1C8M3

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
238
structure length
238
Chain Sequence
b'GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
molecule tags Virus
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
total genus 35
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m300
3NAPC 1AR71 3JB8A 2BPA2 2HWE3 2R043 1PO12 1AYM2 5BNPB 1SMVA 3TN91 3NAPB 5D8AC 1COV3 1FOD3 2TBVA 1AL0G 2BFUS 5BNPC 1RUG1 3VBSB 1D4M1 4GMP3 2RM21 1QQP1 1TME1 4QPGB 5FMOS 1NG0A 1PO13 5ACA1 1EAH1 1PGL1 1DDLA 4Q4Y2 2HWF3 5C8CB 5A32A 4RR3A 1HRI3 2WZR2 2MEV1 1K5MA 5FMOL 5L7OC 1AYN3 1CJDA 1OOPA 5DDJ3 2GH8A 1AR72 1C8NA 1QJY2 3DPRC 1AL22 4QPIC 5L7OB 2BBVA 1BEV3 2RMU2 1Z7S1 5AC93 1RUI2 3DPRB 1W39A 4CDWC 2XBO2 5C4WC 4CDXB 1POV1 1ND2A 3VDDC 5DDJ1 1R081 4Q4X1 1QJX1 2WS91 2RS11 2HWF2 4RQPB 4Q4Y1 2R061 1NA1C 1PGW1 1RUJ1 1HRV3 2XBO1 4CEYC 5BNOA 4RHV1 3JD73 3ZFEB 3VBOC 1RUD2 4GH4C 1RHI1 4IV1B 4QPGA 2HWF1 5A32B 4RR3C 1RUI3 2RR13 1HRV1 4CDQA 2BFUL 4Q4V2 2FZ2A 1TME2 1PO23 1BEV1 4N53C 5ABJB 1HXS2 1R1A3 2VQ0A 3TN93 1ASJ2 1COV1 1RUC2 1RUF2 1POV0 1RUC3 4GB31 1ND3C 1RUG3 4WM8A 1OPOA 5A33A 1V9U2 3HAGA 1EV12 1WCDJ 5C8CC 5K0UC 4Q4X3 3VBRB 5BNOB 1PO22 1E57A 4WM7C 4BCUA 1NY71 4CDWB 2DF7A 1HXS1 5J98B 2BUKA 4WM7B 2RR12 1RVF2 1FOD2 4Q4W2 2RM22 5L7OA 4RQPC 1VBC3 5J96B 1PVC2 2HWE2 3DPRA 1RUE3 4PDWC 3CJIA 2WFF3 1NCRA 1AYM1 1R093 3JD72 2RR11 1VBD3 1RB8G 4N43A 3JB4C 1RUG2 3VDDA 5ACA3 1PO21 1QJU2 1VRH1 1F2NA 1QJX3 1VBE2 3ZFEC 1R083 2WS93 4IV1C 1NA1A 2XBO3 4WM8C 4CEWA 1VBD1 1TMF1 5D8AB 3CJIB 3ZFGC 2HWB3 4CDUA 2R041 4WM7A 1PIV1 2XPJA 1FMD3 4CDQB 5CFCB 5C4WA 4CDXA 1ZBA3 1HRI2 2X5IC 4CDQC 4RQPA 1D4M3 1TMF3 5GKAC 1ND3B 1AR81 1BMV1 1NCRC 1NY72 2IZWA 1PGW2 1RUJ2 5BNOC 1H8TA 3JBG1 3IDEA 1ZBA1 1B35A 4IV3B 1MQTC 4N43B 3VBFA 1NA1B 5C4WB 1PIV2 3ZXAC 4JGZC 4CDUB 3ZFFB 1BEV2 1FMD2 5AC91 4IV1A 2ZTNA 4CEWB 1Z7S2 1AR91 3VBUB 5D8AA 1MEC2 1VBC1 5CFCA 5BNPA 2WZR3 1VBE1 2ZAHA 3VBHB 2RS13 2WFF1 4Q4Y3 1RMU3 1RUE1 5BNNB 4RHV2 1RUJ3 1AR93 1VBA1 1EAH2 1QQP2 3S6PA 1RHI3 1VBD2 2RS31 4WM8B 4RS5A 1OOPC 3VBSC 1VRH3 4YVSC 4YVWB 5CFDB 1H8TC 2Y26A 1AR61 1VBB1 5BNNA 3VBFB 3M8LA 1RVF1 1B35C 1C8M1 1VBC2 4Q4W1 1NCRB 1VBA2 2RM23 4GMP1 3VBFC 1AR82 1BMV2 1ND2C 1QJY1 4Y5Z0 1EAH3 1NCQB 1FMD1 1K5MB 2PLV2 1R1A1 1VAKA 3VBUA 1V9U1 4GB33 4SBVA 1VB4A 1VBB2 1AR62 1F8VA 1ZBE1 1VBE3 1QJU3 5CFDA 5ACA2 3VBOA 4GH4A 4FSJA 1PGL2 3J8F2 2R072 2HWC1 2R073 3J8F3 1MEC3 2GSYA 5JZGC 1Z7S3 3ZFGA 4CDUC 1VBA3 4Q4V3 5C9AC 4RS5B 1PIV3 4FTBA 2WWSA 4JGZA 4RFT0 2PLV1 4N53A 2X5IA 4YVWC 4AEDC 5CFCC 1RUH3 4Q4V1 4QPIA 1ND3A 4Q4X2 2HWE1 4AEDB 1RMU2 1RUF3 1ZBA2 3LOBA 4YVSB 1MQTA 3JBG2 1QQP3 1BBT1 1NCQC 1FPN2 4JGYA 2RS33 2HWB1 1AL21 2RMU3 3VBOB 2HWD1 5JZGA 3CJIC 4Z92B 2MEV3 2MEV2 2RS51 1HRI1 1C8M3 4JGZB 5C9AA 1AYN2 2WZR1 2ZZQA 5ABJC 1AR83 1NOVA 1RUD3 3NAPA 2RS32 4NWWA 1X33A 2R062 4IV3C 2RMU1 1X36A 1IHMA 3JBG3 3VBRC 4PDWB 1QJZA 1D4M2 2RS53 3ZFFA 2RS52 1CD3G 4CEWC 4YVSA 2WLPA 1PVC3 1M06G 2R063 5A33B 4JGYB 1AR92 4EJRA 1AYM3 1VB2A 1MEC1 1MQTB 1A6CA 3VBHC 1RVF3 3VDDB 5AC92 5C8CA 4RHV3 1OOPB 1NCQA 4JGYC 4GMP0 1AL23 1C8M2 1HX6A 1QJY3 1GFF2 1AUYA 1AR73 1RMU1 3VBUC 1PVC1 2HWD3 1V9U3 4Y4YA 1FOD1 1ZBE3 4YVWA 1FPN3 4AEDA 5CFDC 2QQPA 4PDWA 1TME3 1BBT2 2HWC3 2R071 3J8F1 4IV3A 2WFF2 2WS92 1RUE2 1AR63 1VBB3 4GH4B 4N43C 3ZFGB 1RUF1 3VBRA 4GB32 1COV2 4FTEA 1RUC1 1RUH2 1K5MC 3ZFFC 4CEYA 4Q4W3 3ZFEA 4FTSA 2R042 4RR3B 5JZGB 1H8TB 1OHFA 1TMF2 1HQNA 5C9AB 1B35B 4QPGC 3FBMA 5K0UB 3VBHA 1HRV2 4N53B 1RUH1 1EV13 5ABJA 1POV3 4LLFA 1QJU1 1VRH2 4NWVA 1RUD1 1PO11 2HWB2 1ASJ1 1RHI2 2X5IB 5LK7B 4CDXC 4RS5C 2HWC2 3VBSA 1R091 4QPIB 1BBT3 3JD71 1FPN1 5BNNC 1R082 1EV11 1ZBE2 1AYN1 1QJX2 2RS12 5FOJB 5K0UA 5DDJ2 4CEYB 2PLV3 2HWD2 1ASJ3 3TN92 1HXS3 1R1A2 4CDWA 1ND2B 1RUI1 1R092 2FZ1A
chains in the Genus database with same CATH superfamily
1SLCA 5LBBA 3D0JA 5FYYA 4UW4A 2YROA 1J1LA 4P5YA 4QX0A 1V6IA 4LBQA 2R043 4XDOA 2ADDA 3HEIA 4QX7A 1AYM2 5FBZA 4O9EA 3A7QA 4KGGA 4ATEA 2IFWA 4D7TA 5FP9A 1AJKA 3OGVA 4WZFA 5FP8A 1YQ5A 3POWA 4AQ2A 4LBOA 4Z82A 2TBVA 3OY8B 3TEWA 2O0OA 5AVPA 5F6LB 4FOYA 1D4M1 5ANNA 4K1ZA 3O1UA 4I2OA 1QQP1 3FL7A 5FMOS 2R1DA 3HOBA 2VQAA 4XJWA 3H7JA 3W21A 5E16A 1Z78A 4O61A 2NMOA 4CYDA 2Z69A 1PGL1 3DGTA 5JSPA 1DDLA 3I7DA 3WNOA 3IIIA 4COVA 5A32A 4DOUA 5IVCA 4NHKA 2WC2A 2BOIA 2ERFA 1GANA 1K5JA 2WZR2 4HK9A 2MEV1 1JZ5A 5IK8A 5FMOL 3M3CA 3VKOA 1FYUA 3R4SA 1GZ9A 4UAPA 1OQ1A 3POYA 2Q8OA 3DPRC 3MPPG 4XTMA 2F17A 1AL22 1W6OB 2PMWB 4QPIC 1UAIA 4QHZA 1V6NA 5FYCA 4PIYA 1W9WA 3CL1A 2D40A 1SPPB 2VPVA 5LRRA 5A6QA 4CPBA 4D0QA 4FFHA 1W39A 2XJQA 3T0BA 1CAXA 2ARBA 2WO2A 2XJPA 4CDWC 2LROA 3KCCA 1ALYA 3VDDC 1OH4A 3C7GA 2JB4A 4XFCA 3WINE 5F9TA 2Q1FA 4Q4X1 4ONUA 2VNVA 1BK0A 4UW3A 2AYHA 5FPBA 4UW5A 2R061 1YIPA 2GC3A 4KBBA 2IXLA 4NHYA 2DUOA 4AI9A 4CEYC 3T09A 2VMCA 3AB0A 1O3TA 1XE0A 3I97A 2ARAA 1JOBA 2BW8A 2VULA 3PU8A 3WZ1A 2FDJA 4ARYA 2WNUB 1POQA 1S1AA 1RHI1 1X8MA 3PJYA 5C7GA 3FMGA 4EZHA 2HWF1 5FYSA 3BU7A 4QX1A 2WQZC 4V2WA 4HLTA 5LEKA 5G04L 1RUI3 2RR13 4Q0SA 5CYYA 3OUHA 1O3SA 3SHRA 3WT3A 2E26A 4Q4V2 3EXUA 1D0GA 1ZRIA 3MW2A 4W65A 2XR4A 4XBQA 4OMCA 1DGLA 3LFIA 1YIFA 5ABJB 2VQ0A 1COV1 2Q5TA 1Y9GA 4ISRA 5FWEA 5BNOB 2JICA 2ILMA 3T3YA 1RUC3 3OYWB 3U1XA 2QQJA 1AX0A 3WG4A 1H30A 4GWJA 1YUDA 4XUOA 4ASLA 3DF0A 5GZGA 4PQQA 4ZS2A 5LATA 3WP5A 1IS4A 4YGDA 3G6JB 4EROA 5HCFA 2YC2A 1OVPA 2QCSB 5FY9A 3KQ4B 1W8UA 4HOOA 4WM7B 4QX5A 1FOD2 5GZCA 5L9VA 1VRBA 2EALA 2ZAAA 4K21A 4Q4W2 4WZCA 2X05A 4XYXA 5KC6A 3BIEA 2XOMA 1UOFA 3FLRA 4RQPC 1ULGA 2ZOEB 3ELNA 2JDAA 5KR7A 3H8XA 1DGWA 2C26A 2QTWB 1HQLA 2HH9A 2HWE2 4HONA 2F4LA 4OULA 4XF3A 5IVYA 2R30A 4PBPA 2EVXA 1PX4A 3NKGA 4WVMA 3CJIA 3ILFA 4A3ZA 1NCRA 4MGZE 1R093 2V4VA 4MXWB 4HN1A 1X9TA 5FZCA 3MHZA 4FOWA 2WYSA 4RA0A 1W8TA 3N36A 3WW1A 3ZLIA 1JHNA 5JPMB 1HV1A 1QKQA 1C1FA 3B3QE 4GAZA 3J7LA 1EP0A 2NM1A 3KT1A 1HN1A 4GIQA 4N43A 2QKDA 2X8KA 1GV9A 3MUY1 1PO21 3OYWA 1O6UA 1YWKA 4LJHA 2DYCA 2P6CA 5DAQA 5EZWA 3ZVXA 1QJX3 2P3KA 5DPNA 1OC1A 2R0FA 5JIUA 1UY2A 2WS93 4W50A 1YQCA 2BEOA 5FZIA 2BOJA 4W6YA 3T2OA 1IZ3A 4AFDA 3SXWA 1GSLA 2GNDA 2NYYA 2VL4A 4WM8C 5DABA 4FI9A 3SH5A 5JDBA 1H2MA 1TMF1 4FPCA 3WQBA 3ZFGC 4ZU5A 2DU0A 1QH7A 3U75A 4AW7A 2AR6A 2ZHNA 5DAVA 4CPBD 2CY6A 4D6RA 1PIV1 1US3A 4IGPA 5DAXA 4XFAA 1O59A 4AEJA 2E33A 4FVVA 1IQAA 1ZZ8A 3IAPA 4QKDA 1JTZX 2WZ8A 3MLJA 5FDBA 4CDQC 3LQCA 1D4M3 2WQ8A 3TEYA 4XXPA 4XQDA 3RZMA 5J1XA 2ZGKA 1LEMA 3CBNA 4XILA 1UKGA 1AR81 1TEIA 1DBNA 2VZQA 5JUVA 2FDKA 2VTXJ 1V0AA 2VCBA 1DYOA 1PGW2 5BNOC 4LUKA 1D2SA 1H8TA 3TEXA 3FE5A 5DG2A 3JBG1 2VCCA 3NJXA 2XB6C 4Y20B 4YZ4A 5CG8A 1GYKA 3KHBA 4GJYA 1MQTC 4XIOA 3M7AA 1W9TA 3NNGA 4J1WA 3H7YA 2HEWF 1PIV2 4AVTA 4Q26A 3O1VA 2ZMKA 5EXOA 5FYTA 4FP2A 4Q0QA 5AC91 5L9RA 5CKQA 2BERA 4PLMA 4JRLA 1Z7S2 3GBGA 2J7MA 1WGPA 3MUZ1 4AFCA 4LITA 3KD4A 5DUVA 1VBC1 3NMBA 4CXWA 1AXYA 3CMGA 3USUB 3LEKA 2RVAA 3O1RA 1VBE1 1V70A 2Y6LA 3SH3A 4IE6A 4S2FA 4CTEA 2DCYA 5KXCA 1RUE1 5CISA 3ME2A 4KBZA 4XABA 3M4FA 4A45A 4EN8B 5BNNB 2IWGB 1LECA 5A1LA 1REEA 2J22A 4K40A 4HSLA 2WA4A 3I2GA 1GICA 1LHOA 4DUVA 1H6YA 4WM8B 3ZSJA 4SLIA 1YFUA 2AEYA 5I91A 1EY2A 2K46A 3AYDA 3DCQA 4U36A 1MS4A 1K42A 1PGSA 1XSQA 4V1PA 5CFDB 1VBB1 5BPXA 2WNUC 3RGBA 4IUGA 3LCPA 3MIGA 1RVF1 5SV8A 3H1MA 5F1RA 1S0FA 4Y20A 1GOHA 1OLQA 1NZIA 1X9PA 1C5HA 2RM23 3LSEA 4GKXA 4MXVA 1AR82 2VOVA 3NV2A 3GHNA 4FPJA 3UJOA 1UY4A 1QY4A 2A3WA 2D3PA 3FUOA 4QGNA 5AVAA 4AQTA 3ZXEA 5FMDA 3TAYA 1FMD1 1ZZBA 2DV9A 1XJAA 2PLV2 3B7MA 4FFFA 2HBTA 4ITCA 1VAKA 1W2OA 3PUAA 5GLZA 4P9LA 4MXWA 1VB4A 1ULPA 4PBOA 4OI0A 1GUIA 1VMHA 1VBB2 2BGOA 2WSVA 3J7HA 1F8VA 1W2TA 2ES3A 2W08A 5F3CA 2FDHA 1W8ZA 2IXCA 2ZZJA 2GALA 2DU1A 1W6NA 4QDQA 2DVDA 3AK0A 3BALA 1LR5A 3HWJA 1PGL2 4TYSA 4IEVA 2J1AA 2HWC1 1WW4A 1MEC3 2E7AA 3WG2A 1Y9MA 5FLIA 3DUIA 5GLUA 1SZBA 4OHWA 4FPFA 1KDKA 3BB6A 3HNMA 3MIBA 4R9DA 3WSOA 4D7YA 4LBQD 2FHRA 2XLFA 2WWSA 2X53S 5FZ7A 3MPBA 2QZ2A 2VE1A 3LDRA 3WP3A 1J58A 4M4RA 4YNIA 2VVFA 4LKSA 4Q1PA 2HYKA 2E32A 2BNNA 4JDOA 5JSOA 3FHQA 5L36A 4YVWC 4BXSV 1VJ2A 5HCHA 3HT2A 4XFHA 1CWPA 2Z42A 3W59A 3H42B 3VHPA 2D5HA 2HWE1 2JDNA 1CAWA 4XJZA 4A7KA 1RMU2 2ID4A 3OCPA 4HETA 4INDA 4MH0E 4B3NA 3JUUA 2GAUA 5LA1A 1WD4A 3MDPA 3MIHA 3VUOA 2WNEA 1BBT1 1NCQC 4JGYA 3U10A 1ULOA 4N90A 2D6KA 2RS33 5FZEA 1N1SA 2WQ4A 3PVBB 2WO1A 2RDNA 3FZ3A 3ZN6B 3RRDA 2GZWA 3VBOB 3VBRB 2CDPA 2D6LX 5JZGA 3CJIC 3OB8A 3THTA 4Z92B 4FPYA 4AGVA 2JB8A 2RS51 1JZ2A 2VGDA 5FK7A 2DWRA 3AL5A 3O1TA 5C9AA 1DU3D 3ROUA 3E5XA 1NUKA 4DS0A 3NAPA 1IS6A 4BIFA 4NWWA 5FY1A 1X33A 2JKXA 2P17A 4LE3A 1X36A 2ZXQA 5C6CA 1CAUA 1KFUL 5FP7A 5FMCA 5L19A 4E2GA 2RS53 3B9IA 2D6MA 2JDHA 2W1SA 4JDMA 2RS52 3ZYHA 1OLMA 4YG6A 4YVSA 2XHKA 3MIFA 5T5JA 5KHKA 3HBKA 2QQMA 2BVBA 3E5QA 1JODA 1US2A 3BTYA 1LGBA 2EIGA 1W04A 2YBPA 1ULDA 1HW5A 2GNMA 1MQTB 2SBAA 1RVF3 3VD5A 4RHV3 1HQWA 2GN7A 2JG9A 1NQJA 4H2AA 1JYIA 1KDMA 2DVGA 2TEPA 2YU1A 3K46A 3K4DA 4GMP0 3NO8A 4WBBA 1HX6A 2EIBA 4KWLA 3CEWA 1BK1A 1SLTA 3HNBM 1AR73 1J3RA 4GJZA 4L9BA 3AX4A 1LRHA 4Z2WA 1RMU1 4IEQA 1WCQA 2CNAA 1JZ3A 2HWD3 2FCTA 4C0BA 3PVEA 4M01A 1VAMA 1CGPA 4Y4YA 2FMDA 2YMZA 3EO6A 4K1YA 5C5TA 1G9CA 3DV8A 1NE4A 2IVIB 4NJ4A 4AHYA 4YGBA 3PUIA 1XE7A 2FCVA 4QDRA 2QQPA 3VDAA 2VOKA 3UKTA 5KHJA 1ZYBA 1TME3 1BBT2 3OUJA 3WHTA 3ZXLA 4NOTA 1NX9A 4FXKB 4HPKB 4HVOA 1LU1A 4KWKA 3INAA 2HWC3 4FPLA 4MADA 3ZDSA 1OF3A 2OT7A 3IMMA 4KL1A 4DXZA 2D97A 2WFF2 4KG8A 2GNBA 2XLAA 4X6QB 1RUE2 3PJQA 1AR63 4K3UA 4LNVA 2WO7A 2PAMA 3P3PA 2W39A 2GNTA 1RUF1 3M3IA 1COV2 3AFGA 3S30A 3KCYA 4E2SA 4AL9A 3MFAA 4QXHA 2JJ6A 1QDCA 3OBAA 4K20A 4IDZA 4UFHA 5FYVA 3RYKA 4CEYA 1YC61 1FV3A 3WF3A 4FTSA 1V6JA 2JG8A 5JZGB 2A7AA 5LASA 4AQSA 3JQXA 4QWNA 3SEPA 2I74A 4QKFA 2QVSB 2VMFA 1LESA 2CGNA 1W2AX 3MFCA 1DQ1A 2ZGTA 3FBMA 3GGLA 2B7YA 3K51A 4LTAA 3ZSEA 2VZSA 2RE9A 1TG7A 3UJQA 1LOBA 3CNAA 2B4KA 3WW2A 5J3UA 5CA6A 1GNHA 1REFA 2WSUA 5EP9A 5F6KA 2P2KA 1EV13 1WW6A 1UZZA 4AWDA 5ABJA 1MACA 2RHPA 1JU3A 1POV3 3N9NA 4LLFA 4OHXA 3MEPA 5FYMA 1G9AA 1LGNA 3W5NA 4FT8A 5IVVA 3S57A 1PO11 5LRSA 1ASJ1 1RHI2 1W8FA 3O0WA 4FO9A 4AEKA 2BYVE 3ZYFA 3ZKYA 2XH6A 5BY5A 1R091 1G86A 4IE7A 4DXSA 4FBFA 4FPEA 4XQ4A 1UMHA 3E6CC 2IXHA 4NN0A 2OPWA 1H4HA 4KNCA 4NROA 1AYN1 4E27A 2J1TA 1WLTA 3B5LB 5FRAA 1XNCA 3ZKUA 3NV1A 5F7UA 3N4MA 2O14A 3CKHA 1X8EA 4LULA 5FPUA 2PLV3 3SNMA 1ASJ3 1GP6A 1WMEA 2YXSA 1AX1A 3ST7A 1HXS3 3C7HA 2HYXA 4MZUA 2EXIA 2IXKA 1VLNA 4XETA 3OF1A 4QHBA 2RV9A 1QOSA 2IC1A 4OUMA 4QQPA 2VUCA 2E9QA 3MGUA 1C4RA 4NAOA 1S0GA 4WVMB 1AR71 1I6XA 3O0XA 1CAUB 2OXBA 5FYHA 1PO12 4MHUA 1OBNA 4NVPA 2JE8A 3TNPB 3I4IA 2NQYA 3TN91 3NAPB 5IVFA 3BOWA 1O8SA 4COYA 1QXPA 2WAAA 2ZX0A 3VV1A 5BNPC 1RUG1 2JKBA 3VBSB 4D6QA 1EYBA 5A1FA 3H3LA 1W2UA 2KA3A 4ORFA 3K2OA 3A22A 4EZ4A 2OUJA 4R9AA 3IDCB 3OPWA 3HR9A 5GLWA 3GHMA 2C9KA 4BQ2A 1F35A 2HWF3 3ZMNA 3ZO0B 2E6VA 4LOTA 5H9RA 2ATFA 1WCUA 1HRI3 2JD4A 5DQ0A 2P6HA 4JQRA 4L0PA 4Q8LA 3KVBA 5FY4A 1H9PA 1K5MA 3GZEA 3S7EA 5BV6A 4LHLA 2LALA 2D43A 2JG9B 1YFXA 5DDJ3 2GH8A 2BBAA 4EN7B 3M3QA 2RJKA 1C8NA 2ZKNA 3SISA 2VQUA 2VMDA 3ES1A 5L7OB 3UESA 2ZA9A 4V2VA 2IXJA 3H1WA 2RMU2 1OA3A 2B39A 4N9IA 5DZGA 3RZKA 5AC93 1CIYA 2P1BA 3USSA 2ZGPA 3I8TA 1POV1 1ND2A 1WLDA 3V0BB 1PVXA 2O8OA 2VCAA 3U07A 1ENSA 3K4AA 4R9CA 3BTZA 2WS91 2V5DA 3GBFA 3LB9A 5JR7B 5I0SA 1S0IA 4RQPB 1Y3TA 4YGEA 5TSWA 3WQ7A 5C3PA 1RUJ1 3BGAA 1HRV3 2XBO1 2DVBA 3VKLA 1CZVA 3IDBB 2GC2A 1PK6B 2A73B 4PIXA 3CZUA 4UBHA 3ZR5A 3H8RA 2DCKA 1GMMA 1RUD2 3VZJA 4Y3OA 5FWJA 1V6MA 2A5ZA 1SDDB 3DKWA 4UFJA 3U37A 4HXCA 5A7SA 1UY1A 3N9PA 3SMHA 2Y6HA 4LMFA 3D6EA 3ATGA 2HEYF 3J26N 4HVRA 4CDQA 1YI7A 1UZ0A 4LBKA 3OBTA 1SPPA 4L97A 1S2EA 4OHVA 1JH5A 2OA2A 4AGRA 4JHTA 2BTVC 4QQLA 1BEV1 2DTWA 2WAOA 2XGXA 3WX5A 2QQVA 3BODA 2ZPXA 4XFGA 3R05A 4KH9A 4Y22A 2YGLA 3I3QA 4GB31 4AHXA 4FFGA 4DFSA 5BNNA 5A33A 3Q8CA 3SEEA 1EV12 2PXJA 2VXRA 3E6BA 5K0UC 3QOPA 2TUNA 5EV7A 1Q5OA 2Q8DA 3LDKA 1PMJX 2AUYA 1E57A 2P34A 4K8RB 1PZ7A 1G9FA 4MOAA 4MV2A 5E8AA 1PZ9A 2DF7A 1WMFA 4RYDA 5FXWA 1OI6A 1LJ7A 4NRMA 3AKQA 4YWAA 3RWNA 2BUKA 1YLLA 1JUIA 2WYFA 3DYMA 3H50A 1S2KA 2C4XA 3KT7A 4I3PA 5E1RA 5L7OA 1XYNA 5KHIA 2IFRA 2OYZA 3VL9A 3ZXFA 1PVC2 5K9YA 3DPRA 5IYYA 1LCLA 1VP6A 2FCUA 5H9PA 1L7QA 1RUE3 2VBDA 4PDWC 4LO4B 5EJZB 3WNMA 2WFF3 2CYFA 2W1UA 5DG1A 4E4ZA 2VZVA 5KHGA 4LT5A 2ZX1A 4JVAA 1N1YA 2D3RA 3HN1A 4BQ5A 4CP1A 5LA0A 1LOCA 4FPHA 1I1EA 1DQ2A 3CHXA 2YBSA 4OQ9A 3FHAA 1STMA 3JB4C 2ARCA 3B02A 3J7NA 4P9YA 4Z07A 2PHRA 1H4GA 1VRH1 2XDVA 2RJ2A 4RSUA 2ET7A 4MGQA 3HN3A 3POFA 4XXAA 1QNWA 4AF9A 3QH6A 3SC7X 3KSCA 2ZJCA 2VAUA 4AGGA 3ES4A 1AJOA 2XLGA 4WVVA 2GH2A 3C8XA 2NLRA 1UYXA 4RD7A 4LO5B 3N9LA 4A7ZA 4OUEA 2QQKA 4CEWA 5LEJA 1N3QA 2YBKA 5LBCA 2JIGA 4S2DA 5HXVA 5LA2A 3RPQA 2P37A 3F2ZA 5BYNA 4WM7A 2O8QA 4FCAA 2UYAA 5HV4A 3FFQA 1QU0A 2GDFA 1FMD3 4ASMB 4CCLA 1UMIA 4CDQB 3Q8FA 4MGIE 3LFMA 3KVAA 3PL0A 5C4WA 3WF2A 1ZBA3 1HRI2 2JDKA 2L9LA 2NN8A 4Y4RA 1CVNA 4RQPA 1CAVA 4CUCA 1Y9QA 3Q8AA 1YRZA 3BPSA 4TXWA 2ZGNA 1DYPA 2VU9A 4IEWA 3V65A 2XWJB 1BMV1 1QJFA 4F8AA 1OD5A 1YFWA 2D6PA 1FV2A 4UFIA 3RYPA 3I3MA 1YI9A 4FQZA 4XF1A 2G4IA 4GA9A 2ENRA 3GZTB 4CCKA 1F4HA 3MLLA 3A4UA 1QNYA 4OI4A 4NIHA 3PMEA 4FP3A 2QUOA 3ZMOA 2Y6KA 1RINA 1MPXA 3N7KA 4BJ0A 4XC9A 1J3QA 1NE6A 2ZHKA 3KT4A 2D7FA 4IE4A 3ZFFB 2ZGRA 4FQ4A 5C33A 4CEWB 4YW7A 4MGSA 1XNKA 5D8AA 3ZIWA 2YV8A 3FWEA 1JI6A 4XCAA 5GLVA 2UWBA 4XUNA 1RIRA 3E6DA 5BNPA 2WZR3 3R6SA 1KEXA 3HBZA 4CU8A 4QXCA 3VBHB 4LBLA 5DMYA 1RMU3 3NV3A 5T50A 1SACA 4P08A 4NPMA 5JI7A 5LK5A 1VMJA 1T6GC 4RHV2 5I0RA 4IEUA 2W87A 3KF3A 4AG4A 1PNGA 1XBFA 1YXWA 2PHUA 3T08A 3A21A 1VBA1 4H55A 3AYAA 5JXHA 2BWAA 1RHI3 1VBD2 5EJ1B 5JXJA 1YNAA 1WA4A 1J1TA 1SCRA 2FBEA 4RS5A 5A3WA 2ZS6B 5CKMA 2OUHA 3M2MA 2UU8A 3W5MA 4B4RA 1H8TC 1AR61 4YM1A 4O9GA 4XMAA 4KG0A 5JWPA 4XJ8A 1BHGA 1C5IA 1WWYA 3OGGA 2VW2A 1B35C 1C8M1 1P8JA 1VBC2 3R4DB 4Q4W1 3ZSMA 3WNLA 1LOAA 3LF7A 5FKBA 3ON7A 1ZZCA 4GMP1 1YCIA 4Q8KA 1H8VA 3VBFC 1BMV2 3ACLA 1DGRN 1ND2C 2P3JA 1S0CA 4ES9A 1QWRA 3NWKA 3E5UA 3N35A 2XL7A 2F6BA 5DXDA 2PELA 2GP5A 1SBDA 3VBUA 1RYYA 2WLQA 1V9U1 4XJAA 4NIGA 2HEVF 1OF4A 4P14A 4SBVA 2EA7A 4A3XA 4CU9A 1YO8A 1WD3A 1O4YA 3FBYA 5GJ6A 3ZN4A 1AR62 3GF6A 1DLCA 1MZFA 1ZBE1 1DCSA 2B46X 5IT6A 4GQ7A 3AJYA 3WY6A 2VVDA 4ZZ5A 5IW0A 1WBLA 3SH4A 1PM7A 2YPDA 4LR4A 2XONA 2YC0A 5A3NA 4YM2A 3I2IA 5FZGA 2ET1A 2R072 2R073 1V6LA 3J8F3 3J8F2 4G9SB 5A7OA 4UXAA 4PCRA 5JZGC 4A41A 3V0AB 1UF2C 2J42A 2EXJA 2XKPA 3VHOA 3ZFGA 1W6MA 3QD6A 1UZYA 5FCCA 2IXIA 3K3NA 1DF0A 4H7MA 4HZFA 4EYUA 4IGQA 2I45A 3GZUC 3JZVA 1XE8A 1DQ5A 5F3GA 4O7XA 3ZXKA 2GU9A 3RSJA 1OA2A 1HDKA 3BPZA 3ZSKA 4AI2A 1XNBA 2PHFA 4RFT0 5JI9A 1XSRA 2PLV1 4I3GA 4YW4A 3S5QA 1O3RA 2VUAA 4QAWA 2X5IA 3MF6A 3ACIA 3APBA 5FREA 1ZRDA 1JHJA 1MZEA 2XQXA 3OTFA 5DAPA 3LKJA 4MHRA 4AEDC 2VZTA 4TN7A 2VMHA 3VD4A 1ND3A 1QMJA 1WLCA 4AYUA 1W9FA 4ZU7A 4XFFA 2CU5A 4GALA 1KGYA 2VH9A 4AZZA 1DGWX 3ILNA 2VZOA 4ET7A 2X09A 1KJRA 2CTVA 4COZA 2JDMA 1ZBA2 2W46A 4GWIA 2AEZA 1EPWA 4P9IA 4H14A 4QB6A 5FYBA 1TE1B 4QM8A 4NMIA 5FZ3A 5A3OA 4NRPA 1RGSA 1TQ5A 4UF0A 1MS9A 1WMXA 5FUIA 2GMEA 4QX8A 4EWEA 1FT9A 2VMIA 5M0TA 1MS0A 4JX0A 3ETPA 4BMEA 4KI5M 3VB9A 2PYTA 1OA4A 5JPNB 4CUBA 4XPVA 2WNUA 1UYPA 2A3XA 3AYCA 3LOIA 4C90A 1C8M3 4FOQA 3VKNA 4MGYE 3LA2A 1LU2A 1AYN2 2EAAA 2WZR1 5ABJC 3VKFC 3AC0A 5F5AA 4AI1A 2JE9A 3U0ZA 3L2YA 3LWCA 3TBDA 1AR83 1RUD3 2RS32 5FQ0B 1Y7BA 3POGA 2A3YA 3IDAA 2VUJA 1SLIA 2Y8KA 3ABZA 3UT0A 4BZ4A 5IVBA 1D4M2 1LOFC 5FY0A 2LRPA 1ENRA 1SHWB 2NPIA 3AVSA 1N3OA 4YZ3A 3O1SA 4LUMA 2YG0A 1JS9A 1MS3A 4LA2A 1LNSA 1ENXA 4OI1A 4CEWC 1SCSA 2JG8C 5IWFA 5FAXA 1PVC3 5C70A 1M06G 3I2DA 3ACHA 4E4DX 1CX1A 3LD8A 2R063 1NAEA 5F5CA 2W94A 1FXZA 2WWUA 1VB2A 1W6OA 1W0NA 1UQXA 1MEC1 1ZM1A 3KF5A 5FUPA 3VBHC 1CZSA 3POEA 4M0NA 5AC92 5C8CA 5FKCA 4OFGA 2VOWA 2VOXA 2D44A 4I09A 4JGYC 3DKQA 2V72A 3T2QA 1SFYA 4I0AA 4WVZA 2QQLA 4Y1UA 3ZSLA 1UZVA 2YFUA 1AUYA 1WZXA 2W91A 4BIOA 2V73A 4IEPA 3I3DA 3H3ZA 1XB9A 4CCJA 5FO9B 2Y6GA 4IEXA 2XL9A 3VHRA 2WZEA 2FD8A 4YGCA 5GZEA 1ZBE3 3LSDA 4M3CE 4META 4Q0PA 1GWLA 5IFPA 2W52A 5CFDC 5FZDA 1SQ4A 5KWRA 5FZ6A 2BU9A 5FLHA 1JYCA 3JU9A 2P3IA 4TLGA 3JXSA 2Y38A 1SBFA 3FN9A 2FDIA 1KFXL 3N9OA 1VBB3 2OZ6A 5E89A 1QHDA 4CXYA 3VBRA 2BGPA 3P3NA 2WR9A 4YG0A 1I9RA 4P9WA 4J25A 1RUH2 3ZFFC 1K45A 2QZ3A 4D69A 5FY7A 5F3IA 3AP4A 2XG3A 3K48A 4Q4W3 2ARXA 4OHZA 3HQRA 4LPLA 2DBIA 4RR3B 4YW3A 5A3MA 2QDNA 2W3JA 4HFSA 5A6YA 2ORXA 4BDVB 1CPMA 4JHZA 3PVOA 4EE2A 1IG3A 3A0NA 1NKGA 2VECA 1Q8OA 2ZBJA 1HRV2 1UU6A 1JYXA 4FPOB 4XF4A 5FJKA 3PUSA 2VNGA 2MNGA 1O4TA 4L11A 5C3RA 4ZZ8A 4GWNA 1RUD1 1W9SA 2EF6A 1URXA 2X5IB 3VD7A 4CDXC 5FIXA 3I59A 1J84A 2Q30A 2HKXA 3VBSA 3WV6A 2ZACA 4M3CF 3RJRA 2YGMA 5F3EA 2C24A 4QPIB 3T1MA 5A3UA 3EJKA 1FPN1 1HJGA 3UL2A 1U5ZA 5FZBA 4W4ZA 1F31A 2WBKA 1YJKA 5BNNC 3M1HA 1ZBE2 2BGCA 3MIDA 1QJX2 1Q43A 3MO4A 3N7LA 5FOJB 1QGLA 2BP6A 5K0UA 5DDJ2 4HANA 1W0OA 4X8NA 3MV11 4IEOA 3VGIA 4L92A 4UW6A 3U4SA 1K3IA 1ND2B 3V0BA 1QIQA 1R092 2FDGA 1H1MA 1E5HA 3AJZA 5EYYA 1W99A 3NAPC 2K0GA 5A3LA 3JB8A 2BPA2 2E53A 1L3JA 2HWE3 3TOJA 1Q56A 4RGAA 3PNAA 5H9QA 2I2SA 5FOBB 1U0AA 3OPTA 5CZKA 1COV3 1FOD3 3LEMA 4C1XA 3IPVA 4PLNA 3DECA 5FMBA 2WABA 2BFUS 1S0JA 4ZXKA 4LA3A 5EFUA 1ODNA 4GMP3 2CDOA 3AMPA 1QOTA 4QPGB 4QB2A 1NG0A 1PO13 1U5IA 3P5BA 3KHCA 5I93A 4AAPA 1EAH1 2UYBA 2A6VA 4EN6B 2HLEA 2ZGUA 1W8OA 2JG9C 3WR0A 3RZHA 1CESA 4ATFA 1A78A 1GWKA 2Q0AA 3H9AA 4AVBA 4I0WB 4NHXA 3NVCA 1ZZ6A 4KWJA 5T52A 1AYN3 4DZGA 3KV9A 4OYUA 5L7OC 3NSTA 4KMQA 5FJHA 4ZXEA 4C8DA 5JOWA 5T5PA 1JYNA 1ZA4A 1AR72 3CJXA 2GC0A 1JOJA 1UIKA 1XPWA 1O5LA 1RJ8A 2E7TA 2WDBA 5L73A 4I02A 1ZZ7A 1BEV3 4CCEA 4CVUA 3WNXA 1DIWA 1UY3A 2A6XA 3Q8EA 4AI8A 1LULA 1RUI2 5IHRA 4BYYA 5EIYB 4P00B 1NXMA 4JKKA 3I2JA 5C4WC 4CDXB 3RG0A 4BOWA 3ALQA 1XOYA 4IE5A 1HB4A 2XWBB 3RNSA 3W58A 4MG2A 3URFA 1WCSA 1Q3EA 4URTA 1A8DA 1W6QB 2X10A 3R4UA 1QJX1 2BNOA 4DUWA 2RS11 3N9MA 2VUDA 2HWF2 2Y34A 4OLLA 4QT6A 4XZUG 4UBGA 5IAVA 4YPJA 4DEQA 5F8PA 1NA1C 3CF6E 1PGW1 3ECQA 3VD9A 2Y0OA 3T0AA 4CXXA 3MIEA 3ZFEB 2YFZA 1D2QA 2VD7A 3KMHA 1JMUB 4LLOA 3VBOC 2Z2SB 1DGRA 1LB2A 3BKZA 3AYEA 2IUWA 4IV1B 4BQ4A 1DFQA 2H0VA 1JYTA 4QPGA 3OD4A 1XNDA 1V6KA 5A32B 1YFYA 3TRSB 2E31A 5EQUA 2K9ZA 4LK6A 3WUDA 1F5FA 4RR3C 4XDPA 2BVVA 3FFZA 3WDYA 2KM2A 3T2PA 1LOFA 4DEVA 2AENA 2DURA 4C91A 4N7IA 3K3OA 3ZYGA 3O0VA 2KXLA 2JECA 5KXEA 4NE9A 2FZ2A 1XRUA 1TME2 5CAZA 2V09A 5FPVA 1RC6A 1BYHA 1G7YA 1HXS2 2DTYA 3DN7A 2VW0A 4CP9B 1ASJ2 3O5SA 1ULCA 3IZOA 1Q8QA 1RUC2 2J1VA 2JG8B 4FFIA 4LBMA 2ZEYA 3HIFA 1KQRA 1POV0 5IJRA 1OPOA 1A8MA 3ZDVA 3IAQA 5C8CC 3BU0A 3AXDA 3K77A 2JWPA 1NLRA 3ZPOA 4WM7C 1JW6A 1NY71 4YM3A 4OCTA 2PN5A 2GMPA 1EPZA 2FQPA 2OX0A 2UWAA 3FC0A 3KV6A 1PM4A 2RR12 1RVF2 2WNVB 3MYXA 4HK8A 4IXLA 4BE3A 1ZVFA 5AFEA 3B93A 4BWOA 4IEYA 3ZYJB 4CA9A 4URAA 2WL1A 3WDVA 1VBC3 1CIWA 1YYNA 4ZS3A 2G9GA 4BM8A 5HV0A 5FZAA 2CWMA 2VNRA 1WA6X 1ZX5A 5FPAA 3ZXDA 2DCJA 4J1XA 1AYM1 1SEFA 2KR2A 5KXDA 2AGSA 2VG9A 1SDWA 4PIZA 4DMIA 4JAAA 5IUQA 1VBD3 3CDZB 4RFRB 5LCWL 2VO5A 5E6HA 1GQPA 1UD1A 1M4WA 4QD2A 1DYKA 1H0BA 1OD3A 1RUG2 3A0KA 3GM8A 2PA7A 3LA3A 1ACCA 2D93A 3ZPYA 4DXRA 3OUIA 3ZFEC 1NXD1 1R083 1GNZA 4Q0UA 4AI0A 4HN0A 2W0XA 5LW9A 4CU6A 4IV1C 4XAAA 3POSA 4BU2A 1L7LA 5F2WA 1CZTA 2DUQA 4YYOA 1VBD1 3KV5A 3AL6A 4E4HA 3M3OA 4UFKA 1DLLA 3KQRA 5I8TA 1RUNA 3OG2A 3RDIA 4AFBA 4B7EA 5CADA 2VXJA 2XJTA 2WKKA 3AZWA 1ODMA 1EUTA 3IMNA 4QQHA 2BZDA 4XUPA 4B1LA 2W2IA 3LGRA 4CDXA 3H8OA 1SG3A 1C28A 2D98A 3UGGA 3AVRA 3I3EA 4A7YA 2X5IC 3KLSA 5JXIA 2ZHMA 2JDUA 4TLFA 1ZNPA 1C3HA 1O8PA 3BOPA 3F95A 2D3SA 1TMF3 1YJLA 5FZLA 5LA9A 5GKAC 5L9BA 1ND3B 5F32A 4EQVA 3V56A 3THPA 2EXHA 4LHNA 4I30A 1CR7A 2VBBA 4PF5A 3OBRA 2W1WA 1NY72 4QDSA 4B8EA 2IZWA 4F7ZA 3L9JT 5D2AA 1BKZA 3J7MA 3WNKA 2VNOA 2V5YA 3IDEA 3PUHA 4QPYA 5IVJA 4NR1A 2OZJA 4CZSA 2XHNA 1B35A 4X8PA 1OXCA 1ST8A 1LHUA 1KS4A 1YHFA 2XJUA 4IV3B 4JTNA 3UV9A 1CN1A 4Y24A 2HBUA 3VBFA 1NA1B 2WWJA 2Q8EA 3V64A 1OURA 3IKWA 3ZXAC 4XVHA 4JGZC 5FPLA 3GDBA 3O1OA 1IS3A 3WDXA 1FMD2 2ZGSA 3WF0A 2C9AA 2TNFA 3NRUA 2VZ1A 2NZ9A 3VBUB 4XAEA 1LTEA 3POBA 5FR3A 3KWVA 3ZIXA 1MEC2 3I2KA 2VCMA 1OT5A 4UFMA 4XUQA 1UPSA 1KXGA 3KB5A 3B00A 4RGKA 4Q4Y3 3LE0A 4QXBA 3KV4A 5EWSA 3I2OA 4XQWA 2J1UA 4BA6A 3E1F1 3HMYA 3ZYIB 4AVCA 2JEMA 4LO7A 4NIAA 5FV3A 3PUQA 1UOBA 2ZCWA 2W1QA 4XIKA 1S0EA 5A3PA 1VE0A 5FZ4A 1HB3A 4CCOA 4G4FA 3S6PA 2H6CA 4BHPA 1QXJA 2JE7A 4DRVA 2RS31 4OUSA 5FLJA 4KU8A 3RS6A 4QGLA 1VRH3 1UXXX 4YVWB 1S4CA 2W9XA 1PK6C 4DPNA 1HIXA 2ZGQA 3C7OA 4NHLA 4UOJA 3NKTA 2Y26A 3VBFB 3M8LA 1N3PA 4LHKA 1G8WA 2P5BA 4LK7A 4YRDA 1J3PA 3UGFA 4HKLA 5CG9A 1NCRB 3WW3A 1ZRCA 1SFPA 4PF1A 4XHBA 1JZ6A 3BI3A 3PDQA 2WNVA 3D5OA 1EUUA 1H1IA 2ADEA 2JX9A 3IN9A 4FAHA 4NO4A 1UMZA 4F83A 1FATA 3D3AA 3EMRA 2C1FA 2EIDA 2JD9A 1NCQB 3AKPA 1XNTA 4AE2A 1W6PA 2Q1MA 4EN9B 1K5MB 1MS5A 4AR2A 3NL1A 5F37A 2AH2A 4QU2A 1AXZA 5IK7A 2BRTA 4GB33 4MSVA 4AFMA 5JR2A 1O3QA 4Q29A 4XW3A 5FTTC 3CU7A 1OUSA 3RMYA 1NQDA 3NJYA 3OBZA 4FPKA 5A70A 4E9KA 1G6NA 2OW4A 3EB7A 3IIAA 2QDRA 4W6XA 1S0BA 2WUHA 5CFDA 3VBOA 2EAKA 4JRAA 1CQ9A 3WDTA 4DNYA 2QQOA 1SLAA 1UKRA 3AZZA 3PMSA 4ASKA 3UYJA 2OQ7A 2CAVA 3BTAA 3VZKA 1Z7S3 4JKLA 4BQYA 1UIJA 4HMZA 4LBJA 4CDUC 1WBFA 1VBA3 4IETA 4ZU4A 3UGHA 2EXKA 4C0HA 1UYZA 2VR4A 1PIV3 4BK5A 3UK9A 2EIEA 1S0DA 4FTBA 2K2SA 5A7QA 1GZCA 3LPGA 4Q2FA 5A7PA 5ANQA 4L99A 3MI8A 2I07B 5FQ0A 4CCCA 1Z0HA 3J9SA 3LZZA 3NQHA 3Q8BA 1XC6A 3NJVA 2ZKLA 5I0TA 3E97A 3HQUA 1F15A 4NIDA 5CFCC 3G7DA 4MLOA 4A2UA 4XF9A 1T2XA 1R1ZA 1CAVB 1XYPA 1UL9A 2LS6A 1W3XA 5JOXA 1UN1A 3I2HA 1X7NA 1QXRA 4DXTA 1KD7A 2DBNA 4AAXA 1BVP1 1W0PA 3LOBA 3DL3A 1OFNA 4YVSB 5EYXA 1JZ4A 3I49A 4GWMA 2DCZA 3JBG2 2WNOA 1FPN2 5IAXA 2QE3A 4JC1A 4XBNA 5FY8A 1JZ8A 1H2NA 3MZHA 2RMU3 1GNYA 3C3VA 2YU2A 4BXFA 3C2UA 3EHKA 1W28A 5FZ1A 3OOXA 3VN4A 2MEV2 5FY5A 2OQ6A 1AXKA 4PI0A 1BQPA 1UOGA 4JGZB 1W6PB 2WO3A 5SV5A 2XKOA 3JCIA 3THDA 4LE4A 4B7KA 4U2AA 4YW2A 1GKBA 3KZ4C 1D0HA 3BTXA 1JBCA 2RMU1 1W8WA 4LORA 4YFZA 4H7LA 4ZPIA 2OKXA 1LHVA 1QDOA 3VBRC 4PDWB 5JAXA 1BJQA 4XE9A 4CCNA 3NNFA 1GZTA 1Q8PA 3ZFFA 2JDZA 1CD3G 1CJPA 5LZ6A 5FXVA 1E5SA 1IG0A 2WLPA 1NZCA 4QQOA 5DAWA 3SCHA 4DIQA 1JZ7A 1VALA 4XUTA 5GLTA 1UO9A 1IOAA 3RJ2X 3O12A 3WVJA 5A33B 1AR92 1IGOA 5D1IA 5T5LA 4EJRA 1UYYA 4YLZA 2B9VA 3GBWA 4N7UA 5C71A 4MGTA 1DZRA 2UY9A 1OOPB 2FMYA 1OLRA 5A3TA 4BMBA 4M3CB 5C3OA 1LAJA 3KGLA 1AL23 1RTVA 4GULA 1W2NA 1GFF2 1IS5A 2WINB 3FLPA 1E5RA 4R4ZA 1UU4A 5JSRA 3VDCA 4IEZA 3BYWA 1MS1A 5CB7A 3VBUC 1ULFA 2XXZA 3RQ0A 1E5IA 5J7MA 3PLQA 1W6QA 4D7SA 1GWMA 5C8WA 2ZEXA 3U14A 4AVSA 3R0RA 1Y4WA 4Q1RA 1VR3A 4NPLA 1D4VB 2UURA 5JCTA 1FPN3 1J83A 1U5XA 2WFPA 4AEDA 5J48A 2QJVA 1GBGA 4PDWA 2PQSA 1X50A 5IK5A 2N7GA 4XJUA 4D3WA 4IV3A 2GP3A 3FUQA 5IK4A 2WS92 2PFWA 1AVBA 1ONAA 1PX3A 1W05A 4UWDA 1W6NB 3RZZA 3ZFGB 1XNAA 4TTGA 2H6BA 3V0AA 1RUC1 3NNMA 4W8JA 4HSJA 3RFRA 1UNBA 3EYPA 1KS5A 2VZRA 2R042 1OLME 3QACA 5EHDA 1H8TB 4Y1VA 1MZ6A 2QQUA 3T30A 2B45X 5FP4A 4AHWA 5IVEA 3NNJA 1GP4A 2PHXA 5C9AB 1B35B 4QPGC 4PQ9A 4JDNA 3AZVA 3FJSA 2NMNA 3VBHA 3I54A 1KITA 1QJEA 4PJYA 4PT6A 4R9BA 5HBAA 5FZKA 4N53B 1HLCA 5FZOA 2PHDA 1QJU1 5J36A 5JVVA 4JQTA 1MR5A 1I5ZA 2HWB2 1W90A 4E8CA 4IL7A 4OHYA 4NRQA 2HWC2 3AZYA 4NUBA 5FZ0A 4AXOA 2BNMA 5FUNA 4K9SA 1BBT3 5A7WA 2Y60A 4B1MA 5FFOC 3THCA 4S2GA 2CGOA 3WHUA 1UXZA 1EV11 4QGMA 5EJ3A 5FZ8A 4YSFA 5HCAA 3OEAA 2RS12 1TNFA 2PHWA 4L2NA 1YQ6A 4Y1YA 5FBJA 2CV6A 4XURA 1XU1A 3H0OA 3HPNA 2HWD2 4LIVA 4KWUA 4B29A 2WT2A 2DUPA 4MX3A 2A6ZA 2HJIA 4CDWA 3VD3A 4EWDA 4FAGA 2FZ1A 3B94A 2R7EB 2DFCA 3EQEA 3NNLA 3I2FA 3MICA 3IBMA 3W9AA 1LOGA 4CUAA 2OS2A 2QFEA 2QQWA 2C0ZA 2RDRA 5BNPB 5T5OA 1SMVA 3WNPA 2ZMLA 3QLQA 4BLJA 5D8AC 5CBLA 3T2TA 3ACFA 3SKVA 3IM0A 3WNNA 1AL0G 3T1LA 2RM21 5KXBA 1TME1 1RJ7A 1W9YA 3SCGA 5HPOA 1V6OA 4MUVA 4R8HA 5HCBA 1MVQA 1FNZA 2WA3A 2PHLA 5ACA1 3HD8B 4Q5OA 1GOGA 2SLIA 5FPXA 3MLKA 4YZ2A 4Q4Y2 3UETA 5HI0A 1GOFA 5C8CB 5FK8A 2VM9A 4A42A 1DQ6A 4DUXA 4RR3A 1ULEA 2G1MA 4IE0A 5A6ZA 1GQGA 1MVEA 2B8MA 3MW4A 3VHNA 2F4PA 2O1QA 4Y1ZA 5T55A 1ZRFA 1CJDA 1OOPA 1WLWA 4ZY9A 5LY2A 3WCRA 4GXLA 1B09A 4AFAA 4QMAA 3WG1A 3ORJA 3IT8A 4F3JA 1QJY2 2W95A 5GM0A 4NPRA 4ZHNA 3GJAA 2PAKA 1IKPA 1GZWB 2BBVA 1TZOA 4P9XA 2DFBA 1Z7S1 4K8FA 1H2KA 3DPRB 1I3HA 1VAVA 1VMFA 3GCXA 1IPKA 2XBO2 2R1BA 3AKRA 4CRQA 3S0MA 3WP4A 1OUXA 4X6RB 3AP7A 1UCXA 1IQDC 2CHHA 2KD7A 3ZXGA 4CP9A 4E2QA 1KRIA 3GZAA 3PVNA 3VZMA 5DDJ1 2AC1A 1R081 1NLQA 4Q4Y1 4S2HA 4M4PA 1WCKA 1SFNA 2LW8A 4PLOA 2JENA 2H0BA 2XJSA 4AQ6A 5BNOA 4CP2A 1WUVA 4RHV1 1U12A 3JD73 2XUEA 2BWCA 4MGKE 2XVLA 4OMDA 4QKBA 4GH4C 5JOZA 2XMLA 4XOGA 1JOPA 1V00A 5DUUA 1G9DA 5DZEA 1OH3A 5I8SA 5A1AA 1ENQA 2ZX2A 2YC4A 3N9QA 3DEMA 3LDBA 2YYOA 2ZEWA 5CKNA 5LWBA 2Z4FA 3T0DA 2Y33A 3MW3A 4IESA 2A1XA 3O1MA 4FPGA 5CIRA 2RDSA 4B4QA 1HRV1 2VC9A 3D4KA 2P4EA 2V4AA 2E63A 2BFUL 3GALA 3I59B 1WW7A 3QCWA 4JKMA 4QB1A 3MBWA 4RL7A 3C7FA 2ZGLA 1CAXB 3C7EA 4KU7A 2NP0A 4GKYA 2Q1ZB 3OJBA 4E8DA 4BB3A 3GYDA 1PO23 1PNFA 1ZZ9A 2C6SA 4N53C 2OVUA 2JIJA 4XACA 1R1A3 4W6WA 3TN93 4WV8A 1C1LA 4ZONA 4IERA 4XMIA 3VL8A 2YZ4A 1RUF2 3ITQA 4WM8A 1O7FA 1ND3C 1RUG3 4Y1XA 1V9U2 3HAGA 1DHKB 3WOGA 1LODA 1WCDJ 5H9SA 2Y6JA 3AMQA 4PHZA 3FHIB 2AZ5A 4Q4X3 3AXEA 2B5HA 1PO22 4G3YC 4JCKA 1JYWA 4BCUA 2WJSA 4CDWB 5C3QA 1BLZA 4LKFA 5E88A 1GR3A 1HXS1 5BUVA 1RXFA 1IPJA 2DVAA 5J98B 1UU5A 4LBNA 1A34A 4UF0B 1OPMA 3PURA 3GJBA 4YARA 5BXXA 4LO6B 3Q9OA 2D6OX 2RM22 2X29A 2YHJA 1W3VA 1F9KA 3AMHA 3DYPA 4ZKTB 5DN2A 5J96B 1FX5A 2JXAA 3LPFA 4FXGB 3RI8A 3RMXA 3ZN5A 1QOOA 1AX2A 4Y33A 5G05L 5FXXA 5CU1A 4CP0A 1FNYA 3WDUA 4H3WA 3IB3A 4YZ1A 4AVAA 2RJLA 1WMDA 4LO8A 3GNEA 4YW1A 4QX2A 3JD72 4LBQB 2VW1A 2RR11 2DVFA 2E7QA 4YM0A 3SCFA 1RB8G 3T4VA 3KGZA 2G9FA 3D82A 3IWZA 4UI9L 4JZRA 3VDDA 5ACA3 1QJU2 5CVRA 3AMMA 1F2NA 1VBE2 3WP6A 1SBEA 4BLIA 1HJFA 4YFWA 1NA1A 2XBO3 2VJXA 1UOJA 2G9ZA 3RYRA 4YW5A 2QNKA 1FAYA 5CEHA 3HNYM 2QQIA 4XEZA 5FPZA 3WF4A 5B4NA 5D8AB 4A6SA 3CJIB 5JOYA 2YUEA 2HWB3 4CDUA 1ZA7A 4XTPA 2R041 3L2HA 5EPAA 1REDA 4A4AA 3UKVA 3EBRA 3WLUA 2XPJA 2A70A 4LKDA 1DZTA 3U78A 2XQRA 3I3BA 5CFCB 5HXMA 2VMEA 5APAA 2DCTA 1Q8SA 5FYUA 2D6NA 3BIWE 3DXTA 4Q0VA 5K7PA 2W92A 1XXNA 2AACA 4M0HA 4NIIA 1O4ZA 2VVEA 2XUMA 4JTOA 4HG6B 2R6QA 1RL3A 2FDFA 1AF9A 5AFBA 2ZX4A 1IKQA 1T6BX 3K75B 1H1AA 1NCRC 3ZYPA 5A7WB 4K7JA 4BH9A 2MHFA 1RUJ2 2W5FA 4IW3A 4HKWA 1WKYA 4Y26A 1U5YA 3SKJE 5IATA 1ZBA1 2ZEZA 4XBLA 5ISLA 2Z5WA 3OEBA 2RDQA 1UX7A 3POJA 1K12A 4YW6A 1VIWB 4N43B 2VZPA 1XQNA 2LM3A 5C4WB 2PHTA 5GZFA 5K4LA 4CDUB 3O1PA 1BEV2 1J59A 1JYVA 2BJSA 5FZ9A 3CO2A 3VLBB 4IV1A 2ZTNA 3TB0A 3FLTA 1OKQA 2VZ3A 3JQWA 1AR91 3AM2A 1BCXA 4HT1T 4XFBA 3RWKX 2B9UA 5JMOA 4UT5A 2Z79A 2J1EA 1GZWA 1XYOA 2ETEA 2UWCA 3B01A 3TNQA 2XVKA 5CFCA 2R16A 4A6OA 3PIJA 2WN3A 4MYEA 2GN3A 3N7MA 3OGSA 2ZAHA 1LOEA 5CNAA 3ZX7A 2RS13 4P9JA 5DUWA 1LKNA 2WFF1 5I8YA 3VZLA 4TZDA 3N3HA 1CONA 4OZXA 3RVHA 2Q8CA 4LXLA 1JN2P 2PTMA 1BVVA 1W8HA 3UNPA 1RUJ3 2VTXA 3HVDA 1AR93 4BQXA 3AMNA 4FOVA 3ZR6A 4Z2AA 3P6BA 2A6WA 1EAH2 2Y6FA 1QQP2 4TWTA 2JDYA 3ZM8A 1W8NA 3HJRA 3CLPA 1NLSA 4D94A 2EICA 1OOPC 4OZOA 4YVSC 3NV4A 3VBSC 1XU2A 1DQ4A 1GU3A 3M3EA 3BUCA 1W6MB 4IGOA 1JU4A 4HVQA 4KGQA 3ENRA 3AKSA 4CCMA 2MPFA 1NYWA 2Y64A 3AZXA 1VBA2 3MF9A 2VMGA 4MO3M 1CAWB 2R32A 3ILRA 3CQOA 4DQAA 3OY8A 5C5UA 1N1TA 4BISA 1KJLA 1QJY1 5J09A 4Y5Z0 1EAH3 4CSWA 4QQ2A 3WEZA 2Q4SA 3A23A 2GMMA 5FZHA 1R1A1 3SITA 2VOTA 5D21A 3WQ0A 1OVSA 3ACGA 3LEIA 5LBEA 1APNA 1ZRRA 4MVTA 1VBE3 1O91A 1QJU3 3TYJA 5ACA2 2WZPP 1ZREA 1QF3A 1LHWA 1WW5A 2ZGMA 4GH4A 1MZ5A 5GZDA 2WIIB 3RZJA 3WF1A 4FSJA 3DYOA 2ZABA 2GSYA 1YEWA 3O7OA 2W47A 5KBFA 3WDWA 1DP0A 2LTNA 2ZHLA 3GXUA 3KCXA 4ISQA 2E51A 1PMHX 2ZX3A 4Q4V3 3RZGA 4UYBA 5C9AC 3LEGA 2WN2A 4N8MA 1RXGA 2CGPA 4RS5B 4B4PA 4OQ8A 1LEDA 4TSVA 1YQ2A 3KS7A 1HN0A 4NHMA 4XJ9A 3BN6A 3HT1A 4JGZA 4BQWA 3POIA 2BDRA 2R49A 4N53A 4NAMA 2VZUA 3N7JA 3ETQA 3PHMA 5FXZA 4AI3A 2ORZA 3WD5A 4Z8BA 3WUCA 3S7IA 1RUH3 4Q4V1 1OQDA 4QPIA 5JXGA 1HKDA 1UWWA 3SQOA 3AP5A 2QQNA 4Q4X2 3RZLA 2GC1A 3K4ZA 3ZXJA 3B9CA 4AEDB 4QX3A 5F2SA 5KHHA 1RUF3 2JDPA 5JIAA 2A6YA 3WXPA 4C1WA 4XHXA 4OVEA 2R0HA 4HPKA 1UZWA 5JMCA 1N47A 1MQTA 5IFTA 1F5JA 1QQP3 2UY8A 1AHSA 3NW4A 4P9GA 3VKMA 3O14A 2AREA 4QM9A 4BK4A 1S55A 2HWB1 1AL21 2Y0IA 3CIHA 4XFIA 1PMIA 5B2GB 1LHNA 1OSGA 4M3CA 1PK6A 3AP9A 3FX3A 3VZNA 4QXKA 4IQPA 2A75A 2HWD1 4R4XA 3GCWA 5FO8B 2G19A 1JUHA 2MEV3 4DY3A 3HQXA 2CL2A 1BZWA 1HRI1 4LKEA 5FP3A 4E4SA 4Q27A 4DINB 1X82A 4BQ1A 2YY1A 1N1VA 2ZZQA 4RGGA 2VQTA 3WG3A 2LUWA 2WNVC 3QH7A 1MS8A 1Y43B 4Y22B 5FO7B 1NOVA 4DY5A 3MV01 2CAUA 5ERLA 5FZFA 3U11A 3AFKA 2R062 4IV3C 4UFLA 5LY1A 3B69A 1IHMA 5F5QA 3JBG3 1LGCA 1HV0A 4CUGA 1QJZA 2ZMNA 5F5IA 4RN5A 2A71A 3ZN6A 3PTYA 4Y5TA 4AEMA 2CSGA 1IPSA 1HB1A 4P5HA 3S5AA 1H6XA 4QHOA 1H9WA 3H8UA 1UY0A 4LOSA 4JV4A 4CE8A 1FI2A 5DUXA 3H1YA 4EN0A 3ZYBA 4JGYB 1AYM3 1UPIA 4QKNA 1A6CA 3VDDB 1OQEA 3OGJA 3OSDA 3D8CA 4XCBA 3RI9A 4CCDA 1NCQA 4QPWA 5LBFA 1C8M2 5LB6A 3VDBA 1QJY3 4AOCA 4HKOA 1W03A 2YB7A 4M00A 1CX4A 5A7NA 4COWA 4YG3A 1UX6A 1PVC1 2PQQA 4LIUA 3X29B 5DZFA 1OFSA 2WT0A 1QEXA 1V9U3 5C3SA 4L8QA 4LEJA 3WW4A 1FOD1 2P3YA 1JXNA 4XZPA 1HB2A 5FYZA 3BVCA 4YZ5A 1SLBA 3OPZA 1SLLA 4YVWA 1PHMA 1TVGA 2IVJA 2YDEA 1UW8A 3PIGA 3OD0A 4WVWA 3TWIA 2J1SA 4BQ3A 5FZMA 3IPVB 2C5DA 4D6SA 3D0SA 2R071 3J8F1 3SLIA 1DQ0A 1R64A 5FZOB 1G9BA 1RITA 3CZJA 1DZQA 4Y5SA 4COUA 4GH4B 4HBNA 3NJZA 1C57A 4A44A 4J6GA 4N43C 5I0UA 5T54A 4AHZA 1OMIA 5I0DA 4GB32 1CPNA 2XJRA 2XJVA 1GLHA 1S2BA 4D8MA 5A6XA 4FTEA 1VPHA 2BQPA 2BV4A 4KQ7A 1K5MC 4LHSA 5F39A 3ZFEA 2VBPA 2CWSA 4EWAA 1D7PM 1GP5A 1OHFA 2WRAA 2ZGOA 1TMF2 1LENA 2D5FA 4P02B 3W20A 1O5UA 1F4AA 1DG6A 1HQNA 1NT0A 3LAGA 2VY0A 4K6BA 3U4XA 1TNRA 5K0UB 1OKOA 2RG4A 4EV0A 4I0BA 1Q8VA 3WQ1A 3USUA 3KM5A 4XF0A 1RUH1 4AK3A 3LIHA 1QH6A 3OGRA 5T3NA 2YPJA 1I5PA 3VZOA 5BNQA 5J37A 1A3KA 4OI2A 5K8SA 1VRH2 3BCWA 3TEZA 3M70A 4NWVA 4PI2A 5KC5A 2DDUA 4I01A 5B4XA 3H3UA 3PU3A 4LQRA 5LK7B 4ARXA 4DO0A 4Z1VA 4RS5C 4AVVA 4R52A 4N9HA 4HL0A 3ZYRA 3JD71 2XVGA 3LIGA 3UKNA 4BPZA 1H2LA 4DB5A 3QBQA 4CU7A 1PZ8A 4XDQA 3P1IA 5FYIA 1AZDA 1R082 2VTFA 1YQ8A 3PTRB 3WCSA 1W06A 5JLVA 4GZ9A 2PAEA 3DXUA 4CEYB 4DRRA 3LA7A 5GALA 2OPKA 4ES8A 3TN92 1R1A2 4GD4A 4O65A 3ZOIA 1BXHA 1GQHA 2J1RA 2QBXA 5A80A 3J4UH 3AKTA 2OIIA 1RUI1 4QU1A 2W68A 1RUOA 2B42B 2WT1A 3ASIA 1L7RA 3AP6A 3T4HB
chains in the Genus database with same CATH topology
1SLCA 3D0JA 4UW4A 2YROA 1J1LA 1V6IA 4LBQA 2R043 5FBZA 1AYM2 4O9EA 4KGGA 4D7TA 4ATEA 2IFWA 1AJKA 4WZFA 3POWA 4AQ2A 4LBOA 4Z82A 2TBVA 3OY8B 2O0OA 5AVPA 5F6LB 4FOYA 1D4M1 4I2OA 4K1ZA 1QQP1 5FMOS 2R1DA 2VQAA 4XJWA 3H7JA 5E16A 1Z78A 2NMOA 4CYDA 2Z69A 1PGL1 3DGTA 5JSPA 1DDLA 3I7DA 4COVA 5A32A 4DOUA 4NHKA 2WC2A 2ERFA 1GANA 2WZR2 4HK9A 2MEV1 5IK8A 5FMOL 3M3CA 3VKOA 1FYUA 3R4SA 1GZ9A 1OQ1A 3POYA 2Q8OA 3DPRC 3MPPG 4XTMA 1AL22 1W6OB 4QPIC 1UAIA 1V6NA 4PIYA 3CL1A 2D40A 2VPVA 5LRRA 1W39A 2XJQA 4CDWC 1CAXA 2ARBA 2XJPA 3KCCA 1ALYA 3VDDC 4XFCA 3WINE 5F9TA 4Q4X1 4ONUA 4UW3A 2AYHA 4UW5A 2R061 1YIPA 2GC3A 4KBBA 2IXLA 2DUOA 4CEYC 1O3TA 3AB0A 2BW8A 2VULA 3WZ1A 2WNUB 1S1AA 1RHI1 1X8MA 3PJYA 3FMGA 2HWF1 3BU7A 2WQZC 4HLTA 5LEKA 1RUI3 2RR13 4Q0SA 1O3SA 3SHRA 3WT3A 4Q4V2 3EXUA 1D0GA 3MW2A 4W65A 4XBQA 1DGLA 1YIFA 5ABJB 2VQ0A 1COV1 2Q5TA 4ISRA 2JICA 2ILMA 1RUC3 3OYWB 1AX0A 3WG4A 1H30A 1YUDA 4ASLA 3DF0A 5GZGA 3WP5A 1IS4A 4YGDA 3G6JB 4EROA 5HCFA 2QCSB 4WM7B 4QX5A 1FOD2 5GZCA 2ZAAA 2EALA 4K21A 4Q4W2 5KC6A 4WZCA 4XYXA 3FLRA 4RQPC 1ULGA 2ZOEB 3ELNA 1DGWA 1HQLA 2HWE2 4OULA 4XF3A 2R30A 4PBPA 2EVXA 3NKGA 4WVMA 3CJIA 3ILFA 1NCRA 4MGZE 1R093 4MXWB 4HN1A 4FOWA 4RA0A 3N36A 3WW1A 5JPMB 1JHNA 1HV1A 1QKQA 1C1FA 3B3QE 4GIQA 3KT1A 1EP0A 2NM1A 4N43A 2QKDA 2X8KA 1GV9A 5EZWA 1PO21 3OYWA 1YWKA 3ZVXA 2DYCA 1QJX3 2P3KA 2R0FA 5JIUA 2WS93 2BEOA 4W6YA 1IZ3A 4AFDA 3SXWA 1GSLA 2GNDA 2NYYA 4WM8C 3SH5A 5JDBA 1H2MA 1TMF1 4FPCA 3ZFGC 4ZU5A 2DU0A 1QH7A 4AW7A 2AR6A 2ZHNA 2CY6A 1PIV1 4XFAA 4AEJA 4FVVA 1IQAA 1ZZ8A 1JTZX 3MLJA 5FDBA 4CDQC 1D4M3 4XXPA 4XQDA 2ZGKA 1LEMA 4XILA 1UKGA 1AR81 1TEIA 1DBNA 1PGW2 5BNOC 4LUKA 1D2SA 1H8TA 3FE5A 5DG2A 3JBG1 4Y20B 2XB6C 4YZ4A 5CG8A 1GYKA 1MQTC 4XIOA 3M7AA 4J1WA 3H7YA 2HEWF 1PIV2 4AVTA 4Q26A 2ZMKA 5EXOA 4FP2A 4Q0QA 5AC91 4PLMA 4JRLA 1Z7S2 3GBGA 1WGPA 4AFCA 3KD4A 5DUVA 1VBC1 1AXYA 3USUB 1VBE1 1V70A 3SH3A 4S2FA 4CTEA 2DCYA 5KXCA 1RUE1 3ME2A 3M4FA 4EN8B 5BNNB 2IWGB 1LECA 1REEA 4K40A 4HSLA 2WA4A 1GICA 1LHOA 4WM8B 3ZSJA 4SLIA 1YFUA 5I91A 1EY2A 3AYDA 4U36A 1MS4A 1PGSA 5CFDB 4V1PA 1VBB1 5BPXA 2WNUC 3LCPA 3MIGA 1RVF1 5SV8A 3H1MA 5F1RA 1S0FA 4Y20A 1OLQA 2RM23 3LSEA 4GKXA 1C5HA 4MXVA 3UJOA 1AR82 2VOVA 3NV2A 3GHNA 4FPJA 1QY4A 2A3WA 2D3PA 3FUOA 4QGNA 5AVAA 4AQTA 3ZXEA 3TAYA 1FMD1 1ZZBA 2DV9A 2PLV2 4ITCA 3B7MA 1VAKA 5GLZA 4P9LA 4MXWA 1VB4A 4OI0A 4PBOA 1VBB2 2WSVA 1F8VA 2ES3A 2W08A 2IXCA 2ZZJA 2GALA 2DU1A 1W6NA 2DVDA 3AK0A 3BALA 1LR5A 3HWJA 1PGL2 4TYSA 4IEVA 2HWC1 1WW4A 1MEC3 2E7AA 3WG2A 5FLIA 3DUIA 5GLUA 4OHWA 4FPFA 1KDKA 3BB6A 3MIBA 4R9DA 4D7YA 4LBQD 2FHRA 2XLFA 2WWSA 2X53S 3MPBA 2QZ2A 3WP3A 1J58A 4YNIA 2VVFA 4Q1PA 2HYKA 2BNNA 4JDOA 5JSOA 5L36A 4YVWC 1VJ2A 3HT2A 4XFHA 2Z42A 3W59A 3VHPA 2D5HA 2HWE1 1CAWA 4XJZA 4A7KA 1RMU2 3OCPA 4HETA 4INDA 4MH0E 4B3NA 3JUUA 2GAUA 1WD4A 3MDPA 3MIHA 3VUOA 2WNEA 1BBT1 1NCQC 4JGYA 3U10A 4N90A 2D6KA 2RS33 1N1SA 2WQ4A 3PVBB 3FZ3A 3ZN6B 3RRDA 2GZWA 3VBOB 2D6LX 5JZGA 3CJIC 3THTA 4Z92B 4FPYA 4AGVA 2RS51 2VGDA 2DWRA 5C9AA 1DU3D 3ROUA 3E5XA 4DS0A 3NAPA 1IS6A 4BIFA 4NWWA 1X33A 4LE3A 2P17A 1X36A 5C6CA 1CAUA 1KFUL 5L19A 4E2GA 2RS53 3B9IA 2D6MA 4JDMA 2RS52 4YG6A 4YVSA 2XHKA 3MIFA 5T5JA 5KHKA 2BVBA 3E5QA 1LGBA 2EIGA 1ULDA 1HW5A 2GNMA 1MQTB 2SBAA 1RVF3 4RHV3 1HQWA 2GN7A 2JG9A 1NQJA 1JYIA 1KDMA 2DVGA 2TEPA 4GMP0 3NO8A 4WBBA 1HX6A 4KWLA 3CEWA 1BK1A 1SLTA 1AR73 1J3RA 4L9BA 3AX4A 1LRHA 4Z2WA 1RMU1 4IEQA 2CNAA 2HWD3 4C0BA 3PVEA 4M01A 1VAMA 1CGPA 4Y4YA 2FMDA 2YMZA 3EO6A 4K1YA 1G9CA 3DV8A 1NE4A 4AHYA 4YGBA 1XE7A 2QQPA 2VOKA 3UKTA 5KHJA 1ZYBA 1TME3 1BBT2 3WHTA 3ZXLA 4NOTA 4FXKB 4HPKB 4HVOA 1LU1A 4KWKA 3INAA 2HWC3 4FPLA 3ZDSA 4KL1A 4DXZA 2D97A 2WFF2 4KG8A 2GNBA 2XLAA 4X6QB 1RUE2 3PJQA 1AR63 4K3UA 4LNVA 2PAMA 3P3PA 2W39A 2GNTA 1RUF1 3M3IA 1COV2 3AFGA 3S30A 3KCYA 4E2SA 3MFAA 2JJ6A 1QDCA 4CEYA 4K20A 3RYKA 1FV3A 4FTSA 1V6JA 2JG8A 5JZGB 2A7AA 4AQSA 3JQXA 2I74A 2QVSB 1LESA 2CGNA 3MFCA 1DQ1A 2ZGTA 3FBMA 3K51A 2B7YA 4LTAA 3ZSEA 2RE9A 3UJQA 1LOBA 3CNAA 3WW2A 5J3UA 5CA6A 1GNHA 1REFA 2WSUA 5F6KA 2P2KA 1EV13 1WW6A 1UZZA 4AWDA 5ABJA 1MACA 2RHPA 1POV3 4LLFA 4OHXA 3MEPA 1G9AA 1LGNA 4FT8A 1PO11 5LRSA 1ASJ1 1RHI2 3O0WA 4FO9A 4AEKA 2BYVE 2XH6A 5BY5A 1R091 1G86A 4FBFA 4FPEA 4XQ4A 3E6CC 2IXHA 4NN0A 1H4HA 4KNCA 1AYN1 4E27A 1WLTA 3B5LB 5FRAA 1XNCA 3NV1A 3N4MA 1X8EA 4LULA 2PLV3 3SNMA 1ASJ3 1WMEA 2YXSA 1AX1A 3ST7A 1HXS3 4MZUA 2EXIA 2IXKA 1VLNA 4XETA 3OF1A 4QHBA 1QOSA 2IC1A 4OUMA 4QQPA 2E9QA 3MGUA 1C4RA 1S0GA 4WVMB 1AR71 1I6XA 3O0XA 1CAUB 1PO12 4NVPA 3TNPB 3I4IA 2NQYA 3TN91 3NAPB 3BOWA 4COYA 1QXPA 2ZX0A 3VV1A 5BNPC 1RUG1 2JKBA 3VBSB 1EYBA 1W2UA 2KA3A 4ORFA 2OUJA 4R9AA 3IDCB 3HR9A 5GLWA 3GHMA 2HWF3 3ZMNA 3ZO0B 2E6VA 5H9RA 2ATFA 1HRI3 2JD4A 4JQRA 4Q8LA 5BV6A 1H9PA 1K5MA 3S7EA 4LHLA 2LALA 2D43A 2JG9B 1YFXA 5DDJ3 2GH8A 4EN7B 3M3QA 2RJKA 1C8NA 2ZKNA 3SISA 3ES1A 5L7OB 2ZA9A 2IXJA 3H1WA 2RMU2 1OA3A 2B39A 4N9IA 5DZGA 5AC93 3USSA 2ZGPA 3I8TA 1POV1 1ND2A 1WLDA 3V0BB 1PVXA 2O8OA 3U07A 1ENSA 4R9CA 2WS91 5I0SA 3GBFA 3LB9A 5JR7B 1S0IA 4RQPB 1Y3TA 4YGEA 5TSWA 3WQ7A 1RUJ1 1HRV3 2XBO1 2DVBA 3VKLA 3IDBB 2GC2A 1PK6B 2A73B 4PIXA 4UBHA 2DCKA 1RUD2 3VZJA 1V6MA 2A5ZA 3DKWA 3SMHA 3D6EA 3ATGA 2HEYF 3J26N 4HVRA 4CDQA 1YI7A 4LBKA 3OBTA 4L97A 4OHVA 1JH5A 2OA2A 4AGRA 2BTVC 4QQLA 1BEV1 2DTWA 2XGXA 3WX5A 3BODA 2ZPXA 4XFGA 3R05A 4KH9A 4Y22A 2YGLA 4AHXA 4GB31 4DFSA 5BNNA 5A33A 1EV12 2VXRA 3E6BA 5K0UC 3QOPA 2TUNA 5EV7A 1Q5OA 3VBRB 5BNOB 5I8YA 2AUYA 1E57A 2P34A 1PZ7A 1G9FA 4MV2A 5E8AA 1PZ9A 2DF7A 1WMFA 1OI6A 1LJ7A 3AKQA 3RWNA 2BUKA 1YLLA 1JUIA 3H50A 1S2KA 3KT7A 4I3PA 5E1RA 5L7OA 1XYNA 5KHIA 2IFRA 2OYZA 3VL9A 3ZXFA 1PVC2 5K9YA 3DPRA 1LCLA 1VP6A 5H9PA 1RUE3 4PDWC 4LO4B 4E4ZA 2WFF3 2CYFA 5DG1A 5KHGA 4LT5A 2ZX1A 4JVAA 1N1YA 2D3RA 3HN1A 4CP1A 1I1EA 1LOCA 4FPHA 1DQ2A 3JB4C 3B02A 4Z07A 4P9YA 2PHRA 1H4GA 1VRH1 4RSUA 2ET7A 4AF9A 4XXAA 1QNWA 3QH6A 3KSCA 2ZJCA 4AGGA 3ES4A 1AJOA 2XLGA 4WVVA 2GH2A 2NLRA 5LEJA 4RD7A 4LO5B 4A7ZA 4CEWA 1N3QA 4S2DA 5HXVA 3RPQA 2P37A 5BYNA 4WM7A 2O8QA 4FCAA 2UYAA 3FFQA 1QU0A 2GDFA 1FMD3 4ASMB 4CDQB 4MGIE 5C4WA 1ZBA3 1HRI2 2NN8A 1CVNA 4RQPA 1CAVA 1Y9QA 1YRZA 2ZGNA 1DYPA 2VU9A 4IEWA 3V65A 2XWJB 1BMV1 4F8AA 1OD5A 1YFWA 2D6PA 1FV2A 3RYPA 1YI9A 4FQZA 4XF1A 2G4IA 4GA9A 2ENRA 3GZTB 3MLLA 3A4UA 1QNYA 4OI4A 3PMEA 4FP3A 2QUOA 3ZMOA 1RINA 3N7KA 1J3QA 1NE6A 2ZHKA 3KT4A 2D7FA 3ZFFB 2ZGRA 4FQ4A 5C33A 4CEWB 1XNKA 5D8AA 3ZIWA 2YV8A 3FWEA 5GLVA 2UWBA 1RIRA 3E6DA 5BNPA 2WZR3 3R6SA 3HBZA 3VBHB 4LBLA 1RMU3 3NV3A 5T50A 1SACA 5LK5A 5JI7A 1T6GC 4RHV2 5I0RA 4IEUA 4AG4A 1PNGA 1YXWA 2PHUA 1VBA1 4H55A 3AYAA 2BWAA 1RHI3 1VBD2 1YNAA 1WA4A 1J1TA 1SCRA 2FBEA 4RS5A 2ZS6B 2OUHA 3M2MA 2UU8A 4B4RA 1H8TC 1AR61 4YM1A 4O9GA 4XMAA 4KG0A 5JWPA 4XJ8A 1C5IA 3OGGA 2VW2A 1B35C 1C8M1 1VBC2 3R4DB 4Q4W1 3ZSMA 1LOAA 1ZZCA 4GMP1 1YCIA 4Q8KA 1H8VA 3VBFC 1BMV2 3ACLA 1DGRN 1ND2C 2P3JA 1S0CA 4ES9A 1QWRA 3NWKA 3E5UA 3N35A 2XL7A 2F6BA 5DXDA 2PELA 1SBDA 3VBUA 2WLQA 1V9U1 4XJAA 2HEVF 4A3XA 4P14A 4SBVA 2EA7A 1YO8A 1WD3A 1O4YA 3FBYA 5GJ6A 3ZN4A 1AR62 3GF6A 1MZFA 1ZBE1 2B46X 5IT6A 4GQ7A 3AJYA 3WY6A 2VVDA 1WBLA 3SH4A 1PM7A 4LR4A 2YC0A 4YM2A 2ET1A 2R072 2R073 1V6LA 3J8F3 3J8F2 4G9SB 4UXAA 4PCRA 5JZGC 3V0AB 1UF2C 2XKPA 2EXJA 3VHOA 3ZFGA 1W6MA 3QD6A 1UZYA 5FCCA 2IXIA 4H7MA 1DF0A 4HZFA 2I45A 3GZUC 3JZVA 1XE8A 1DQ5A 3ZXKA 2GU9A 3RSJA 1OA2A 1HDKA 3BPZA 3ZSKA 4AI2A 1XNBA 2PHFA 4RFT0 5JI9A 2PLV1 4I3GA 4YW4A 1O3RA 2VUAA 2X5IA 3MF6A 3APBA 5FREA 1ZRDA 1MZEA 3OTFA 3LKJA 4AEDC 2VMHA 1ND3A 1QMJA 1WLCA 4AYUA 4ZU7A 4XFFA 4GALA 2VH9A 1DGWX 3ILNA 1KJRA 2CTVA 1ZBA2 1EPWA 4P9IA 4H14A 1TE1B 4QM8A 1RGSA 1TQ5A 1MS9A 2GMEA 4EWEA 1FT9A 2VMIA 1MS0A 4BMEA 2PYTA 1OA4A 5JPNB 4XPVA 3AYCA 2WNUA 2A3XA 3LOIA 4C90A 1C8M3 4FOQA 3VKNA 4MGYE 3LA2A 1LU2A 1AYN2 2EAAA 2WZR1 5ABJC 3VKFC 4AI1A 2JE9A 3U0ZA 3L2YA 3LWCA 3TBDA 1AR83 1RUD3 2RS32 5FQ0B 1Y7BA 2A3YA 2VUJA 1SLIA 4BZ4A 1D4M2 1LOFC 1ENRA 2NPIA 1N3OA 4YZ3A 4LUMA 4LA2A 1MS3A 1ENXA 4OI1A 4CEWC 1SCSA 2JG8C 5FAXA 1PVC3 1M06G 3I2DA 4E4DX 2R063 1FXZA 1VB2A 1W6OA 1ZM1A 1MEC1 3VBHC 5AC92 4M0NA 5C8CA 4OFGA 2VOWA 2VOXA 2D44A 4I09A 4JGYC 1SFYA 4I0AA 4WVZA 4Y1UA 3ZSLA 1AUYA 4BIOA 2V73A 4IEPA 3H3ZA 5FO9B 4IEXA 2XL9A 3VHRA 4YGCA 5GZEA 1ZBE3 3LSDA 4M3CE 4META 4Q0PA 2W52A 5CFDC 1SQ4A 5KWRA 5FLHA 1JYCA 3JU9A 2P3IA 2Y38A 1SBFA 1KFXL 1VBB3 2OZ6A 5E89A 1QHDA 3VBRA 3P3NA 4YG0A 1I9RA 4P9WA 1RUH2 3ZFFC 2QZ3A 4D69A 3AP4A 2XG3A 3K48A 4Q4W3 2ARXA 4OHZA 4YW3A 4RR3B 5A3MA 2QDNA 4HFSA 1CPMA 3PVOA 3A0NA 2VECA 1Q8OA 2ZBJA 1HRV2 1UU6A 4FPOB 4XF4A 2VNGA 2MNGA 1O4TA 4L11A 4GWNA 1RUD1 2EF6A 1URXA 2X5IB 4CDXC 3I59A 2Q30A 2HKXA 3VBSA 3WV6A 2ZACA 4M3CF 3RJRA 2YGMA 3T1MA 4QPIB 3EJKA 1FPN1 3UL2A 1U5ZA 1F31A 1YJKA 5BNNC 3M1HA 1ZBE2 2BGCA 3MIDA 1QJX2 1Q43A 3N7LA 5FOJB 1QGLA 5K0UA 5DDJ2 4HANA 1W0OA 4X8NA 4IEOA 3VGIA 4L92A 4UW6A 1ND2B 3V0BA 1R092 1H1MA 3AJZA 5EYYA 3NAPC 5A3LA 2K0GA 3JB8A 2BPA2 2E53A 1L3JA 2HWE3 3TOJA 1Q56A 4RGAA 3PNAA 5H9QA 2I2SA 5FOBB 1U0AA 1COV3 1FOD3 4C1XA 3IPVA 4PLNA 2BFUS 1S0JA 4ZXKA 4LA3A 5EFUA 4GMP3 3AMPA 1QOTA 4QPGB 1NG0A 1PO13 1U5IA 5I93A 1EAH1 2UYBA 2A6VA 4EN6B 2ZGUA 3WR0A 2JG9C 1CESA 4ATFA 1A78A 2Q0AA 3H9AA 4AVBA 4I0WB 3NVCA 1ZZ6A 4KWJA 5T52A 1AYN3 5L7OC 3NSTA 5JOWA 5T5PA 1ZA4A 1AR72 3CJXA 2GC0A 1JOJA 1UIKA 1O5LA 1RJ8A 2E7TA 5L73A 4I02A 1ZZ7A 1BEV3 3WNXA 1DIWA 2A6XA 4AI8A 1LULA 1RUI2 4BYYA 1NXMA 5C4WC 4CDXB 3RG0A 4BOWA 3ALQA 2XWBB 3RNSA 3W58A 3URFA 1WCSA 1Q3EA 4URTA 1A8DA 1W6QB 3R4UA 1QJX1 2BNOA 2RS11 2HWF2 4OLLA 4QT6A 4UBGA 1NA1C 3CF6E 1PGW1 3ECQA 2Y0OA 3MIEA 3ZFEB 1D2QA 3KMHA 4LLOA 3VBOC 2Z2SB 1DGRA 1LB2A 3AYEA 4IV1B 1DFQA 2H0VA 4QPGA 3OD4A 1XNDA 1V6KA 5A32B 1YFYA 3TRSB 2K9ZA 3WUDA 1F5FA 4RR3C 2BVVA 3FFZA 3WDYA 2KM2A 1LOFA 2AENA 2DURA 4C91A 4N7IA 3ZYGA 3O0VA 2KXLA 2JECA 5KXEA 2FZ2A 1XRUA 1TME2 5CAZA 2V09A 1RC6A 1BYHA 1G7YA 1HXS2 2DTYA 3DN7A 2VW0A 1ASJ2 3O5SA 1ULCA 1Q8QA 1RUC2 2JG8B 4LBMA 3HIFA 1KQRA 1POV0 1OPOA 1A8MA 5C8CC 3AXDA 1NLRA 4WM7C 1JW6A 1NY71 4YM3A 2PN5A 2GMPA 1EPZA 2FQPA 3MYXA 2UWAA 3FC0A 4HK8A 2RR12 4IQPA 1RVF2 2WNVB 4IXLA 4BE3A 5AFEA 1ZVFA 3B93A 4BWOA 4IEYA 3ZYJB 2WL1A 3WDVA 1VBC3 1CIWA 1YYNA 2G9GA 4BM8A 2CWMA 2VNRA 1ZX5A 3ZXDA 2DCJA 4J1XA 1AYM1 1SEFA 2AGSA 2VG9A 1SDWA 4PIZA 4DMIA 4JAAA 5IUQA 1VBD3 1UD1A 1M4WA 4QD2A 1DYKA 1H0BA 1RUG2 3A0KA 2PA7A 3LA3A 2D93A 3ZPYA 3ZFEC 1NXD1 1R083 1GNZA 4Q0UA 4AI0A 4HN0A 2W0XA 4IV1C 3POSA 2DUQA 4YYOA 1VBD1 3M3OA 1DLLA 3KQRA 5I8TA 1RUNA 3RDIA 4AFBA 4B7EA 5CADA 2XJTA 2WKKA