  1SLJ A;  3VYT A;  4N9T A;  4X64 Q;  4HID A;  2VB2 X;  4ULL A;  4DV1 Q;  5EPK A;  2XRQ D;  4L8J A;  3J81 E;  1PRT D;  5JVG 3;  4BBS G;  2K01 A;  3CCR A;  4DUZ L;  4CHT B;  2PI2 A;  1Y8N B;  3RZD B;  2L4N A;  4PZ6 A;  5D14 A;  1PMR A;  1F9P A;  5E7N A;  1FJG Q;  1BF4 A;  4LF4 Q;  3PSI A;  2EYP A;  4YCU A;  1TWF H;  5EJW A;  2M9V A;  4HCS A;  2ZM6 L;  4BY7 G;  4JYA Q;  1V1P B;  4JPB W;  1XPU A;  5IY0 A;  4KHP L;  3HOZ G;  1F9Q A;  2SEB D;  3A5Z B;  4EQ5 A;  5I6Y A;  2MUY A;  1ZEQ X;  3S17 B;  1AP0 A;  1VQL A;  2K7V A;  1WTW A;  4XT3 B;  2F0D A;  2WAC A;  5M3M H;  2N8N A;  3NEN A;  1R4Q B;  4DV4 L;  3QJY A;  2RHQ B;  3DM1 A;  1LTT D;  1LTL A;  1SE4 A;  1SN8 A;  4CDD C;  1KHI A;  4KD4 A;  1DOK A;  2MP1 A;  3PUV A;  1FGB D;  2EDG A;  4K5V A;  1EIF A;  3D3R A;  3WDN A;  4DV0 Q;  2XNA C;  3J80 i;  4HIM A;  4KLK A;  2UUC L;  3K58 A;  3D8G A;  3MEF A;  5IT9 c;  1PFM A;  3SR1 A;  5C6A A;  1EIH A;  5FO8 B;  2ENB A;  1ONL A;  2IL8 A;  1IXR A;  1ASY A;  2X69 A;  4H0L C;  1KLU D;  4A3I G;  1B9M A;  1PA6 A;  1L0Y B;  1SRU A;  4AYB B;  4BY1 G;  1GVP A;  2RA4 A;  5IGE A;  2E2I B;  1CSQ A;  5C5M A;  4ODG A;  4X65 Q;  1KAB A;  3J7A 5;  1HCZ A;  5IYC H;  3H91 A;  5C3X A;  2R7D A;  2MQH A;  3VA5 A;  2OTL A;  5E3F A;  3W3A A;  2IT1 A;  2IHF A;  4LF9 Q;  3E3X A;  1EWI A;  4RHR A;  3MEH A;  3JAM L;  4X3K A;  1PZI D;  1YNJ D;  4R8N A;  2GVB A;  4I7Z C;  4A3K H;  2EXD A;  4ZCK A;  2QIL A;  1BOS A;  4DUZ Q;  1ZKO A;  3H0G B;  3I4N H;  4AH6 A;  3GTL H;  4X66 Q;  3EBE A;  2R7Z B;  2PMZ B;  1VQ9 A;  4RHS A;  1PRT F;  4YCW A;  2NVY H;  1F2Z A;  1YHA A;  2R92 H;  3I55 A;  2A19 A;  5IGD A;  4JI3 L;  2ZM6 Q;  1D6E C;  3HKZ E;  4KHP Q;  1A6X A;  4F87 A;  3OW2 A;  5LL6 S;  1BBX C;  3VR5 A;  4ABN A;  3TDQ A;  3J7Z C;  2JE6 I;  3P1H A;  2VW9 A;  1R9T B;  4BBR H;  3P20 A;  1STG A;  4LF6 L;  3BZC A;  3T51 B;  2C5C A;  4MTN A;  4DV4 Q;  4NPS A;  3RMH A;  1L1O C;  4RWS C;  3PO3 H;  3HZX A;  1CHQ D;  1B8A A;  4GOP C;  3HOV H;  3K57 A;  4L5R C;  3BVZ A;  4GNX B;  1CZW A;  1JCK B;  3L7Z C;  3FKI B;  3UDG A;  1I4R A;  2UUC Q;  3W5O A;  1SYF A;  1EY8 A;  1HHV A;  5ELF A;  1HRJ A;  1MJE A;  1I94 Q;  4IUT A;  1BDO A;  4ZAI A;  3OYY A;  1EQQ A;  5HGT A;  1JMC A;  3T1H L;  1YVC A;  1CI3 M;  1I6H H;  1IYJ B;  1EY6 A;  1UUP A;  2K5W A;  2A73 B;  1QVC A;  5KGU A;  3PIO 3;  5ELE A;  3JAM i;  1S5F D;  5JEA G;  4HED A;  4PG3 A;  2R93 B;  1E22 A;  1SNO A;  1PFB A;  5IGG A;  3TZU A;  1U0L A;  1SSO A;  2L55 A;  1FL0 A;  2A68 C;  4UPA A;  4GLA C;  1H9M A;  2FXQ A;  2N88 A;  1GO3 E;  1HZB A;  3CRK C;  2IW3 A;  2Z9H A;  1YIT A;  2X6L A;  1RTO A;  4DR1 L;  4A3G H;  1UE7 A;  1SYE A;  3C2P A;  4RGT A;  3BZK A;  5CV6 A;  4JI5 L;  2XIW A;  5DM7 3;  4FF2 A;  1MJC A;  5M5X B;  3TME A;  4BXX H;  3HKZ G;  4LF6 Q;  4R9W A;  2R6G A;  1N36 L;  4HIK A;  1Y1V B;  2ICE C;  2KBN A;  3OMC A;  3GTQ B;  4C3J B;  1H95 A;  3ZJY C;  1CM9 A;  4EQO A;  2WKD A;  1QJO A;  3HG9 A;  2L11 A;  1EQR A;  2EQS A;  4PNY A;  2DJF C;  1VQM A;  3I3C A;  4JG2 A;  1K3B C;  1U9R A;  1KC8 C;  1X65 A;  1KDB A;  1IHZ A;  3TP7 A;  4I65 A;  1PH8 A;  2L0C A;  3TRE A;  4F7X A;  1KDA A;  1QZG A;  1MSG A;  2RDG A;  1X56 A;  2RSN A;  4A3E B;  4JBW A;  3S1N H;  1UNS A;  1VQK A;  3TS2 A;  3T1H Q;  2ATW A;  1LV9 A;  2F52 A;  4RH6 A;  3NTH A;  1GUT A;  4X3S A;  2GN5 A;  2UUA L;  2WAQ E;  2RQX A;  1E2Z A;  2AHO B;  1I5F A;  1SE8 A;  2NZO A;  3H09 A;  5I9O A;  5E4W C;  3OW7 A;  1TWA H;  2JA8 G;  4DGZ A;  1F9R A;  4DR3 L;  4KK7 A;  4RAU C;  2WB1 B;  5M3F G;  3S15 H;  4AQY L;  2EXZ A;  1VQI A;  1WI5 A;  1OXX K;  4PV1 C;  4LF8 L;  5CMD A;  2JA7 H;  3VYU A;  2IWH A;  3LNN A;  1EL0 A;  3K8A A;  1Y1W H;  3VR6 A;  5IWA L;  2PW7 A;  2SNM A;  4JOI A;  4N9P A;  1B70 B;  2YTV A;  4UDU C;  1JOQ A;  1O7I A;  1SE3 A;  1H9S A;  5BN5 A;  3M85 A;  1SMY D;  3ULJ A;  2NVQ B;  3A7A B;  3H15 A;  1PZK D;  4JW0 A;  3CME A;  4JI5 Q;  1U4P A;  4Y7N B;  3KDF A;  1DON A;  1SNQ A;  2QA4 A;  1KAW A;  4XYO A;  1VF5 C;  2ZTD A;  2KCC A;  4A3C H;  2NN6 H;  5ISR A;  3NE5 B;  3S2D H;  1DGS A;  1N36 Q;  3BG3 A;  3CHB D;  4P71 A;  5I2X A;  3G6E A;  1YZ6 A;  1JB3 A;  3EVQ A;  4GNX C;  1KQS A;  3HOU H;  1NMF A;  3AFQ A;  3CCV A;  2E8G A;  2B2W A;  2PCF B;  5BR8 L;  4BA1 I;  5IP9 G;  1N8R C;  1ZYR D;  5M5W B;  5CV4 A;  5C3E B;  5C4X B;  3CCJ A;  2J4X A;  2DJG C;  5EKL A;  1WTH A;  2NZH A;  3HOY G;  2B2U A;  3PQI A;  1V43 A;  1PYS B;  1X3E A;  1WD1 A;  3BDC A;  2UU9 Q;  3LGJ A;  4CGY B;  1OXU A;  1AZQ A;  3GTK B;  2PI2 E;  3GTJ H;  2F4I A;  2PQA A;  2A6E D;  1C0A A;  2UUA Q;  5EPL A;  1J5E L;  2VQE L;  4HMI A;  3QOJ A;  2L12 A;  4A3M H;  3CF5 A;  2OXP A;  1HUM A;  3K7A B;  2CQO A;  1LTA D;  4CDE C;  4OXP A;  4QF4 A;  1N33 L;  1VQO A;  2WAQ G;  4H13 C;  1S40 A;  4AQY Q;  4X62 L;  1I4P A;  5EPJ A;  4IFD G;  4LF8 Q;  1CQV A;  4YWL A;  1GUO A;  5C4H A;  5D65 A;  5FLM H;  3KF8 A;  3T53 B;  1HZ9 A;  3RZO H;  4QQB X;  5IWA Q;  3SK6 A;  4RA8 A;  3I56 A;  2EIF A;  5AJ3 L;  5KYL A;  1VDZ A;  2VUM H;  5HGQ A;  3H0G G;  4IJH A;  3CC2 A;  1K0S A;  4K6L A;  2R7Z G;  4QIW B;  1HNX L;  3OHX C;  4MIU A;  4C2M B;  2OQK A;  1X55 A;  4GLX A;  4BBS H;  2F03 A;  4Z9C B;  2VQF L;  4C1N K;  4PMC A;  3E0J A;  2WKC A;  1E24 A;  1E2W A;  4ILW A;  2EYL A;  2HUG A;  2JA5 B;  1ESR A;  5J39 A;  4LFC Q;  1G91 A;  1KLG D;  5KNB A;  5C4Z A;  3K5M A;  3TSS A;  5C4J H;  1GUN A;  2B39 A;  2QCP X;  4ZRZ A;  5BR8 Q;  1YIJ A;  4TSS A;  3E5S A;  3Q24 A;  4M8A A;  1G51 A;  4BY7 H;  1XNQ L;  5G3L D;  3OPO A;  3ITP A;  3R3O A;  4NP5 A;  1WTV A;  4GS3 A;  1NR4 A;  3OOC A;  1L1O A;  1X54 A;  2F0K A;  2F0N A;  1BQQ T;  3DEO A;  2R7F A;  1HPC A;  1T9H A;  2IHE A;  2K4K A;  2P5Z X;  1KRT A;  5E4X A;  3GV6 A;  3FKI G;  3S1M H;  4KY5 A;  3F8T A;  2A74 C;  1SMX A;  5COY A;  2EYF A;  1LT5 D;  2ZXO A;  1I50 H;  1RHP A;  3CC4 A;  4JI2 L;  1CKM A;  4HMJ A;  4FNF A;  2LXJ A;  2K32 A;  5FLX E;  3KLS X;  1J5E Q;  3F2C A;  4KHV A;  2CCZ A;  3E6Z X;  4DV6 L;  4ZUJ A;  4JI1 L;  4G7O C;  2PW5 A;  2X6G A;  2K5D A;  1N33 Q;  4A93 G;  1Q81 C;  3M7N A;  1JC7 A;  1IW7 D;  1JOK A;  3RD4 A;  4X62 Q;  2A8V A;  4A3I H;  1Q82 C;  1K8M A;  5CR3 A;  5DLQ E;  2PO4 A;  2K14 A;  1BR9 A;  2R93 G;  4FF4 A;  2F0Q A;  4G7Z C;  1CZG A;  1CQF A;  3MHB A;  5AJ3 Q;  4FF3 A;  3D0F A;  4RCO A;  4A75 A;  5EAY A;  1F2L A;  1HNX Q;  1F2Y A;  3J7A V;  2D0O A;  2EPB A;  3PO2 G;  2YYZ A;  3RN2 A;  5KIX A;  1GD7 A;  3G7L A;  4ZQ3 A;  2VQF Q;  2PQA B;  5JVH 3;  3UI2 A;  1G29 1;  5D3D A;  3S1R B;  3G71 A;  3CPW A;  1TVX A;  1J9O A;  3MVV A;  4BA2 I;  3AFP A;  1XNQ Q;  1NY4 A;  1N9W A;  1Y1V G;  2HHH L;  2NVX B;  4B3R L;  2SOB A;  1D7Q A;  3V05 A;  2Z6B A;  4FXD A;  1STH A;  4C3J G;  1EY7 A;  4MHE A;  3G48 A;  1GJX A;  2IPK D;  2OTJ A;  2B2V A;  5G3L F;  1C8C A;  3UDI A;  1VMC A;  4PZ7 A;  2K75 A;  3H3V C;  4JI2 Q;  4A3D B;  2WFW A;  1K73 C;  4GLV B;  4O42 A;  1PRT B;  1W6J A;  2RCF A;  2A69 C;  4C1N I;  2FHT A;  1SNM A;  1STN A;  4DR7 L;  3TQY A;  4JI1 Q;  1NCV A;  3GP7 A;  1BVS A;  2AUJ D;  3V96 A;  2KUM A;  3OMG A;  1AE2 A;  5JOB A;  5FLX c;  1KDC A;  5D3I B;  2E2J H;  4ZK9 B;  1SE2 A;  1A3U A;  1X9N A;  4R4C A;  2Z8L A;  3PGZ A;  1W3S A;  3J80 L;  2WP8 J;  2KA7 A;  2KHJ A;  2K33 A;  1AE3 A;  2UXB L;  3SGI A;  2ZJP A;  3E9H A;  1XPO A;  4XQJ A;  3K5O A;  1JB7 A;  1XXG A;  1PVO A;  3TEH B;  3OIQ A;  3T13 A;  3IFD A;  4BS9 A;  4O0A A;  4FXG C;  1I4X A;  1TXY A;  1PTO C;  4EQP A;  1RJT A;  5ELN A;  2NB0 A;  2D9U A;  1DM0 B;  4RKL A;  2EJF C;  2KVM A;  2ZT9 C;  3FEW X;  1SNC A;  3LWE A;  2BOS A;  3NTI A;  3ONA B;  3VDY A;  5J1Z A;  2PYK A;  4YHH Q;  3U4Z A;  2EOT A;  4C3H H;  5LMN L;  5LMN W;  4A76 A;  3CRL C;  4CJ0 B;  3SK5 A;  4TQU S;  2AUK A;  1QWY A;  4J6H A;  4X66 L;  1WTQ A;  2MO1 A;  2HHH Q;  3X3N A;  2E76 C;  4B3R Q;  2BH8 A;  1ASZ A;  4DAY B;  3X3M A;  1A15 A;  1QZH A;  1RTN A;  1CSP A;  5C3E G;  1NAP A;  1VQN A;  5C4X G;  4FXK C;  3PIP A;  4J1M A;  3SDZ A;  4K14 A;  3P7J A;  1QVG A;  3I4N B;  3I4L A;  3L2P A;  2NVT H;  2AQ3 B;  2O5I C;  4APV A;  3EIV A;  2OQ0 A;  1Q86 C;  2K6A A;  1QUQ B;  3QO2 A;  1ENA A;  2NUC A;  1PH7 A;  2BDO A;  3HOY B;  4RGM A;  3RR5 A;  3R8B A;  2H4O A;  4DR7 Q;  4RCN A;  3M3Y H;  4E6I A;  3PF4 A;  5IYB H;  2CWA A;  4JBJ A;  3HOX B;  2K05 A;  1YNN C;  2AQ2 B;  3U9O A;  1Z6H A;  1H9K A;  2NTT A;  5HY6 A;  4BBR B;  1FR3 A;  4C3I H;  2E2H B;  1EY0 A;  4DR6 L;  1I94 L;  3CCE A;  1SJE D;  2BA1 A;  3PO3 B;  3S2H H;  1FGU A;  2UXB Q;  3KBG A;  3GTP H;  3STB C;  4UAI A;  3HOV B;  2VNU D;  1LTB D;  4GKK L;  1SAP A;  3S14 H;  2JN4 A;  3MXN B;  1QCB D;  1ICF B;  2WAQ B;  3NWS A;  3CQZ H;  2JA8 H;  3I4M H;  3NBI A;  1B7Y B;  3MWY W;  5M3F H;  1TS5 A;  4DV7 Q;  1K83 H;  1B53 A;  4OEM B;  4CBV A;  5T1G A;  2GVA A;  1M90 C;  2K5Q A;  1KXL A;  4JI6 Q;  5JJK A;  2ZTC A;  5KRU A;  3W1B A;  2F3V A;  5LMN Q;  2XVS A;  2Z6K A;  4LNQ A;  1VQ6 A;  2EVB A;  1SYB A;  2NN6 I;  5KND A;  3N6R A;  3PUW A;  1VQJ A;  1SJH D;  3RZD H;  2JA5 G;  3J81 c;  1JIC A;  3FDT A;  1DZ1 A;  2ZXP A;  1EU4 A;  2Q2H A;  3BVG A;  1HQR D;  2B2Y A;  4O1N A;  3CC7 A;  4LJZ C;  3G4S A;  4MNO A;  2OF1 A;  4YWM A;  5IGB A;  2Q8I B;  4KN4 C;  5FJ8 G;  4B3T L;  4V19 0;  4Y52 H;  1RL2 A;  3U4V A;  2CQA A;  4LUO A;  5IP9 H;  1PDQ A;  4B3S L;  4IUV A;  3KLS A;  2Z1C A;  1M8A A;  3SK4 A;  1KD1 C;  4R8I A;  1Q12 A;  3FPP A;  3HS0 C;  2QEJ C;  1Z9F A;  2FMC A;  5ELB A;  4BWG B;  4MZ9 A;  1EOV A;  1GM5 A;  4DV5 L;  2HT1 A;  5BN3 A;  3S1Q H;  4HAE A;  3K59 A;  2LY7 A;  2DY7 A;  2YU9 B;  5IYD H;  1WTP A;  1LT6 D;  4DR6 Q;  1XX8 A;  1EIY B;  4JBM A;  3BDO A;  3NK9 A;  4UY8 C;  4WOR A;  1P8L A;  2JJQ A;  2VS1 A;  4GKK Q;  3GTO B;  1K8A C;  3CU7 A;  2E2I H;  3QOL A;  1FNV A;  2BE5 C;  5GAH C;  1BCP D;  2RKS A;  4A93 B;  4JK1 C;  1UE6 A;  3BZD B;  5H1S E;  3KUP A;  4JVZ A;  5IIF A;  4S3S A;  4EGV A;  3AMU A;  4GN4 B;  1TWC B;  4K8I A;  1CTM A;  1UE1 A;  1G6Z A;  1LTG D;  3E9I A;  3CW2 C;  4K2K A;  2WII B;  3KBX A;  1VQ8 A;  3J7Y W;  2O2L D;  3J80 E;  1N34 L;  4OO1 H;  2KHS A;  4DR5 L;  1X32 A;  2XTI A;  1SNP A;  2LSS A;  4DK6 C;  3VR3 A;  1SYC A;  3H0G H;  4G4K A;  1O78 A;  2R7Z H;  1XPR A;  3PO2 B;  3IRB A;  1C48 A;  1WCM G;  3HKS A;  4IUP A;  3HOW H;  3T56 B;  2KJX A;  2Y0S B;  1V1Q A;  2K1B A;  3KF6 A;  3PUX A;  4K2L A;  5I6W A;  1QB5 D;  3S15 B;  3NBH A;  1CKN A;  1YNJ C;  4B3T Q;  2F0U A;  4DPG A;  4POG A;  2DNC A;  4DAP A;  3U58 A;  1R9T H;  3F2B A;  4A3B B;  2QDB A;  2F0L A;  1TS4 A;  4LFB Q;  4B3S Q;  1JJC B;  3KOJ A;  3HFZ B;  4HJ8 A;  3L3O C;  3QWN A;  1E0B A;  4ZKC B;  4KJN A;  3Q23 A;  4A3D G;  3HGB A;  1C7Y A;  1TS2 A;  1Q1B A;  4DR4 L;  1Z47 A;  4DV5 Q;  1CFM A;  1K28 A;  1YHB A;  1EUJ A;  4UP7 A;  4A3J H;  3FKI H;  5CV7 A;  1JQY D;  1STA A;  4GZY C;  4MN3 A;  1W6K A;  2LXK A;  4OL7 A;  2UU9 L;  5C44 B;  1SRO A;  1BNZ A;  1UEB A;  5HUR A;  2SDF A;  2FFK B;  4DN4 M;  1LTI D;  4KTA A;  4IUR A;  1PH9 A;  4XIG S;  4NXM Q;  1NR2 A;  2CH4 A;  2O5J C;  1STE A;  4RFB A;  5EKK A;  2HDM A;  3HEJ A;  4HSP A;  2M00 A;  2YV5 A;  4Q0F A;  5CBE E;  1DYQ A;  1A8V A;  2EE1 A;  1BCP F;  2R93 H;  4FDB A;  4IPG A;  4IPC A;  1HFG A;  3GTJ B;  3NEL A;  4P73 A;  3HRZ C;  3NSW A;  4KD3 A;  2RCN A;  4CJ1 B;  3A74 A;  1N34 Q;  2XSC A;  4JI8 L;  2AQ1 B;  1OXS C;  2F0J A;  2A6H D;  4DR5 Q;  4KY6 A;  2XWB B;  3PF5 A;  2B2T C;  1GHK A;  2JXM B;  3J80 c;  4DNR B;  4R4I A;  3VR2 A;  1G2S A;  3OTO L;  5JPN C;  1S72 A;  1AH9 A;  2JA6 H;  1Y69 U;  2PNR C;  3URY A;  2QW7 A;  3RZO B;  3K81 C;  4DFA A;  3A0J A;  5M5X H;  5COR A;  4DK3 C;  3CCM A;  1L0W A;  2ALY B;  3JAM E;  5TSS A;  4JI0 L;  4WJ4 A;  4A3F H;  1NUC A;  1Y1V H;  4OON A;  1TII D;  4LFC L;  3CP0 A;  2B8F A;  3I4N G;  3F2U A;  3GTQ H;  4C3J H;  2MJ8 A;  5IE8 A;  2OEO A;  4DR4 Q;  3U50 C;  2CHB D;  5A2Q L;  2IX3 A;  1XMO L;  5LMU L;  5C0X G;  4LF7 L;  1KL9 A;  3ND8 A;  4K0K L;  3PIO A;  3UDF A;  1VQ5 A;  1UEA B;  2CW0 C;  4PMB A;  4JV5 L;  2F4V L;  3HOX G;  2WIN B;  1FVI A;  1QE6 A;  4QCL A;  2OT2 A;  3DEP A;  3ER0 A;  1YJW A;  4A3E H;  5IT9 L;  4BBR G;  4UHV A;  3I7F A;  3PO3 G;  3KF6 B;  1Q90 A;  5C3W A;  4IOA A;  3NBH B;  3HOV G;  1HNW L;  2F3I A;  2L15 A;  4GN5 A;  4R4O A;  4OWT B;  1KNA A;  3IL8 A;  3D31 A;  3S1M B;  1KTK A;  1EZ8 A;  1P16 A;  3S16 B;  4R4Q A;  1JWS D;  3DM3 A;  1CA5 A;  3L0O A;  4OHJ A;  4FYD A;  4YCV A;  2CH4 W;  4B08 A;  2AMC B;  3C1F A;  4PMW A;  4JI8 Q;  2BCO A;  5E1F A;  4LF5 L;  2F0T A;  1B4O A;  1FNW A;  5JAV A;  1HA6 A;  3A8J E;  3ERS X;  4DNI A;  1ICW A;  1Y8P B;  1E1O A;  1LYL A;  3ND9 A;  1TKW B;  5CC4 A;  3A54 A;  2Y0S E;  3FMC A;  4LK1 C;  3OTO Q;  1ML0 D;  2NVQ H;  1VQC A;  3Q22 A;  3U9S A;  1I3Q B;  1LO5 D;  1Y14 B;  1B3A A;  1YJ9 A;  3KFU A;  4CDC C;  3M9B A;  4Y7N H;  1ESF A;  3CXC A;  5J3B A;  2ICI A;  4P72 A;  1TWG B;  5FO9 B;  1EY5 A;  4N8X 1;  2RSO A;  4JI0 Q;  2XGT A;  3I70 A;  3ICE A;  5EKI A;  2AWN A;  1GUG A;  4O2D A;  2OCE A;  4ID6 A;  2AWO A;  2F0W A;  3CMA A;  4IJL A;  2IJ0 A;  2BA0 A;  3A8K E;  1KNE A;  4OEL B;  1IYU A;  5DAU A;  3JAM c;  4FF1 A;  5CYU A;  4P75 A;  3HOZ H;  5M5W H;  4WFN 3;  1XMO Q;  5LMU Q;  2H1E A;  2F1M A;  3MXP A;  3CKI B;  4YWK A;  2V1C C;  5C4X H;  4LF7 Q;  4IAL A;  4K0K Q;  2K5H A;  4GOP A;  2ES2 A;  4PZ8 A;  2F4V Q;  4JV5 Q;  5KEE A;  1RF2 D;  3ERO A;  4BXX G;  1L0X B;  4IO9 A;  4HN7 A;  4QMG A;  2B63 B;  1TR5 A;  2FMM A;  3GTK H;  3FVQ A;  1TWH B;  3N52 A;  3OSO A;  1TS3 A;  1X3G A;  1NMG A;  4OGQ C;  3MTS A;  1H9S B;  1J8I A;  4DXG A;  5I9P A;  2K50 A;  1HNW Q;  4LUZ A;  5M5Y B;  3GTM B;  3H3V H;  3OWE B;  3NXW A;  4KMU C;  4JC0 A;  1YJN A;  3KDF B;  1WVL A;  1WTX A;  3K7A H;  2EYH A;  2K28 A;  4POF A;  1U4R A;  4P74 A;  2I46 A;  4L5T A;  3GDE A;  4ME3 A;  1V1O A;  2PPB C;  2A1A A;  3RN5 A;  2MPM A;  2VZA A;  2UXC L;  4RKB A;  4BY1 H;  4KHZ A;  2A6E C;  2KOL A;  4LF5 Q;  4X3T A;  1HR0 L;  1OO9 B;  3R2I A;  1MBY A;  2AKW B;  1PTO D;  4DK0 A;  1I4H A;  1BBU A;  2RDH A;  3J7A F;  4J8Q A;  4LFA L;  3O13 A;  3QR8 A;  5IOD A;  1RDP D;  4B9W A;  3KLW A;  3GTG B;  1V1P A;  1ENF A;  2HCI A;  5A35 A;  3FRP B;  4DK1 A;  4KY7 A;  1SFO B;  1PTO H;  2NZ1 D;  2PZT A;  4C2M H;  2Y0S G;  3NP8 A;  2JP1 A;  1DOL A;  1LT4 D;  1MGS A;  4YHH L;  1EWH A;  1S5C D;  2ASB A;  3TP5 A;  1Y1W G;  3ERQ A;  1WCM B;  1T5X D;  1C4Q A;  3MFG A;  2L1B A;  2JA5 H;  5EGT A;  2B8G A;  1MI2 A;  2LS0 1;  3K80 C;  2B29 A;  1RKN A;  1WJJ A;  3MC0 B;  3TBI B;  1S3O A;  5EBC A;  4A3B G;  4WJ3 M;  1A63 A;  3JC6 6;  3SE0 A;  3FP9 A;  3CCQ A;  3M4O B;  5L37 A;  1D5X C;  4I7A A;  4DKA C;  5GAD C;  1TQO A;  4XXE A;  5FJ8 H;  2PZU A;  5ELD A;  4HCE A;  4JI7 L;  3KF8 B;  4HTH A;  2E75 C;  2NN6 G;  2Z0S A;  1B50 A;  1LAB A;  1O7Y A;  2QDL A;  1OXT A;  5C44 G;  1TWF B;  1D2B A;  2QF7 A;  2VL6 A;  2XRS D;  1Q8I A;  2F0F A;  4ZKB B;  4A3L G;  3NQI A;  1K9M C;  5A2Q E;  3C46 A;  2Q2T A;  1NSN S;  1PXU A;  4YY3 Q;  4DXF A;  4EVO A;  4CKB A;  5M3M B;  2K5V A;  4OIJ A;  2UXC Q;  1WOC A;  2N49 A;  4NXN L;  5ELO A;  1E3P A;  2WV6 D;  3F1Z A;  1IL2 A;  2ID0 A;  5C5L A;  4H44 C;  1HR0 Q;  5I2Y A;  5IT9 E;  3BU2 A;  1PH1 A;  1OXV A;  1STB A;  3MXG A;  4HSV A;  4HR7 B;  4OO1 I;  5JEA H;  1IBM L;  1L1O B;  4LFA Q;  2E2D C;  1HZA A;  1W2B A;  4R4T A;  3DUZ A;  1K3R A;  4A3M G;  4DV7 L;  1EQV A;  1PTO F;  1AFP A;  1OTC A;  4JI6 L;  1XMQ L;  3NHH A;  5FLM G;  1LAC A;  3DXJ C;  2N3S A;  3S24 A;  2IY5 B;  3S1R H;  2F0G A;  3AEV A;  2K5N A;  2FJ2 A;  1D8L A;  1A62 A;  3AB9 A;  3A5U A;  5GAG C;  1CT1 D;  4GNX A;  2NVX H;  2VUM G;  3DWQ A;  2I5M X;  1IBL L;  1TT2 A;  2KHI A;  4JOI C;  2IX0 A;  3G6J B;  4YIJ A;  4A3K B;  4JI7 Q;  1JE5 A;  1X3P A;  5CV8 A;  2EYO A;  1JT8 A;  1PFS A;  3P75 A;  1HUN A;  3QB3 A;  3T1Y L;  1Q3L A;  4CJ2 C;  3GTL B;  5JJI A;  3C1E A;  4A3D H;  2LKV A;  5J22 A;  1JOO A;  2NVY B;  2R92 B;  3C3L A;  4KN7 C;  4B3M L;  2FIN B;  2M2L A;  5KNC A;  1HJP A;  4X6A H;  5IP7 G;  3GQB A;  3K7U C;  4WRD A;  1D5Z C;  2PNH A;  2SNS A;  1FD7 D;  5CGK A;  2ZJR A;  2C35 B;  2DGY A;  1JWU D;  5FKA C;  4CDF C;  4HIO A;  2F0O A;  2B2W C;  4Q5V A;  1BBW A;  3NEM A;  4QL5 A;  5GQO A;  2R61 A;  3MFY A;  3D6C A;  4NXN Q;  4NB3 A;  1K0R A;  2DNE A;  3KK7 A;  2J0T D;  2KED A;  2B2U C;  1MKH A;  2TMP A;  3KJP A;  2BE5 D;  3IKJ A;  4OWX B;  1AN8 A;  4K5X A;  1WD0 A;  4DF7 A;  1IBM Q;  3S1Q B;  1DXM A;  1SXT A;  1ILQ A;  1LLR D;  4DAM A;  3EQL C;  4LWC A;  2KCT A;  5JEA J;  3VYR A;  3RLN A;  3K6O A;  4IUN A;  2R3Z A;  1Q1E A;  4U68 A;  1PZJ D;  1F2M A;  4TKO B;  3RLO A;  4UP9 A;  4KKT A;  1ET9 A;  3IAY A;  2E74 C;  1I6H B;  1XMQ Q;  1X3Q A;  2EY2 A;  1YI2 A;  2A68 D;  3BYY B;  4DV3 L;  4HJ9 A;  3B6Y A;  3NQT A;  1BUV T;  1U4L A;  3QIA A;  4L5S A;  1DOM A;  5DM6 3;  4RMF A;  4CKC A;  2DUD A;  5K36 G;  2HQE A;  3I2Z A;  4LW1 A;  1IBL Q;  4XYQ A;  1U5K A;  4ZUI A;  1RIP A;  2BH2 A;  1BCP B;  1BXT A;  4RGN A;  2G9D A;  3PCO B;  4J15 A;  2NTS A;  4B9X A;  1QNU A;  2HQL A;  1N32 L;  1EY9 A;  1IKL A;  2JYO A;  3S17 H;  1PRT C;  4XT1 B;  3T1Y Q;  3DWP A;  1O7L A;  1X3F A;  3DWA A;  5I4D A;  2Q8T A;  2DY8 A;  2CFM A;  4H02 A;  3WOE A;  2TSS A;  3SEB A;  4LFB L;  3HOW B;  4A3G B;  4B3M Q;  1AEX A;  4HJ5 A;  2B63 G;  5C0X H;  4QGU A;  3HOY H;  2EY5 A;  1EYG A;  1RD9 D;  3HOX H;  4KV6 A;  2F0M A;  4N8F A;  3T16 A;  5T1I A;  3SVM A;  2I0Q A;  1HTP A;  2A5H A;  2KCM A;  5EBD A;  2E2H H;  2K52 A;  5NUC A;  2OWO A;  2HCC A;  1D1I A;  2ZXR A;  1D1K A;  3AQQ A;  5IOC A;  1TY0 A;  4NXM L;  1VQG A;  4IUU A;  4RGO S;  3M4Y A;  1G8Z D;  4A3J B;  1SBB B;  3CAM A;  3W2D A;  1LTS D;  1ROD A;  1FNU A;  1KIX A;  3RNU A;  2NYZ D;  4IFD H;  3TRZ A;  2XN9 C;  1IKM A;  5FO7 B;  3S1N B;  3SHL A;  1PHJ A;  3BS1 A;  5JJL A;  2B3G A;  4L63 B;  3D4W A;  3I4O A;  3ZYY X;  2EY6 A;  4NDX A;  2CVR A;  3MA2 B;  4DV3 Q;  2CKZ B;  3BVM A;  2QEX A;  4EQN A;  1HFN A;  1LT3 D;  4JCV E;  4WJW A;  3MAQ A;  4X3U A;  1NJI C;  4R1J A;  1I6V C;  1NBW A;  1TWA B;  2DN8 A;  3DHQ A;  3K0X A;  1Q7Y C;  1T5E A;  1C9O A;  2UUB L;  2JA7 B;  4DNT B;  2C9O A;  4L6T B;  1Y1W B;  1N32 Q;  1B3Q A;  1EEF D;  1CUK A;  3RLF A;  5GAE C;  4GN3 B;  3D4R A;  1A2T A;  2RVL A;  1VQE A;  1J6Q A;  1VF7 A;  1S5B D;  2O4X A;  4C3H G;  2G5D A;  1Q46 A;  1QNK A;  1S4Z A;  5EQ0 A;  2D0P A;  4JI3 Q;  1EFI D;  3KJO A;  2JA6 B;  2K04 A;  3PUY A;  4ZLT F;  5C0X J;  2Q2I A;  3NTK A;  4FO2 A;  1QVF A;  1GUS A;  2CW0 D;  3H3V I;  3S2D B;  3R2T A;  1IBK L;  2KEC A;  2YU9 H;  5M9O A;  3BYT B;  4P2C B;  4A3F B;  4UP8 A;  3HOU B;  4NKL A;  5FLX L;  2G9H D;  5IGF A;  2L9H A;  1VMP A;  1CKO A;  1CK1 A;  1MD2 D;  1I4G A;  1XJV A;  1LTR D;  5M3M G;  4H7B A;  4QJF A;  2MHV A;  3GTO H;  2F0H A;  2B2V C;  3A55 A;  1SYD A;  3MZ5 A;  1B2T A;  4TRD A;  4A93 H;  2JEA I;  3IFT A;  1EZ6 A;  4NW2 A;  1KAA A;  1RCV D;  5IYB G;  2EYM A;  1TWC H;  1VQD A;  1S5D D;  4IFD J;  4C3I G;  3PUZ A;  1VQF A;  1HTL D;  1I4Q A;  3K5L A;  2L5T A;  4AYB E;  2N78 A;  1V8Q A;  3EJI A;  5BN4 A;  1K8O A;  1XWE A;  3LX0 A;  1EOT A;  4XQN A;  1BCP C;  1GXD C;  1XTD A;  4A3M B;  2E5L L;  4LUV A;  2F3W A;  5KYI A;  2EZV A;  4LMQ D;  4PQX A;  3PO2 H;  3FPU B;  2I5L X;  5IYC G;  3I4M G;  2UUB Q;  5AFW A;  4XQQ A;  3TP8 A;  4FVM A;  1MHW C;  2HDL A;  3EA6 A;  3DMU A;  1HZC A;  4IZ8 A;  1G6P A;  1H9J A;  3CCU A;  1HH2 P;  4IUQ A;  3TN2 A;  4A3K G;  4A3B H;  2PMZ E;  4NMZ A;  1PLF A;  2I5H A;  4DR1 Q;  2BDN A;  2VUM B;  2I07 B;  1NTG A;  3SXH A;  4K5W A;  5JPM C;  1TU2 B;  1UWV A;  1KRS A;  3QG1 A;  1PFN A;  1VQB A;  2R92 G;  4BBS B;  4ALP A;  3Q0A A;  5DNF A;  2RBM A;  4IPH A;  1IBK Q;  4XTC S;  1B1Z A;  1SDF A;  1PH2 A;  1HXY D;  2ZJQ A;  1IYV A;  1O7Z A;  2HD3 A;  5C44 H;  3HP3 A;  5C4J B;  4LAA A;  1SEB D;  1MIU A;  1EQT A;  4K6D A;  4BY7 B;  3HOZ B;  2F0E A;  4A3L H;  1PYW D;  1EU3 A;  1ILP A;  2KQ3 A;  1HA5 A;  1A2U A;  1BO0 A;  1CKN B;  1R4P B;  2KEN A;  1PH5 A;  3K0Y A;  4EX5 A;  1PH3 A;  1TY2 A;  1V9P A;  2K03 A;  1G2T A;  1I50 B;  4XDX A;  5IYD G;  1VQP A;  5GRO A;  2Q2U A;  5FOB B;  2HIX A;  1K8G A;  4FP5 D;  4QB4 A;  3J81 j;  2F0P A;  3D4D A;  2JA9 A;  1WFQ A;  2YTY A;  3GV3 A;  2E5L Q;  4AYB G;  1EIG A;  3FHW A;  1AW7 A;  1MSH A;  4DR3 Q;  4KKU A;  3PV0 A;  4A3I B;  2HIV A;  3AYH B;  2RHS B;  4BY1 B;  3J81 L;  2JQO A;  2VXW A;  1A0I A;  3CCS A;  2Z4H A;  3DLL A;  1EWC A;  5K5P A;  4DUY L;  3NPP A;  3UE0 A;  2A6H C;  5LHY 1;  4OO1 G;  3CD6 A;  3A8I E;  2YTX A;  5DEH A;  1CHP D;  4ZYS A;  1VCI A;  1AZP A;  2MO0 A;  1SMY C;  3OIP A;  1X6O A;  4U67 3;  2Z6K C;  3HOW G;  1PTO B;  5C3E H;  4A3G G;  1GHJ A;  3VA7 A;  2QGQ A;  1WYD A;  3D6W A;  1IL8 A;  5CV5 A;  2LMC B;  3A7L A;  3SK8 A;  3ULP A;  2NBF A;  5FK9 C;  1Y8O B;  1GOZ A;  2Z4I A;  3TS0 A;  2B2Y C;  1LM0 A;  5IP7 H;  4KI0 A;  2VB3 X;  4DAV A;  1ZYR C;  4GKJ L;  4OX9 L;  2A69 D;  1VS0 A;  1ENC A;  3LWU A;  2D62 A;  1B44 D;  1JWM D;  4F88 A;  3NWT A;  3UE1 A;  1YBY A;  1S5E D;  5CV9 A;  1DCZ A;  2EJG C;  4A3J G;  1WTR A;  4M1U B;  3S16 H;  1M4V A;  1PV4 A;  2EJM A;  4YY3 L;  4G57 A;  1HQM C;  3GD7 A;  1L2F A;  3I72 A;  2MFI A;  1SND A;  2VQE Q;  4G7H C;  4DU9 A;  1HR0 W;  4AIM A;  2LFN A;  2VY3 A;  5CBA E;  3J81 i;  2F0S A;  1HNZ L;  1EYC A;  3PIP 3;  1GKH A;  3PMF A;  1PYB A;  2E2J B;  2EY1 A;  4DAY A;  4OWW B;  1JJG A;  5F2D A;  2WB1 E;  4JI4 L;  3TZD A;  2QKI C;  4F8M A;  1A3V A;  2F0I A;  1F77 A;  1EY4 A;  1QOH A;  3CPF A;  2UXD L;  1I3Q H;  1JE4 A;  1Z7T A;  4DR2 L;  2D5D A;  4DUY Q;  1E2V A;  3UDX A;  1DJR D;  1F9S A;  1XNR L;  1TWG H;  2JA7 G;  4KKS A;  3OWF A;  2JK8 A;  2XWJ B;  4DV2 L;  5K36 H;  4IPD A;  1II3 A;  4A4I A;  1QUQ A;  1VQ4 A;  4QY7 A;  4OIK A;  1NE3 A;  1ZXT A;  4HJA A;  1JOR A;  2Q8R E;  3L9A X;  3VYS A;  2KEE A;  1UAP A;  5C0X I;  1VQH A;  1FYC A;  3V2T A;  2IX1 A;  2MNA A;  4X64 L;  4DV1 L;  2JA6 G;  1XYI A;  4IN3 A;  4C3H B;  1EYD A;  1PH4 A;  1XTC D;  1O80 A;  1IZ6 A;  2PZW A;  4MTK A;  2NWG A;  4A3C G;  1QG7 A;  2B63 H;  2V4D A;  2H5X A;  1JJ2 A;  1TWH H;  2D2C C;  1BKB A;  4A3F G;  2CWP A;  3KYH C;  1FJG L;  4GKJ Q;  4OX9 Q;  3HOU G;  4LF4 L;  3I8Z A;  3MXN A;  3EFX D;  2J7Z A;  3VR4 A;  4V0B A;  3HKZ B;  3R93 A;  3ULL A;  5M5Y H;  1CA6 A;  3GTM H;  4JYA L;  1YNN D;  2JSO A;  1LUZ A;  3NUC A;  3Q6S A;  3BJU A;  4QUF A;  2GA4 B; 
#chains in the Genus database with same CATH homology
 2NVT B;  3WOF A;  3I73 A;  1B9N A;  4ME5 A;  4IFD I;  1A3T A;  5IGC A;  1DD2 A;  1QIL A;  1WTO A;  3BDL A;  3H94 A;  3GO5 A;  3M3Y B;  1ET6 A;  4QUC A;  1U4M A;  3MXU A;  2KCN A;  3S9W A;  4C3I B;  3T4A C;  3KLR A;  2RDF A;  2F0V A;  1IW7 C;  1SYG A;  2B2T A;  4DA2 A;  1H9R A;  3S2H B;  2N55 A;  3RUZ A;  1STY A;  3GTP B;  1GUW A;  3S14 B;  1EYA A;  2MGS A;  4K8J A;  2PQE A;  3I91 A;  3AU7 A;  5ELC A;  4IQZ A;  2JA8 B;  3CQZ B;  3I90 A;  3I4M B;  4C56 C;  3K5N A;  3M7G A;  5M3F B;  5LL6 X;  3TP6 A;  4KJO A;  1K83 B;  2JEB I;  5JJZ A;  1EEI D;  1D5M C;  3H6M A;  4CKE A;  2EYJ A;  1JR0 D;  3A56 A;  3VYT A;  4N9T A;  2VB2 X;  4ULL A;  5EPK A;  2XRQ D;  4L8J A;  3J81 E;  1PRT D;  5JVG 3;  2K01 A;  4CHT B;  1Y8N B;  3RZD B;  2L4N A;  5D14 A;  1PMR A;  1F9P A;  1BF4 A;  2EYP A;  5EJW A;  2M9V A;  4HCS A;  1V1P B;  1F9Q A;  2SEB D;  5I6Y A;  2MUY A;  1ZEQ X;  3S17 B;  1AP0 A;  2K7V A;  1WTW A;  4XT3 B;  2F0D A;  2WAC A;  1R4Q B;  3QJY A;  3DM1 A;  1SE4 A;  4KD4 A;  1DOK A;  2MP1 A;  3PUV A;  1FGB D;  2EDG A;  4K5V A;  3D3R A;  3WDN A;  2XNA C;  3K58 A;  3D8G A;  1PFM A;  3SR1 A;  5C6A A;  1EIH A;  5FO8 B;  2ENB A;  1ONL A;  2IL8 A;  2X69 A;  4H0L C;  1KLU D;  1B9M A;  1L0Y B;  4AYB B;  2E2I B;  2RA4 A;  5IGE A;  5C5M A;  4ODG A;  1KAB A;  1HCZ A;  3H91 A;  5C3X A;  3VA5 A;  5E3F A;  3W3A A;  2IT1 A;  4RHR A;  3MEH A;  3JAM L;  4X3K A;  1PZI D;  1YNJ D;  4R8N A;  4I7Z C;  2QIL A;  1BOS A;  1ZKO A;  3H0G B;  2R7Z B;  2PMZ B;  4RHS A;  1PRT F;  1F2Z A;  5IGD A;  1D6E C;  1A6X A;  4F87 A;  5LL6 S;  1BBX C;  3VR5 A;  4ABN A;  3TDQ A;  2JE6 I;  3P1H A;  1R9T B;  3P20 A;  1STG A;  3T51 B;  2C5C A;  3RMH A;  4RWS C;  3HZX A;  1CHQ D;  3K57 A;  3BVZ A;  1CZW A;  1JCK B;  3L7Z C;  3FKI B;  1I4R A;  1SYF A;  1EY8 A;  1HHV A;  5ELF A;  1HRJ A;  4IUT A;  1BDO A;  4ZAI A;  5HGT A;  1CI3 M;  1EY6 A;  1UUP A;  2K5W A;  2A73 B;  5KGU A;  3PIO 3;  5ELE A;  1S5F D;  5JEA G;  4HED A;  2R93 B;  1SNO A;  1PFB A;  5IGG A;  3TZU A;  1SSO A;  2L55 A;  2A68 C;  1H9M A;  2N88 A;  3CRK C;  2IW3 A;  2X6L A;  1RTO A;  1SYE A;  3C2P A;  4RGT A;  5CV6 A;  2XIW A;  5DM7 3;  4FF2 A;  5M5X B;  3TME A;  4R9W A;  2R6G A;  1Y1V B;  2ICE C;  3OMC A;  3GTQ B;  4C3J B;  1CM9 A;  4EQO A;  2WKD A;  1QJO A;  3HG9 A;  2L11 A;  4PNY A;  3I3C A;  1U9R A;  1KDB A;  1IHZ A;  3TP7 A;  4I65 A;  2L0C A;  4F7X A;  1KDA A;  1MSG A;  2RDG A;  2RSN A;  4A3E B;  4JBW A;  1UNS A;  1LV9 A;  4RH6 A;  3NTH A;  1GUT A;  4X3S A;  2RQX A;  1E2Z A;  3H09 A;  5I9O A;  5E4W C;  3OW7 A;  4DGZ A;  1F9R A;  4KK7 A;  4RAU C;  2WB1 B;  2EXZ A;  1OXX K;  4PV1 C;  5CMD A;  3VYU A;  2IWH A;  3LNN A;  1EL0 A;  3VR6 A;  2PW7 A;  2SNM A;  4N9P A;  4UDU C;  1JOQ A;  1SE3 A;  1H9S A;  5BN5 A;  3M85 A;  1SMY D;  2NVQ B;  3A7A B;  1PZK D;  1U4P A;  4Y7N B;  1DON A;  1SNQ A;  4XYO A;  1VF5 C;  2KCC A;  2NN6 H;  5ISR A;  3NE5 B;  3BG3 A;  3CHB D;  5I2X A;  1JB3 A;  3EVQ A;  2B2W A;  2PCF B;  4BA1 I;  1ZYR D;  5M5W B;  5CV4 A;  5C3E B;  5C4X B;  2J4X A;  5EKL A;  2B2U A;  1V43 A;  1WD1 A;  3BDC A;  4CGY B;  1OXU A;  1AZQ A;  3GTK B;  2F4I A;  2A6E D;  5EPL A;  4HMI A;  3QOJ A;  2L12 A;  2OXP A;  1HUM A;  3K7A B;  1LTA D;  4QF4 A;  4H13 C;  1I4P A;  5EPJ A;  4IFD G;  1CQV A;  1GUO A;  5C4H A;  5D65 A;  3KF8 A;  3T53 B;  3SK6 A;  4RA8 A;  5KYL A;  1VDZ A;  4K6L A;  4QIW B;  3OHX C;  4MIU A;  4C2M B;  2F03 A;  4Z9C B;  4C1N K;  4PMC A;  3E0J A;  2WKC A;  1E2W A;  4ILW A;  2EYL A;  2HUG A;  2JA5 B;  1ESR A;  5J39 A;  1G91 A;  1KLG D;  5KNB A;  5C4Z A;  3K5M A;  3TSS A;  1GUN A;  2B39 A;  2QCP X;  4ZRZ A;  4TSS A;  3E5S A;  3Q24 A;  4M8A A;  5G3L D;  3OPO A;  3ITP A;  3R3O A;  4NP5 A;  1WTV A;  1NR4 A;  3OOC A;  2F0K A;  2F0N A;  1BQQ T;  3DEO A;  1HPC A;  5E4X A;  3GV6 A;  4KY5 A;  2A74 C;  5COY A;  2EYF A;  1LT5 D;  2ZXO A;  1RHP A;  4HMJ A;  4FNF A;  2K32 A;  5FLX E;  3KLS X;  4KHV A;  3E6Z X;  4ZUJ A;  4G7O C;  2PW5 A;  2X6G A;  2K5D A;  3M7N A;  1JC7 A;  1IW7 D;  1JOK A;  3RD4 A;  1K8M A;  5CR3 A;  2PO4 A;  1BR9 A;  4FF4 A;  2F0Q A;  4G7Z C;  1CZG A;  1CQF A;  3MHB A;  4FF3 A;  4RCO A;  1F2L A;  1F2Y A;  3J7A V;  2EPB A;  2YYZ A;  5KIX A;  3G7L A;  4ZQ3 A;  5JVH 3;  3UI2 A;  1G29 1;  5D3D A;  3S1R B;  1TVX A;  1J9O A;  3MVV A;  4BA2 I;  2NVX B;  2SOB A;  3V05 A;  4FXD A;  1STH A;  4C3J G;  1EY7 A;  4MHE A;  1GJX A;  2IPK D;  2B2V A;  5G3L F;  1C8C A;  1VMC A;  3H3V C;  4A3D B;  4O42 A;  1PRT B;  1W6J A;  4C1N I;  2A69 C;  2FHT A;  1SNM A;  1STN A;  3V96 A;  1NCV A;  3GP7 A;  2AUJ D;  2KUM A;  3OMG A;  5JOB A;  1KDC A;  5D3I B;  4ZK9 B;  1SE2 A;  1A3U A;  2Z8L A;  3J80 L;  2WP8 J;  2KA7 A;  2K33 A;  4XQJ A;  3K5O A;  1XXG A;  3OIQ A;  3T13 A;  3IFD A;  4BS9 A;  4FXG C;  1I4X A;  1PTO C;  4EQP A;  1RJT A;  2NB0 A;  2D9U A;  1DM0 B;  4RKL A;  2EJF C;  2KVM A;  2ZT9 C;  3FEW X;  1SNC A;  3LWE A;  2BOS A;  3NTI A;  3ONA B;  5J1Z A;  2PYK A;  2EOT A;  3CRL C;  4CJ0 B;  3SK5 A;  4TQU S;  2AUK A;  1QWY A;  4J6H A;  1WTQ A;  3X3N A;  2E76 C;  3X3M A;  1A15 A;  1RTN A;  1NAP A;  4FXK C;  4J1M A;  3SDZ A;  4K14 A;  3P7J A;  3I4N B;  3I4L A;  2AQ3 B;  2O5I C;  2K6A A;  3QO2 A;  1ENA A;  2NUC A;  2BDO A;  3HOY B;  4RGM A;  3R8B A;  2H4O A;  4RCN A;  4E6I A;  3HOX B;  2K05 A;  1YNN C;  2AQ2 B;  3U9O A;  1Z6H A;  1H9K A;  2NTT A;  4BBR B;  1FR3 A;  2E2H B;  1EY0 A;  1SJE D;  2BA1 A;  3PO3 B;  3KBG A;  2VNU D;  4UAI A;  3HOV B;  1LTB D;  1SAP A;  1QCB D;  2WAQ B;  3NWS A;  3NBI A;  3MWY W;  1TS5 A;  1B53 A;  4CBV A;  5T1G A;  2K5Q A;  5KRU A;  2F3V A;  2XVS A;  2EVB A;  1SYB A;  2NN6 I;  5KND A;  3N6R A;  3PUW A;  1SJH D;  1JIC A;  3FDT A;  1DZ1 A;  2ZXP A;  1EU4 A;  3BVG A;  1HQR D;  2B2Y A;  4O1N A;  4LJZ C;  2OF1 A;  5IGB A;  2Q8I B;  4KN4 C;  4V19 0;  2CQA A;  1PDQ A;  4IUV A;  3KLS A;  2Z1C A;  1M8A A;  3SK4 A;  4R8I A;  1Q12 A;  3FPP A;  3HS0 C;  2QEJ C;  2FMC A;  5ELB A;  4BWG B;  5BN3 A;  4HAE A;  3K59 A;  2LY7 A;  2DY7 A;  2YU9 B;  1WTP A;  1LT6 D;  1XX8 A;  3BDO A;  3NK9 A;  4WOR A;  3GTO B;  3CU7 A;  3QOL A;  1FNV A;  2BE5 C;  1BCP D;  2RKS A;  4A93 B;  4JK1 C;  3BZD B;  3KUP A;  5IIF A;  4S3S A;  4EGV A;  3AMU A;  1TWC B;  4K8I A;  1CTM A;  1G6Z A;  1LTG D;  4K2K A;  2WII B;  3KBX A;  3J7Y W;  2O2L D;  3J80 E;  4OO1 H;  2KHS A;  1X32 A;  1SNP A;  3VR3 A;  1SYC A;  4G4K A;  1O78 A;  3PO2 B;  1C48 A;  4IUP A;  3T56 B;  2KJX A;  2Y0S B;  3PUX A;  2K1B A;  3S15 B;  4K2L A;  5I6W A;  1QB5 D;  3NBH A;  1YNJ C;  2F0U A;  2DNC A;  4DAP A;  4A3B B;  2QDB A;  2F0L A;  1TS4 A;  3L3O C;  3QWN A;  1E0B A;  4ZKC B;  4KJN A;  3Q23 A;  3HGB A;  1TS2 A;  1Q1B A;  1Z47 A;  1CFM A;  5CV7 A;  1JQY D;  1STA A;  4GZY C;  4MN3 A;  1W6K A;  4OL7 A;  5C44 B;  1BNZ A;  5HUR A;  2SDF A;  2FFK B;  4DN4 M;  1LTI D;  4KTA A;  4IUR A;  4XIG S;  1NR2 A;  2O5J C;  1STE A;  4RFB A;  5EKK A;  2HDM A;  3HEJ A;  4HSP A;  2M00 A;  4Q0F A;  5CBE E;  1DYQ A;  2EE1 A;  1BCP F;  1HFG A;  3GTJ B;  3HRZ C;  3NSW A;  4KD3 A;  4CJ1 B;  2XSC A;  2AQ1 B;  1OXS C;  2F0J A;  2A6H D;  4KY6 A;  2XWB B;  2B2T C;  1GHK A;  2JXM B;  4DNR B;  3VR2 A;  1G2S A;  5JPN C;  1Y69 U;  2PNR C;  3URY A;  3RZO B;  4DFA A;  5COR A;  3JAM E;  5TSS A;  1NUC A;  1TII D;  2B8F A;  3F2U A;  2MJ8 A;  2OEO A;  2CHB D;  5A2Q L;  2IX3 A;  5C0X G;  3ND8 A;  1UEA B;  2CW0 C;  4PMB A;  2WIN B;  1QE6 A;  4QCL A;  2OT2 A;  3DEP A;  5IT9 L;  1Q90 A;  5C3W A;  1KNA A;  3IL8 A;  3D31 A;  3S1M B;  1KTK A;  1EZ8 A;  3S16 B;  1JWS D;  1CA5 A;  4OHJ A;  4FYD A;  4B08 A;  3C1F A;  4PMW A;  2BCO A;  5E1F A;  2F0T A;  1B4O A;  1FNW A;  5JAV A;  1HA6 A;  3A8J E;  1ICW A;  1Y8P B;  3ND9 A;  1TKW B;  5CC4 A;  3A54 A;  3FMC A;  4LK1 C;  1ML0 D;  3Q22 A;  3U9S A;  1I3Q B;  1LO5 D;  1B3A A;  1ESF A;  2ICI A;  1TWG B;  5FO9 B;  1EY5 A;  2RSO A;  3I70 A;  5EKI A;  2AWN A;  1GUG A;  4ID6 A;  2AWO A;  2F0W A;  2IJ0 A;  2BA0 A;  3A8K E;  1KNE A;  1IYU A;  5DAU A;  4FF1 A;  5CYU A;  4WFN 3;  2H1E A;  2F1M A;  3MXP A;  3CKI B;  4IAL A;  5KEE A;  1RF2 D;  3ERO A;  1L0X B;  2B63 B;  4QMG A;  4HN7 A;  1TR5 A;  2FMM A;  3FVQ A;  1TWH B;  3N52 A;  3OSO A;  1TS3 A;  4OGQ C;  3MTS A;  1H9S B;  1J8I A;  4DXG A;  5I9P A;  5M5Y B;  3GTM B;  3OWE B;  3NXW A;  4KMU C;  1WVL A;  1WTX A;  2EYH A;  2K28 A;  1U4R A;  2I46 A;  1V1O A;  2PPB C;  2MPM A;  4RKB A;  4KHZ A;  2A6E C;  2KOL A;  4X3T A;  1OO9 B;  3R2I A;  1MBY A;  4DK0 A;  1PTO D;  1I4H A;  2RDH A;  3J7A F;  4J8Q A;  3O13 A;  5IOD A;  1RDP D;  4B9W A;  3GTG B;  1V1P A;  1ENF A;  2HCI A;  5A35 A;  3FRP B;  4DK1 A;  4KY7 A;  1SFO B;  1PTO H;  2NZ1 D;  2PZT A;  3NP8 A;  2JP1 A;  1DOL A;  1LT4 D;  1MGS A;  1EWH A;  1S5C D;  3TP5 A;  3ERQ A;  1WCM B;  1T5X D;  1C4Q A;  3MFG A;  2L1B A;  5EGT A;  2B8G A;  1MI2 A;  2LS0 1;  1RKN A;  3MC0 B;  3TBI B;  5EBC A;  3SE0 A;  3M4O B;  1D5X C;  1TQO A;  4XXE A;  2PZU A;  5ELD A;  4HCE A;  4HTH A;  2E75 C;  2NN6 G;  1B50 A;  1LAB A;  1O7Y A;  1OXT A;  1TWF B;  1D2B A;  2QF7 A;  2XRS D;  1Q8I A;  2F0F A;  4ZKB B;  3NQI A;  5A2Q E;  3C46 A;  1NSN S;  1PXU A;  4DXF A;  4EVO A;  4CKB A;  5M3M B;  4OIJ A;  2WV6 D;  2ID0 A;  5C5L A;  4H44 C;  5I2Y A;  5IT9 E;  1OXV A;  1STB A;  3MXG A;  4HSV A;  4HR7 B;  4OO1 I;  5JEA H;  2E2D C;  3DUZ A;  1EQV A;  1PTO F;  1AFP A;  3NHH A;  1LAC A;  3DXJ C;  2F0G A;  2FJ2 A;  3AB9 A;  1CT1 D;  3DWQ A;  1TT2 A;  2IX0 A;  3G6J B;  4YIJ A;  4A3K B;  1X3P A;  5CV8 A;  2EYO A;  3P75 A;  1HUN A;  3QB3 A;  1Q3L A;  4CJ2 C;  3GTL B;  3C1E A;  2LKV A;  5J22 A;  1JOO A;  2NVY B;  2R92 B;  3C3L A;  4KN7 C;  2FIN B;  2M2L A;  5KNC A;  3GQB A;  4WRD A;  1D5Z C;  2SNS A;  5CGK A;  1FD7 D;  1JWU D;  5FKA C;  2F0O A;  2B2W C;  4Q5V A;  2R61 A;  3MFY A;  3D6C A;  2DNE A;  3KK7 A;  2J0T D;  2KED A;  2B2U C;  2TMP A;  2BE5 D;  3IKJ A;  1AN8 A;  4K5X A;  1WD0 A;  4DF7 A;  3S1Q B;  1DXM A;  1SXT A;  1ILQ A;  1LLR D;  3EQL C;  5JEA J;  3VYR A;  3K6O A;  4IUN A;  2R3Z A;  1Q1E A;  4U68 A;  1PZJ D;  1F2M A;  4TKO B;  4KKT A;  1ET9 A;  3IAY A;  2E74 C;  1I6H B;  1X3Q A;  2EY2 A;  2A68 D;  3BYY B;  3NQT A;  1BUV T;  1U4L A;  3QIA A;  1DOM A;  5DM6 3;  4CKC A;  5K36 G;  2HQE A;  4XYQ A;  4ZUI A;  1BCP B;  1BXT A;  4RGN A;  2G9D A;  2NTS A;  4B9X A;  1QNU A;  1EY9 A;  1IKL A;  2JYO A;  1PRT C;  4XT1 B;  3DWP A;  1O7L A;  3DWA A;  5I4D A;  2Q8T A;  2DY8 A;  3WOE A;  2TSS A;  3SEB A;  3HOW B;  4A3G B;  1AEX A;  5C0X H;  2EY5 A;  1RD9 D;  4KV6 A;  2F0M A;  3T16 A;  5T1I A;  3SVM A;  1HTP A;  2A5H A;  5EBD A;  5NUC A;  2HCC A;  1D1I A;  2ZXR A;  1D1K A;  5IOC A;  1TY0 A;  4IUU A;  4RGO S;  3M4Y A;  1G8Z D;  4A3J B;  1SBB B;  3W2D A;  1LTS D;  1ROD A;  1FNU A;  2NYZ D;  4IFD H;  2XN9 C;  1IKM A;  5FO7 B;  3S1N B;  3SHL A;  3BS1 A;  4L63 B;  3D4W A;  3ZYY X;  2EY6 A;  4NDX A;  2CVR A;  3MA2 B;  3BVM A;  4EQN A;  1HFN A;  1LT3 D;  4WJW A;  3MAQ A;  4X3U A;  1I6V C;  1TWA B;  2DN8 A;  3DHQ A;  1T5E A;  2JA7 B;  4DNT B;  2C9O A;  4L6T B;  1Y1W B;  1EEF D;  3RLF A;  3D4R A;  1A2T A;  2RVL A;  1VF7 A;  1S5B D;  2O4X A;  4C3H G;  1QNK A;  1S4Z A;  5EQ0 A;  1EFI D;  2JA6 B;  2K04 A;  3PUY A;  4ZLT F;  5C0X J;  3NTK A;  4FO2 A;  1GUS A;  2CW0 D;  3S2D B;  3R2T A;  2KEC A;  5M9O A;  3BYT B;  4P2C B;  4A3F B;  3HOU B;  4NKL A;  5FLX L;  2G9H D;  5IGF A;  2L9H A;  1VMP A;  1CK1 A;  1MD2 D;  1I4G A;  1LTR D;  4H7B A;  2MHV A;  2F0H A;  2B2V C;  3A55 A;  1SYD A;  3MZ5 A;  1B2T A;  4TRD A;  2JEA I;  3IFT A;  1EZ6 A;  4NW2 A;  1KAA A;  1RCV D;  2EYM A;  1S5D D;  4IFD J;  4C3I G;  3PUZ A;  1HTL D;  1I4Q A;  3K5L A;  2L5T A;  1V8Q A;  3EJI A;  5BN4 A;  1K8O A;  1XWE A;  3LX0 A;  1EOT A;  4XQN A;  1BCP C;  1GXD C;  4A3M B;  2F3W A;  5KYI A;  2EZV A;  4LMQ D;  4PQX A;  3FPU B;  5AFW A;  4XQQ A;  3TP8 A;  4FVM A;  2HDL A;  3EA6 A;  3DMU A;  4IZ8 A;  1H9J A;  4IUQ A;  3TN2 A;  4NMZ A;  1PLF A;  2BDN A;  2VUM B;  2I07 B;  3SXH A;  4K5W A;  5JPM C;  1TU2 B;  3QG1 A;  1PFN A;  4BBS B;  3Q0A A;  5DNF A;  2RBM A;  4XTC S;  1B1Z A;  1SDF A;  1HXY D;  1IYV A;  1O7Z A;  3HP3 A;  5C4J B;  4LAA A;  1SEB D;  4K6D A;  1EQT A;  4BY7 B;  3HOZ B;  2F0E A;  1PYW D;  1EU3 A;  1ILP A;  1HA5 A;  1A2U A;  2KQ3 A;  1BO0 A;  1R4P B;  3K0Y A;  1TY2 A;  2K03 A;  1G2T A;  1I50 B;  4XDX A;  5FOB B;  4FP5 D;  4QB4 A;  2F0P A;  3D4D A;  3GV3 A;  1EIG A;  1AW7 A;  1MSH A;  4KKU A;  3PV0 A;  4A3I B;  4BY1 B;  3J81 L;  2VXW A;  2Z4H A;  1EWC A;  5K5P A;  3NPP A;  2A6H C;  5LHY 1;  4OO1 G;  3A8I E;  5DEH A;  1CHP D;  4ZYS A;  1VCI A;  1AZP A;  1SMY C;  3OIP A;  4U67 3;  1PTO B;  1GHJ A;  3VA7 A;  3D6W A;  1IL8 A;  5CV5 A;  2LMC B;  3A7L A;  3SK8 A;  2NBF A;  5FK9 C;  1Y8O B;  1GOZ A;  2Z4I A;  2B2Y C;  4KI0 A;  2VB3 X;  4DAV A;  1ZYR C;  2A69 D;  1ENC A;  3LWU A;  2D62 A;  1B44 D;  1JWM D;  4F88 A;  3NWT A;  1S5E D;  5CV9 A;  1DCZ A;  2EJG C;  1WTR A;  4M1U B;  1M4V A;  2EJM A;  4G57 A;  1HQM C;  3GD7 A;  3I72 A;  1SND A;  4G7H C;  4DU9 A;  2LFN A;  5CBA E;  2F0S A;  1EYC A;  3PIP 3;  3PMF A;  2E2J B;  2EY1 A;  4DAY A;  5F2D A;  3TZD A;  2QKI C;  4F8M A;  1A3V A;  2F0I A;  1F77 A;  1EY4 A;  1QOH A;  1JE4 A;  1Z7T A;  2D5D A;  1E2V A;  1DJR D;  1F9S A;  4KKS A;  3OWF A;  2XWJ B;  5K36 H;  1II3 A;  4OIK A;  1ZXT A;  1JOR A;  2Q8R E;  3L9A X;  3VYS A;  2KEE A;  1UAP A;  5C0X I;  1FYC A;  3V2T A;  2IX1 A;  1XYI A;  4IN3 A;  4C3H B;  1EYD A;  1XTC D;  1O80 A;  2PZW A;  2NWG A;  1QG7 A;  2V4D A;  2D2C C;  3I8Z A;  3MXN A;  3EFX D;  2J7Z A;  3VR4 A;  4V0B A;  3HKZ B;  3R93 A;  1CA6 A;  1YNN D;  2JSO A;  3NUC A;  3Q6S A;  1LTT D;  4QUF A;  2GA4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...