1C8M3

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
molecule tags Virus
total genus 35
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m300
3TN93 3ZFEA 4CDXA 1AR91 2WZR2 1PIV3 5AC93 2PLV2 4YVWB 1C8M3 5JZGA 4N43A 5C4WC 1F2NA 2BFUS 4JGYA 2RR11 1Z7S2 2WFF1 1R082 1RUD1 4YVSB 5C9AB 3JB8A 3VBHA 1VBB2 3CJIC 1GFF2 5BNPC 1RUI3 1VRH1 4GB32 2HWC3 4GH4C 4Q4Y1 1POV0 3VBRA 4CDWA 1BEV2 4JGZC 2MEV3 1HQNA 2GH8A 3J8F3 4CDUA 1AR62 1MEC2 1AUYA 1E57A 2RS31 3NAPA 3ZFFA 1HX6A 1NA1C 2TBVA 1V9U3 1VBE3 1H8TA 1NY71 5BNNB 4CEWB 1CD3G 4IV1C 3JBG3 1PO21 5FMOS 1AYM1 1EV11 4QPIB 1D4M3 1NCQA 4Q4V3 1TMF1 1QJX1 3VBOB 2R062 2VQ0A 3VDDA 1VAKA 1PGL2 1COV1 1ZBE3 4GMP3 1RUC2 4RR3A 3ZFGB 2RS12 4AEDC 5D8AA 5DDJ3 3VBFC 4CEYB 1QJY3 5ABJB 1C8NA 5ACA3 1PO12 3ZFEC 4CDXC 4NWVA 1TME3 2WS92 1RMU1 4EJRA 2QQPA 5JZGC 1F8VA 4N43C 4YVSA 4JGYC 1NCRB 3VBHC 1FPN1 1RUF3 2R061 1FMD1 1R1A2 4QPGA 1ZBA3 1MQTA 4CDWC 4FSJA 4N53A 2HWB3 3TN91 4Q4X1 4CDUC 1PIV1 2HWF2 5AC91 1VB2A 1RUH2 1C8M1 3NAPC 5C8CB 1EAH2 3VBUB 4CEWA 1H8TC 1RUE3 1AR72 1RUI1 1K5MB 1AR92 1QJU3 2HWC1 4IV3B 1PVC2 3VBOA 1NCQC 2MEV1 4LLFA 4GB33 3VDDC 2RR12 3M8LA 2WLPA 2WFF2 3JD73 4FTEA 3J8F1 1RUD2 4RR3C 1VBD3 5D8AC 1RUH1 1VRH2 1V9U1 1AR83 4Q4Y2 1VBE1 2HWE3 2RM23 2X5IB 1POV3 4Z92B 1RVF3 2HWD3 3FBMA 4WM8B 3JBG1 2RS32 1D4M1 1PVC1 4Q4V1 1QQP3 3S6PA 5K0UB 4QPGC 1ZBE1 4GMP1 1NY72 1MQTC 1ND2B 2XBO3 1PO22 1QJY1 4N53C 1FOD3 1AYM2 1EV12 2WWSA 1RUG3 1RUJ3 1TMF2 1QJX2 4Y5Z0 5C8CA 1COV2 1PO13 4CDQB 4RQPA 1PGW1 1AL23 4CEWC 2WS93 2R043 1VBA3 1RUF1 4PDWA 1HRV2 5CFCC 3VBSB 4IV3A 5A32A 1BBT3 3VBOC 1RMU2 5C4WB 5FOJB 3CJIB 1ND3B 1OOPA 2RS53 1FPN2 2GSYA 5FMOL 2XPJA 1FMD2 1VBC2 2X5IA 4JGZB 4RHV1 5CFDB 5L7OA 1RUE1 1HXS3 4WM7B 1HRI3 3TN92 4Q4X2 1QJU1 1HRV1 4Q4W3 1M06G 1PIV2 2IZWA 5AC92 1NA1B 4YVWA 1C8M2 1X33A 1OHFA 3JD71 1ASJ3 5C9AA 3LOBA 2R073 5J98B 4IV1B 2ZZQA 1VBD1 1RUI2 1A6CA 2HWC2 1AR81 1AYN1 2HWE1 1RHI3 1VBC1 2RM21 1POV1 2RMU3 2MEV2 3VBRC 4FTBA 2HWD1 1R091 5C8CC 3J8F2 5BNOB 1BMV1 3ZXAC 4RQPC 3VBFB 1QQP1 3HAGA 1V9U2 2Y26A 3ZFEB 3VBSA 4CDXB 1VBE2 4PDWC 3ZFFC 2WZR3 5BNNA 4IV3C 2PLV3 1NG0A 5JZGB 2XBO1 3DPRB 4JGYB 2BBVA 1Z7S3 3JBG2 1FOD1 1R083 2FZ2A 3CJIA 3VBHB 4QPIA 1ND3A 1D4M2 1RUG1 1RUJ1 1VBB3 4Q4V2 1OOPC 1ZBE2 5CFDA 1RB8G 4CDWB 1TMF3 1AL21 1WCDJ 3ZFGA 1BEV3 4WM7A 5L7OC 5DDJ2 4CEYA 2R041 1VB4A 1QJY2 5ABJA 4CDUB 1AR63 1MEC3 1BBT1 3NAPB 4YVWC 1PGW2 1NCRA 4YVSC 5C9AC 2RS51 1RUF2 4RS5B 1ZBA2 1QJZA 1AL0G 1NCQB 2R063 3VDDB 1HXS1 1HRI1 2BFUL 5DDJ1 1W39A 5BNOA 5ACA1 4Q4W1 1RUC3 4RR3B 2BPA2 2RS13 5D8AB 1TME1 4Q4X3 3VBUA 3VBSC 4RHV2 1B35B 1ASJ1 1RUE2 5BNNC 2R071 4SBVA 3DPRA 1K5MA 1QJU2 1ZBA1 1RHI1 4QPIC 1ND3C 2RMU1 5A33B 4QPGB 1R1A3 1DDLA 3JD72 1MQTB 2HWB1 5CFDC 5BNPB 2BUKA 3ZFGC 1VBD2 4N53B 4WM7C 4RFT0 4CEYC 4GH4B 1AR82 1AYN2 5ABJC 2HWE2 2WZR1 2HWF3 2RM22 2PLV1 1RVF2 1RUH3 2HWD2 1R092 2DF7A 1EAH3 4WM8A 1Z7S1 1BMV2 1R081 1NCRC 1VBB1 1AR73 1QQP2 5K0UA 4RS5A 5CFCB 1AR93 4GB31 3JB4C 1PVC3 1ND2A 1NOVA 1BEV1 2XBO2 2RR13 4BCUA 2WFF3 1FOD2 1RUD3 1CJDA 1AR61 5BNOC 1MEC1 1RUG2 5LK7B 1RUJ2 5GKAC 1RVF1 1VRH3 2ZAHA 4Q4Y3 4CDQA 1B35A 1AL22 3VBUC 4AEDB 2R042 1VBA2 3DPRC 1K5MC 1BBT2 2RS33 4FTSA 5C4WA 5A33A 4GMP0 1PGL1 4N43B 5J96B 1RUC1 5BNPA 2RS11 3IDEA 1OPOA 2RS52 4GH4A 1PO23 2ZTNA 1AYM3 1EV13 1PO11 4JGZA 1SMVA 3VBRB 1QJX3 2X5IC 1HXS2 2WS91 1HRI2 1COV3 1VBA1 4RQPB 4RHV3 5ACA2 4WM8C 4Q4W2 1NA1A 5CFCA 1TME2 4PDWB 3ZFFB 1HRV3 5K0UC 1R1A1 4RS5C 5A32B 1IHMA 1H8TB 1ASJ2 2R072 1RMU3 4IV1A 1ND2C 1X36A 4Y4YA 1RHI2 2HWF1 1OOPB 2RMU2 1FPN3 1FMD3 1AYN3 1EAH1 2HWB2 1VBC3 4CDQC 4AEDA 5L7OB 1B35C 2FZ1A 3VBFA 1R093 1AR71 4NWWA
chains in the Genus database with same CATH superfamily
4AVCA 1ZRFA 2AC1A 1AR91 2JE9A 3NJVA 4XFCA 1MS8A 4CCKA 1GICA 4COZA 1WLCA 4AVTA 4AI3A 4KWJA 1DYPA 5F39A 5F32A 3WG3A 5T50A 4AEMA 3N9LA 1Z7S2 2ADDA 2WFF1 2XJVA 1RJ8A 5J1XA 4CTEA 3ZIWA 1UZWA 3FBYA 3JB8A 3VBHA 4ITCA 2UYAA 1VBB2 5F5AA 1RINA 1E5RA 4EYUA 5BNPC 1H9PA 4XAAA 2HH9A 2XVLA 1GMMA 1IKPA 1QEXA 2IXIA 2WNEA 3RI9A 1H6XA 3MW2A 3VBRA 4TWTA 2YBKA 1DGRA 3J7HA 2JWPA 3WNPA 2RHPA 4XTMA 2YHJA 2D93A 4QQHA 2B42B 4HT1T 3TEYA 2BWCA 3I4IA 5IVVA 1HV1A 3AB0A 4ZU5A 3MBWA 1GU3A 2RS31 1UAIA 5A7PA 1F35A 1BHGA 2KM2A 2YFZA 3FC0A 3QOPA 5A7NA 4GA9A 1HX6A 4QX0A 4K3UA 5CB7A 2VD7A 3GBGA 1SPPB 4LKDA 1JS9A 3A22A 1FATA 3SISA 1DF0A 2ZHKA 5L9VA 4HOOA 3DECA 4FXKB 4IQPA 1FAYA 4LUMA 1CWPA 3FHIB 2VBBA 5FMOS 3WCSA 4R9DA 4Q29A 4FO9A 3OGJA 2X09A 2VCMA 3I7DA 4KG8A 5LEKA 1CAUA 3VBOB 1QJX1 3AP9A 2DV9A 4FT8A 3VDDA 2R49A 1VAKA 4BQ1A 5JCTA 5JXHA 1HB3A 3THCA 1COV1 4BXSV 2VUJA 3KZ4C 3QACA 4GMP3 4DY3A 1S2BA 5A7OA 4WZCA 3PJQA 3USUA 5JOYA 4XXPA 2E32A 4I0AA 1J3RA 2EIDA 1SBEA 5KHKA 3QBQA 1QJY3 4HN0A 4DMIA 1PO12 5JR7B 3ZFEC 5KHGA 3C2UA 5IK8A 3IZOA 4OI0A 5JUVA 3AFKA 2QQPA 1VPHA 4J1XA 1URXA 5FY8A 1F8VA 3OEAA 3NWKA 4JGYC 4XDQA 4YG0A 4BOWA 1NCRB 3WNOA 3WG2A 3WR0A 1HW5A 5FY5A 2WZEA 5A3NA 1W8ZA 1RUF3 3THPA 1R1A2 1J1LA 3NW4A 5FMCA 1IS3A 4QDQA 5JSPA 2D6MA 4XETA 1V6MA 2HWB3 4QGMA 5BYNA 1PM4A 2VTFA 3TN91 1X8EA 4LBQA 1U5YA 4CDUC 1MS9A 1UPSA 1NKGA 3CL1A 5AC91 2BVBA 3ST7A 4ASMB 2D6KA 3UJOA 3VZNA 4CU8A 3R4UA 3MUZ1 3WCRA 3NAPC 4XUNA 4EWAA 5C8CB 4Z07A 3HMYA 2QQNA 5IVYA 3SQOA 5I91A 3URFA 1RUE3 3AP6A 3WUCA 1OPMA 1YNAA 3W9AA 1AR92 1QJU3 4Y1XA 2HWC1 2JDKA 4Y5SA 5I8YA 1HDKA 4IV3B 4XHXA 3VBOA 1LEDA 2A73B 5GZCA 4CCCA 5FZBA 1NCQC 3OBTA 1DGWX 1N1YA 2RG4A 4I30A 3ZYRA 5CADA 3GXUA 2E7AA 3M8LA 3LDKA 2WFF2 3D5OA 4FTEA 2OX0A 4QDSA 3WNLA 3U11A 4NPLA 4Y26A 3O1UA 4JCKA 4FAHA 1BQPA 1RUH1 3H1WA 3VKLA 1V9U1 1H4GA 3LIHA 1AR83 4XIKA 4A6OA 3PUIA 3ZXFA 4URTA 2VTXJ 2P6HA 2X5IB 1POV3 3MLKA 2VNOA 5E1RA 2HWD3 5FP4A 3KV9A 1WCKA 3AC0A 1MS0A 2XKOA 3BPSA 1X50A 2Y6GA 1LTEA 1VRBA 2VUDA 4WM8B 2JIGA 3RJRA 4CCEA 3DUIA 2RS32 2VVFA 1D4M1 5H9RA 1PVC1 5F5CA 1ZM1A 4J1WA 5K0UB 3H42B 5LCWL 1NQJA 3IM0A 4JAAA 2Q8CA 2JD4A 4YFWA 3BIEA 1NLSA 1Y9GA 1UY4A 3HR9A 2A6XA 4JRLA 4Q1RA 3ZN4A 1DQ4A 2VVDA 4ARXA 5EIYB 3ASIA 4QMAA 5FYBA 1W9TA 2VPVA 2XBO3 5T5JA 2HBTA 1DCSA 5C8WA 4N53C 4COWA 3NVCA 1KRIA 5ANNA 4LLOA 1S0FA 3VKOA 4Y20B 2DVGA 2WZ8A 1QJX2 4MXWA 5AVAA 1NAEA 4RL7A 5C8CA 2Q30A 1N1SA 2FHRA 1COV2 1S0BA 3O5SA 5EJ3A 5C5UA 1PNFA 5CEHA 3KV4A 1O8PA 4XUTA 5FZ6A 4QQOA 2XLFA 2P6CA 2ZKNA 1D2SA 1UXZA 4PDWA 1W6NB 4AVBA 5CFCC 4D7SA 3VBSB 4IV3A 5A32A 1Q8VA 3AZYA 1EY2A 1OH4A 2QVSB 2VOWA 4LBLA 5DG2A 3DF0A 2VXJA 1RJ7A 2VZPA 3N35A 5HXMA 2ORZA 2JG8A 3LDRA 4EV0A 1OD5A 1A3KA 4LQRA 1IS6A 4K40A 3C7OA 4NMIA 2H0BA 3WEZA 1D2QA 2GDFA 2DCZA 2VOKA 4CU7A 4IE0A 4ZU4A 1RIRA 3WG4A 4JKLA 3HWJA 1DYOA 2X5IA 4UW3A 1V6JA 4ES8A 1XYPA 3CU7A 3FJSA 3WNNA 5JOXA 2XJTA 5FWEA 5D1IA 1PZ9A 3POWA 1LECA 1VMHA 1S0CA 3K48A 2C9AA 3TN92 3S57A 4Y1VA 1HRV1 3KS7A 4XCAA 1RUOA 4FPLA 2A75A 5DZEA 5AC92 4JZRA 2CDOA 4YVWA 3WQ1A 1YYNA 4XABA 5IFTA 2OIIA 2WT1A 3KGLA 1MS3A 2VCBA 3BI3A 3ZKYA 1WGPA 2IUWA 1BXHA 5DAWA 5JMOA 3EB7A 1ZZCA 5J98B 3F2ZA 2ZZQA 1A78A 2K46A 2YFUA 2R0FA 1ZRDA 2A7AA 1Z78A 1XC6A 2HWC2 2K2SA 3TWIA 5KC5A 2WQZC 4JQTA 5E6HA 5GALA 1D0GA 5CKQA 5JPNB 4FTBA 1UMZA 4XF0A 4XJAA 3AJZA 3J26N 2BW8A 4PIYA 4H7MA 4XFHA 4RQPC 3LSDA 5FZGA 5EPAA 4YWAA 3J7LA 5EP9A 1JYIA 1QQP1 1W6NA 1UU5A 2GNDA 1V9U2 3ZFEB 4AVSA 3VBSA 3NQHA 3ZFFC 2WO1A 1K12A 1G86A 2WZR3 3OGRA 3VUOA 4HFSA 1QF3A 1LOEA 3DYMA 2WBKA 3WOGA 4G9SB 1CQ9A 3IN9A 3OTFA 1ZREA 5F1RA 4OFGA 4XIOA 4JGYB 5TSWA 3ZLIA 2BBVA 5JAXA 1VAVA 1Q8OA 1AZDA 3AYAA 5FP7A 4AGRA 1UPIA 3VKMA 2QCSB 2PFWA 1GYKA 4QPIA 4ASKA 1D4M2 1RUJ1 3ES1A 5FPLA 3HD8B 5LA9A 1MS1A 2EIEA 4QXHA 5IJRA 2UYBA 3OY8A 5FZDA 1UIKA 1BK1A 1S4CA 1W0NA 1K3IA 1YJKA 3KCXA 2WNVC 4XPVA 3TNQA 5A1AA 5IK7A 5J37A 1KDKA 3ZDSA 1AL21 5J09A 3POSA 4I0BA 5L7OC 1WLTA 2YMZA 2BV4A 2R041 3AXEA 1XYOA 4M3CB 5DDJ2 1GKBA 5FZFA 2ZGSA 3AVSA 4CDUB 1W99A 4B4PA 5CBLA 1AR63 3N7KA 5GJ6A 3UYJA 2JDPA 2E51A 2FDHA 1MZ5A 3NAPB 4MGQA 1W0PA 2EAKA 2ZGNA 1WW5A 3H9AA 3VHPA 4PQQA 3NV2A 1HN1A 2GC1A 1APNA 4AR2A 1W9SA 1UZZA 3HQUA 2G9ZA 5EJ1B 1DZQA 4YVSC 3RDIA 1BJQA 4ZY9A 4A41A 5C9AC 5JOWA 4NIIA 5K8SA 3BVCA 2Y0OA 3PVEA 3BOWA 3O1TA 1N47A 2EXKA 3I2HA 1G9BA 1XU2A 1ZBA2 4LBKA 4W6WA 5FYUA 3BCWA 2VUAA 1NCQB 3AM2A 3M3EA 4WV8A 4WVMA 3WQ7A 3UKVA 2VH9A 4ATEA 3THDA 4QXBA 3RZKA 4WVVA 1W28A 1VALA 4XBQA 1UY1A 4Y1YA 1JOJA 1HJGA 2EF6A 4Q4W1 3MF9A 3WP6A 1GZ9A 2WFPA 4NPMA 1YXWA 4FOVA 3LZZA 3I2JA 1TME1 4P5HA 2F17A 2B39A 1W8NA 1QOTA 1XE7A 3ACIA 5BNNC 1QY4A 3GNEA 4SBVA 1W9YA 4FQZA 4LA2A 1XB9A 1NXD1 4DS0A 1K5MA 4NROA 1CVNA 1RHI1 1QNWA 5FZLA 3ZYGA 4YZ5A 4M01A 2ZGRA 3AXDA 2RMU1 2VL4A 5A33B 1V6KA 2GNBA 2ZMNA 4Y5TA 3RYPA 2PTMA 3NJXA 4HG6B 3B9CA 5EJZB 3AMPA 5DAPA 3RG0A 3WF2A 4XYXA 2ES3A 5CFDC 2D3PA 3KHBA 4IGOA 4M3CA 4N53B 1YI9A 4Q0QA 3AL5A 3FWEA 1IQAA 3BU7A 3VD3A 3WF1A 1BKZA 2EIBA 5C5TA 1JZ3A 2HWF3 3N9NA 5FYMA 2PLV1 4FCAA 4PLOA 3AKQA 2JDMA 4R8HA 5FPZA 2ZJCA 3IKWA 1E5IA 1O3RA 4QB1A 2I45A 3R4SA 4COYA 1R081 5T52A 1LHWA 1SACA 2Z4FA 3VZLA 1AR73 1QQP2 1UMHA 5C3OA 2J1SA 3FZ3A 2G9FA 2ILMA 5CFCB 3AX4A 2KXLA 3O0VA 1KXGA 4GB31 4M4PA 3U14A 1X82A 1H1AA 4I0WB 4KG0A 1G9FA 1L3JA 1NOVA 1BEV1 1W9FA 2C6SA 1LHOA 2IXCA 4DOUA 3TEWA 3J7MA 4UAPA 4N9IA 3AVRA 2HYXA 3I3DA 1H1IA 1CJDA 3NKGA 4Q0SA 4Y4RA 5FZ9A 1ZZBA 2AENA 4QDRA 1RUJ2 4M0HA 1LGBA 2AUYA 2OXBA 3RZLA 4AHZA 1WA6X 3IT8A 2P2KA 2QQVA 1C5IA 2ZAHA 4CDQA 5FO8B 1QXPA 4PIXA 4KNCA 4GJYA 1AL22 3HQRA 3T30A 2Y6HA 3OSDA 1GNZA 1PGSA 2LROA 2R042 1VBA2 4HSJA 3DPRC 3N9MA 4QQ2A 4F8AA 3OEBA 3AJYA 2OVUA 3I3MA 4IE7A 1LULA 3OJBA 4NPRA 5A3OA 2HEWF 1GP4A 5A33A 2J1AA 4GMP0 4HK8A 3VL8A 4M4RA 4N43B 2VC9A 5CG8A 4AI9A 4YW2A 3ACFA 1SLTA 3B3QE 3NKTA 2LUWA 4H55A 2YG0A 2QJVA 1JMUB 3IDEA 1NT0A 4FPCA 2P4EA 4IE6A 4CP2A 4QPWA 5IK5A 1YFUA 2W1SA 3N9OA 1H2KA 1UOFA 3C3VA 1QXJA 4NIHA 3VDBA 4JGZA 1JODA 4MADA 5FK8A 1WCQA 1W6MA 2RDNA 1RL3A 1OKQA 2WS91 3H8UA 1XXNA 3ZXGA 5C70A 4RQPB 4RHV3 4Q4W2 4FQ4A 4HSLA 5B4NA 4HVRA 4ZXEA 3KGZA 3M4FA 1WW7A 1T6BX 2QBXA 4PBPA 5CFCA 1TME2 4QKDA 1W6OB 4GXLA 1ALYA 4K8FA 2V4AA 4OVEA 5GZEA 3ZFFB 3T4HB 1YQ8A 2XONA 4MXVA 4XXAA 4BMEA 3MUY1 4IV1A 1ND2C 2DTWA 3Q8BA 4D7YA 1YFWA 3AKRA 1I1EA 2XGXA 5J3UA 2YZ4A 3NNJA 5E8AA 1L7RA 1U0AA 5FREA 2QKDA 1RHI2 3T0DA 2A6ZA 2ZEYA 5FYIA 5F7UA 2RMU2 5FUPA 1EAH1 4BB3A 4NR1A 2R30A 5L7OB 1UY2A 4D69A 1B35C 1JZ2A 1TNRA 1SG3A 3KMHA 3T1MA 5A3PA 4QHBA 1P8JA 3EJKA 1Y4WA 3E97A 5FJHA 4CDXA 3LB9A 4NHXA 3AMHA 4ET7A 2AGSA 1PIV3 3J4UH 5FYCA 2PLV2 4JC1A 1C8M3 5JZGA 1KD7A 4MGSA 5HV0A 4N43A 2PHLA 1F2NA 5C4WC 2RR11 3IDAA 5F3EA 1R082 4YVSB 5C9AB 3MF6A 5DAXA 4LXLA 1LOGA 3MIBA 4GJZA 5HCFA 1GFF2 1RUI3 5DMYA 3VKNA 1SEFA 4GB32 2ZACA 5J36A 4GH4C 1G6NA 2A6WA 1POV0 2P3KA 2ZHLA 4FOWA 3TAYA 4EZHA 5A1FA 4CDWA 5IFPA 2RVAA 1BEV2 2MEV3 3KWVA 3O0WA 4Q0VA 3T08A 1IPSA 4W6YA 3ZXJA 4AK3A 2ARBA 2XQRA 1W8FA 4LEJA 1BYHA 4ZS2A 3OGGA 4DY5A 1AUYA 4LULA 1E57A 5I0UA 4XBNA 1XE0A 2JB4A 3VLBB 3WNXA 3GYDA 1W6OA 3ZFFA 1UZVA 2NN8A 2HEYF 1O59A 2TBVA 5F6KA 2K0GA 1QU0A 4I3GA 3P1IA 5AFEA 4NAOA 2XQXA 3EHKA 3NNLA 5BNNB 2OS2A 1X9TA 2GC3A 3AYEA 4H14A 2C24A 3SHRA 2G19A 4CCOA 5T54A 2ZAAA 1PO21 3JBG3 5FZCA 4I01A 1AYM1 4L11A 5FZIA 1IOAA 1IPKA 5SV5A 3ZX7A 2XG3A 2R062 4JDOA 4XF1A 3WG1A 4E2QA 1UY3A 1VJ2A 4IXLA 5DXDA 2KD7A 1ZBE3 3GHMA 3KD4A 4XUPA 1W6PA 3MICA 4RR3A 5FZ1A 3UKTA 4AEJA 4AEDC 3LEMA 5A6QA 3D3AA 3ZYFA 1SCRA 3VBFC 5GM0A 4L0PA 2PAKA 4N8MA 1C8NA 1Y3TA 1OLME 4N7IA 2VMDA 5JLVA 4RGGA 3WINE 2XVGA 1UOBA 3SCFA 3WF4A 2E63A 4NWVA 1TVGA 3PUSA 4JVAA 2FCTA 4L2NA 2WS92 1RMU1 4CP9A 1KITA 2EXJA 2E7TA 3DKWA 3WT3A 2IXJA 1LKNA 1ULFA 2XB6C 4MGZE 2XUEA 4YVSA 5LRRA 3KV6A 3LKJA 4HONA 1OMIA 4E2GA 1QIQA 1YRZA 3LA3A 4OYUA 5F2SA 2IVJA 1SDWA 2YV8A 2VECA 1FMD1 4QPGA 4LBQD 2HBUA 4IEUA 2WNUB 1IG0A 1MQTA 3ZXEA 3MIDA 4LKFA 2JG9A 4J25A 1RC6A 4FSJA 3ZKUA 4UFIA 4A4AA 2MNGA 3VD4A 4QU2A 4LOTA 3SKVA 3T09A 3LFMA 1US2A 5M0TA 1UW8A 4MGIE 1ZX5A 3E5UA 2HKXA 5CAZA 5HPOA 1QDCA 1VB2A 3AZVA 3K4ZA 4QHOA 2XJRA 2W0XA 3PIGA 3B93A 1EAH2 1KFXL 3NV1A 5B2GB 4P00B 5A3LA 5FYVA 1H8TC 1RITA 4NHKA 1CPNA 3INAA 2QTWB 5F5IA 5FZKA 4AHYA 3AZXA 4WBBA 2BNNA 1UYPA 2VMEA 4P9IA 4AI1A 4OUEA 1A8DA 3NV4A 2VZUA 2WQ4A 3WZ1A 4LLFA 1O3SA 2RR12 3JD73 2BYVE 2XH6A 4KBBA 4OI2A 4QKBA 3T0BA 1XSQA 2YC4A 2LS6A 3UKNA 4CPBA 5G04L 1QXRA 3WDYA 3ZR6A 1VBD3 2GN3A 3BGAA 2Q8EA 5D8AC 1GZCA 1C5HA 4E9KA 1I9RA 5APAA 3GCWA 2HWE3 1EP0A 4JRAA 3N9PA 3KF5A 4Z92B 1RVF3 5C6CA 3OF1A 3O0XA 3FBMA 2D7FA 1GSLA 4L9BA 1KJRA 4FPOB 2D3RA 4AFAA 5ANQA 3T2PA 4Z1VA 2BRTA 2ZPXA 4R9AA 2XHKA 2WNUA 4O61A 5ISLA 5EZWA 4YRDA 4GMP1 4UFHA 1SFYA 4LE3A 3BALA 1A34A 5GLWA 3KCCA 1F5FA 5A3MA 1ND2B 4OCTA 4XILA 2D43A 5LA0A 1GWLA 4UW4A 2B9VA 2PHXA 2WAAA 1PO22 1QJY1 4KU7A 1FOD3 5LBEA 3POIA 1CAXB 1AYM2 5SV8A 4Q8KA 3PJYA 3FLTA 5F2WA 3B7MA 2WWSA 5BY5A 1HJFA 1T2XA 1GLHA 3FE5A 4RN5A 2C1FA 1PO13 3I59A 2YC0A 5FZ7A 1PGW1 1V6NA 5JR2A 2E7QA 4CEWC 5BXXA 4W6XA 3FL7A 4DXRA 3G6JB 2P3IA 2ZGTA 3WY6A 1GR3A 5CVRA 1RUF1 4JTNA 2XL7A 2QQUA 1SZBA 2JDYA 1SCSA 2VZTA 1QMJA 5AFBA 4CU9A 2YBPA 1ZA4A 1O4ZA 5FZOA 1RMU2 1AXYA 5C4WB 4Q1PA 2VOVA 4ZHNA 1LHUA 5FPBA 4JDMA 1PNGA 4JHTA 4BU2A 4XJ9A 1QDOA 3HNMA 4CA9A 3NO8A 2XHNA 2R7EB 3ZYJB 1ND3B 1OOPA 3KF3A 2CAVA 1FMD2 1VMFA 3SH4A 4AWDA 3WHUA 4YYOA 3VL9A 2VQAA 4QM8A 2Z5WA 1VBC2 2TEPA 4HBNA 1RUE1 2TNFA 1LESA 4YG3A 4WM7B 1HRI3 2LALA 3RNSA 3WX5A 4OQ9A 3ILNA 3U78A 1R64A 1JI6A 1QJU1 1HLCA 4HKLA 4BIOA 1M06G 4LOSA 5J48A 4R9CA 2VW1A 3DCQA 5FP9A 4CUGA 4B4RA 1H8VA 3RPQA 5FCCA 4GWNA 4XZPA 1ZZ9A 3ZVXA 4URAA 2VZVA 4BQYA 1OHFA 1LGCA 1SHWB 2Y64A 1QHDA 3WXPA 2WT0A 1ASJ3 4XOGA 4XHBA 2R16A 4LPLA 2R073 3D6EA 4Y22B 3WV6A 3U4SA 3L9JT 1VLNA 4SLIA 2CSGA 5I93A 3EBRA 3C7FA 4ES9A 4HZFA 4IGPA 1AR81 3CJXA 4W4ZA 4OHXA 1WW4A 1ULDA 3I2OA 3O1MA 1I6XA 1POV1 2Y60A 2BGPA 5A80A 2HWD1 4CCLA 3OOXA 1OA3A 3I8TA 1KEXA 3OBZA 4GKXA 4UI9L 2JDZA 5BNOB 3HT1A 3ZXAC 5HCHA 4NIGA 1FI2A 3ZXKA 2X29A 5A7WB 3WP5A 3VBFB 4BJ0A 2VO5A 4DB5A 1RXGA 2W94A 1MZ6A 4ZS3A 3HAGA 1KGYA 2DFBA 3EXUA 4LO5B 3DYOA 4ZZ8A 1SPPA 2GH2A 3VV1A 3UV9A 1NG0A 3E5QA 3IAPA 2XBO1 5HV4A 4KU8A 3ZXDA 4FFIA 2SBAA 4XMIA 1W2OA 1J84A 1XQNA 4XJWA 3VN4A 1WWYA 2C9KA 2I07B 4AGGA 4OI1A 1ND3A 2YY1A 4KL1A 1O8SA 1VP6A 3HPNA 4QM9A 1GWMA 3X29B 1GBGA 5JXJA 1NYWA 2OKXA 2ZHMA 3TRSB 1RB8G 2HLEA 1TNFA 4AEKA 2Q1FA 1V6IA 3CEWA 2VZ3A 1MS4A 3P3NA 3JCIA 4LHSA 4WM7A 2B7YA 4FP2A 4M3CF 1QJY2 3MFAA 4PCRA 1XNCA 5JPMB 1MEC3 3KT1A 4MHRA 1O5UA 5A3WA 3BTYA 1D4VB 3DKQA 4BM8A 4PJYA 2NP0A 1KS4A 1GZWB 4UWDA 1PMIA 2ET1A 1PGW2 3H7JA 1QOOA 1NCRA 2WUHA 3IAQA 3T4VA 1XNBA 2WZPP 1CAVB 1YO8A 2YYOA 3WNKA 2H6BA 1Y9QA 2PELA 1PX3A 4LK6A 3WNMA 2Y6LA 1Z0HA 1RUF2 2EALA 2Y38A 2Z2SB 3PVOA 3SCGA 1VE0A 1J3QA 4KH9A 5FWJA 2VW2A 2CHHA 2DBNA 5FY4A 3H1MA 4LK7A 1W2UA 3E6DA 4IEPA 2JB8A 5F8PA 3WDWA 1NZIA 1CZVA 1XNTA 5DUWA 3KT7A 1WBLA 2JDHA 5DDJ1 1FNYA 2ZEXA 4BH9A 5BNOA 2LRPA 2BOIA 2EVXA 5ACA1 5JWPA 3WW3A 1RUC3 5A7WA 2W39A 1W6QB 2RS13 2FDKA 1GP6A 5D8AB 4LUKA 5FO9B 1H2LA 1LOFC 1UX7A 1HB1A 2YUEA 3B02A 4JTOA 4LBOA 1YJLA 1LB2A 1RUE2 3PUQA 1REDA 1V00A 2CWMA 1FYUA 2E33A 5LRSA 4BWOA 4Q26A 4PF1A 3N9QA 2OPKA 3ATGA 1QJU2 3GBWA 4KI5M 5DUUA 4RD7A 4PLNA 5FY9A 1OSGA 1ZBA1 4DRVA 2E31A 2W87A 2ZX1A 5E16A 1O7FA 1YIPA 1W8TA 2QQWA 4P14A 1DGWA 3U75A 4DINB 3KB5A 4XQDA 3BODA 4YGDA 4DUWA 3C7GA 2WINB 4E4ZA 1WCSA 4MV2A 5BNPB 1G7YA 4QX2A 3ZFGC 2Y6JA 4CEYC 4ZKTB 3KV5A 1AR82 5ABJC 4B8EA 2P37A 4XBLA 5JVVA 4C8DA 4M0NA 2WZR1 2WT2A 3ZSJA 2V4VA 2VU9A 1TE1B 3I2DA 4C0HA 1RUH3 2HWD2 4G4FA 4PI2A 5LA1A 4UFKA 2AR6A 4ZONA 1LOCA 3MIFA 4TN7A 4WM8A 4YG6A 1PZ8A 1CIYA 2JKBA 1CAVA 3I2FA 4GWJA 4UOJA 1WLDA 5FZ0A 5K0UA 4COUA 4DZGA 2FBEA 2FMYA 5E88A 5T3NA 3DN7A 5FR3A 1YLLA 4JDNA 4TSVA 1WW6A 3Q8FA 3R05A 4Q0PA 4XZUG 3JB4C 3MDPA 1PVC3 2W3JA 5FXXA 3S7IA 4XQ4A 4OHWA 3U4XA 3M3CA 5IT6A 1DHKB 2EXIA 2XBO2 3ACLA 3WDXA 3UGHA 1RUD3 4Y1ZA 1AR61 4Q27A 3EYPA 3ZPYA 2W52A 4Y20A 5GKAC 1POQA 2WWUA 4IEOA 3OYWB 3KHCA 1VRH3 2E26A 2XL9A 4MLOA 4Q4Y3 1J1TA 2VTXA 3N36A 4EN9B 1QH7A 2PHUA 3I54A 3PTRB 3VBUC 1DFQA 3MHZA 3ZN5A 1ZVFA 2R6QA 3H7YA 2VJXA 3OD0A 2J1RA 1XNAA 2IXKA 3FHAA 4AFCA 4E4SA 2OUHA 1JZ6A 4YM2A 3AKPA 3USSA 2MHFA 3OCPA 2BERA 4LO8A 3TBDA 2X53S 2C5DA 2ZX0A 3BOPA 2ZGUA 3POJA 4PHZA 4C0BA 2QZ3A 3WF0A 1REEA 2DCKA 4A7ZA 1XJAA 3V0BB 4YLZA 3I3QA 1H30A 4NAMA 2C0ZA 5BNPA 1AF9A 2CTVA 1CAWB 4NHYA 1SLLA 1QH6A 1PK6C 3ITQA 2VZ1A 1ZYBA 4FPYA 2B8MA 2VQTA 2WC2A 4WVWA 1K45A 4MHUA 1HKDA 4NE9A 1EV13 1OA4A 3DYPA 4I3PA 1YCIA 4AF9A 2A6VA 2WWJA 2ENRA 4XVHA 1RXFA 5IYYA 4L8QA 1DQ0A 3HN3A 3E1F1 4P9WA 1VBA1 1WZXA 5ACA2 1UX6A 3UGGA 3O12A 3ZSEA 3B69A 4OMCA 3TB0A 2W91A 3M3QA 1UZYA 4WVZA 5FZHA 1WMDA 3VHNA 1HRV3 3UJQA 3VHRA 3H8XA 4TLFA 4RS5C 2IFWA 3OB8A 2DBIA 3D0SA 4JKKA 3DL3A 2ARCA 3EQEA 1OT5A 1SQ4A 5DZFA 5LBFA 1JN2P 1X36A 2IWGB 3U1XA 1ST8A 4FPJA 1OVPA 4I02A 2HWF1 5T5PA 4EN0A 4D94A 1A8MA 2F6BA 5F37A 3OYWA 1FPN3 4YW5A 2YBSA 2WO7A 3UNPA 4XDOA 2D40A 5CU1A 3P3PA 3BUCA 2WN2A 2YPDA 3GF6A 3LPFA 4U36A 4BHPA 3OGSA 3AYCA 5EV7A 3V0AB 2W9XA 5FPVA 1AR71 2P34A 3CNAA 2P1BA 2NZ9A 4BISA 4ZU7A 3PTYA 3IIIA 3ZFEA 2BWAA 4WZFA 4A44A 4NRQA 2WZR2 2ZXQA 1JBCA 3V64A 4IERA 3E5XA 4UFLA 4QX8A 1OI6A 3I97A 4J6GA 2BNMA 4KMQA 2RDRA 1RTVA 2FDJA 4K6BA 1F5JA 1ZZ7A 2I74A 4JGYA 1N3QA 2O8OA 3V0BA 2GMPA 3NNMA 4QXKA 4GWMA 4DXZA 1CAWA 3CJIC 3RQ0A 4CYDA 2O0OA 3KVAA 2A70A 2XJQA 4XUQA 1O3QA 1LHNA 1LU1A 1MR5A 5ERLA 4LA3A 4A7YA 2L9LA 1HB4A 3C7EA 5FFOC 1HQNA 3B00A 1W2TA 2OZ6A 3CZJA 4W65A 3J8F3 5F3IA 5DN2A 4CDUA 2W46A 2VR4A 4NO4A 5D21A 3MFCA 5FJKA 1AR62 2WJSA 3MPBA 2ZEWA 2VVEA 3NAPA 4Q0UA 4D3WA 1NA1C 1DQ5A 1JU4A 4QGLA 5FYTA 1JW6A 4MG2A 1VBE3 1LJ7A 4BIFA 3UGFA 4EQVA 1NQDA 4JKMA 5A3TA 3MV11 1JZ8A 4XJUA 5FZEA 4CRQA 3QH7A 2J1EA 3BKZA 3ME2A 3QD6A 3QLQA 1XYNA 1ZZ8A 5H9SA 3HQXA 1NZCA 2UWAA 3O14A 1WMFA 1QWRA 1NCQA 1UD1A 2W1WA 1TMF1 4Q4V3 3I2KA 4B4QA 2VQ0A 5EWSA 1F31A 2UU8A 3LIGA 4QU1A 3R4DB 5KHIA 5FUNA 3S7EA 1AHSA 1GANA 3O7OA 2WO3A 1E5SA 2CDPA 4AI0A 4EE2A 4AW7A 4OZXA 5FV3A 1SLBA 3UL2A 2BZDA 4QX7A 2ZGKA 3ZFGB 3DV8A 4CEYB 2QZ2A 3OPTA 4LT5A 5ABJB 2VCAA 2EXHA 2GNMA 1ENRA 3UESA 3MYXA 3WDUA 1TEIA 2RJKA 4R9BA 2P17A 2OZJA 3K4AA 1TME3 2ETEA 1ZRRA 2ZZJA 2Q5TA 4EJRA 3O1RA 1D7PM 4PI0A 2WN3A 4Z82A 4IW3A 2XWJB 1WKYA 2FCUA 3U0ZA 1S2KA 2Q1ZB 4Y3OA 3BTZA 3VBHC 4PIZA 1Y9MA 4BDVB 3CZUA 1MZFA 1MVEA 3KQ4B 3ZPOA 4OUMA 4A6SA 2DFCA 2R061 4QXCA 4AAPA 1UU6A 1JOPA 2PHTA 4OHZA 4DXSA 3JQWA 1U12A 4EROA 2JIJA 3ZYBA 1YHFA 1S0EA 2BU9A 4YARA 4N53A 2PHDA 3FHQA 4XQWA 5FPXA 4HN1A 4MUVA 3PIJA 4Q4X1 1IGOA 1W8WA 1PIV1 2HWF2 3DEMA 5LA2A 3JXSA 2VUCA 1C8M1 3WLUA 3G7DA 2VULA 5LWBA 3HIFA 3AP5A 4GAZA 2D6PA 4BXFA 3WQ0A 3GGLA 1LHVA 1BLZA 2P3YA 4FVVA 3VBUB 1O3TA 1AR72 1DGRN 4C90A 2OW4A 1RUI1 4QQPA 4ISRA 2XVKA 4YGCA 3GALA 3EO6A 4CUBA 3FUOA 3LD8A 4CPBD 2VY0A 2G1MA 2MEV1 3WD5A 4HXCA 4GB33 3UT0A 3IWZA 4LNVA 3VDDC 2PAMA 4AQ6A 2WLPA 4GKYA 4Q2FA 4FOYA 2VGDA 2W1QA 5DPNA 2VQUA 4NUBA 5FQ0B 1CX4A 5I0RA 1PK6B 5CG9A 2Q8OA 2ZGPA 2BGOA 3W21A 5C7GA 4TYSA 1SBFA 3LEKA 4N90A 2WNVB 4M3CE 1M4WA 3RWNA 3K75B 2VM9A 2DVDA 2J7MA 3AP7A 5LBBA 2RM23 2PQSA 4P9YA 5JMCA 2DVFA 2ORXA 4UF0B 3SH5A 2VMIA 3ZIXA 3JBG1 3MGUA 4E4HA 1IS5A 3M3OA 4FI9A 2P5BA 3D0JA 2J22A 2ZCWA 2JD9A 3N7JA 4FXGB 4YZ3A 5FY7A 3D4KA 1XBFA 5FYHA 2A3XA 3PVNA 5J7MA 1ZBE1 3ACGA 5L9BA 4BPZA 2DDUA 2NMOA 2MPFA 3T3YA 3MPPG 2E53A 2VCCA 5KR7A 1LCLA 1W90A 3N7LA 1ENQA 4FAGA 1OBNA 3AL6A 1RUG3 1TMF2 4IGQA 2DURA 4Y5Z0 4YZ1A 4CCJA 1UCXA 1W8UA 1VR3A 3ZN6B 4BK4A 2XJPA 3SEEA 3GZEA 4RQPA 4AQ2A 2ARXA 1RGSA 2DUPA 1JYNA 5IW0A 3PLQA 2WS93 2K9ZA 3RS6A 1ZA7A 3KM5A 1O4TA 5GZDA 1G9CA 2DWRA 4GWIA 4BMBA 1UYXA 3R0RA 5FZ8A 3NL1A 1BBT3 2A6YA 4E8CA 1OQEA 1DU3D 2JENA 1CJPA 3VBOC 1GV9A 2N7GA 4YM0A 1CONA 1WD3A 3ON7A 2BVVA 3MIEA 1SFPA 2WQ8A 3ZMOA 3VB9A 1AX1A 5FQ0A 3MZHA 1EPZA 3CJIB 3K3NA 4NRPA 4LHNA 4BZ4A 4DQAA 4QQLA 3K2OA 1ZRIA 2RS53 4XAEA 3U37A 2GSYA 1GZTA 5CKMA 4B1LA 3LEIA 2WNVA 3CLPA 1S1AA 3W5NA 4I2OA 4GZ9A 1UXXX 4HL0A 4KQ7A 3VKFC 5LK5A 2CGOA 4Y24A 1F15A 4UF0A 5CFDB 4HKOA 5L7OA 4QB6A 1HXS3 1BZWA 1ZRCA 5FP3A 3GDBA 4Q4X2 4D8MA 5K9YA 2ZBJA 1SLAA 2DTYA 2LTNA 3FLRA 2JECA 5F3GA 1CIWA 4JX0A 3RMXA 3CQOA 1PIV2 2IZWA 3N7MA 4HPKB 3HJRA 1NA1B 1FNZA 5FLIA 1C8M2 1W9WA 3ZYIB 4CXXA 5LW9A 3ES4A 4DNYA 3AMQA 3IIAA 3JD71 3DXUA 5I8SA 3O1SA 4CU6A 5C9AA 3LOBA 3T2TA 1HQWA 2QDRA 3GZUC 3RGBA 1IQDC 3T0AA 4YSFA 1RUI2 1A6CA 1VBD1 4LBNA 5IWFA 1LNSA 1UKGA 4FFHA 3K51A 1JYXA 4CCMA 5A6YA 5KC6A 1AYN1 1LOAA 2HWE1 3H3ZA 2TUNA 4YW4A 5L9RA 4DUXA 1VBC1 2W5FA 2RJLA 2MEV2 3ZN6A 3LFIA 4QX5A 1R091 1YWKA 2WAOA 5C8CC 3ALQA 1AX2A 4H7LA 2WIIB 4S2DA 5LEJA 1N3PA 2ID4A 2ZA9A 4NN0A 3B94A 4QWNA 1DLCA 2GNTA 2DVAA 2LW8A 5DAVA 4B7KA 1IS4A 3SLIA 4PDWC 4LTAA 4S2HA 3TOJA 5BNNA 1UIJA 4AFBA 4IV3C 1XU1A 4K7JA 3HVDA 4CP0A 4ASLA 3DPRB 4XMAA 3FUQA 1Z7S3 2Q0AA 3JBG2 5I8TA 1DLLA 1FOD1 3R6SA 3C7HA 3CJIA 4FPKA 4IDZA 2FZ2A 3VBHB 2G4IA 3LA7A 5FMDA 1VBB3 2R1DA 4IE5A 2JG8C 1Q3EA 4MGYE 4F83A 5BPXA 4X8NA 2JKXA 3VD5A 3S30A 3ELNA 5DUXA 5KXCA 2ZGLA 2XWBB 1ZBE2 5GZGA 3GJAA 4LJHA 5CFDA 2QE3A 4XFFA 5KXEA 2GMMA 3GJBA 1W03A 4LO7A 4O9EA 1BCXA 1KJLA 2W47A 4TZDA 4BQ3A 3NV3A 3ACHA 3SKJE 1XRUA 1YQ2A 2WL1A 4DUVA 4YVWC 1ODNA 2RDSA 1QJEA 5EQUA 1JTZX 3KSCA 5HCBA 2IVIB 5EXOA 2AACA 2NQYA 4LHKA 1E5HA 3I2GA 2VZQA 4P9GA 1KDMA 4XDPA 4IEZA 5C33A 4KGQA 5FY0A 4LBMA 3N3HA 5IHRA 3S0MA 3WP4A 2ADEA 4NRMA 1QJZA 1AL0G 2LM3A 5I0TA 3K77A 5FO7B 1DG6A 3VDDB 4AVVA 3M2MA 1HRI1 3ZMNA 2RE9A 3H3UA 3ECQA 1W39A 1AVBA 4DPNA 5K4LA 2Z42A 3FLPA 1YIFA 2GP5A 3ILFA 3IBMA 3USUB 5E89A 5KWRA 1NXMA 2BPA2 4BK5A 1EUUA 3E6CC 1SLCA 1TQ5A 2WYSA 3V65A 3AYDA 1JOBA 4E27A 5HI0A 4XURA 2UY8A 2D44A 2ATFA 1J59A 2CL2A 2V73A 2AZ5A 3VBSC 2D98A 3ETQA 1B35B 1ASJ1 2Z69A 4C1WA 1W2NA 2R071 3DPRA 4MYEA 3VZOA 1JHJA 1SLIA 2J1VA 3SXWA 4CP1A 4A42A 1KS5A 4P02B 3TNPB 3LGRA 4NJ4A 1LGNA 3ZOIA 3C8XA 2R32A 4QPIC 2QQLA 2ZOEB 3THTA 1R1A3 2CV6A 3RZGA 1OUSA 3JD72 3FFQA 2HWB1 3OBAA 1PMHX 1N1TA 1C3HA 1ULPA 1VBD2 4P9JA 4X8PA 4XCBA 5T5LA 1CN1A 1N1VA 4CUCA 1SBDA 1YFXA 4RFT0 2NM1A 4GH4B 1AYN2 2C26A 2QQOA 3POGA 2HWE2 4LBQB 5C71A 3NNGA 1AJOA 1HN0A 1RVF2 2GAUA 2KA3A 1R092 1WUVA 1XPWA 2DF7A 1OKOA 2JDUA 3MW4A 1PMJX 4HMZA 4XEZA 3WVJA 4DEQA 2DCJA 1AXKA 2O14A 4Q5OA 5KXDA 3POFA 1JYWA 1H0BA 1HB2A 4QX1A 3A21A 4DXTA 2PAEA 3LQCA 1OF3A 5KHHA 1NE4A 2X8KA 5C3SA 3Q9OA 3RZJA 1AR93 3LA2A 2YXSA 4K1YA 5LB6A 1GQPA 4AAXA 4E4DX 5L36A 3RRDA 1ND2A 4CXYA 2WRAA 2W95A 3AKSA 1GWKA 4BCUA 2V09A 2VMGA 2WFF3 1FOD2 2WSUA 3LSEA 1CAXA 4FFFA 3H50A 3I2IA 5FKBA 5FIXA 1FV2A 1MEC1 4EZ4A 4LKEA 2WDBA 1UY0A 3MEPA 5HXVA 1S55A 1F4HA 2FDFA 2D5FA 2V5YA 4AHWA 4CZSA 1B35A 2YPJA 4OUSA 2DVBA 5DZGA 2NLRA 4AEDB 4BQXA 1OQ1A 2ZMKA 3MV01 5CISA 1JU3A 4CUAA 1YQ6A 3J9SA 1ODMA 2WA4A 1LRHA 1K5MC 1Q8SA 1PHMA 2UWCA 3EMRA 2RS33 2VNVA 3AZZA 1K5JA 5FLHA 5C4WA 1NLRA 2ZABA 1H2MA 1PGL1 1QJFA 1CESA 3I3BA 3MLLA 2ERFA 1Q43A 4RGKA 4A45A 5HCAA 4IUGA 2V72A 5FZAA 4F7ZA 5J96B 1RUC1 2YU2A 4LBJA 1GP5A 2RS11 1O5LA 1MACA 1OPOA 4ONUA 1JYVA 4GH4A 1BK0A 5BUVA 3I3EA 4RSUA 2JE8A 2ZTNA 2YU1A 4XF4A 4P08A 4HK9A 5FBJA 3CBNA 2EIGA 1SMVA 2EICA 1QJX3 4MXWB 1Q56A 3MIGA 1LR5A 1WA4A 1HRI2 2KR2A 4Z8BA 5EHDA 1COV3 3TYJA 5FUIA 3FX3A 4XACA 4PF5A 4Y1UA 2GZWA 4AGVA 4YFZA 1UU4A 5JI7A 2VMHA 4QKNA 4DEVA 3HBKA 4PDWB 3DXTA 2WLQA 2PYTA 3POYA 1DQ2A 3GM8A 5A32B 1H8TB 5FDBA 1ASJ2 4EN6B 5FOBB 2Q4SA 2YGLA 2R072 4Y22A 5H9QA 3RVHA 1LENA 3MO4A 4CE8A 1D0HA 5A1LA 5IUQA 3MIHA 4INDA 5F5QA 2QQIA 4HVQA 1LODA 4Y4YA 3U07A 3I49A 1EPWA 2JG8B 3H1YA 2B46X 4QT6A 1UWWA 1GOFA 2C4XA 5G05L 3V56A 2H0VA 1IG3A 2ARAA 1DZRA 4NOTA 2CYFA 5DAQA 3VZKA 3N4MA 2HWB2 4XF9A 1AX0A 5C3RA 4CDQC 5A7QA 4AEDA 1XNDA 2FZ1A 3CMGA 3VBFA 1DZTA 2Y8KA 4XTPA 4IETA 2PHFA 4JQRA 4NWWA 4ZPIA 4CCDA 3TN93 4QGNA 3NSTA 5AC93 1KFUL 1HIXA 2E9QA 4YVWB 4CVUA 1LOBA 2O1QA 4L97A 2QUOA 5LATA 3ZXLA 2BFUS 1S0JA 3GHNA 1RUD1 2D6LX 3A23A 3Q8CA 1U5ZA 2HJIA 1GQHA 1OA2A 1WCUA 2VG9A 3PUHA 3VD7A 4GIQA 3OPZA 3BIWE 1UMIA 3M1HA 5JIUA 1Q8QA 1VRH1 2HWC3 5HBAA 2F4PA 4Q4Y1 4UFMA 3ENRA 4AI2A 3ZDVA 1OURA 3GZAA 2QQMA 1W05A 1REFA 4JGZC 1CPMA 4EWDA 4LE4A 2GH8A 2PA7A 4YW7A 1CGPA 1UL9A 4MO3M 4I09A 1MEC2 1O4YA 2ET7A 3VDCA 1V70A 2A3YA 3ZO0B 5DUVA 4FPGA 5FLJA 5LY2A 1WMEA 5LY1A 1GZWA 1V9U3 1WLWA 2RJ2A 3K46A 4QX3A 4X6QB 5CNAA 2A3WA 1H8TA 4W8JA 1NY71 4CEWB 4UBGA 3PMSA 4OLLA 1CD3G 1OQDA 1UN1A 2PN5A 5FXZA 3IDBB 5A3UA 3L2HA 5FKCA 4IV1C 3KVBA 4H3WA 1G8WA 4A3ZA 1JHNA 4A2UA 2XMLA 4YW3A 3U10A 1EV11 1I5ZA 4QPIB 4Z2AA 1D4M3 1DYKA 4HLTA 1QGLA 3OY8B 1J58A 2VZSA 5GZFA 5H9PA 4LORA 1PGL2 1AXZA 4GD4A 3AK0A 3D8CA 3L2YA 3RI8A 4LHLA 1RUC2 1NUKA 2Y6KA 3PMEA 4X6RB 3ZSLA 1W6QA 2RS12 5D8AA 2FD8A 3POEA 5DDJ3 4UXAA 4BQWA 3LDBA 3OPWA 4MSVA 2B5HA 4CSWA 5ACA3 4Z2WA 3POBA 2R1BA 4CDXC 1X8MA 2OQ6A 1ULOA 1Y43B 2XDVA 5L73A 2B9UA 2XOMA 4G3YC 4UYBA 5FTTC 2VXRA 4XFIA 4DO0A 5JZGC 2BBAA 4LMFA 5GLUA 4RA0A 1C28A 3RYRA 4N43C 2VNGA 5I0SA 3SMHA 3T2QA 1FX5A 1N3OA 2YC2A 5FYZA 4A3XA 3PNAA 3BU0A 4F3JA 1DQ6A 2X05A 1FPN1 2JDNA 4OZOA 2NPIA 4MOAA 4FP3A 3WP3A 1ZBA3 3RYKA 4ARYA 4UW6A 3F95A 5C3QA 2CGNA 4CDWC 4COVA 4WVMB 5JSOA 3PHMA 3TEXA 3CF6E 4Q8LA 3WW4A 3FMGA 3OG2A 2PMWB 3CDZB 2QNKA 3AZWA 1DP0A 2WR9A 2B45X 3ZSKA 1RUH2 4YZ4A 3T1LA 3M7AA 1LU2A 4BE3A 4LO4B 3VZJA 5F9TA 4D6QA 4E8DA 5FZ3A 1UF2C 4CEWA 1W0OA 1G9AA 1ONAA 1OXCA 1NLQA 3D82A 3FFZA 3OD4A 1OFNA 3B01A 5A7SA 3UK9A 1K5MB 3KQRA 4PBOA 3AKTA 2JX9A 1US3A 5JDBA 5CA6A 4XE9A 1PVC2 4OQ8A 4OHVA 5GLTA 4YM3A 1I5PA 5FPAA 3PL0A 4V2VA 1OUXA 2YB7A 3J8F1 1RUD2 4XFGA 4XC9A 3T2OA 2OYZA 1WBFA 3WF3A 3LE0A 4RR3C 2X10A 3GCXA 1K42A 1OF4A 2FMDA 5JXGA 3IB3A 1VRH2 2IFRA 4LITA 1VBE1 3H3LA 2VBDA 4Q4Y2 4RFRB 3IMNA 1R1ZA 1UKRA 1YUDA 4NHMA 1CR7A 1NE6A 4IEQA 4W50A 4EWEA 5FY1A 1BVVA 1SDDB 3P6BA 2ZHNA 4N7UA 5FMBA 2H6CA 2OA2A 1ULEA 2Q1MA 5IVJA 3B5LB 4META 3AP4A 4O7XA 1JYCA 4Q4V1 5T55A 1QQP3 3S6PA 3BYWA 3H8RA 1YI7A 5DG1A 2IXHA 4QPGC 2OUJA 1NY72 2WO2A 1MQTC 3BTAA 3RZZA 3ORJA 2R0HA 1I3HA 2JG9C 1OH3A 1CZSA 3LF7A 4HKWA 4UW5A 5FYSA 1EUTA 3CO2A 1JZ7A 3ILRA 3ZM8A 1G9DA 1EV12 1HQLA 1SFNA 1RUJ3 4HETA 5T5OA 5A6ZA 2PQQA 1T6GC 1RYYA 2PHWA 1PM7A 4YNIA 3LEGA 2XLGA 4XFAA 5EFUA 5KXBA 1JZ5A 1WD4A 4YPJA 1UQXA 4XFBA 4CDQB 3W58A 1AL23 4BA6A 1TZOA 3RZHA 4BQ2A 5JOZA 2R043 3ZYHA 3OUIA 1VBA3 4LO6B 3TEZA 1CX1A 1H9WA 1HRV2 1YQCA 3BPZA 3W5MA 2ZEZA 4QD2A 1C1FA 2OPWA 1H4HA 3A0NA 4BLJA 4S2GA 5IVFA 1Q5OA 5JI9A 2A71A 3OBRA 5IAVA 2VAUA 4XF3A 4D6RA 3HNBM 5FXVA 2QDNA 3UETA 4RGAA 5FOJB 4AE2A 4YGBA 4D0QA 1S2EA 3WDVA 1AJKA 2JDAA 2BNOA 3KCYA 2D97A 3W20A 1FPN2 5FMOL 2XPJA 2A1XA 1L7QA 5IVEA 2IXLA 2JE7A 3J7NA 2V5DA 1V0AA 4JGZB 4RHV1 1VMJA 2FDGA 1W6MB 1PX4A 3P5BA 3RFRA 4CCNA 3V0AA 5FXWA 1IPJA 5LZ6A 1C57A 2XLAA 1BVP1 3S5QA 5K7PA 2ZGQA 2AREA 4S2FA 4Q4W3 1W2AX 2GMEA 4JHZA 1EYBA 3K3OA 1WMXA 4FPFA 3ZSMA 2QQJA 4B29A 1RUNA 2AEYA 1X33A 2ZGOA 5FRAA 5GLZA 2BTVC 2JJ6A 2WNUC 1XNKA 3GBFA 2AYHA 1S0IA 2UY9A 4HVOA 4LIVA 3W59A 2O8QA 4IV1B 4K8RB 2G9GA 4ZZ5A 3M70A 2JEMA 1DBNA 3PVBB 3ZR5A 2VOTA 1W06A 3FN9A 1OLRA 1Q8PA 1RHI3 4R52A 3JZVA 2RM21 2CWSA 2W08A 2ZX2A 2RMU3 3VBRC 5DABA 2D6OX 2E6VA 2QFEA 3WW2A 4C91A 3J8F2 2DCTA 2W2IA 1BMV1 2J1TA 4O9GA 2YDEA 4AL9A 4TXWA 3RJ2X 3SEPA 4DRRA 3LOIA 5LASA 1LOFA 4V2WA 4PLMA 1OD3A 4LIUA 4AXOA 3WQBA 5B4XA 1UYZA 1MS5A 2Y26A 2GN7A 1VBE2 4CDXB 4AQSA 2XUMA 2VBPA 2VMFA 4B1MA 2ZGMA 5CZKA 2PLV3 5AVPA 1UNBA 3ZYPA 4TLGA 5JZGB 2Y34A 5L19A 2NYYA 2F4LA 3LAGA 3LCPA 1GUIA 1R083 5FYYA 3CKHA 1JXNA 4NIAA 4PQ9A 4IESA 2P3JA 1RUG1 2GC2A 2Y33A 3B9IA 4MZUA 4Q4V2 4AFMA 1OOPC 5A6XA 1IKQA 3O1PA 5BNQA 5A70A 1HV0A 4CDWB 1TMF3 1WCDJ 3ZFGA 1BEV3 4BQ5A 1J83A 1OLMA 4LR4A 3HNYM 4CEYA 1ENXA 2W92A 1VB4A 3IDCB 4MGKE 2PXJA 2Z79A 4O65A 1QKQA 5ABJA 3WSOA 1W3XA 3NRUA 4B7EA 3MW3A 1DQ1A 1BBT1 2FQPA 4XW3A 4TTGA 3O1VA 3AMMA 4KWLA 4U2AA 4AVAA 5JXIA 4IL7A 1W3VA 3M3IA 1C1LA 4IEXA 4YZ2A 5KHJA 1IZ3A 2EAAA 5IVCA 3A4UA 3CIHA 1UYYA 3SCHA 5IATA 5C3PA 5FBZA 5JSRA 4ZXKA 2RS51 3IMMA 2ZX3A 3WHTA 4RS5B 2PHRA 4JV4A 4NVPA 3S5AA 3APBA 3HBZA 2BGCA 4P9LA 4QB2A 3VD9A 4MGTA 3ABZA 2ZX4A 3OUJA 4PT6A 2R063 2RDQA 1JZ4A 4FFGA 1HXS1 2CNAA 2BFUL 1PVXA 4OULA 4XUOA 3SITA 4R4XA 5CKNA 1YEWA 1W6PB 4RR3B 4P9XA 3Q8EA 4ORFA 2BEOA 3NJZA 5F3CA 4UBHA 1X9PA 2VW0A 3A0KA 4Q4X3 5FP8A 2Q8DA 3BB6A 1ACCA 1O6UA 1VAMA 2OQ7A 3VDAA 2BJSA 3VBUA 4KGGA 4RHV2 3SH3A 1MZEA 3H0OA 5FPUA 5GLVA 4CP9B 4DIQA 1ENSA 1ULCA 3PDQA 1STMA 2UWBA 3E6BA 2B4KA 1H1MA 2Y0IA 4E2SA 4IEWA 3RZMA 4Y33A 2DU1A 4K1ZA 4K9SA 1OLQA 5BV6A 5KBFA 4UFJA 1NX9A 3HN1A 4GQ7A 4CXWA 1ND3C 1H2NA 4XJZA 3MLJA 4QPGB 1DDLA 3HEIA 2WABA 1JYTA 1MQTB 2YROA 3RWKX 2JG9B 2A5ZA 3WW1A 2DU0A 4HANA 4AQTA 1PK6A 2DYCA 1XE8A 2BUKA 1J3PA 2JXAA 2AH2A 3IPVB 3KLSA 4H2AA 1VIWB 2JICA 2WYFA 3HOBA 4K21A 4WM7C 4N9HA 2W1UA 1JUIA 1B09A 1DGLA 1L7LA 5FZ4A 2WKKA 4QAWA 5JIAA 1MPXA 4L99A 2RM22 2D6NA 1GQGA 2VMCA 2CU5A 3PU3A 4AOCA 2IC1A 2EA7A 4KBZA 1EAH3 1ZZ6A 1Z7S1 2AEZA 1BMV2 4FBFA 1DIWA 3LPGA 3NNFA 4A7KA 3GZTB 5CYYA 5FZMA 3NJYA 1ZNPA 2BDRA 5IK4A 5F6LB 2DUOA 1F4AA 1NCRC 1VBB1 1GNHA 1X7NA 3NMBA 1S0DA 4D6SA 3VHOA 3SNMA 3AMNA 1XOYA 3MI8A 3QCWA 4LKSA 2WSVA 4RS5A 1LAJA 3BN6A 1UO9A 4GULA 3SC7X 1PZ7A 5D2AA 1Y7BA 2XJSA 4YW6A 3JU9A 1U5XA 4AYUA 5IAXA 2CGPA 1MVQA 4RYDA 2D5HA 2RR13 5I0DA 1H6YA 2VE1A 2VZRA 2ZMLA 2HYKA 1QOSA 5BNOC 1CZTA 2BP6A 3VZMA 3A7QA 4NHLA 1RUG2 5LK7B 2HEVF 3Q8AA 1GOGA 3OUHA 4ATFA 1RVF1 4IE4A 1ULGA 4XJ8A 1V6LA 4MVTA 3K4DA 1JH5A 1W8HA 3H8OA 2WA3A 3WDTA 5EYXA 4OHYA 4AG4A 2NMNA 4YGEA 1QNYA 4AZZA 1JUHA 3LWCA 3OGVA 1BBT2 3DGTA 5IVBA 4EN8B 1GOHA 2D3SA 4FTSA 1TG7A 2FDIA 4ISQA 3CHXA 1GNYA 4B3NA 1UOGA 2OT7A 3ETPA 1FXZA 2J42A 2WNOA 4QHZA 2FCVA 3JUUA 3PURA 2XKPA 3IPVA 5FK7A 2RS52 3PUAA 2VZOA 2CY6A 1PO23 4MH0E 1OVSA 3ROUA 2GP3A 2GU9A 1AYM3 4FOQA 4V1PA 1PO11 5EYYA 3HT2A 3VBRB 4FPEA 2X5IC 1HXS2 4D7TA 1FT9A 4OMDA 3WUDA 2DUQA 4BQ4A 3JQXA 2DCYA 1LEMA 3I59B 3PU8A 4M00A 4BLIA 3QH6A 4WM8C 2I2SA 2XJUA 2YGMA 1YC61 4C1XA 4HPKA 2SLIA 1W04A 4AI8A 1S0GA 1V6OA 3O1OA 1NA1A 2BQPA 5FAXA 4L92A 1OC1A 5K0UC 1R1A1 4OI4A 1IHMA 3BTXA 1O91A 2ZS6B 5FZOB 1OFSA 1RMU3 1U5IA 1YFYA 2QQKA 4FPHA 1UOJA 1UZ0A 4KWUA 3RSJA 4AHXA 2GC0A 2XR4A 1KQRA 2ZKLA 4UT5A 4AFDA 4GALA 4NIDA 1XSRA 2J1UA 1OOPB 3AFGA 4R4ZA 1CAUB 2W68A 2Y6FA 4IEYA 4MX3A 5CIRA 4QPYA 1FMD3 4P5YA 5DQ0A 1AYN3 4YM1A 1C4RA 1YQ5A 4YW1A 4EN7B 2BOJA 3VGIA 1VBC3 3RMYA 2GALA 2VNRA 2VOXA 1FV3A 3KT4A 4KWKA 4QKFA 2RV9A 4K20A 2UURA 1R093 1F9KA 1W8OA 4BYYA 4IEVA 5LBCA 4DFSA 2CAUA 2XXZA
chains in the Genus database with same CATH topology
4AVCA 1ZRFA 1AR91 2JE9A 4XFCA 1MS8A 1GICA 4COZA 1WLCA 4AVTA 4AI3A 4KWJA 1DYPA 3WG3A 5T50A 4AEMA 1Z7S2 2XJVA 2WFF1 1RJ8A 4CTEA 3ZIWA 3FBYA 3JB8A 3VBHA 4ITCA 2UYAA 1VBB2 1RINA 5BNPC 1H9PA 2XVLA 1IKPA 2WNEA 2IXIA 3RI9A 3MW2A 3VBRA 4TWTA 1DGRA 2RHPA 4XTMA 2YHJA 2D93A 4QQHA 2B42B 4HT1T 2BWCA 3I4IA 1HV1A 3AB0A 4ZU5A 2RS31 1UAIA 2KM2A 3FC0A 3QOPA 4GA9A 1HX6A 4K3UA 5CB7A 3GBGA 1FATA 3SISA 1DF0A 2ZHKA 4FXKB 4IQPA 1FAYA 4LUMA 3FHIB 5FMOS 3WCSA 4R9DA 4Q29A 4FO9A 3OGJA 4KG8A 5LEKA 3I7DA 1CAUA 3VBOB 1QJX1 3AP9A 2DV9A 4FT8A 3VDDA 2R49A 1VAKA 4BQ1A 5JCTA 4DY3A 1COV1 2VUJA 3KZ4C 3QACA 4GMP3 1S2BA 4WZCA 3PJQA 3USUA 5JOYA 4XXPA 4I0AA 1J3RA 5KHKA 1SBEA 3QBQA 1QJY3 4HN0A 4DMIA 1PO12 5JR7B 3ZFEC 5KHGA 3C2UA 5IK8A 4OI0A 3AFKA 2QQPA 4J1XA 1URXA 1F8VA 3NWKA 4JGYC 4XDQA 4YG0A 4BOWA 1NCRB 3WG2A 3WR0A 1HW5A 1RUF3 3THPA 1R1A2 1J1LA 3NW4A 1IS3A 5JSPA 2D6MA 4XETA 1V6MA 2HWB3 4QGMA 5BYNA 3TN91 1X8EA 4LBQA 1U5YA 4CDUC 1MS9A 1UPSA 3CL1A 5AC91 2BVBA 3ST7A 4ASMB 2D6KA 3UJOA 3VZNA 3R4UA 3WCRA 3NAPC 4EWAA 5C8CB 5I91A 4Z07A 3HMYA 3URFA 1RUE3 3AP6A 3WUCA 1OPMA 1YNAA 3W9AA 1AR92 1QJU3 4Y1XA 2HWC1 5I8YA 1HDKA 4IV3B 4XHXA 3VBOA 1LEDA 2A73B 5GZCA 1NCQC 3OBTA 1DGWX 1N1YA 4I30A 3ZYRA 5CADA 2E7AA 3M8LA 4FTEA 2WFF2 3D5OA 3U11A 4Y26A 4JCKA 4FAHA 1BQPA 1RUH1 3H1WA 3VKLA 1V9U1 1H4GA 1AR83 4XIKA 3ZXFA 4URTA 2X5IB 3MLKA 1POV3 2VNOA 5E1RA 2HWD3 1WCKA 1MS0A 2XKOA 1X50A 4WM8B 1LTEA 3RJRA 3DUIA 2RS32 2VVFA 1D4M1 5H9RA 1PVC1 1ZM1A 4J1WA 5K0UB 1NQJA 3IM0A 4JAAA 2JD4A 4YFWA 1NLSA 4Q1RA 3HR9A 4JRLA 2A6XA 3ZN4A 1DQ4A 2VVDA 3ASIA 4QMAA 2VPVA 2XBO3 5T5JA 5C8WA 4N53C 4COWA 3NVCA 1KRIA 4LLOA 1S0FA 3VKOA 4Y20B 2DVGA 1QJX2 4MXWA 5AVAA 4RL7A 5C8CA 2Q30A 1N1SA 2FHRA 1COV2 1S0BA 3O5SA 5EJ3A 1PNFA 4QQOA 2XLFA 2ZKNA 1D2SA 4PDWA 1W6NB 4AVBA 5CFCC 4D7SA 3VBSB 4IV3A 5A32A 1Q8VA 3AZYA 1EY2A 2QVSB 2VOWA 4LBLA 5DG2A 3DF0A 3N35A 1RJ7A 2JG8A 4EV0A 1OD5A 1A3KA 1IS6A 4K40A 2H0BA 1D2QA 2GDFA 2DCZA 2VOKA 4ZU4A 1RIRA 3WG4A 3HWJA 2X5IA 4UW3A 1V6JA 4ES8A 1XYPA 3CU7A 3FJSA 5JOXA 2XJTA 5D1IA 1PZ9A 3POWA 1LECA 3K48A 1S0CA 3TN92 2C9AA 4Y1VA 1HRV1 3KS7A 1RUOA 4FPLA 2A75A 5DZEA 5AC92 4YVWA 3WQ1A 1YYNA 2OIIA 2WT1A 3KGLA 1MS3A 1WGPA 1BXHA 1ZZCA 5J98B 2ZZQA 1A78A 2R0FA 1ZRDA 2A7AA 1Z78A 2HWC2 2K2SA 3TWIA 5KC5A 2WQZC 5GALA 1D0GA 5JPNB 4FTBA 1UMZA 4XF0A 4XJAA 3AJZA 3J26N 2BW8A 4PIYA 4H7MA 4XFHA 4RQPC 3LSDA 1JYIA 1QQP1 1W6NA 1UU5A 2GNDA 1V9U2 3ZFEB 4AVSA 3VBSA 3ZFFC 1G86A 2WZR3 3VUOA 4HFSA 1QF3A 1LOEA 3WOGA 4G9SB 1CQ9A 3IN9A 3OTFA 1ZREA 5F1RA 4OFGA 4XIOA 4JGYB 5TSWA 2BBVA 5JAXA 1VAVA 1Q8OA 1AZDA 3AYAA 4AGRA 1UPIA 3VKMA 2QCSB 2PFWA 1GYKA 4QPIA 1D4M2 1RUJ1 3ES1A 3HD8B 1MS1A 2UYBA 3OY8A 1UIKA 1BK1A 1YJKA 3KCXA 4XPVA 2WNVC 3TNQA 5IK7A 5J37A 1KDKA 3ZDSA 1AL21 5J09A 3POSA 4I0BA 5L7OC 1WLTA 2YMZA 3AXEA 2R041 4M3CB 1XYOA 5DDJ2 1GKBA 2ZGSA 4CDUB 5CBLA 4B4PA 1AR63 3N7KA 5GJ6A 2E51A 1MZ5A 3NAPB 1W0PA 2EAKA 2ZGNA 1WW5A 3H9AA 3VHPA 3NV2A 2GC1A 1APNA 1UZZA 3RDIA 1DZQA 4YVSC 1BJQA 5C9AC 5JOWA 5K8SA 3PVEA 2Y0OA 3BOWA 1N47A 2EXKA 1G9BA 1XU2A 1ZBA2 4LBKA 4W6WA 3BCWA 2VUAA 1NCQB 3AM2A 3M3EA 4WV8A 4WVMA 3WQ7A 3UKVA 2VH9A 4ATEA 4WVVA 1VALA 4XBQA 4Y1YA 1JOJA 2EF6A 4Q4W1 3MF9A 3WP6A 1GZ9A 2WFPA 1YXWA 4FOVA 3LZZA 1TME1 4P5HA 2B39A 1QOTA 1XE7A 5BNNC 1QY4A 3GNEA 4SBVA 4FQZA 4LA2A 4DS0A 1NXD1 1K5MA 1CVNA 1RHI1 1QNWA 4YZ5A 3ZYGA 4M01A 2ZGRA 3AXDA 2RMU1 5A33B 1V6KA 2GNBA 2ZMNA 3RYPA 2PTMA 3RG0A 3B9CA 3AMPA 4XYXA 2ES3A 5CFDC 2D3PA 4M3CA 4N53B 1YI9A 4Q0QA 3FWEA 1IQAA 3BU7A 1BKZA 2HWF3 2PLV1 4FCAA 4PLOA 3AKQA 4R8HA 5FPZA 2ZJCA 3IKWA 1O3RA 2I45A 3R4SA 4COYA 1R081 5T52A 1LHWA 1SACA 3VZLA 1AR73 1QQP2 3FZ3A 2G9FA 2ILMA 5CFCB 3AX4A 2KXLA 3O0VA 1KXGA 4GB31 1X82A 1H1AA 4I0WB 4KG0A 1G9FA 1L3JA 1NOVA 1BEV1 1LHOA 2IXCA 4DOUA 4N9IA 4Q0SA 1H1IA 1CJDA 3NKGA 1ZZBA 2AENA 1RUJ2 4M0HA 1LGBA 2AUYA 4AHZA 3IT8A 2P2KA 1C5IA 2ZAHA 4CDQA 5FO8B 1QXPA 4PIXA 4KNCA 1AL22 1GNZA 1PGSA 2R042 1VBA2 4HSJA 3DPRC 4QQ2A 4F8AA 3AJYA 2OVUA 1LULA 3OJBA 4NPRA 2HEWF 5A33A 3VL8A 4GMP0 4HK8A 4N43B 5CG8A 4YW2A 1SLTA 3B3QE 3NKTA 2LUWA 4H55A 2QJVA 3IDEA 4FPCA 5IK5A 4CP2A 1YFUA 1H2KA 3C3VA 1QXJA 4JGZA 1W6MA 1RL3A 1OKQA 2WS91 3H8UA 1XXNA 3ZXGA 4RQPB 4RHV3 4Q4W2 4FQ4A 4HSLA 4HVRA 3KGZA 3M4FA 1WW7A 4PBPA 5CFCA 1TME2 1W6OB 4GXLA 1ALYA 4K8FA 4OVEA 3ZFFB 5GZEA 4MXVA 4XXAA 4BMEA 4IV1A 1ND2C 2DTWA 4D7YA 1YFWA 3AKRA 1I1EA 2XGXA 5J3UA 2YZ4A 5E8AA 1U0AA 5FREA 2QKDA 1RHI2 2A6ZA 2RMU2 1EAH1 4NR1A 2R30A 5L7OB 4D69A 1B35C 1TNRA 3KMHA 3T1MA 4QHBA 3EJKA 3E97A 4CDXA 3LB9A 3AMHA 2AGSA 1PIV3 3J4UH 2PLV2 4JC1A 1C8M3 5JZGA 1KD7A 4N43A 2PHLA 1F2NA 5C4WC 2RR11 1R082 4YVSB 5C9AB 3MF6A 1LOGA 3MIBA 5HCFA 1GFF2 1RUI3 3VKNA 1SEFA 4GB32 2ZACA 5J36A 4GH4C 1G6NA 2A6WA 1POV0 2P3KA 2ZHLA 4FOWA 3TAYA 4CDWA 1BEV2 2MEV3 3O0WA 4Q0VA 4W6YA 4AK3A 3ZXJA 2ARBA 4LEJA 1BYHA 4DY5A 3OGGA 1AUYA 4LULA 1E57A 5I0UA 4XBNA 3VLBB 3WNXA 3GYDA 1W6OA 3ZFFA 2NN8A 2HEYF 2TBVA 5F6KA 5AFEA 2K0GA 1QU0A 4I3GA 3EHKA 5BNNB 2GC3A 3AYEA 4H14A 3SHRA 5T54A 2ZAAA 1PO21 3JBG3 4I01A 1AYM1 4L11A 1IOAA 1IPKA 5SV5A 3ZX7A 2XG3A 2R062 4JDOA 4XF1A 3WG1A 4E2QA 4IXLA 1VJ2A 5DXDA 3GHMA 1ZBE3 3KD4A 1W6PA 3MICA 4RR3A 3UKTA 4AEJA 4AEDC 1SCRA 3VBFC 5GM0A 2PAKA 1C8NA 1Y3TA 4N7IA 5JLVA 4RGGA 3WINE 2XVGA 3SCFA 2E63A 4NWVA 4JVAA 4L2NA 2WS92 1RMU1 1KITA 2EXJA 2E7TA 3DKWA 3WT3A 2IXJA 1LKNA 1ULFA 2XB6C 4MGZE 4YVSA 5LRRA 3LKJA 1OMIA 4E2GA 1YRZA 3LA3A 1SDWA 2YV8A 2VECA 1FMD1 4QPGA 4LBQD 4IEUA 2WNUB 1MQTA 3ZXEA 3MIDA 2JG9A 1RC6A 4FSJA 2MNGA 4QU2A 1UW8A 4MGIE 1ZX5A 3E5UA 2HKXA 5CAZA 1QDCA 1VB2A 3AZVA 2XJRA 2W0XA 3B93A 1EAH2 1KFXL 3NV1A 5B2GB 5A3LA 1H8TC 1RITA 4NHKA 1CPNA 3INAA 4AHYA 3AZXA 4WBBA 2BNNA 4P9IA 4AI1A 1A8DA 3NV4A 3WZ1A 2WQ4A 4LLFA 1O3SA 2RR12 3JD73 2BYVE 2XH6A 4KBBA 4OI2A 3UKNA 1QXRA 3WDYA 1VBD3 2GN3A 5D8AC 1GZCA 1C5HA 4E9KA 1I9RA 4JRAA 2HWE3 1EP0A 4Z92B 1RVF3 5C6CA 3OF1A 3O0XA 3FBMA 2D7FA 1GSLA 4L9BA 1KJRA 4FPOB 2D3RA 4AFAA 4Z1VA 2ZPXA 4R9AA 2XHKA 2WNUA 5EZWA 4YRDA 4GMP1 1SFYA 4LE3A 3BALA 5GLWA 3KCCA 1F5FA 5A3MA 1ND2B 4XILA 2D43A 4UW4A 2PHXA 1PO22 1QJY1 4KU7A 1FOD3 1CAXB 1AYM2 5SV8A 4Q8KA 3PJYA 3FLTA 3B7MA 2WWSA 5BY5A 1GLHA 3FE5A 2C1FA 1PO13 3I59A 2YC0A 1PGW1 1V6NA 2E7QA 4CEWC 5BXXA 4W6XA 3G6JB 2P3IA 2ZGTA 3WY6A 1GR3A 5CVRA 1RUF1 4JTNA 2XL7A 1SCSA 1QMJA 5AFBA 1ZA4A 1O4ZA 1RMU2 1AXYA 5C4WB 4Q1PA 2VOVA 1LHUA 4JDMA 1PNGA 4XJ9A 1QDOA 3NO8A 3ZYJB 1ND3B 1OOPA 2CAVA 1FMD2 3SH4A 4AWDA 3WHUA 4YYOA 3VL9A 2VQAA 4QM8A 2Z5WA 1VBC2 2TEPA 4HBNA 1RUE1 2TNFA 1LESA 4YG3A 4WM7B 1HRI3 2LALA 3RNSA 3WX5A 3ILNA 1QJU1 1HLCA 4HKLA 4BIOA 1M06G 5J48A 4R9CA 2VW1A 4B4RA 1H8VA 3RPQA 5FCCA 4GWNA 4XZPA 1ZZ9A 3ZVXA 1OHFA 1LGCA 1QHDA 3WXPA 2WT0A 1ASJ3 4XOGA 4XHBA 2R16A 4Y22B 2R073 3D6EA 3WV6A 3L9JT 1VLNA 4SLIA 5I93A 3EBRA 4ES9A 4HZFA 1AR81 3CJXA 4OHXA 1WW4A 1ULDA 1I6XA 1POV1 2HWD1 1OA3A 3I8TA 4GKXA 2JDZA 5BNOB 3HT1A 3ZXAC 1FI2A 3ZXKA 2X29A 3WP5A 3VBFB 4DB5A 1MZ6A 3HAGA 2DFBA 3EXUA 4LO5B 2GH2A 3VV1A 3UV9A 1NG0A 3E5QA 2XBO1 4KU8A 3ZXDA 4XMIA 2SBAA 4XJWA 1XQNA 3VN4A 2I07B 4AGGA 4OI1A 1ND3A 2YY1A 4KL1A 1VP6A 4QM9A 3X29B 1GBGA 1NYWA 2ZHMA 3TRSB 1RB8G 1TNFA 4AEKA 1V6IA 3CEWA 1MS4A 3P3NA 3JCIA 4WM7A 2B7YA 4FP2A 4M3CF 1QJY2 3MFAA 4PCRA 1XNCA 5JPMB 1MEC3 3KT1A 1O5UA 1D4VB 4BM8A 4PJYA 2NP0A 1KS4A 1GZWB 1PMIA 2ET1A 1PGW2 3H7JA 1QOOA 1NCRA 1XNBA 2WZPP 1CAVB 1YO8A 2YYOA 2H6BA 1Y9QA 2PELA 1Z0HA 1RUF2 2EALA 2Y38A 2Z2SB 3PVOA 3SCGA 1J3QA 4KH9A 2VW2A 3H1MA 1W2UA 3E6DA 4IEPA 3WDWA 5DUWA 3KT7A 1WBLA 5DDJ1 1FNYA 4BH9A 5BNOA 2EVXA 5ACA1 5JWPA 3WW3A 1RUC3 2W39A 1W6QB 2RS13 5D8AB 4LUKA 5FO9B 1H2LA 1LOFC 2YUEA 3B02A 4JTOA 4LBOA 1YJLA 1LB2A 1RUE2 1REDA 1V00A 2CWMA 1FYUA 5LRSA 4BWOA 4Q26A 2OPKA 3ATGA 1QJU2 3GBWA 5DUUA 4RD7A 4PLNA 1OSGA 1ZBA1 4DRVA 2ZX1A 5E16A 1O7FA 1YIPA 4P14A 4DINB 1DGWA 3KB5A 4XQDA 3BODA 4YGDA 2WINB 4E4ZA 1WCSA 4MV2A 5BNPB 1G7YA 3ZFGC 4CEYC 4ZKTB 1AR82 5ABJC 4B8EA 2P37A 4XBLA 5JVVA 4M0NA 2WZR1 2WT2A 3ZSJA 2VU9A 1TE1B 3I2DA 4C0HA 1RUH3 2HWD2 4G4FA 2AR6A 1LOCA 3MIFA 4WM8A 4YG6A 1PZ8A 2JKBA 1CAVA 1WLDA 5K0UA 4COUA 4DZGA 2FBEA 2FMYA 5E88A 5T3NA 3DN7A 1YLLA 4JDNA 4TSVA 1WW6A 3R05A 4Q0PA 3JB4C 3MDPA 1PVC3 3S7IA 4XQ4A 4OHWA 3U4XA 3M3CA 5IT6A 1DHKB 2EXIA 2XBO2 3ACLA 3WDXA 1RUD3 4Y1ZA 1AR61 4Q27A 3ZPYA 2W52A 4Y20A 5GKAC 4IEOA 3OYWB 1VRH3 2XL9A 4MLOA 4Q4Y3 1J1TA 3N36A 4EN9B 1QH7A 2PHUA 3I54A 3VBUC 1DFQA 3ZN5A 1ZVFA 2R6QA 3H7YA 3OD0A 2IXKA 4AFCA 2OUHA 4YM2A 3AKPA 3USSA 2MHFA 3OCPA 4LO8A 3TBDA 2X53S 2C5DA 2ZX0A 3BOPA 2ZGUA 4C0BA 2QZ3A 1REEA 2DCKA 4A7ZA 3V0BB 4YLZA 1H30A 2C0ZA 5BNPA 1AF9A 2CTVA 1CAWB 1SLLA 1QH6A 1PK6C 4FPYA 1ZYBA 2B8MA 2WC2A 4WVWA 1HKDA 1EV13 1OA4A 4I3PA 1YCIA 4AF9A 2A6VA 2ENRA 4L8QA 1DQ0A 4P9WA 1VBA1 5ACA2 1UX6A 3O12A 3ZSEA 3B69A 3TB0A 3M3QA 1UZYA 4WVZA 1WMDA 3VHNA 1HRV3 3UJQA 3VHRA 4TLFA 4RS5C 2IFWA 3D0SA 3DL3A 3EQEA 5DZFA 1SQ4A 1JN2P 1X36A 2IWGB 4FPJA 4I02A 2HWF1 5T5PA 4EN0A 4D94A 1A8MA 2F6BA 3OYWA 1FPN3 4YW5A 2D40A 5CU1A 3P3PA 4U36A 3GF6A 4BHPA 3AYCA 5EV7A 3V0AB 1AR71 2P34A 3CNAA 4ZU7A 2NZ9A 3PTYA 3ZFEA 2BWAA 4WZFA 2WZR2 1JBCA 3V64A 4IERA 3E5XA 1OI6A 4J6GA 2BNMA 1RTVA 4K6BA 1F5JA 1ZZ7A 2I74A 4JGYA 1N3QA 2O8OA 3V0BA 2GMPA 4QXKA 4GWMA 4DXZA 1CAWA 3CJIC 3RQ0A 4CYDA 2O0OA 2A70A 2XJQA 1O3QA 1LHNA 1LU1A 1MR5A 4LA3A 4A7YA 5FFOC 1HQNA 3B00A 2OZ6A 4W65A 3J8F3 4CDUA 4NO4A 1AR62 3MFCA 2WJSA 3MPBA 2VVEA 3NAPA 4Q0UA 4D3WA 1NA1C 1DQ5A 4QGLA 1JW6A 1VBE3 1LJ7A 4BIFA 1NQDA 4XJUA 4CRQA 3QH7A 3ME2A 3QD6A 3QLQA 1XYNA 1ZZ8A 5H9SA 3HQXA 1NZCA 2UWAA 3O14A 1WMFA 1QWRA 1NCQA 1UD1A 4Q4V3 1TMF1 4B4QA 2VQ0A 5EWSA 1F31A 2UU8A 3R4DB 5KHIA 3S7EA 1AHSA 1GANA 3O7OA 4AI0A 4AW7A 4OZXA 1SLBA 3UL2A 3ZFGB 2ZGKA 3DV8A 4CEYB 2QZ2A 4LT5A 5ABJB 2EXHA 2GNMA 1ENRA 3MYXA 3WDUA 1TEIA 2RJKA 4R9BA 2P17A 2OZJA 1TME3 2ETEA 1ZRRA 2ZZJA 2Q5TA 4EJRA 4Z82A 2XWJB 3U0ZA 1S2KA 2Q1ZB 3VBHC 4PIZA 1MZFA 1MVEA 4OUMA 2DFCA 2R061 1UU6A 2PHTA 4OHZA 3JQWA 1U12A 4EROA 1YHFA 1S0EA 4YARA 4N53A 2PHDA 4XQWA 5FPXA 4HN1A 4MUVA 4Q4X1 1IGOA 1PIV1 2HWF2 1C8M1 3WLUA 3G7DA 2VULA 3HIFA 3AP5A 2D6PA 3WQ0A 1LHVA 4FVVA 3VBUB 1O3TA 1AR72 1DGRN 4C90A 2OW4A 1RUI1 4QQPA 4ISRA 2XVKA 4YGCA 3GALA 3EO6A 3FUOA 2VY0A 2MEV1 3WD5A 4GB33 3IWZA 4LNVA 3VDDC 2PAMA 4AQ6A 2WLPA 4GKYA 4Q2FA 4FOYA 2VGDA 5FQ0B 1CX4A 5I0RA 1PK6B 5CG9A 2Q8OA 2ZGPA 4TYSA 1SBFA 4N90A 2WNVB 4M3CE 1M4WA 3RWNA 2DVDA 3AP7A 2RM23 4P9YA 5JMCA 2DVFA 3SH5A 2VMIA 3ZIXA 3JBG1 3MGUA 1IS5A 3M3OA 3D0JA 2ZCWA 4FXGB 3N7JA 4YZ3A 3D4KA 5J7MA 2A3XA 3PVNA 1ZBE1 4BPZA 2NMOA 2MPFA 3MPPG 2E53A 1LCLA 3N7LA 1ENQA