1C8M3

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
238
structure length
238
Chain Sequence
b'GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
molecule tags Virus
total genus 35
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m300
4Q4X1 1RUH1 4GH4A 1MQTB 1FPN2 4QPGC 2BPA2 1FMD2 4YVWA 1POV1 1TME1 4WM8B 1F2NA 1NCRA 3JBG1 4CDXA 2RS51 3ZFFC 2TBVA 4RHV3 5C9AA 1AYM3 4CDWB 5C4WB 2HWE1 1ZBE2 1HX6A 1K5MB 1OOPA 2R071 1BMV1 2FZ1A 1OPOA 3VBSC 4RR3B 2RMU3 1NCQA 1ND3C 3ZFEB 4GMP0 1Z7S1 2RS12 2WZR1 5FMOS 3VBUA 1RUD1 5JZGC 2WLPA 1VBE2 1POV0 2WWSA 4Y4YA 1AR61 2R063 1ZBA3 1EAH1 1AL21 5K0UC 5ABJB 3ZFGC 1DDLA 1ND2B 5AC92 1RB8G 1HRV3 5BNOC 1NOVA 1AUYA 1R092 2QQPA 1HRI3 4RQPB 4Q4V2 4RS5C 5D8AA 4SBVA 2PLV3 4QPIA 4IV1B 1R083 2HWF3 1Z7S2 4FTSA 4BCUA 3VBHA 1RHI1 4CEYB 5A32B 1NG0A 1RVF3 2R043 4GMP3 1V9U3 4AEDB 4JGYB 1AR71 2MEV3 1POV3 1RUC1 3CJIC 1E57A 1B35C 1QJY2 2HWC2 2ZZQA 5BNPA 4IV3C 1R1A1 3JBG3 2BUKA 1VRH2 1RUI3 4JGZC 4QPGB 4PDWC 2RS31 1TMF2 5DDJ1 3VBOA 3VDDA 4GH4C 1PO21 1RUG2 5A33A 1PGL2 3VBFA 1QJX2 1NY71 4YVWC 2X5IA 3ZFFB 4NWWA 1AR91 3JD71 1BBT2 1NCRC 1HQNA 1QQP3 4CDXC 4N53A 1VBD2 1C8M3 4LLFA 1FOD1 5ACA2 1RMU3 1PO13 5C9AC 2WZR3 4CDQB 1F8VA 3J8F2 2HWD1 2WS93 1ASJ3 4EJRA 3TN93 3VBSB 1D4M2 1FPN1 4GB32 1AL0G 1OOPC 1FMD1 1ND3B 1AL23 1C8M2 2HWB3 5JZGB 1NCQC 1H8TB 1BEV2 5K0UB 3ZFGB 1RUF3 3VBUC 1ZBE1 2BFUL 4JGZA 4N43C 4RS5B 1SMVA 1VBC3 1COV2 3HAGA 1HXS3 1MEC3 4CDWA 3JB8A 5D8AC 4QPIC 2RS11 2RMU2 2WFF3 1VBE1 3LOBA 3NAPB 1QJZA 1NA1C 1VBB2 3VBHC 1RUE3 5AC91 1PVC2 3CJIB 1R091 1B35B 1ZBA2 4Q4V1 4IV3B 5CFDB 2IZWA 1HRV2 1HRI2 2RM22 1VBA3 1W39A 1AR93 3JD73 2PLV2 5BNPC 2BBVA 1RUJ3 4GH4B 1AYN3 1PIV3 1QJU2 1R082 2HWF2 4Q4W3 4YVWB 1X33A 3VBOC 5J98B 4CEWB 4N43A 5LK7B 3DPRA 3VDDC 4CDUA 1NCRB 4WM7A 4CDXB 5C8CC 2R042 3VBFC 2XBO2 1V9U2 2X5IC 1QJY1 2HWC1 2MEV2 1EV13 1VRH1 4N53C 5GKAC 5CFCA 1TMF1 1NA1A 1RUI2 1VB4A 2RR12 4Q4Y3 1RUG1 1PGL1 1NCQB 1QJX1 4Q4X3 1RUH3 3VBUB 1BBT1 1X36A 1VBD1 1TME3 5BNNB 5ACA1 4YVSA 1M06G 1MQTC 1QQP2 3J8F1 3VBRA 1VBE3 2XPJA 4WM8C 2RS53 1D4M1 1PO12 1RMU2 1VAKA 4GB31 5D8AB 1C8M1 2HWE3 2WS92 1ASJ2 5FMOL 3TN92 5C8CA 2HWB2 3ZXAC 4Q4V3 4CDWC 5C4WC 2R073 1BEV1 3VBHB 2GSYA 1AR82 2ZTNA 1Z7S3 1AYM1 1RUD3 4RR3C 5L7OA 1COV1 1AR63 1EAH3 5BNPB 1VBC2 4Y5Z0 1HXS2 1MEC2 1QJY3 2RMU1 1VB2A 3VBOB 1VRH3 3VDDB 1MQTA 2WFF2 5A33B 1VBB1 3VBFB 5BNOB 1PVC1 4WM8A 2X5IB 1TMF3 4RHV2 1AYM2 1PGW2 1ZBA1 3DPRC 4CDUC 1RUG3 4WM7C 1RUE2 1RHI3 1HRV1 4N53B 1A6CA 1HRI1 3NAPA 2RM21 1CJDA 1C8NA 5C4WA 1BBT3 2PLV1 3FBMA 4RFT0 1AR73 1VBA2 1RUC3 1K5MA 1QJU1 1R081 1RUJ2 2HWF1 3J8F3 1R1A3 5CFCC 4JGYC 1CD3G 1AYN2 4RR3A 1D4M3 3M8LA 1PIV2 3ZFEA 1RVF1 2R041 2RS33 4GMP1 4Q4W2 2XBO1 5DDJ3 2R062 1V9U1 4FTBA 1PO23 2MEV1 4JGZB 4PDWB 4CEWA 5ABJA 1BEV3 4YVSC 1ND2A 1EV12 1RUI1 3VBRC 1GFF2 2RR11 1FOD3 4RQPA 2HWD3 4Q4Y2 1COV3 1FPN3 1FMD3 1RVF2 4IV1A 4CDQC 4Q4X2 1RUH2 5C9AB 2GH8A 1QQP1 4CEYA 5J96B 5A32A 1TME2 1OOPB 1PO11 1RMU1 1WCDJ 3JBG2 4AEDA 1VBB3 1ZBE3 4JGYA 5L7OC 2WS91 1ASJ1 3TN91 1PVC3 2RS52 1H8TC 5BNNA 2HWE2 2HWB1 4QPGA 4NWVA 2RM23 1AR81 2R072 1BMV2 2Y26A 4N43B 3DPRB 2RS13 4CDUB 1RUF1 2DF7A 4WM7B 1QJU3 3ZFFA 2ZAHA 2WZR2 1RUD2 1VBC1 1IHMA 4QPIB 5AC93 1AR62 2XBO3 1R093 3NAPC 1EAH2 1AL22 1HXS1 1MEC1 4CDQA 5CFCB 1NA1B 2VQ0A 3VBSA 2BFUS 1K5MC 2WFF1 1ND3A 5CFDC 4RHV1 1PGW1 2RR13 1RUF2 5JZGA 1OHFA 1RUE1 3ZFEC 1H8TA 5K0UA 3ZFGA 4YVSB 1RHI2 5BNOA 3VBRB 1VBA1 4Z92B 4CEWC 3JB4C 4RS5A 5ABJC 2HWC3 4FTEA 1RUJ1 1ND2C 1AR72 1RUC2 1AYN1 5FOJB 5C8CB 4RQPC 1PIV1 4Q4W1 1R1A2 2R061 2RS32 1QJX3 4IV1C 5DDJ2 2FZ2A 1PO22 3S6PA 5L7OB 1NY72 4CEYC 1EV11 1AR83 1VBD3 3CJIA 1B35A 5ACA3 1AR92 3JD72 4IV3A 5CFDA 4AEDC 4Q4Y1 1FOD2 4PDWA 4FSJA 5BNNC 4GB33 2HWD2 3IDEA
chains in the Genus database with same CATH superfamily
4HL0A 5LRRA 1ONAA 2ARXA 3CJXA 2BOIA 4XFFA 2A6VA 3VKFC 2Y64A 2BPA2 4XZUG 3JUUA 4HETA 4AF9A 3EBRA 3A0KA 4QGNA 2VNOA 4FPFA 2ZCWA 4BHPA 2ORXA 4XURA 1W28A 4NHMA 1NCRA 3AC0A 2SBAA 4FAGA 5F6KA 5C33A 4FI9A 1W2TA 4JV4A 4U2AA 4AAPA 3ZFFC 4Y1XA 4RHV3 3AVSA 1XRUA 5C4WB 2HWE1 4D7YA 1WUVA 1OURA 4F3JA 3CKHA 3N7LA 3OUIA 5BNQA 1OOPA 2W91A 2WC2A 2WZPP 5FP7A 1IG3A 2GC2A 3OBRA 1CAVA 1UOBA 2GU9A 5I0UA 4TSVA 2QNKA 1SQ4A 3VBSC 1JZ2A 2IWGB 2EALA 2Y33A 3A7QA 2K46A 3AYAA 4AVTA 1EY2A 5DAQA 4QD2A 2ZMLA 2HH9A 2Y6HA 3O0WA 3IIAA 4URAA 4QPYA 2AGSA 4QDRA 4Y1YA 4CU9A 3N7MA 1POV0 2WWSA 2R063 4BM8A 5K0UC 2GH2A 3ZFGC 2BRTA 1RIRA 5IAVA 2EIEA 1ND2B 1GOHA 3PNAA 5JPMB 2W68A 2E32A 3WQ1A 1HRI3 1VMJA 1UAIA 3KF5A 3WNMA 5F1RA 3DECA 2IXLA 3HNYM 1I5ZA 5CZKA 5D8AA 2PLV3 1MZFA 5L9VA 2VMIA 3OPTA 2FCUA 4L8QA 3V0AB 4Q27A 1CQ9A 5FYYA 1KRIA 4RYDA 1NE4A 1X82A 4Z8BA 3OEBA 3WQBA 2IXIA 2ES3A 2WQZC 1NX9A 4MZUA 3FLRA 2JDZA 1RL3A 4BCUA 1WD4A 1CIWA 1O91A 3VBHA 1RHI1 2JD9A 4C1WA 2YMZA 3ILNA 2SLIA 2VAUA 5LA0A 5DUWA 2GMEA 4JGYB 5EQUA 3LFIA 4CXXA 1AR71 1POV3 2AEZA 2VOKA 2W52A 3BTXA 1B35C 3ZYBA 4LBQD 1Y9MA 4IV3C 4MHUA 3JBG3 2BUKA 2VBBA 4YGCA 3I49A 1RUI3 3NMBA 2WQ4A 5FY1A 4JGZC 4UW4A 2QDNA 5A7WA 3DN7A 5DZEA 3M3IA 5C5TA 4Q1RA 3UK9A 2EIDA 2EIBA 3VBOA 1UX7A 1UU4A 2D6PA 2D93A 4WV8A 1WD3A 3K51A 4ZXKA 3H3ZA 4NVPA 1PGL2 3VBFA 5A3UA 2X5IA 2OZ6A 3LD8A 4YZ1A 2DVGA 4NWWA 2PHLA 1N3PA 4KH9A 4EN6B 2XONA 1W0PA 4JRLA 1NCRC 4Y33A 4FPJA 2WRAA 1SZBA 1J84A 1YJKA 1R1ZA 2DBIA 4R8HA 2A1XA 2WN2A 1OLMA 2WNVB 2W94A 4PHZA 3HVDA 4CSWA 3J8F2 3NV2A 3MZHA 3SITA 3DKQA 2WS93 2LS6A 5FY4A 5FOBB 5FZ3A 4B29A 5I0SA 1OOPC 1FMD1 2UYAA 1AL23 1C3HA 1C8M2 1H2KA 2DFBA 5EZWA 3GZTB 4M4PA 3P5BA 1W04A 2DURA 1WCQA 1W6OB 4AI9A 3SH3A 1UOFA 4L9BA 4UFIA 1YIFA 1FT9A 1G6NA 3AZZA 3R05A 1W6NB 1A3KA 1H8TB 1ZRIA 2B9VA 3P6BA 4HPKB 1BVVA 5DUXA 4Z07A 1BEV2 4CVUA 1GP6A 3ATGA 2D5FA 1I9RA 1DGRA 3MIDA 2QE3A 3NJVA 3WDVA 1HIXA 4DUVA 2GMMA 4LO6B 5EIYB 1CVNA 3MPBA 4XFAA 4RS5B 5JI9A 1PHMA 3W20A 1QKQA 3KV5A 4QAWA 4ZKTB 1QOOA 1FV3A 5F5AA 5J36A 3QACA 1MEC3 3PIJA 3ES1A 4KWKA 5D8AC 3WNOA 4NPRA 1ENRA 3KV6A 4IESA 3ZXGA 5HV0A 4NIAA 1P8JA 3M3EA 2HJIA 4XFBA 4IEZA 5FXVA 4LK6A 1G9DA 1HJFA 2WFF3 1O3RA 3LKJA 4HSLA 4XDPA 3NV4A 4HSJA 4UOJA 4D3WA 2O1QA 4GKYA 2GAUA 1VBB2 3VBHC 2VZ1A 1RUE3 1AXKA 1YFUA 4QU2A 3CJIB 2B46X 1W6QB 1WW7A 5FMCA 2J1TA 3AP6A 2GNMA 2XXZA 3PVEA 3GCWA 5G04L 1NE6A 4AVAA 1HRI2 1F9KA 2RM22 1XYOA 3AYEA 4XUTA 1ZZ6A 4YARA 2AC1A 2QZ2A 1AR93 3ABZA 2CGOA 2PLV2 3ZYFA 2DBNA 1RUJ3 1GQHA 4LJHA 4XOGA 1JN2P 3MW2A 5FKBA 5JOZA 3UGHA 1AYN3 3NW4A 3IDCB 2KR2A 1PIV3 4YVWB 5FAXA 1NZIA 3WY6A 1X33A 3WNPA 5FZ0A 3VBOC 3MLKA 3BGAA 3DPRA 5T3NA 1GLHA 2X29A 2RDRA 1ZRCA 3VBFC 4TWTA 1ST8A 1V6MA 2X5IC 4LXLA 4M00A 2E33A 5A1FA 2GALA 3ZR5A 2PHUA 5J3UA 2ZX3A 4OZOA 3THTA 2QQLA 1EV13 4AVVA 3U37A 3MW4A 5ISLA 3SISA 1RINA 5CFCA 5FLIA 2B9UA 4X6RB 3T1LA 3DL3A 1NA1A 1RUI2 4O9GA 4XILA 3ACIA 4NHKA 3KM5A 1PMIA 5IK5A 1RUG1 1PNGA 3KGLA 1QJX1 3BTAA 1VMHA 3DYMA 5JOXA 3MLLA 2XJRA 3ZSMA 4P08A 4O61A 1PM4A 2VO5A 1S2BA 5FLHA 5SV8A 3B9IA 1J1LA 2DV9A 5IVJA 1W8OA 2ADDA 4FOQA 4YVSA 1LTEA 1JYNA 1C1FA 4HLTA 5FYCA 2UY9A 2VZVA 2Y6GA 2VMDA 2OUJA 1VBE3 4MXWB 5D2AA 5LWBA 2CWMA 1OQDA 2XPJA 1D4M1 4GB31 5F32A 1Y3TA 2CL2A 4LE3A 4E9KA 2HWE3 2WS92 5FMOL 4N7UA 4RGAA 2VNVA 1I3HA 1HQLA 1JYCA 4Q4V3 2QFEA 3NV3A 4BK4A 1H9PA 3FX3A 2TNFA 4DOUA 2Z5WA 4K8RB 5DMYA 5CKNA 1E5HA 2P1BA 1YFYA 2Y34A 5FZ8A 1D7PM 1XNBA 2R32A 1DQ2A 1WW6A 4J6GA 4CPBA 1AYM1 1JW6A 2ETEA 2XR4A 2DWRA 1WLWA 2Y8KA 4PIZA 5F2SA 4XTPA 1S55A 4FVVA 4RR3C 3KMHA 4UW5A 1MR5A 1GR3A 1JZ7A 1OA4A 5JXHA 3GNEA 1K42A 4JTNA 4DQAA 5HPOA 1H1IA 3JCIA 1SCSA 1MVQA 3ZN6A 5BNPB 2AYHA 1H4GA 4Y5Z0 5JPNB 2ZGPA 2V5DA 3E97A 2TUNA 1L3JA 1EYBA 4EN9B 1MEC2 2RMU1 4DUXA 2X10A 2Q8OA 1VRH3 4XBNA 2VMCA 1W2OA 2WFF2 2YPJA 1FX5A 5A33B 5JOYA 3OPZA 5GZDA 3O0XA 4YFZA 5A70A 1TMF3 1CPMA 1EPWA 2VOTA 2WO2A 2ILMA 3DPRC 5IWFA 5DG1A 3TB0A 4ATEA 4B4RA 1SBEA 4A41A 1VJ2A 1RUE2 3E5XA 1RHI3 4X8NA 4A45A 3O1PA 5A80A 4OUMA 1CZTA 1ZZCA 3USUA 1CJDA 4LKEA 2D43A 5C4WA 2XGXA 3M3OA 4HXCA 5CU1A 4Z82A 2OQ6A 1E5IA 1GP4A 1AR73 2VOXA 3BIEA 3E1F1 3H1YA 1H6XA 3VKLA 3SCHA 5CADA 3VD5A 5FR3A 1NLQA 3PVBB 3WUDA 5CFCC 1RUJ2 3CU7A 1XE8A 1KEXA 1DLCA 3LCPA 1OUXA 1AYN2 2NLRA 3FLPA 3M8LA 4BYYA 1OH4A 1PIV2 1RVF1 5F7UA 2PAEA 4GMP1 1BHGA 2H0VA 3SHRA 3K4DA 2XBO1 3W5MA 1V9U1 1AJKA 1U5YA 2D97A 3VDAA 2ZGTA 3ZOIA 4QHZA 3VUOA 2YC4A 4ZU7A 5HCHA 4MHRA 3D4KA 3OEAA 5K7PA 4JGZB 4KNCA 1N1SA 2AACA 2UY8A 3GJBA 3FFQA 5F3GA 1N1YA 1ODMA 4YVSC 1RITA 4IQPA 1ND2A 3ZMOA 1EV12 5D21A 4GIQA 2P37A 1QOTA 3OBTA 3WG1A 5EHDA 2B8MA 1LESA 3S7EA 3ITQA 2MHFA 4BK5A 2BOJA 4NIDA 1UZZA 3SNMA 1AVBA 1UYZA 2Z69A 1PK6B 3WCSA 3V0AA 3D6EA 2YBSA 3NJYA 2F4LA 3DGTA 1FMD3 4OYUA 3NRUA 1NKGA 1WZXA 5I8SA 3ZXEA 3WF1A 4CXYA 4CCJA 3POIA 5BPXA 1LENA 2CSGA 5FWEA 3GXUA 1V0AA 1KJRA 1CGPA 5T5OA 1XQNA 4E4DX 4P9GA 3NVCA 4LKSA 1OOPB 1RMU1 1BKZA 1WCDJ 1XPWA 4JGYA 1EPZA 1F4AA 1WGPA 5ANNA 5LA9A 2EA7A 2Q1ZB 1ASJ1 2W5FA 3ETQA 4QWNA 2YROA 3SEEA 2HWE2 2C6SA 2NMNA 2YC0A 1DGWX 4LBKA 3MEPA 3VKOA 4CUCA 1JYIA 5FP9A 1Q56A 3FL7A 2QUOA 4PLNA 4DINB 3VV1A 1LHVA 2ZMNA 1C5IA 4Y1UA 1ZA4A 5F9TA 1AR81 1W0OA 1YI7A 3IB3A 2ZPXA 3AFGA 5FZ6A 4IUGA 1VP6A 2YYOA 4CTEA 4N7IA 4CDUB 4BOWA 3H8OA 5GM0A 2JG9C 2E63A 3WG3A 2WKKA 1QJU3 2F17A 1W90A 4LBOA 4FBFA 4AI1A 2V72A 2ZABA 1CR7A 1HV0A 1IHMA 1V6IA 3KS7A 1GWMA 1R64A 5JVVA 3V56A 3VZOA 4PLOA 3WXPA 4D0QA 2VY0A 2LRPA 1YIPA 2ZEXA 1VLNA 4BQ2A 1I1EA 3RG0A 2WNVA 3WF2A 1CJPA 1LGBA 1XE7A 4XEZA 2C24A 3HNMA 2P3KA 4XXPA 2VQ0A 4QXHA 5FYTA 5ANQA 5FZIA 4Q0UA 4XF0A 2WO3A 3CQOA 1JBCA 1UNBA 1Y43B 5HCFA 1D2QA 5FO7B 1WLCA 1YQ2A 3SCGA 4RHV1 4DNYA 3SCFA 4X6QB 2RR13 1RUF2 4LKFA 3ZN5A 4QX3A 5A3NA 4DPNA 4LHKA 1W6NA 1H8TA 4EYUA 5FZ4A 5L36A 3ZYRA 4IEWA 4MGZE 4DXRA 1JZ8A 1RHI2 4IGPA 1UZYA 2WR9A 3L2HA 4RD7A 5BNOA 3SH5A 3H9AA 2N7GA 1VBA1 4XUQA 3AX4A 4Z92B 4RS5A 4GWNA 5IAXA 1RUNA 3BPSA 3AXDA 3I8TA 3D3AA 1ZA7A 1ND2C 2FHRA 1AR72 4W65A 1JYWA 3EMRA 1N1TA 1OFSA 1VIWB 2OUHA 4LO5B 3LDBA 3GM8A 2PHFA 1OF4A 2W47A 2R061 1IPJA 1US2A 1Q8SA 4YW1A 1W2UA 2VMHA 2E7QA 4XIOA 4P9IA 4COYA 2IXKA 1QJX3 3KLSA 3H7YA 5A6XA 3B3QE 5E16A 3ASIA 4LO7A 2EXJA 1BLZA 4URTA 2AEYA 5FWJA 3WHUA 3TNQA 3PMEA 5L7OB 3AKRA 1HB2A 3KV4A 4M4RA 3CJIA 2AUYA 4M3CE 1W6QA 3ZYGA 3VKNA 2XKOA 2ZA9A 2K0GA 5EJ3A 4DIQA 4HK8A 3PJYA 1FNYA 4FSJA 1LGCA 2FDHA 4GB33 2FD8A 1DIWA 2E53A 5JCTA 3FHQA 1RUH1 4KGGA 4CUAA 4JTOA 2VCAA 2P34A 4IEQA 5JXGA 1QY4A 3OGJA 1FMD2 2WSVA 3KQ4B 5CISA 2OW4A 1UKGA 1S2KA 1TQ5A 1POV1 4QM9A 4YVWA 3O1SA 2GDFA 2BQPA 2NP0A 4DZGA 2Z2SB 2WWJA 2Q1FA 4A3ZA 1YFWA 3DXTA 2OVUA 3JBG1 4CP9A 3N7KA 3UNPA 5FZCA 3D8CA 2RS51 2CAVA 5C9AA 1AYM3 4XJUA 1J3QA 3LIHA 1HX6A 4OULA 4AHZA 5DN2A 1W2NA 5FPVA 4BPZA 2WNVC 3KQRA 4CUBA 4W6YA 5IJRA 4BMBA 3ACFA 3EB7A 3WOGA 2OYZA 4IE0A 4RR3B 2RMU3 2WT0A 4I3GA 3ZFEB 4BDVB 2ZGLA 4GMP0 2H0BA 1UPSA 1Z7S1 3S57A 2WUHA 5FMOS 3T09A 1RUD1 5JXIA 4XUPA 2IFRA 1W8NA 4DRVA 1GBGA 1UOJA 4Y5SA 4DXZA 3I97A 1AL21 5ABJB 3M7AA 3OD0A 4JZRA 3EO6A 4E2GA 1RB8G 1W0NA 1V6JA 5BNOC 1D0HA 2IFWA 1N3OA 1LHUA 1OUSA 5EFUA 2QQPA 4B1MA 3CDZB 5IK7A 2GC0A 5F6LB 4RS5C 1PMJX 1U5XA 4MLOA 4XF9A 5C5UA 5JMCA 1PX4A 1LHNA 3MUY1 3OOXA 3M1HA 5KBFA 1WBLA 4JDOA 4LA2A 1BK1A 5BY5A 5IVCA 3N3HA 5EXOA 4EN7B 4PJYA 1S0DA 5GALA 5HCBA 2DUOA 5F37A 1OF3A 2PHTA 3MIFA 1NG0A 1RVF3 2ZGRA 3AZYA 4GMP3 4HANA 1E5SA 4JAAA 1OKQA 2W1SA 3RZZA 1V9U3 1MS0A 3ZPOA 3KWVA 2A70A 2ET1A 5A3TA 5FPZA 3Q8BA 2RHPA 2CGPA 1T6BX 2VJXA 2P6HA 4PF5A 1JYVA 3KCCA 2P6CA 1RUC1 3CJIC 1CIYA 1G9CA 3BUCA 5E8AA 5BNPA 3KCXA 2LTNA 4H2AA 3TEWA 4MG2A 2J1EA 3V0BB 2WYSA 2HBTA 1J59A 3ACHA 1RYYA 2YXSA 2FMYA 5KXEA 5FV3A 1DZRA 2XHNA 5JSOA 3QLQA 5GZFA 2W92A 5JR7B 1JZ6A 3LA2A 3WDYA 4ZZ8A 2A5ZA 2F4PA 3Q8FA 4KBZA 3J4UH 4MV2A 4PBOA 4AG4A 2QQUA 1RUG2 4IE4A 5A33A 4QX5A 1QJX2 4E27A 2WLQA 4YVWC 2VZSA 5CA6A 2QQIA 1XBFA 1HV1A 3T2OA 1AR91 1JOJA 1NXMA 2ERFA 3MLJA 1HQNA 3VLBB 4R9AA 4P9LA 2BP6A 4XJAA 4KMQA 1GKBA 2NN8A 3CIHA 4IXLA 3IPVB 4LLFA 4YM0A 4HVQA 5LASA 1RMU3 5C9AC 1SHWB 1A8DA 1F8VA 3NQHA 1B09A 4FPGA 4LO4B 4P00B 3BB6A 5FQ0B 1CX4A 4COWA 1ASJ3 4EJRA 1JUHA 4P9XA 1D4M2 4GB32 1ND3B 1V6LA 3N9NA 2RDQA 5FMBA 4QHBA 5E1RA 1JHJA 4A44A 2EXIA 3ON7A 4EWDA 2QQNA 3AKTA 3WP6A 5K4LA 4QXKA 3GF6A 4XF1A 2Y0IA 3RZKA 5A3OA 3WF3A 4V2VA 3FUQA 3BTYA 1SCRA 1ZBE1 3VHNA 2JDYA 4NIIA 5D1IA 2BFUL 4JGZA 4ES8A 4GALA 3ACGA 2V5YA 3NJZA 2D3RA 2EXKA 4YZ3A 5GZEA 4ZZ5A 3HT2A 2XKPA 5A7OA 4A7KA 1SBDA 4CCOA 1MVEA 3HAGA 3T4HB 3OBZA 3PUHA 3W59A 2JG9B 2VD7A 2YHJA 3IIIA 4YSFA 4G3YC 3RJ2X 3Q8EA 3O0VA 4AYUA 1PK6A 1U0AA 4R9BA 3RQ0A 2RS11 4MADA 1FV2A 5C8WA 2UYBA 2NYYA 2RMU2 2ZX2A 3WDUA 3AZVA 2BTVC 2XJTA 1VBE1 4BQ1A 2IXHA 3OYWB 4HFSA 3LOBA 5E89A 1KD7A 1CAXB 3USUB 5C3SA 4NO4A 5KWRA 1NZCA 1RTVA 1JI6A 3OGGA 1UY0A 3VKMA 5DQ0A 1S0EA 5CVRA 5AC91 1LU2A 4LIVA 1DCSA 4K3UA 2JE7A 2NPIA 4GJZA 5L9RA 1QH7A 1F31A 2QTWB 4Q4V1 3ES4A 1XNDA 3DYPA 5LA2A 2DUQA 1V6OA 5F8PA 4EN8B 3MDPA 2D3SA 3QBQA 2AR6A 2VMGA 4S2DA 1UY3A 1VBA3 1W39A 2FQPA 4LORA 3VDBA 3WSOA 4YZ5A 1YQCA 1Z78A 3O1UA 1KQRA 5AFEA 4TN7A 5BNPC 3AZWA 4XJ8A 4CE8A 5DZFA 5IVVA 4GH4B 1PZ8A 4AGRA 1U5ZA 1WMXA 3UGGA 5LK7B 5I0RA 2ORZA 3OD4A 1U12A 1MPXA 4CDUA 5CEHA 3O1MA 1A34A 2FDKA 3VL8A 2H6BA 1SACA 1OI6A 5FCCA 4H3WA 4QQHA 2XBO2 5F5IA 2JE9A 1V9U2 2ZX4A 3MV01 1OQEA 3AB0A 1TVGA 3C7OA 2HWC1 4DXSA 2JB8A 3K48A 2VULA 3WNLA 5JSRA 1VRH1 3AMQA 4MX3A 2Q4SA 2LM3A 3J7NA 1ZYBA 4Q0QA 3O1TA 1HW5A 1VALA 1YO8A 2DVDA 1GZ9A 3UT0A 4QDQA 1IZ3A 1TMF1 3IKWA 3PUAA 5IK8A 2I2SA 1US3A 2QQWA 5FK8A 5FYSA 4AI8A 4OQ8A 3EQEA 5C3RA 1NCQB 1UIJA 4XUOA 1XNAA 4WVWA 3ZLIA 1RUH3 3I2IA 1XSRA 5KHIA 1UYXA 3MV11 3VBUB 4BH9A 2Y6KA 2IC1A 2VUJA 1K45A 4MYEA 4P14A 4Y26A 2ZJCA 3MFAA 1VBD1 4MSVA 2VG9A 3P1IA 3CO2A 5EWSA 3RZJA 1M06G 5KXBA 3RDIA 3H3LA 4I09A 4JHZA 2EIGA 3GHMA 2YDEA 2X05A 4WM8C 2RS53 1RMU2 5BXXA 3HMYA 2KXLA 3RRDA 1W9TA 3B9CA 2RJKA 3OGRA 2C9KA 4NPMA 1ASJ2 4HKLA 2XJQA 4AR2A 1FI2A 2ENRA 1G7YA 4DY3A 3NV1A 1IQAA 3LDRA 4D7TA 3PUQA 3HD8B 1ZM1A 4ZS2A 3WHTA 1PK6C 4LHSA 2XWJB 2DCTA 4LUKA 2DVBA 1AR82 2XQXA 4Q8KA 2PA7A 4ZU4A 2ZTNA 1JODA 2J1RA 4FOYA 2VZPA 1SLIA 1Z7S3 3WP3A 3H1MA 2DCZA 2ADEA 5DAWA 1RUD3 1TNRA 5L7OA 2IXCA 3Q8AA 3ZYHA 2XDVA 2XLFA 4KWJA 3K46A 1W8TA 1CZVA 2J1UA 3POBA 5JLVA 2ET7A 3JQWA 3C7GA 4NIHA 1M4WA 1O3TA 3KT4A 1ULOA 2PHDA 4H7LA 1QJY3 3LSDA 3WLUA 2DDUA 5CBLA 3HOBA 1J83A 1W8UA 1LHOA 2D7FA 2J1SA 2J22A 3K3NA 3KT1A 1VB2A 2JKXA 3WW2A 4DB5A 2JIJA 2R16A 2Y6LA 3VDDB 4WZFA 1H2NA 3ALQA 3BOWA 5BNOB 1CAUB 4GWIA 3O1RA 1VAVA 4QGLA 4RHV2 5FXXA 1ZBA1 3R0RA 1H2MA 2A3XA 2XJPA 3T2QA 2F6BA 4CDUC 3THPA 5GLWA 1HRV1 5T52A 1A6CA 2WNUB 4ASMB 3NAPA 3AYCA 1JZ5A 3ORJA 1O4ZA 3AXEA 3BPZA 3RGBA 3C3VA 1G86A 1BBT3 1ENSA 4RFT0 2VVFA 4AGGA 5KHJA 3R6SA 1VBA2 1RUC3 4UW3A 4LBLA 4PLMA 5IVFA 3WDWA 3DKWA 1S0GA 3PVNA 4FFHA 4CU6A 1QJU1 3ACLA 3FHIB 2OXBA 4QQLA 3PHMA 1SBFA 2LUWA 3FUOA 3WNKA 3H8RA 3WNNA 3WNXA 5A7NA 4G4FA 2R49A 4RR3A 3BU7A 2AH2A 4YW7A 1UZVA 3ZFEA 3WR0A 4P5HA 4XETA 3WQ7A 3I2GA 2R062 3WF4A 3ZYJB 1SLLA 2BBAA 2PQSA 4QQOA 4MUVA 4BZ4A 4FTBA 2GC3A 2VGDA 3B94A 3SLIA 1Y9GA 2VZOA 2XJVA 3MIHA 2MEV1 4BJ0A 4EZ4A 3KT7A 4XYXA 1ULFA 5CKMA 2OPWA 4CCEA 1W9YA 4CEWA 4CCDA 3BI3A 1OSGA 5JI7A 5ABJA 5FPXA 4OI0A 1WMFA 3HQUA 4JKKA 4XQ4A 2B42B 4XQWA 4AQ2A 1H2LA 1GFF2 1W9SA 1JZ3A 2RR11 1AXYA 4D6RA 2WYFA 3IZOA 1QDCA 5C3PA 4NE9A 2JDPA 5C6CA 4ZONA 1QNWA 3I59B 3ZVXA 3CBNA 2A75A 4XJ9A 2CYFA 2WNOA 3GZUC 3AP7A 1COV3 4D6QA 3C2UA 1C57A 3IAPA 2E26A 4CP9B 2BGOA 3ZMNA 4CDQC 1RUH2 4M01A 4EV0A 3S5AA 4B4PA 5C9AB 1Q5OA 4EWAA 2GH8A 1QQP1 4W50A 5IYYA 3GBGA 4S2FA 1G8WA 1HDKA 3WCRA 4LA3A 4QKDA 4ZHNA 3JBG2 1ZBE3 2Z79A 1Q8PA 1JH5A 3FN9A 1LHWA 3LSEA 4I30A 5HI0A 5L7OC 1PVC3 2RS52 3K75B 4NHYA 4DRRA 4FT8A 5BNNA 3KCYA 2CDPA 1YLLA 2HWB1 3LEGA 3V0BA 1OD3A 1XC6A 2X8KA 4IEOA 5JWPA 1GNHA 1SLBA 4Q0VA 4NWVA 4QPWA 1OLME 3H7JA 4JRAA 4BQWA 3VN4A 1PNFA 3TEYA 1OBNA 4FPHA 2Y26A 4IERA 4LHLA 2RS13 1F35A 4BQXA 4KU7A 1W03A 4Y5TA 4WM7B 3SC7X 1AX1A 4E2QA 1KJLA 1VMFA 1AX0A 3LF7A 1AZDA 2QBXA 1XXNA 2KA3A 3BALA 4FXGB 4JKMA 1RUD2 1W8HA 4SLIA 5FUPA 4IEYA 3HBKA 2VOVA 3VZNA 3HPNA 5AC93 5FXWA 4KWLA 5FZMA 4QXBA 3IPVA 1LOEA 3NAPC 3ZR6A 4XZPA 3FLTA 4DEQA 1HXS1 1AL22 1YCIA 2MNGA 4BQ3A 5FZKA 5FQ0A 1FATA 4IEVA 2J42A 1GNYA 2PHXA 2BFUS 1ND3A 4LKDA 3HBZA 4ATFA 5CFDC 4ARYA 2HEWF 4F8AA 3HN3A 1IPSA 4XACA 2YU1A 2BGPA 2RDSA 4ASLA 4FP2A 3THCA 4ASKA 2JD4A 1GNZA 2E51A 3U4SA 1LULA 1APNA 3GYDA 4N9HA 1JYTA 4IE6A 5K8SA 3ZFEC 1C5HA 4MVTA 3T0AA 3MICA 1IQDC 2VNGA 2Y60A 4BLJA 1W3XA 1H0BA 3FZ3A 2ZEWA 3LA3A 3UKTA 2QCSB 3HEIA 5LBBA 5IFPA 4K21A 4AXOA 2QQVA 1IS3A 3AL6A 3CHXA 3OY8B 3ZN4A 2VM9A 4CEWC 2BZDA 2I74A 1UY2A 1DQ5A 2HWC3 1NAEA 4BLIA 5ABJC 4UT5A 2Z42A 3VZMA 2WAOA 4A2UA 1RUC2 4OHZA 2NM1A 4OUSA 2JG9A 3ZYIB 2NMOA 4ISQA 1MZEA 3H1WA 2GNTA 2VBPA 4Q4W1 1KXGA 5I8TA 4Z2WA 4O7XA 3EXUA 2CTVA 1KS5A 3WUCA 1D0GA 1W2AX 5J7MA 3HWJA 3OGSA 2FCTA 3H3UA 3OCPA 3OYWA 3QH6A 4BB3A 1CAXA 1O8PA 3K4ZA 2JB4A 4IDZA 4P9JA 3PIGA 3S6PA 2OT7A 1V6NA 2VZQA 5C71A 4CCLA 1L7RA 1VBD3 2VPVA 3OTFA 2A6XA 2CWSA 1DBNA 1AR92 2ZEYA 5F39A 1K5JA 4W6XA 2D6KA 3SEPA 4AFDA 5A6QA 2BNOA 4OFGA 4UXAA 3WP5A 4Q0SA 2PQQA 2B7YA 4PDWA 4CZSA 5BNNC 2A3WA 4N90A 4OHVA 4RL7A 1CX1A 1YC61 4O65A 2BVVA 3USSA 3I7DA 4FFGA 1QOSA 1S1AA 3KGZA 4GH4A 4IGOA 4B4QA 4A7YA 4D7SA 4WM8B 1TEIA 2RG4A 3FHAA 3PMSA 3AP4A 2WIIB 1OD5A 4KU8A 3MBWA 4HVOA 3A23A 4UF0B 4JDMA 2JWPA 2TBVA 2WZ8A 2HLEA 1WCKA 1ZBE2 2WBKA 3M3QA 4QXCA 2X09A 1W99A 4RSUA 5JIAA 1X8EA 3W21A 1K5MB 4LK7A 1DGRN 4FPLA 4K7JA 3NNJA 2WA3A 1DQ4A 1ALYA 5BV6A 1CAWB 2J1VA 3J7LA 2FZ1A 4CPBD 3UESA 2W2IA 3MF6A 3ZDVA 3I3QA 1LOCA 3WDXA 4LBQB 1NCQA 1KFXL 1F5JA 1ND3C 3DV8A 3D0SA 1OLRA 3D5OA 1IPKA 4XF3A 2RS12 4E8DA 4OI1A 3VBUA 3C7HA 2D98A 1LEDA 1VBE2 1JUIA 4Y4YA 3FE5A 2XLGA 5FRAA 4EZHA 2YY1A 1ZBA3 3ENRA 3KF3A 2RVAA 4YZ2A 1NT0A 2YFZA 5AC92 1ZRFA 1HRV3 1GP5A 1NOVA 1QXJA 3H8XA 3FC0A 3PU8A 2PFWA 4RQPB 2VZRA 4Q4V2 4AK3A 4EN0A 4Y24A 5L9BA 4QMAA 3E5UA 4NAOA 4UFKA 2W87A 1HQWA 3LEIA 2YZ4A 2R0FA 2VH9A 1GOGA 4HKWA 5DXDA 3M3CA 2BERA 4QU1A 4C0BA 3B5LB 5FZGA 3BKZA 5DZGA 3S0MA 1C4RA 2GN7A 2DCKA 2EAAA 2DU1A 2VTFA 4QB2A 4Y4RA 3X29B 3RWNA 4NPLA 3SQOA 1VPHA 2I45A 5A3MA 2B4KA 2JEMA 4AEDB 1XNKA 4XAEA 1O8SA 4Q1PA 4UFLA 4AGVA 2VC9A 2MEV3 3G7DA 4QX7A 5LEKA 1MZ6A 4M0HA 3UV9A 3GGLA 5T5JA 1OLQA 3LWCA 4Y20B 2HWC2 2ZZQA 4FXKB 3LEKA 5EPAA 5FZOB 1R1A1 1CN1A 1VRH2 2ZGOA 5DUUA 3INAA 4QPGB 2YC2A 4PDWC 1MS5A 2VCCA 2XVGA 4YYOA 5KXDA 2ZKLA 3B02A 4JC1A 2C5DA 1TMF2 5F3EA 4MOAA 4QB1A 4FOWA 5DDJ1 4YPJA 5EV7A 4I01A 3VDDA 4GH4C 1WMDA 5EYXA 1PO21 2W95A 3N9OA 1KDMA 2JDMA 4EWEA 1NY71 1CAUA 5AFBA 5I0DA 5K9YA 1UY4A 4Y22B 3BYWA 3JQXA 5FYMA 2QQMA 1H8VA 5LATA 4C1XA 4HONA 4NUBA 1QQP3 2K2SA 2PXJA 5JDBA 1VBD2 2WNUA 1ZVFA 3OPWA 1V00A 4AVSA 3OG2A 2WZR3 2IXJA 4R4XA 4XAAA 5FZFA 4CDQB 2HWD1 3ZPYA 1RC6A 4NHXA 1EP0A 1FPN1 2V4VA 3J26N 3I4IA 2G1MA 2HWB3 4JQRA 1DF0A 5DUVA 3MIBA 4QT6A 4XE9A 2R1BA 5FZ1A 4H55A 4Y1ZA 1KS4A 1O4YA 3GJAA 1Q3EA 3ZKUA 1X8MA 5JZGB 4KI5M 1NCQC 3BN6A 4NRQA 4BMEA 4PT6A 3S5QA 3WW3A 1XSQA 4I0WB 4HN0A 3P3NA 4NRMA 3VBUC 3I2OA 1DLLA 1UU6A 2YGMA 2H6CA 4JDNA 1LAJA 5LY2A 3BCWA 2DCYA 5FP4A 1Q8VA 1XOYA 4AHXA 1H1MA 5FZDA 2AREA 4N43C 2UWAA 3NJXA 4AVCA 1W8ZA 5T5LA 4AI0A 2WFPA 3POFA 5FY0A 5AVPA 1WA4A 1LOBA 1H9WA 3LQCA 2BU9A 3CL1A 1HXS3 2TEPA 3I59A 4LO8A 5B4XA 4CDWA 3JB8A 5GLUA 3ECQA 1JOPA 3RYKA 4Q8LA 4UFHA 2R6QA 3J7MA 3KZ4C 5FIXA 4Y3OA 5C3QA 1LR5A 2ZGMA 2DU0A 4GA9A 1YYNA 1WWYA 4K6BA 2WNEA 3JZVA 3C8XA 4JHTA 1OC1A 1QJZA 3NAPB 4RGGA 4Q5OA 2OPKA 3KSCA 4KBBA 4RFRB 3SKVA 2FDIA 1F15A 1ACCA 1UMIA 4FPEA 4U36A 2D44A 1SEFA 2Q0AA 4YG3A 4RN5A 1R091 1E5RA 1JYXA 1ZBA2 2XJSA 2W0XA 5CFDB 3BIWE 3S7IA 2VTXA 1HRV2 3VZLA 3A4UA 1W05A 3K3OA 3WINE 1XNTA 5FJKA 5A1LA 1UOGA 3HN1A 1YWKA 3JD73 1ZREA 3WP4A 4EQVA 3U14A 2BBVA 2XVKA 3ST7A 5FMDA 1GUIA 3VD4A 5J09A 1QIQA 4NOTA 3AJYA 3U4XA 1OH3A 1I5PA 2R0HA 3SKJE 3OJBA 5FDBA 1LRHA 1QJU2 4Q4W3 5T54A 3RSJA 4DFSA 1AJOA 5J98B 1C1LA 1IKPA 4CEWB 3VDDC 3WT3A 4WM7A 4WBBA 4LOSA 4C90A 4CDXB 2Q5TA 3IMNA 4UBGA 5C8CC 4MGQA 4B1LA 4CA9A 4AWDA 1QJY1 4XMAA 2VCBA 2ZHMA 1JU4A 2FCVA 3AFKA 2OS2A 5LK5A 1G9FA 3GBFA 1BZWA 2MEV2 1YUDA 1ULPA 1UZWA 1SPPB 2WNUC 5GKAC 3E6DA 3OB8A 2WSUA 5A6YA 5FKCA 1UX6A 5GLTA 3A0NA 5HXVA 3UYJA 1Q8OA 2RR12 3RJRA 1K12A 1X7NA 5LBEA 2VR4A 2P2KA 4F7ZA 2CV6A 1RXFA 4M3CF 2LALA 3ZXKA 3AMMA 5IW0A 4A3XA 1QMJA 5CG8A 3M70A 4BQ4A 4Z1VA 1BBT1 4WVMB 2B39A 2VMEA 1RUOA 4KL1A 4WZCA 1HB4A 1DYKA 1NXD1 1OVPA 1BVP1 2CNAA 3JXSA 4WVVA 4GULA 2O14A 3BOPA 3THDA 5ACA1 3KVBA 5BNNB 3FFZA 5JMOA 3GZAA 2D3PA 5IVEA 1MQTC 1J1TA 1QQP2 2BYVE 2WJSA 4FCAA 4L0PA 3W9AA 3OY8A 1NUKA 3UL2A 3VZJA 3D0JA 1KDKA 2O0OA 2XHKA 1ZNPA 4YRDA 4AQSA 1O5LA 2KM2A 2J7MA 2JG8B 2UWCA 4YW6A 3N7JA 4BIFA 2ZGSA 2HWB2 4CDWC 2VECA 4MGIE 5GJ6A 2GNBA 3WW1A 4OMCA 3OF1A 4XFHA 4PIYA 4I2OA 2XMLA 2GN3A 2WAAA 4HK9A 2X53S 3PL0A 2DYCA 5HBAA 2HEYF 3GHNA 4DO0A 3POSA 2G9GA 3FWEA 4ONUA 4BIOA 1YFXA 1COV1 4FPKA 3ZIWA 3AVRA 4AZZA 2VZTA 3HR9A 1S0CA 4NAMA 1QU0A 4FAHA 1H1AA 2W1WA 4UI9L 1SFYA 5FZ9A 1HXS2 3PTRB 5IVYA 2P3YA 1QJFA 1UPIA 4PF1A 5IFTA 4GAZA 1A8MA 3ROUA 4Y1VA 5GZCA 1PVC1 4WM8A 1AXZA 3IBMA 1AYM2 5C3OA 4LNVA 4I0AA 4WM7C 1VAMA 4OQ9A 4AI3A 2ZS6B 4UF0A 3PDQA 4N53B 5FZHA 3TYJA 2EAKA 1O3SA 3PUIA 5F3IA 3POWA 2QQKA 2XOMA 1HLCA 3FBMA 3UETA 1DQ0A 4UFJA 4NR1A 4TXWA 3GALA 1K5MA 1WBFA 2P3JA 3DUIA 1R081 2HWF1 1CAWA 2JDUA 1R1A3 2PAMA 3J8F3 1MS9A 3WV6A 5IHRA 1CONA 2UWBA 3B7MA 2BNNA 2FDFA 1DP0A 4LBQA 1TE1B 2R041 4Q4W2 5DDJ3 3OUHA 1ULGA 3ZKYA 2VW0A 4PI0A 2ZGUA 4XBLA 4XXAA 2ZOEB 1PO23 5A7SA 1H6YA 2ZGNA 4B8EA 2VBDA 3ZSKA 4XJWA 2ARAA 5FYHA 4PDWB 4GWJA 2ZZJA 3ETPA 4QM8A 3PURA 1BEV3 3T2TA 1PMHX 1JXNA 4BISA 2JKBA 4PQ9A 1QF3A 4YG6A 2A73B 4XVHA 3BU0A 4EE2A 4YNIA 4RQPA 3UJOA 5FY9A 3RZHA 3RZLA 1QH6A 2DTWA 1REDA 1W9WA 4HN1A 2HWD3 1BK0A 4J1XA 2R7EB 3NKTA 4PIXA 1O3QA 2BJSA 5FPLA 4IL7A 3ZXJA 3LPFA 4AFCA 2VVEA 1N1VA 2JENA 1FPN3 1RVF2 5HXMA 2P3IA 1VR3A 4QQ2A 1VRBA 1GMMA 4AHWA 3AMPA 1GWKA 4XPVA 1X9PA 4X8PA 2WZEA 1ULEA 1XNCA 1GZTA 5GLVA 4HOOA 3MUZ1 4KG8A 1O7FA 4D69A 5J96B 2NQYA 4DY5A 2GMPA 1X9TA 4YGEA 2FBEA 2WWUA 1PO11 3VD9A 4AEDA 5GZGA 1VBB3 2Y0OA 5FZ7A 3B69A 4ET7A 3AKQA 3WEZA 4BQYA 3TN91 2VMFA 4K1ZA 2D6LX 4ORFA 1CESA 1STMA 2VQAA 3AZXA 4H14A 4LUMA 4Y20A 4XUNA 5FZOA 3RMYA 2BNMA 3U10A 2QJVA 4AVBA 3T0DA 1IS4A 1UO9A 3VL9A 4QPGA 3BODA 2RM23 3PTYA 2Q8CA 3WX5A 1WLTA 2VNRA 4UAPA 4AE2A 1GZCA 1Y9QA 3F95A 2C1FA 4V1PA 4W8JA 1L7QA 4I3PA 4M3CB 3ZXFA 4N43B 2FDGA 4I02A 1RUF1 2ZGQA 2DF7A 5EJ1B 5FYZA 5KHKA 3EJKA 4AW7A 4UFMA 2OA2A 4Y22A 1XJAA 3B93A 2ZAHA 3OGVA 4N9IA 3ZSJA 3FJSA 4CCMA 1NQJA 3N35A 3B01A 5AVAA 1K3IA 5FJHA 4MGSA 5JSPA 1VBC1 2VCMA 4KQ7A 5BYNA 4TLGA 3NL1A 3MYXA 1R093 1BCXA 2XUEA 4BWOA 4COVA 1UWWA 4CDQA 5J48A 3QOPA 3N9MA 4YW4A 5TSWA 3L9JT 2DVFA 5FUNA 5LA1A 4C8DA 5KC5A 1G9AA 5FYIA 5LZ6A 1K5MC 1X50A 5BUVA 5CG9A 4OI2A 2YBKA 4K8FA 3CZUA 4K40A 1Q43A 1PGW1 3H50A 2W1QA 1WLDA 5JZGA 3AM2A 1UU5A 1YHFA 4AL9A 4UYBA 2XLAA 2G19A 2OIIA 5FY5A 3UGFA 2VZUA 2ZACA 3LA7A 1JU3A 2WT1A 3AMHA 3C7FA 3VBRB 3V65A 3HIFA 5FXZA 4AEMA 2RJ2A 5EP9A 1GICA 1ENQA 1ZRRA 1YQ6A 4QX0A 3J9SA 1O59A 4S2HA 2WA4A 4H7MA 5F2WA 5C8CB 1UMZA 4RQPC 3WVJA 3H0OA 1R1A2 1SDDB 5DG2A 3O5SA 2P17A 2YGLA 4KG0A 4ZPIA 1PX3A 4PBPA 4QKBA 4XFIA 2JDKA 5JOWA 1NLSA 2XJUA 4CCCA 5DDJ2 5FP8A 1SFPA 3RZGA 3I3DA 2FZ2A 1AF9A 4FQZA 1PO22 2WDBA 1TZOA 1DQ6A 1NY72 3ILRA 5FBJA 5B2GB 2PAKA 1GV9A 1PM7A 1JZ4A 1N3QA 5ACA3 1OQ1A 2UURA 5J1XA 4GXLA 4LPLA 5CFDA 3WDTA 4AFBA 4Q29A 4AEDC 3QD6A 3W58A 1OKOA 4OZXA 3HQRA 4Q4Y1 1D4VB 2XH6A 4A6SA 1BXHA 4A4AA 5APAA 2HWD2 3SMHA 1SLCA 4Q4X1 2BDRA 1UZ0A 5JR2A 1LU1A 3LAGA 1QGLA 3VDCA 5I91A 5LW9A 1MQTB 1FPN2 1I6XA 4QPGC 4AFMA 1LODA 3FBYA 3I3EA 1TME1 2VUCA 1F2NA 2E7TA 4FPCA 1KFUL 3AMNA 3Q8CA 1RJ7A 2A71A 1DFQA 5A1AA 4Q0PA 4CDXA 4A42A 3CLPA 2A7AA 4META 4MH0E 2PELA 4YWAA 2VOWA 2XL7A 4CDWB 5KC6A 2CHHA 3N9LA 1Y4WA 4E8CA 1SPPA 2HKXA 4OI4A 3IMMA 4CP0A 4G9SB 2R071 1REEA 3H8UA 1BMV1 2HYXA 1OPOA 5DPNA 4TZDA 1WMEA 4IW3A 4JKLA 2YBPA 5LBCA 4LIUA 1UYYA 1GYKA 3RS6A 3WZ1A 3NNGA 2WZR1 4WVMA 5JZGC 2WLPA 3FMGA 4QGMA 3NWKA 3MI8A 3H42B 5FYUA 1AR61 3AL5A 4TLFA 3AK0A 1ZRDA 5DAXA 1EAH1 2PHRA 3IAQA 3O1OA 5I8YA 1DDLA 5T55A 4GWMA 2O8QA 4YW5A 2JIGA 1AUYA 4OHWA 1R092 5A3LA 3KB5A 3I3BA 4B7EA 2OQ7A 4SBVA 1GANA 4QPIA 4AEJA 1MS1A 1EUTA 1QXPA 1UW8A 4IETA 4XHBA 5FPAA 2G4IA 3I2JA 2JG8A 3S30A 2IUWA 2ZHLA 1MS3A 1OA2A 5FK7A 3MIEA 3NO8A 4IV1B 3VHOA 1R083 1DG6A 1QDOA 2HWF3 4O9EA 2P5BA 1Z7S2 4FTSA 1QWRA 1UF2C 5EYYA 4AEKA 1J3PA 1SLAA 4TTGA 4YM3A 1QJEA 3GBWA 1LCLA 4CEYB 4XMIA 3TEXA 5A32B 2R043 4R52A 3ZIXA 3RYPA 3TNPB 2ID4A 1OT5A 3A22A 4B7KA 2VE1A 4OCTA 4P02B 1UL9A 4COUA 1XU2A 3D82A 4CU8A 5FO9B 1LB2A 1GSLA 2ZMKA 3TRSB 5JUVA 1E57A 1QJY2 4R9DA 4V2WA 1XYPA 3NKGA 3AP5A 3PVOA 2E31A 4J1WA 4HZFA 2WN3A 1LOFA 5LCWL 3LB9A 2RDNA 4XCAA 1Z0HA 1BQPA 4I0BA 3LGRA 2VUDA 2RS31 2A6YA 1W3VA 3E5QA 1ZX5A 3KD4A 4FOVA 3WQ0A 4QKFA 1KITA 2WO7A 4PCRA 2ZHKA 1FXZA 1UIKA 2VVDA 3O1VA 4YGDA 4QX2A 1MZ5A 3OBAA 4YM1A 1PZ7A 1ULDA 2D40A 2C4XA 3ZFFB 1JOBA 2GC1A 3WW4A 1YQ5A 2CY6A 3JD71 5I93A 1BBT2 1HKDA 1WKYA 3IN9A 1UYPA 4GJYA 4CDXC 1IS6A 4DMIA 1YI9A 4HVRA 1Q8QA 2W39A 1DZTA 3HT1A 4N53A 3VB9A 1GZWB 1FOD1 5ACA2 2CDOA 1PO13 4QHOA 3MPPG 2YG0A 2Y38A 2BVBA 4E4SA 1GU3A 3TN93 3VBSB 5GLZA 2R30A 2ZEZA 5IK4A 4OHXA 1AL0G 2ZX1A 1XU1A 5FYVA 3N36A 2VQTA 3PLQA 3E6CC 1JTZX 4IEUA 1CPNA 2B45X 3ILFA 3LDKA 3TAYA 1WW4A 3RPQA 4AQTA 3ZSEA 3WD5A 4NHLA 5K0UB 3ZFGB 5FPUA 2XWBB 1RUF3 3AKSA 1QXRA 5FZEA 2V4AA 2RE9A 1OXCA 5KHGA 3RFRA 2AENA 1QHDA 1ZZ8A 2IVJA 3LPGA 3MO4A 1OVSA 1SMVA 1W06A 2VL4A 1VBC3 3AYDA 1COV2 1NYWA 5IVBA 1HN0A 1NQDA 3MIGA 2VTXJ 4D6SA 2Q30A 4DUWA 3ZO0B 4QPIC 5H9RA 2P4EA 5G05L 1IS5A 2JG8C 2E7AA 3K4AA 1S4CA 1VE0A 2BGCA 4HKOA 2D6NA 5F5QA 5JXJA 2D5HA 3MF9A 1NA1C 4ARXA 3PJQA 4KGQA 3U11A 1W6PB 1S0IA 3ZM8A 1W8WA 5C7GA 1N47A 1YNAA 2QZ3A 4FFIA 4NROA 4A6OA 4CU7A 3W5NA 4FQ4A 5LY1A 1PVC2 2WABA 4AI2A 1JS9A 3LIGA 1B35B 3AP9A 3IT8A 1J3RA 1H4HA 1Y7BA 4LMFA 5B4NA 4YG0A 4LITA 1W6MB 4IV3B 3DYOA 5A6ZA 2IZWA 2Y6JA 1CZSA 1DGLA 1OFNA 3LFMA 2DCJA 4XQDA 2NZ9A 2DFCA 3TOJA 4OUEA 2JDNA 1YRZA 4XABA 3C7EA 4Q2FA 1GQPA 3BVCA 3BTZA 4CYDA 1LOFC 4F83A 3EHKA 5FZAA 4L97A 1R082 2HWF2 3CMGA 4RA0A 2W1UA 1A78A 4M3CA 1TG7A 2YFUA 4N43A 3L2YA 3QCWA 1NCRB 3T3YA 4CRQA 1S0FA 1YJLA 2R042 5DAPA 5H9QA 4K20A 3LOIA 3APBA 1PVXA 1MACA 4OVEA 2DVAA 4CXWA 2ZKNA 1UXZA 5JIUA 3URFA 2JJ6A 2BV4A 3HNBM 4N53C 3KVAA 2ZGKA 1HJGA 2Y6FA 5L19A 3CF6E 1OA3A 3R4DB 1VB4A 1CAVB 2CU5A 2UU8A 2W9XA 4Q4Y3 3DF0A 1YEWA 5FREA 3VZKA 1DZQA 4L92A 2PN5A 2CGNA 4AFAA 1SDWA 4LBJA 4ZY9A 5M0TA 3EYPA 1PGL1 1S0JA 2WQ8A 4LTAA 4CUGA 4Q4X3 4LE4A 4XHXA 1SLTA 3IDBB 3VHPA 1SG3A 4NN0A 3RNSA 4FFFA 4P9WA 1X36A 2VW1A 4XFCA 3T4VA 4BU2A 1TME3 2JE8A 4P9YA 3ZX7A 4CCKA 1ZZ7A 1REFA 5FFOC 4XF4A 3RWKX 4L11A 2LROA 5T5PA 3I2FA 1OMIA 1S0BA 3J8F1 2VUAA 3VBRA 4COZA 5A3PA 1RJ8A 5LEJA 1MS8A 2YU2A 1PO12 1VAKA 2E9QA 1YXWA 2HBUA 5D8AB 1C8M1 1NLRA 4MO3M 4FP3A 4TYSA 3CNAA 3TN92 5FUIA 2RJLA 3NNLA 1URXA 4LR4A 4AAXA 5IATA 2PHWA 5C8CA 3M2MA 3OUJA 2VZ3A 4JQTA 3ZXAC 1LEMA 5C4WC 3V64A 4OMDA 5KHHA 1S2EA 2R073 1PZ9A 3JU9A 3Q9OA 3T1MA 3UKNA 2GNDA 1BEV1 1XYNA 4K1YA 1DHKB 5EJZB 4Z2AA 1O5UA 1LKNA 4UW6A 2GSYA 3VBHB 4CP1A 3PU3A 5CAZA 4LT5A 2Z4FA 2VXJA 1MS4A 2D6OX 1AX2A 2QVSB 4QB6A 4INDA 4FPOB 1V6KA 1W6OA 4IE7A 4LBNA 2DTYA 1J58A 3T30A 4D94A 4PQQA 2JICA 1C28A 1HB3A 4HPKA 1JMUB 1FYUA 4BXSV 1AR63 5HV4A 1AHSA 1YQ8A 3VD3A 1EAH3 1VBC2 3KHCA 3NNMA 3TWIA 4YW3A 1CWPA 3POYA 1UKRA 2CAUA 4Q26A 3O12A 5FPBA 5A7WB 2JXAA 3RYRA 4L99A 4YLZA 1PGSA 2VXRA 2WL1A 3VBOB 5F3CA 1W8FA 4LBMA 5J37A 4CCNA 5JAXA 1MQTA 2A3YA 1QNYA 3VHRA 1VBB1 4JCKA 3VBFB 3I3MA 2FDJA 1BJQA 3DCQA 3LE0A 4S2GA 1ZZBA 2BWAA 2JDAA 2X5IB 3IDAA 5IUQA 2A6WA 2HYKA 4J25A 1PGW2 2WO1A 2V09A 5F5CA 1W9FA 1RUG3 4HG6B 2C26A 4XDOA 3U75A 3KV9A 3HQXA 1HRI1 2RM21 4KWUA 4ISRA 2AZ5A 1QEXA 4XTMA 2W3JA 3RZMA 1C8NA 1IOAA 3O14A 2PLV1 3I54A 4R9CA 1DYPA 2GZWA 2A6ZA 3A21A 4UBHA 3ME2A 1GOFA 2EVXA 2Q1MA 4LULA 1FAYA 4IGQA 5A7PA 3U1XA 4FO9A 1ODNA 4JGYC 1CD3G 3CEWA 4L2NA 3U78A 1UY1A 2QQOA 1XE0A 2ZBJA 3CZJA 2GP5A 1DQ1A 3HJRA 3MFCA 1D4M3 5CB7A 2RS33 3QH7A 1BYHA 3OSDA 2RV9A 3AJZA 1LNSA 2E6VA 2YPDA 4YFWA 4W6WA 2VU9A 3K77A 3N9PA 2ARBA 4ES9A 5HCAA 3G6JB 1EUUA 2BW8A 1FNZA 1L7LA 5A7QA 4C0HA 4OLLA 2PTMA 3ZYPA 2XB6C 3R4SA 4AOCA 5E88A 3I2DA 5FY7A 1RUI1 4GZ9A 1ULCA 4QX8A 3VBRC 3ZXLA 3MGUA 4LEJA 2R1DA 2W46A 1FOD3 4GKXA 3ZXDA 4OHYA 4GQ7A 1H30A 3T08A 2XG3A 3LZZA 3WG4A 1KGYA 2BEOA 1GQGA 1F4HA 4Q4Y2 3SH4A 1WCUA 3P3PA 5LRSA 2ZHNA 1DYOA 2J1AA 4HMZA 3LEMA 1SFNA 1WCSA 2BWCA 3VD7A 5FLJA 4IV1A 4E4HA 1GWLA 2YB7A 1JHNA 1D2SA 2ATFA 2QQJA 3R4UA 2I07B 4Q4X2 1WW5A 1V70A 5T50A 3PUSA 3F2ZA 2EF6A 4XC9A 3DXUA 4CEYA 5A32A 1TME2 1U5IA 5LB6A 4BQ5A 1IKQA 4E2SA 2XQRA 3NSTA 1LJ7A 4ZU5A 4D8MA 1HB1A 4NIGA 2IVIB 1ENXA 4IEPA 2WS91 4DS0A 5SV5A 4AQ6A 3POJA 3POEA 1H8TC 5I0TA 2C9AA 1UN1A 3O7OA 5FYBA 3I2HA 1WA6X 3ZSLA 4MXWA 1O6UA 1POQA 2V73A 4EROA 2QDRA 2W08A 2OKXA 3T0BA 1T6GC 2R072 2JDHA 4JVAA 4LQRA 5A3WA 1BMV2 2XL9A 5CNAA 4MGTA 3DPRB 4R4ZA 5LBFA 1LGNA 3M4FA 2ZXQA 3UJQA 2D6MA 2L9LA 3I2KA 4YM2A 4MGKE 3ZFFA 4QX1A 3RI9A 1UQXA 2WZR2 5KR7A 1LOGA 2LW8A 3UKVA 4GD4A 3NNFA 2QKDA 3E6BA 4IE5A 4QPIB 4AHYA 3SXWA 2PMWB 1F5FA 1T2XA 2G9ZA 1GZWA 1AR62 2G9FA 2XBO3 4WVZA 4C91A 4M0NA 1EAH2 1MEC1 5H9PA 4LHNA 3B00A 5CFCB 4W4ZA 2VW2A 1OPMA 2VQUA 4XFGA 1LOAA 4XW3A 3U07A 2PYTA 1NA1B 4QQPA 4B3NA 4CP2A 3N4MA 3DEMA 3VBSA 4MGYE 2FMDA 5CYYA 1UXXX 2WT2A 3GCXA 5E6HA 2WINB 5FZLA 2WFF1 3GDBA 3GZEA 4YW2A 5FP3A 4BA6A 4XIKA 5ERLA 4PI2A 3TEZA 1TNFA 4YZ4A 1DGWA 1OHFA 1RUE1 4NJ4A 5DAVA 4UWDA 2ZX0A 1DU3D 5FZBA 1HN1A 4QDSA 5K0UA 3ZFGA 2C0ZA 4YVSB 1IG0A 5CKQA 1IGOA 4NMIA 4XJZA 4A7ZA 2DUPA 1ZZ9A 1O4TA 3TBDA 4BE3A 2YUEA 1RXGA 4HBNA 5L73A 4E4ZA 3JB4C 3N9QA 4P5YA 3ZDSA 5DABA 4YGBA 4JX0A 4DEVA 4FTEA 3K2OA 1RUJ1 2YV8A 4RGKA 1XB9A 4K9SA 2MPFA 5H9SA 5C70A 3AKPA 1AYN1 4HT1T 3VGIA 5FOJB 2EICA 5FO8B 5IT6A 1PIV1 4XCBA 5FTTC 2EXHA 4IEXA 2Q8EA 3U0ZA 4ITCA 1RGSA 4MXVA 4BXFA 5FBZA 4N8MA 1LECA 5FY8A 3WG2A 3RMXA 4FPYA 2ARCA 2RS32 4IV1C 4NRPA 3POGA 1UMHA 2Q8DA 3IM0A 2B5HA 3RVHA 1UCXA 1W6PA 5KXCA 2ZAAA 2OX0A 2OZJA 4CEYC 1EV11 3MW3A 1AR83 3RI8A 4DXTA 1UD1A 3T2PA 2KD7A 1G9BA 1B35A 2GP3A 3IWZA 2JX9A 4QKNA 4ZXEA 3MHZA 3JD72 4LOTA 5CIRA 1W6MA 4IV3A 4XBQA 2JECA 2XUMA 3ZN6B 2HEVF 4LLOA 4XDQA 3KHBA 1FOD2 3J7HA 2K9ZA 3WF0A 4ZS3A 3ELNA 2O8OA 2XVLA 1C8M3 3IDEA
chains in the Genus database with same CATH topology
4HL0A 5LRRA 1ONAA 2ARXA 3CJXA 4XFFA 2A6VA 3VKFC 2BPA2 3JUUA 4HETA 4AF9A 3EBRA 3A0KA 4QGNA 2VNOA 4FPFA 2ZCWA 4BHPA 4NHMA 1NCRA 2SBAA 4FAGA 5F6KA 5C33A 4JV4A 4U2AA 3ZFFC 4Y1XA 4RHV3 1XRUA 5C4WB 2HWE1 4D7YA 1WUVA 4F3JA 3N7LA 5BNQA 1OOPA 2WZPP 2WC2A 2GC2A 3OBRA 1CAVA 2GU9A 5I0UA 4TSVA 2QNKA 1SQ4A 3VBSC 2IWGB 2EALA 4AVTA 3AYAA 1EY2A 4QD2A 2ZMLA 3O0WA 3IIAA 4QPYA 2AGSA 4Y1YA 3N7MA 1POV0 2WWSA 2R063 4BM8A 5K0UC 2GH2A 3ZFGC 1RIRA 5JPMB 1ND2B 3PNAA 2W68A 3WQ1A 1HRI3 1UAIA 5F1RA 2IXLA 5D8AA 1I5ZA 2PLV3 1MZFA 2VMIA 3V0AB 4L8QA 1KRIA 4Q27A 1CQ9A 1NE4A 1X82A 4Z8BA 2IXIA 2ES3A 2WQZC 4MZUA 3FLRA 2JDZA 1RL3A 4BCUA 1WD4A 1CIWA 1O91A 3VBHA 1RHI1 4C1WA 2YMZA 3ILNA 2SLIA 5DUWA 2GMEA 4JGYB 1AR71 1POV3 2VOKA 2W52A 1B35C 4LBQD 4IV3C 3JBG3 2BUKA 4YGCA 1RUI3 2WQ4A 4JGZC 4UW4A 2QDNA 3DN7A 5DZEA 3M3IA 4Q1RA 3UK9A 3VBOA 1UU4A 2D6PA 2D93A 4WV8A 1WD3A 3K51A 4ZXKA 3H3ZA 4NVPA 1PGL2 3VBFA 2X5IA 2OZ6A 4YZ1A 2DVGA 4NWWA 2PHLA 1N3PA 4KH9A 4EN6B 4JRLA 1W0PA 1NCRC 4FPJA 1YJKA 1R1ZA 4R8HA 2WNVB 3J8F2 3NV2A 3MZHA 3SITA 2WS93 5FOBB 4B29A 5I0SA 2UYAA 1OOPC 1FMD1 1AL23 1C3HA 1C8M2 1H2KA 2DFBA 5EZWA 3GZTB 2DURA 1W6OB 3SH3A 4L9BA 1YIFA 1FT9A 1G6NA 3AZZA 3R05A 1W6NB 1A3KA 1H8TB 4HPKB 5DUXA 4Z07A 5KHKA 1BVVA 1BEV2 3ATGA 2D5FA 1I9RA 1DGRA 3MIDA 2QE3A 3WDVA 1HIXA 2GMMA 4LO6B 1CVNA 3MPBA 4XFAA 4RS5B 1PHMA 1QKQA 4ZKTB 1QOOA 1FV3A 5J36A 3QACA 1MEC3 3ES1A 4KWKA 5D8AC 4NPRA 1ENRA 4IESA 3ZXGA 3M3EA 2HJIA 4XFBA 4IEZA 1G9DA 1O3RA 2WFF3 3LKJA 4HSLA 3NV4A 4HSJA 4D3WA 2O1QA 4GKYA 2GAUA 1VBB2 3VBHC 1RUE3 1AXKA 1YFUA 4QU2A 3CJIB 2B46X 1W6QB 1WW7A 3AP6A 2GNMA 3PVEA 1NE6A 4AVAA 1HRI2 1F9KA 2RM22 1XYOA 3AYEA 1ZZ6A 4YARA 2QZ2A 1AR93 2CGOA 2PLV2 1RUJ3 1GQHA 4XOGA 1JN2P 3MW2A 5JOZA 1AYN3 3NW4A 3IDCB 1PIV3 4YVWB 5FAXA 3WY6A 1X33A 3VBOC 3MLKA 3DPRA 5T3NA 1GLHA 2X29A 1ZRCA 3VBFC 4TWTA 1V6MA 2X5IC 4M00A 2GALA 2PHUA 5J3UA 2ZX3A 3THTA 1EV13 4AVVA 3MW4A 3SISA 1RINA 5CFCA 5FLIA 2B9UA 4X6RB 3T1LA 3DL3A 1NA1A 1RUI2 4O9GA 4XILA 4NHKA 3KM5A 1PMIA 5IK5A 1RUG1 1PNGA 3KGLA 1QJX1 3BTAA 5JOXA 3MLLA 2XJRA 3ZSMA 1S2BA 5FLHA 5SV8A 3B9IA 1J1LA 2DV9A 4FOQA 4YVSA 1LTEA 1C1FA 4HLTA 2UY9A 2OUJA 1VBE3 4MXWB 2XPJA 2CWMA 1OQDA 1D4M1 4GB31 1Y3TA 2CL2A 4LE3A 4E9KA 2HWE3 2WS92 5FMOL 4N7UA 4RGAA 1I3HA 1HQLA 1JYCA 4Q4V3 2QFEA 3NV3A 1H9PA 3FX3A 2TNFA 4DOUA 2Z5WA 1YFYA 1XNBA 2R32A 1DQ2A 1WW6A 4J6GA 1AYM1 1JW6A 2ETEA 2DWRA 1WLWA 4PIZA 4XTPA 1S55A 4FVVA 4RR3C 3KMHA 4UW5A 1MR5A 1GR3A 1OA4A 3GNEA 4JTNA 4DQAA 1H1IA 3JCIA 1SCSA 1MVQA 3ZN6A 5BNPB 2AYHA 1H4GA 4Y5Z0 5JPNB 2ZGPA 3E97A 2TUNA 1L3JA 1EYBA 4EN9B 1MEC2 2RMU1 2Q8OA 1VRH3 4XBNA 2WFF2 2YPJA 1FX5A 5A33B 5JOYA 3OPZA 5GZDA 3O0XA 4YFZA 1TMF3 1CPMA 1EPWA 3TB0A 4ATEA 2ILMA 3DPRC 4C0BA 5DG1A 4B4RA 1SBEA 1VJ2A 1RUE2 3E5XA 1RHI3 4X8NA 4OUMA 1ZZCA 3USUA 1CJDA 2D43A 5C4WA 2XGXA 3M3OA 5CU1A 4Z82A 1AR73 2VOXA 3H1YA 3SCHA 5CADA 3PVBB 3WUDA 5CFCC 1RUJ2 3CU7A 1XE8A 3LCPA 1AYN2 2NLRA 3FLPA 3M8LA 4BYYA 1PIV2 1RVF1 2PAEA 4GMP1 2H0VA 3SHRA 2XBO1 1V9U1 1AJKA 1U5YA 2D97A 2ZGTA 3VUOA 4ZU7A 3D4KA 5K7PA 4JGZB 4KNCA 1N1SA 2UY8A 3FFQA 1N1YA 4YVSC 1RITA 4IQPA 1ND2A 3ZMOA 1EV12 4GIQA 2P37A 1QOTA 3OBTA 3WG1A 2B8MA 1LESA 3S7EA 2MHFA 1UZZA 3SNMA 1AVBA 2Z69A 1PK6B 3WCSA 3V0AA 3D6EA 3DGTA 1FMD3 5I8SA 3ZXEA 5BPXA 1LENA 1KJRA 1CGPA 5T5OA 1XQNA 4E4DX 4P9GA 3NVCA 1OOPB 1RMU1 1BKZA 1WCDJ 4JGYA 1EPZA 1WGPA 2EA7A 2Q1ZB 1ASJ1 3ETQA 2YROA 2HWE2 2NMNA 2YC0A 4LBKA 1DGWX 3VKOA 3MEPA 1JYIA 1Q56A 2QUOA 4PLNA 4DINB 3VV1A 1LHVA 2ZMNA 1C5IA 4Y1UA 1ZA4A 5F9TA 1AR81 1W0OA 1YI7A 2ZPXA 3AFGA 1VP6A 2YYOA 4CTEA 4N7IA 4CDUB 4BOWA 5GM0A 2JG9C 2E63A 3WG3A 2WKKA 1QJU3 4LBOA 4FBFA 4AI1A 2ZABA 1CR7A 1HV0A 1IHMA 1V6IA 3KS7A 3V56A 5JVVA 3VZOA 3WXPA 4PLOA 2VY0A 1YIPA 1VLNA 1I1EA 3RG0A 2WNVA 1CJPA 1LGBA 1XE7A 4XEZA 2P3KA 4XXPA 2VQ0A 4Q0UA 4XF0A 1JBCA 1Y43B 5HCFA 1D2QA 5FO7B 1WLCA 3SCGA 4RHV1 4DNYA 3SCFA 4X6QB 2RR13 1RUF2 3ZN5A 4DPNA 4LHKA 1W6NA 1H8TA 5L36A 3ZYRA 4IEWA 4MGZE 1RHI2 4RD7A 1UZYA 3L2HA 5BNOA 3SH5A 3H9AA 2N7GA 1VBA1 4Z92B 3AX4A 4RS5A 4GWNA 1RUNA 3AXDA 3I8TA 1ND2C 2FHRA 1AR72 4W65A 1N1TA 1OFSA 1VIWB 2OUHA 4LO5B 2PHFA 2R061 1IPJA 1Q8SA 4YW1A 1W2UA 2VMHA 2E7QA 4XIOA 4P9IA 4COYA 2IXKA 1QJX3 3KLSA 3H7YA 3B3QE 5E16A 3ASIA 4LO7A 2EXJA 4URTA 3WHUA 3TNQA 3PMEA 5L7OB 3AKRA 3CJIA 2AUYA 4M3CE 1W6QA 3ZYGA 3VKNA 2XKOA 2ZA9A 2K0GA 5EJ3A 4HK8A 3PJYA 1FNYA 4FSJA 1LGCA 4GB33 1DIWA 2E53A 5JCTA 1RUH1 4KGGA 4JTOA 2P34A 4IEQA 1QY4A 3OGJA 1FMD2 2WSVA 2OW4A 1UKGA 1S2KA 1TQ5A 1POV1 4QM9A 4YVWA 2NP0A 2GDFA 2BQPA 4DZGA 2Z2SB 1YFWA 2OVUA 3JBG1 3N7KA 3D8CA 2RS51 2CAVA 5C9AA 1AYM3 4XJUA 1J3QA 1HX6A 4OULA 4AHZA 4BPZA 2WNVC 3KQRA 4W6YA 4BMBA 3WOGA 2OYZA 4RR3B 2RMU3 2WT0A 4I3GA 3ZFEB 2ZGLA 4GMP0 2H0BA 1UPSA 1Z7S1 5FMOS 1RUD1 2IFRA 4DRVA 1GBGA 4DXZA 1AL21 5ABJB 3M7AA 3OD0A 3EO6A 4E2GA 1RB8G 1V6JA 5BNOC 1D0HA 2IFWA 1N3OA 1LHUA 5EFUA 2QQPA 5IK7A 2GC0A 5F6LB 4RS5C 4XF9A 1U5XA 4MLOA 5JMCA 1LHNA 3M1HA 5KBFA 1WBLA 4JDOA 4LA2A 1BK1A 5BY5A 3N3HA 5EXOA 4EN7B 4PJYA 1S0DA 5GALA 5HCBA 2DUOA 2PHTA 3MIFA 1NG0A 1RVF3 2ZGRA 3AZYA 4GMP3 4HANA 4JAAA 3RZZA 1OKQA 4AQ2A 1V9U3 1MS0A 2A70A 2ET1A 5FPZA 2RHPA 2CGPA 4PF5A 3KCCA 1RUC1 3CJIC 1G9CA 5E8AA 5BNPA 3KCXA 2LTNA 3V0BB 1J59A 2YXSA 2FMYA 5KXEA 1DZRA 5JSOA 3QLQA 5GZFA 5JR7B 3LA2A 3WDYA 2A5ZA 2F4PA 3J4UH 4MV2A 4PBOA 4AG4A 1RUG2 5A33A 4QX5A 1QJX2 4E27A 2WLQA 4YVWC 5CA6A 1HV1A 1AR91 1JOJA 1NXMA 2ERFA 3MLJA 1HQNA 3VLBB 4R9AA 4P9LA 4XJAA 1GKBA 2NN8A 4IXLA 4LLFA 3IPVB 4YM0A 4HVQA 1RMU3 5C9AC 1F8VA 1A8DA 1B09A 4FPGA 4LO4B 3BB6A 5FQ0B 1CX4A 4COWA 1ASJ3 4EJRA 1JUHA 4P9XA 1D4M2 4GB32 1ND3B 1V6LA 4QHBA 5E1RA 2EXIA 4EWDA 3WP6A 3AKTA 4QXKA 3GF6A 4XF1A 2Y0IA 3FUQA 1SCRA 1ZBE1 3VHNA 5D1IA 2BFUL 4JGZA 4ES8A 4GALA 2V5YA 3NJZA 2D3RA 2EXKA 4YZ3A 5GZEA 3HT2A 2XKPA 4A7KA 1SBDA 1MVEA 3HAGA 3W59A 4YSFA 2JG9B 2YHJA 4G3YC 3RJ2X 3O0VA 4AYUA 1PK6A 1U0AA 4R9BA 3RQ0A 2RS11 5C8WA 1FV2A 2UYBA 2NYYA 2RMU2 2ZX2A 3WDUA 3AZVA 2BTVC 2XJTA 1VBE1 4BQ1A 2IXHA 3OYWB 4HFSA 3LOBA 5E89A 1KD7A 1CAXB 3USUB 4NO4A 5KWRA 1NZCA 1RTVA 3OGGA 3VKMA 1S0EA 5CVRA 5AC91 1LU2A 4K3UA 2JE7A 2NPIA 1QH7A 1F31A 3ZDSA 4Q4V1 3ES4A 1XNDA 2DUQA 1V6OA 4EN8B 3MDPA 2D3SA 3QBQA 2AR6A 2VMGA 4S2DA 1VBA3 1W39A 2FQPA 4YZ5A 1Z78A 1KQRA 5AFEA 5BNPC 3AZWA 4XJ8A 5DZFA 4GH4B 1PZ8A 4AGRA 1U5ZA 5LK7B 5I0RA 3OD4A 1U12A 4CDUA 3VL8A 2H6BA 1SACA 1OI6A 5FCCA 4H3WA 4QQHA 2XBO2 2JE9A 1V9U2 2ZX4A 1OQEA 3AB0A 2HWC1 3K48A 2VULA 5JSRA 1VRH1 3AMQA 4MX3A 2Q4SA 2LM3A 1ZYBA 4Q0QA 1HW5A 1VALA 1YO8A 2DVDA 1GZ9A 1IZ3A 1TMF1 3IKWA 5IK8A 2I2SA 4AI8A 3EQEA 1NCQB 1UIJA 4WVWA 1RUH3 5KHIA 3VBUB 4BH9A 2IC1A 2VUJA 4MYEA 4P14A 4Y26A 2ZJCA 3MFAA 1VBD1 4MSVA 2VG9A 3CO2A 5EWSA 1M06G 5KXBA 3RDIA 4I09A 2EIGA 3GHMA 2YDEA 4WM8C 2RS53 1RMU2 5BXXA 3HMYA 2KXLA 3RRDA 3B9CA 2RJKA 1ASJ2 4HKLA 2XJQA 1FI2A 2ENRA 1G7YA 4DY3A 3NV1A 1IQAA 4D7TA 3HD8B 1ZM1A 3WHTA 1PK6C 2XWJB 2DCTA 4LUKA 2DVBA 1AR82 4Q8KA 2PA7A 4ZU4A 2ZTNA 4FOYA 1SLIA 1Z7S3 3WP3A 3H1MA 2DCZA 1RUD3 1TNRA 5L7OA 2IXCA 4KWJA 2XLFA 5JLVA 2ET7A 3JQWA 1M4WA 1O3TA 3KT4A 2PHDA 4H7LA 1QJY3 3LSDA 3WLUA 5CBLA 1LHOA 2D7FA 3KT1A 1VB2A 3WW2A 4DB5A 2R16A 3VDDB 4WZFA 1H2NA 3ALQA 3BOWA 5BNOB 1CAUB 1VAVA 4QGLA 4RHV2 1ZBA1 3R0RA 1H2MA 2A3XA 2XJPA 2F6BA 4CDUC 3THPA 5GLWA 1HRV1 5T52A 1A6CA 2WNUB 4ASMB 3NAPA 3AYCA 1O4ZA 3AXEA 3BPZA 3C3VA 1G86A 1BBT3 1ENSA 4RFT0 2VVFA 4AGGA 5KHJA 3R6SA 1VBA2 1RUC3 4UW3A 4LBLA 4PLMA 3WDWA 3DKWA 1S0GA 3PVNA 1QJU1 3ACLA 3FHIB 4QQLA 3PHMA 1SBFA 2LUWA 3FUOA 3WNXA 4G4FA 2R49A 4RR3A 3BU7A 2AH2A 3ZFEA 3WR0A 4P5HA 4XETA 3WQ7A 3ZYJB 2R062 1SLLA 4QQOA 4MUVA 4BZ4A 4FTBA 2GC3A 2VGDA 3B94A 3SLIA 2XJVA 3MIHA 2MEV1 3KT7A 4XYXA 1ULFA 4CEWA 1OSGA 5JI7A 5ABJA 5FPXA 4OI0A 1WMFA 4XQ4A 2B42B 4XQWA 1H2LA 1GFF2 2RR11 1AXYA 1QDCA 5C6CA 1QNWA 3I59B 3ZVXA 2A75A 4XJ9A 2CYFA 3GZUC 3AP7A 1COV3 3C2UA 1C57A 3ZMNA 4CDQC 1RUH2 4M01A 4EV0A 4B4PA 5C9AB 1Q5OA 4EWAA 2GH8A 1QQP1 3GBGA 4S2FA 1G8WA 1HDKA 3WCRA 4LA3A 3JBG2 1ZBE3 2Z79A 1Q8PA 1JH5A 3LSEA 1LHWA 5HI0A 4I30A 5L7OC 1PVC3 2RS52 4DRRA 4FT8A 5BNNA 3KCYA 1YLLA 2HWB1 3V0BA 2X8KA 4IEOA 5JWPA 1GNHA 1SLBA 4Q0VA 4NWVA 4JRAA 3H7JA 3VN4A 1PNFA 4FPHA 2Y26A 4IERA 4LHLA 2RS13 4KU7A 4WM7B 1AX1A 4E2QA 1KJLA 1AX0A 1AZDA 1XXNA 2KA3A 3BALA 4FXGB 4SLIA 1RUD2 3VZNA 3WDTA 4IEYA 2VOVA 5AC93 4KWLA 3IPVA 1LOEA 3NAPC 4XZPA 3FLTA 1HXS1 1AL22 1YCIA 2MNGA 5FQ0A 1FATA 4IEVA 2PHXA 2BFUS 1ND3A 3HBZA 4ATFA 5CFDC 2HEWF 4F8AA 4ASLA 4FP2A 2JD4A 1GNZA 2E51A 1LULA 1APNA 3GYDA 4N9HA 5K8SA 3ZFEC 1C5HA 4MVTA 4BLJA 3MICA 2VNGA 1H0BA 3FZ3A 3LA3A 3UKTA 2QCSB 4K21A 4AXOA 1IS3A 3OY8B 3ZN4A 4CEWC 2I74A 1DQ5A 2HWC3 4BLIA 5ABJC 3VZMA 2Z42A 4A2UA 1RUC2 4OHZA 2NM1A 4OUSA 2JG9A 3ZYIB 2NMOA 4ISQA 1MZEA 3H1WA 2GNTA 4Q4W1 5I8TA 1KXGA 4Z2WA 3EXUA 2CTVA 1KS5A 3WUCA 1D0GA 5J7MA 3HWJA 3H3UA 3OCPA 3OYWA 3QH6A 1CAXA 4P9JA 3S6PA 1V6NA 1VBD3 2VPVA 3OTFA 2A6XA 2CWSA 1DBNA 1AR92 4AFDA 4W6XA 2D6KA 2BNOA 4OFGA 4UXAA 3WP5A 4Q0SA 2PQQA 2B7YA 4PDWA 4CZSA 5BNNC 2A3WA 4N90A 4OHVA 4RL7A 2BVVA 3USSA 3I7DA 1QOSA 1S1AA 3KGZA 4GH4A 4B4QA 4A7YA 4D7SA 4WM8B 1TEIA 3PMSA 3AP4A 2WIIB 1OD5A 4KU8A 4HVOA 4JDMA 2TBVA 1WCKA 1ZBE2 3M3QA 5JIAA 4RSUA 1X8EA 1K5MB 1DGRN 4FPLA 4K7JA 2WA3A 1DQ4A 1ALYA 5BV6A 1CAWB 2FZ1A 3MF6A 1LOCA 3WDXA 4LBQB 1NCQA 1KFXL 1F5JA 1ND3C 3DV8A 3D0SA 1OLRA 3D5OA 1IPKA 4XF3A 2RS12 4OI1A 3VBUA 2D98A 1LEDA 1VBE2 1JUIA 4Y4YA 3FE5A 2XLGA 5FRAA 2YY1A 1ZBA3 3ENRA 4YZ2A 5AC92 1ZRFA 1HRV3 1NOVA 1QXJA 3FC0A 2PFWA 4RQPB 4Q4V2 4AK3A 4EN0A 4Y24A 4QMAA 3E5UA 1HQWA 2YZ4A 2R0FA 2VH9A 4HKWA 5DXDA 3M3CA 3B5LB 5DZGA 3S0MA 1C4RA 2GN7A 2DCKA 2EAAA 2DU1A 3X29B 3RWNA 2I45A 5A3MA 2JEMA 4AEDB 1XNKA 4Q1PA 5LEKA 4AGVA 2MEV3 3G7DA 1MZ6A 4M0HA 3UV9A 5T5JA 1OLQA 3LWCA 4Y20B 2HWC2 2ZZQA 4FXKB 1R1A1 1CN1A 1VRH2 2ZGOA 5DUUA 3INAA 4QPGB 4PDWC 1MS5A 4YYOA 2XVGA 5KXDA 2ZKLA 3B02A 4JC1A 2C5DA 1TMF2 5DDJ1 4FOWA 3VDDA 5EV7A 4I01A 4GH4C 1WMDA 5EYXA 1PO21 4EWEA 1KDMA 1NY71 1CAUA 5AFBA 5K9YA 4Y22B 3JQXA 1H8VA 4C1XA 1QQP3 2K2SA 5JDBA 1VBD2 2WNUA 1ZVFA 1V00A 4AVSA 2WZR3 2IXJA 4R4XA 4CDQB 2HWD1 3ZPYA 1RC6A 1EP0A 1FPN1 3J26N 3I4IA 5DUVA 2HWB3 4JQRA 1DF0A 3VKLA 3MIBA 4QT6A 4XE9A 2R1BA 4H55A 4Y1ZA 1KS4A 1O4YA 1Q3EA 1X8MA 5JZGB 1NCQC 4BMEA 3WW3A 4I0WB 4HN0A 3P3NA 3VBUC 1DLLA 1UU6A 2YGMA 2H6CA 4JDNA 3BCWA 2DCYA 1Q8VA 4AHXA 1H1MA 2AREA 4N43C 2UWAA 4AVCA 5T5LA 4AI0A 2WFPA 5AVPA 1WA4A 1LOBA 1H9WA 3CL1A 4LO8A 1HXS3 2TEPA 3I59A 4CDWA 3JB8A 5GLUA 3ECQA 3RYKA 4Q8LA 2R6QA 3KZ4C 1LR5A 2ZGMA 2DU0A 4GA9A 1YYNA 4K6BA 2WNEA 3JZVA 4RGGA 3NAPB 1QJZA