1C8PA

Nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
102
structure length
102
Chain Sequence
b'MIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOKINE RECEPTOR COMMON BETA CHAIN
molecule tags Membrane protein
source organism Homo sapiens
publication title The solution structure of the cytokine-binding domain of the common beta-chain of the receptors for granulocyte-macrophage colony-stimulating factor, interleukin-3 and interleukin-5.
pubmed doi rcsb
total genus 11
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1999-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c8pA00
1INDH 1Q9OA 4YHOH 4HJGB 4YDJB 1LO0H 2CK0H 4KV5F 3HFMH 4M4RA 4NP4H 5HPMB 1UKQA 1FZJA 2GJ6A 3IF1A 4YR6A 1MFDH 3U83A 2NY0C 3HLAB 4HK3J 5M94B 4YHZH 4YHPB 3BRGC 3QRGH 1T1WB 1MNUL 1YJDL 5LVEA 4NHCL 4M7LL 3KJ6L 2IFFH 3MYZA 4DTGL 1MCPH 1X4XA 2IAMD 2X2YA 1VKXB 4LQ1A 3TYGL 4MCYA 2A77H 2LAAA 4U7MA 1K8IA 1QP1A 2H8PB 1MHCB 2EXYD 1KELL 2R1WA 4JFQA 4M7LH 1BM3H 3TT1H 4AIZA 4JM4L 3K1KC 2FZ3B 4FXKB 1F58L 5HYQB 3ABZA 1PG7L 4LKCA 5F6IB 2NPLX 1KJ3L 1A6WH 4LASL 4APQC 3RWDA 1R3JB 4XCYA 3DVNA 3ESVF 3VXUE 3GSWA 4O9HH 4CW1B 1IEBB 3PGDB 3DYPA 1TJGL 3JVGA 4D9RD 3BIBX 3CJJA 3NMEA 4HWUA 4P5TB 4AM0B 1UA6L 1YEIL 4KDTA 5F88B 3E8UL 2F74A 2I5YH 2RAMA 4GAGL 4LSQL 4PRPA 5L8LB 4YHIB 1K5NB 5ICZB 1BQHA 2O93L 3SGKA 5IW6B 2LTQC 4WUUB 4PP2A 2BHZA 4MA8H 4NRXB 5K93A 1HI6B 3AXLB 2ZNWA 2QLVB 3QFJA 1T2XA 3FFCE 4H1LG 3MLUL 4L1DA 3P4OB 2XY2A 1TZHA 3EZJB 3UPRA 1MHPH 3I6LD 4Q9RL 4G8GA 2C3WA 4HIHB 1YMMB 2Q8AH 1OGTB 3SJVA 3VCLB 3SKJL 4M7JL 1L7IH 1WFNA 3GHEH 4X98B 5D1XB 4Z8FL 4LFHG 5GZNC 2XY1A 5IFJA 5DSCA 5DUMH 3MLUH 3KYMB 2MFNA 2VLRA 1GH7A 1T03L 3ARGD 3WUWB 1KCLA 3T04D 4PJIA 4P23D 2F8XC 3FHAA 1P4BL 3ZYJA 1MVUB 1P7KB 4PJHA 4ETYA 2BC4B 2DMCA 4N1HB 1M1SA 1MRCH 4KKLD 4FP8L 2RCSL 5CGMA 2X1XR 3VJ6A 1KC5H 1F6LL 1C1EH 1A6UL 1EBPA 3RVVC 3A6CL 4NCC1 1LEGA 2G2RB 4R4FL 4AQ1B 5J6GA 2F58H 1J8HD 3BMWA 3EBAA 3FB8B 4MJIB 1XGQA 2EYSB 5L7XL 4WY7L 3E6FA 2IALB 1NGQL 5GGUB 2XNAB 1A8JH 2YSSB 1FPTH 3GRWH 3RL1A 5HYFA 4K3EL 5H8DA 1IGIH 4L29B 1CCZA 3KHOA 3QQ3B 2EEDA 3DX7B 1GZPA 2XFXB 4IHOA 4AMKL 5JUEH 3ULVD 4ZFZA 4TUJB 4JQXA 1LMKA 1XF3A 5EO0A 2Z8SA 2VNCA 2BNRD 4JVPA 3ULSA 4P46C 3U9UB 3TCLA 1QACA 2JB5L 4OZIE 1V7NL 3MTRA 1JPTL 2E27H 1H5BA 4V1DA 3FONA 4EN3A 2J8UB 1G0DA 2FDBP 4EI5A 5DLMH 2VITB 4JHAL 3LS5L 3HE6B 4Z6AT 3MLZL 4XNZB 5C3TA 4PRIA 2FECI 4NWUH 1KIRB 3JVGC 3U0PA 1AKJD 3ZDYE 3HC4L 5DJ6B 1T7WA 5FHAH 4K3DL 5ADPL 3D9AL 1OTUD 4MS8D 2J8OA 3F5WA 4NKIL 4Q9QH 4R4BA 3VXRB 3WDIA 5JDJA 4X7FC 4N68A 2X4TB 5LCVH 1BREA 3H0TB 5BMFH 3FN0H 1OPGH 3D9AH 4I1NB 4M8QB 4G8GB 3BJ91 3EJZC 4OLZL 5LGHH 5D2NA 4NQXB 4UDTB 2OCFD 4B41A 5F7UA 2GK0B 1BFVL 3WHXB 5MEOB 4UV4L 4LHUA 4I5BB 5IJKA 1HILA 5GS3A 3QYCA 4CGTA 3GKZA 4HXBL 5H2BA 4DGIL 1YY9C 3SGKC 4WV1A 4XPTL 2VXQH 4J23A 5CJ5A 3BUTA 1NAML 3QG7L 1T0NA 2MPAL 1KUMA 1NCDL 3QDHA 4HXBH 3T2QA 3U4AA 3QUZB 3JWDL 3RY5A 3UX9B 2X4UB 1UEMA 3MJ8B 3TH4T 4D9QD 1BJ1H 1AP2A 2EKSB 5FKPB 4OLEA 4ISVB 4ELMF 2YA0A 3QEQE 1QR1A 4XXDB 1R5VA 3T2NL 2HFFA 2Q7YB 4JZNB 3QH3B 2GI7A 4WRLA 2DDQH 2DYPA 4QF1B 3HC3L 1KCVL 1GHFH 2APVA 3P0VH 5ALBL 4OCNC 4MJID 3K4AA 1A9EA 1A6TA 3MXWL 1T1XB 4K94L 3TVMD 1WAAF 4F2MA 1W0WB 5J0BA 1D5MB 5EZLB 3TCLB 2X40A 4P2CG 5TE4L 5BZDB 2NR6D 4JFYB 4FN0A 5DS8B 3GJEA 5K33A 5T3XE 3LN5B 4WENB 1JE6A 1BAFH 4PY7B 4EUPG 2GY5A 5C6WH 5GSRA 4F7EA 3MLYL 4NQED 1EFXB 1FYTE 3VXSD 4JVWA 1CU4H 4GBXB 2V5RA 1IZJA 3TBSB 3CX5J 5IVZB 4AL8L 1M7IA 5HHPB 5FO9B 5IVXA 3G6JE 2VLJE 3MRJB 1JRHI 5I1AA 4U1LA 2J8UF 3ARRA 3MCKB 1FG2A 4TVSa 5IG7A 4R6UA 5DEFB 4DKAA 1C12B 1NUNB 4K3JL 1ZA6B 4W70A 2BRRH 1DFBH 3FQWA 1UZ8B 4QHNA 1MQKL 1JN6B 1UKSA 2HVKB 4RIRA 4S2SA 2E9BA 3PP3K 2H41A 3LB6C 1FVDA 2ZKHH 5FUCC 3TYFA 3LQZB 3GMQB 5E1AA 5TDPB 1AGDA 3SGDH 4H25B 4JY6B 3G5XA 1DBKL 3PP4H 5J9PA 3VFRA 4PRHA 3FMGL 1N8ZA 1JWMA 3W0WB 5I1KL 2ZKHL 3KS0J 4UV7H 2HTKD 2X4SA 3QUXD 1RHHA 1T3FB 3DUSA 1F2XK 4DFHA 4LIQH 1EJOH 2FATH 1A2YB 3TA3A 3EYFA 5IVOA 3VXMA 5C70A 4B0MM 1BGXL 1MCNA 4PGCA 5DHYB 1TQCC 1Q8MA 3RWGB 3V52L 1KLGB 3SHSA 3O3BA 3UAJD 1E6JL 2XN9A 4IJ3B 4LP4A 3DGGB 4WEBL 1EEYB 1EJOL 3MLXH 4HIHA 1MEXH 5DJZB 1NSNH 3HPLA 5INCA 4ZPVA 3FFCD 5DRWB 1SJEA 2CK2A 5MEND 3LV3A 5CEYA 4UIMB 2EC9U 1CLOH 1J8KA 1CXEA 4MVBC 4P2OD 3OGCA 4KJYA 2R0KL 1MVUA 3QWRD 4J4PD 4HWBL 4MAUL 4MMZC 4XWGH 1INEL 1KJVA 2YMXH 5HGHB 3O6LL 5IBLD 1FDLL 1N6QL 4LHUG 3MOBH 5F1KC 5DJDA 4M6NH 4ZS6C 3T8XB 4QHKJ 1T0PB 1A6VH 3WIHA 1W0VA 4OCRH 2I9LB 3BD4A 2C5DC 4L5FH 4XWGL 2QL1A 3VI3F 5HVFB 3MA7A 5BOPA 2J5LB 5CJBA 3LSOB 5E6ZA 2EDQA 2NY5H 5C0CA 4OLVH 4GRLB 4PRNB 2NNAA 3H3KA 4JM2D 1AH1A 3TFKC 5DRXA 5LAXA 2DL2A 3PWVA 1BQHG 1OD9A 3N1QC 4FQ2L 4BFGA 1KPVA 5EU4A 3GSQA 4K7PY 1A47A 1FV1B 4KZDL 2C9AA 2EE2A 5KVEL 1RFDL 1T22A 4OLVL 4D8PA 1A7QH 4WVRA 4F58H 4UZGA 4OCYH 1TFHA 3GJEB 3NA4A 4N1EA 4UOJA 4NQCD 4QNPF 1UACL 1T21B 3M8OL 2MMXA 3CLEL 1LO5A 3MRBA 4Z77A 4DCQA 2C7UA 4KZEH 1AGBA 1S7VB 1HDMA 3MV7A 4Q6IC 3RVWC 2AJXL 3EOAA 1FL5A 1D5ZA 4EBQL 5EULV 3UTOA 1E4KA 1TVBA 3D2UA 4BZ1L 3CX2A 4DAGL 5IV2A 3QDAA 2QR0B 3C9NA 4JFHD 3CLEH 1GAFL 2GKIA 3WFDH 4U2ZA 4ERSH 3OR6A 4BK4A 4YE4L 1JYWA 4WI6A 2CJUH 4PIRF 2XTLA 3C5ZD 3VFUA 5SV4A 3DGGA 3X17A 2FEEI 3EOTH 1KTDA 1R0AL 3MJ7A 4LGSB 5IQ9A 4WI4A 2WUBH 1AXTL 1CGSL 3O11B 4B53A 1KIQA 3MOAL 1S5IH 3OKLA 4I48B 1QVOA 5C9JA 2LU7A 1TDQA 5ERWB 1F90H 1ZLUK 5KS9E 4F7MA 3HTLX 4LPXA 4TNVF 3HAEB 3MNVA 1E0OB 2H1PH 1X5AA 2NX5E 5E8OA 4MNHA 5FYJU 1T6VN 4NPYA 1S7UA 5D72L 4XMLH 1F90L 2XZZA 4WIQA 5E6IC 5I1CL 1UENA 3L3IA 4MA7L 3OR7B 3BZ4B 2RQ8A 3QWOA 1H5BC 5DQJB 3U79A 3P77A 2CGRL 3MLVH 5FA4B 3T2OA 2AK4B 5B38A 4C56D 2AABL 1FRGL 1WBYB 3UTPE 2OL3L 3TBVB 4G9FA 5GGRY 3GI8L 1OCWH 1SJEB 5ID0B 1PGRB 3L6FB 4H26B 3VRIB 2PYED 2DBLH 1KPVB 2CGRH 2QADC 3OHXB 4R0LC 5GRUH 5JW5A 1NEZG 4OAWA 4ZODA 4J6RL 4X5LA 4P3WA 3BQUD 1DANU 3TBYA 4R3SB 3QI9B 4L4JA 3VD5A 1T7VA 3NTCL 5DHXB 5DJXA 3MUY1 4TSCL 4H1LH 5FECA 4JFYA 3MCLH 3T65A 3LPWA 4DW2L 3FT3B 3PGDA 2NY1D 4QT5A 2YD6A 5E4EB 1DE4B 1M7DA 4M00A 4RGND 4OLYL 3CK0L 4JJHA 3TZVA 3ECBB 4OZHF 4JB9L 3KWWA 3VXRD 4UOW1 4YC2C 5EZOH 1CE6A 4PJEF 5IT2L 3ARWA 3F8UB 4GRLC 5DRXB 5LAXB 4LBEA 1MF2H 1U8JA 2YWZA 5EUOB 1JI1A 3TJHC 3VFVA 1YY9D 4FS0A 3D39B 1BBDH 4YWGH 4O00A 1ZT4A 2XWBA 4JLRB 1IEAB 4HF5L 3VWKB 1AXSA 4Q6IB 5BVPL 5ENWB 1I3GH 1EVUA 2ERJB 1NBZB 1JWSA 4BFIA 4R90H 2P43B 2EC9T 4YX2H 1HXMA 2HRPL 4PRBA 4HUUB 5DEGB 5HI4D 4FZ8H 3S96A 3DX8B 3TPUB 3WSQH 2ILLA 3DV4A 1I3GL 3REVA 5HHMD 5D8JL 4D2NA 3EYOA 1JWMB 4I18C 4RFOL 1CI5A 1KCVH 2VERN 3ORJA 4HWEL 3SDYH 3BQUA 5GGVY 1L9MA 5HI3D 2D3VA 2WIIB 3KDMA 2MTPA 1TETL 2HG5B 2YA1A 4KDWA 1KACB 1FN4A 1QRNB 3QXUA 4OUUA 2DQIH 5E08H 1YEJL 3L5XL 4FZEH 1P4LB 3W0WE 1QSFE 2XQYG 1B4JL 4IRJC 2C3HA 4GKSA 4WHDA 1GPOL 1SVZA 4HKXB 1O7SA 3ROLA 3HCVB 4OFDA 3BH9A 4KHTL 1AQKL 4LLMA 5GGSB 2DTMH 4UDUA 2BNUA 2EDXA 3GKWH 2YD8A 2DTSA 5DA0B 2ZOKB 4NO5A 1MLCB 2WWKT 3AS1A 1E6OH 1AD9A 3C8KA 3QULA 5EBWA 2CDGA 4ZO9A 1SBSL 1I8KB 5CJXC 4FQQB 5HDQH 5J6HB 1JZ4A 3HPJB 4W68A 1HYRC 4ZTOL 1BOYA 3ULUC 3RNQA 4UQ2A 2OJEA 1N4XL 2YKLH 2W9DH 3I50H 3V6FA 2DM7A 2VLJB 3S88L 1B2WL 3MUZ1 3N06B 4KDVA 4NUGH 4OCXL 5HGAA 3WLWC 1HH9A 4ZSOA 1FYTA 5DVLA 3DO3A 3K1DA 3MRGB 4YGAB 1F02I 1GGCH 2OQJA 1NGYB 5JHDD 4XPTH 3S88H 2AGJL 5J12B 5F7EH 1FIGL 2QKIB 2IJ0C 5JW4Q 5KSBE 5CEZL 5BV7L 3MGOA 1IFHL 3SGDI 3S37X 1A0QL 3I2CL 4K23H 4HIEB 3MLPA 4NNPH 3T1FB 1RUAL 4YFDB 3FO9B 4NGHH 3GEWB 4P5MA 2CDEA 4GRMB 4HCRH 1QFHA 4PLOB 4JFXA 1NKRA 1CXIA 3MLWL 1U3ZA 3QNYB 4NQDA 3H9HA 5ID1A 5DQDL 3ETBF 4JFFB 3QZWB 1IFHH 4ZUVA 3SDCD 4WEUD 1R24A 4L9LB 4ODXB 5I76B 1GHFL 3GIVA 5HDLA 1SYVA 2ICEB 4HFWA 4NJAH 1R5WB 2R0LL 5IWLC 5F7LB 3O3UN 1MIML 5B4MD 5GGQH 5EO9A 3BPOB 4K94H 2BSED 5HDBF 1H8OA 3L5IA 3JV4A 2H26A 3DUUA 4NO0D 3P11L 3D48R 4UUJA 3CGTA 4LCWE 5KSAC 1ZHLA 1DEDA 3W9EA 4I18A 2R0LH 2HFGH 4FQIH 2NY3D 2Y7QA 5ADOL 3QO0A 4H1LB 5FOJA 4YBQD 3PDOA 1KFAL 1X5FA 3B2VL 4POZC 2F53B 4ONGH 3FO0L 4D3CH 4NO2B 4GBXC 4OGYH 4YHNB 5ENWA 4HKXA 2N4IA 2PO6D 2EDTA 3PGFH 5JQHC 5ICXA 3F7PC 2L0DA 3RGVB 5GRXG 4IMLB 3B8SA 4RZCB 3BN3B 5BO1H 3BWUC 4N0FB 3SY0A 1QBML 1WBZB 1KCRL 4NUJA 1G1YA 4GMTL 1OAUL 1X5GA 2G9HB 4OKVA 4P23B 4Q9CA 4U31A 2AQ3A 3C8KB 1OM3L 5JW3L 1T4KB 2IGFL 4FTVB 1IGML 3BQUB 2XTJB 5JR1L 2CDGB 4ELKB 3VH8A 3L3OB 3D0LA 4M48L 2F8VA 2OI9B 3AGVA 2QSVA 2C26A 3SKOA 3RQ3A 4FMKA 4QEGA 4UQ3B 1J0HA 4LARH 4CVXB 1WWBX 4MJ2A 5ITFA 2XKNB 1MCFA 3ALPA 4YGVA 1UH4A 5MEQB 3C5SA 1ZT7B 4KJQD 3MNWB 4HWNA 1BIIB 3GMNA 4POUB 2DYPD 2JJSA 1K5NA 4KRPB 3OAUH 2PYFA 1KCUH 3WFBH 4BZ1H 2OS7A 4U1LB 5A43C 4GG6B 2Z93A 3O4LB 4GW5A 1RZ8A 2YZ8A 4GW1B 4NM4L 1NJ9A 4OLUL 4PB9H 2VAJA 3NCYP 4OLWL 5JXAL 3ULUD 3M1BA 3VFOA 1N5YL 4XCEA 1HQ4A 3B2UC 3BGFB 8FABA 4S2SB 1NGPH 3V5KB 1AGDB 2FCBA 3QHZH 5D71L 3T77A 5JW4R 2UWEE 4L3CA 1AC6A 3ULVE 4AEIH 1H15B 4JFZL 1JWUB 1NFIA 4Y5XC 1YYLL 1XEDA 4JPVL 1S5IL 4I3SL 3RTQC 2YMXL 3HUJF 4QRRA 3JV4B 4IS6A 3MFGB 2CMRL 5A40E 2CPCA 2P5ED 2BDNL 4R0LB 3ZKNC 3IS1X 5CD3B 1I1AA 5F1OB 1KLGA 2PTVA 4XWOD 1GGBH 1BF8A 3D0VB 3BD5A 4PRDA 5E03A 3PHQA 3QZWA 1NLDH 5HYJB 4QYOA 5KSAB 1NUDA 2ATPB 2ZG2A 4YEEA 5I76A 1J0JA 3MLVL 2DLFH 2EYRB 2GIYA 1EAPA 2UZXB 1M71A 1IGTA 1MHEB 5HHOA 5SX5K 2R4SL 1D7FA 5ESVA 3P40A 4FABH 3D1MC 1MCBA 5EIVA 2B0SL 1F3DH 1N0XL 4HUVB 3GIZL 4PJBE 2CKBB 4N8VA 4UBDC 5GRUL 4DWHA 1J05B 4JGJA 3C60D 4NZRH 5BRZE 4U6YB 1JNNL 2ED7A 3O4LE 3NCCB 1ITCA 5CBAA 2GW5A 3B3IB 5GGUA 4G9DB 3HMXA 3K2UL 3UPCA 3ZHKA 3CCHA 2SEBB 1WGOA 1IVLA 4UT7L 7FABH 1KSRA 2OTUB 1F4WL 5KAQF 3ZKMC 2OR7A 2QSQA 6FABH 3T0DA 2NY2D 4JKWA 5E8EA 3L7FA 3SDDA 3ARYA 1UXSA 1VGKB 1JNNH 5FCUL 2QQKL 3O6MH 4GG6A 4JREC 3MO1B 4UTBL 5ACZB 2BNRE 3NN8B 2V17H 3VFGH 4GRWH 1U92B 3V6OE 3VMNA 1VCAA 1CDGA 5JIPA 1Q38A 4NKDB 4BZ2L 1I3RA 3TO4A 1LK2B 1GC1L 4L3EE 4KVNL 4DEPC 2GAZA 2XT1B 2BVOB 3IKCA 1RJLA 4KTDH 4LKXB 3TNMB 2XA3A 4JQIL 5ECJE 3MRBB 5TF0A 4CVXA 4HF5H 5GGTH 3FQNB 5BVPH 4YXLL 5FDWA 3T2PA 3ZTJH 1JGEA 3GSVB 2CIKA 1A6UH 1QBAA 5HHOD 1AGCB 2BNQA 3PIQA 3WXVL 2P24B 2QR0A 3C9NB 3OJDA 5T1LA 1BZ9B 1FH5L 5TE7H 4KJPC 4G7VL 4PV9B 3OXRA 4P57B 3GZKA 4LDLB 2B2XH 3VFTA 4S1RH 4KQ4L 1JL8A 5F7NC 5E9DD 4LEOB 5DWUH 4MHHI 3NCMA 4UU9A 3L3KB 4ZOEA 1SJXA 2V7NB 5KAQG 5C0EA 4XZUA 4DGYH 1TENA 4M8VA 2ICES 1IZKA 3NGBC 4Y5YA 3NIDF 4OUOA 3ILQC 4IDJL 3H9YA 5T5NG 1EHLL 4PJIE 1CVRA 1J1XL 1I85C 4F37F 3CDGB 4HHAA 3U0TB 2J5LC 4GMSH 1QFUH 5F7DB 1B4JH 2R9HD 3RDTB 3TN0A 3UTQB 1TVHB 3CMOL 4PYHA 1G9ML 3QUMA 5EFIB 3REWB 5DURD 1WIUA 3S35H 4JR9L 2KPNA 5EU7E 4EIGB 5EU6B 2BC4A 3DTXA 4NWTH 2LVEA 1BD2B 2X4NA 3VWJA 1A4KB 3MR9B 2Q6WA 2DLHA 2FYYB 4LLVB 3QT2A 4PRPE 3VWKC 4PJAE 5K9KA 4U6HB 2A9NL 5EIIA 3KLAB 3RY6C 5IMLA 1S8DB 2EDJA 3FQUA 3RGVA 3FN0L 1A02N 4IRSC 3C60B 3BPCA 4PG2A 1WZ1H 3GO1L 2NY7H 4UI2A 1IT9L 1MFCL 2ENYA 3CLFH 4O2EA 1B3JA 3UBXB 4IHOB 5KSVB 1T4KA 2V2XA 4FTVA 3RUGE 4NKDA 2R2HB 1QPPA 4UB0H 1NDMB 5DHVA 5BV7H 5FKAB 1VACB 3B2UD 4JHWH 3KYNB 3LN5A 3O2WL 2HT4D 1KB5B 4M6MH 2F5AH 2GK2A 4WW2A 5BJTA 3RBSA 2B5IC 4HV8A 5FECB 1JGEB 2PO6B 3GSVA 1I8LC 3T4AA 1J11A 4Y89A 5ITFB 1QLRB 3F7VA 1UM6H 3VXUD 4PBXA 4N8CH 2DB8A 2GITA 3K46A 5I1AB 2F5AL 2XZQH 2MSPA 4KTEH 2WK2A 1RZ7H 1JTTA 3R1GL 1IBGH 2OMBA 1EGJA 3L3KA 2VABA 3BAEL 2CRMA 1MCJA 2CUMA 2QBWA 4NKQB 4ZS6D 3P11H 4XWOC 3QIUB 3GB7A 2YBRB 5AYUL 3WLBB 1FFOB 5IIEB 5IROC 4N0RA 3V0WH 1NKOA 2FJFA 1JVKA 2ZUUA 4MAYB 5IB1A 2D0GA 5A2FA 5A2KH 3OV6A 1E4XI 4OF8A 4YIQA 1TVHA 2IBBA 2K3TA 4GAYB 4EEEA 3NIGE 3QO1A 3VDAA 3V2AR 3NFNB 1S3KL 4MQXC 2Y07L 4MQ7B 4KJYB 4YDJA 2VDOL 4KMTH 4LF3B 4OQTA 35C8H 4J12A 4TPRL 4NM8L 1QHPA 2BHYA 2JELH 4C56E 4Y5XB 3RZCB 1IQDA 3IFOA 5DR5L 4KU1A 1BZ7A 3KVQA 4HZAA 3HE7B 3KPSD 1RULH 3OWEA 4QTHA 3VMPA 2X4QB 2VXTL 1IKNA 4RNRA 1T1WA 4LSUH 2H45A 3H9ZA 5D5ME 5F9WB 3EIFA 1ULVA 5DD6A 2V7HB 5E99L 3U0TA 1A7RH 2HJFB 5ESAB 5IM7B 1QEWB 4G3YL 4O58L 5E95B 2A77L 3ROOB 1RULL 3MZGB 4AIZB 3QQ9D 3T0EE 2GTZB 1V7MH 3MREB 2C4FT 2Y06L 3QUZC 2NXYD 3TZVC 2VDLL 2B8OT 5FKAA 1SBBA 1I9EA 4RGNC 3QXVA 4OGZA 2X4NB 5B3JE 4Y1AE 4O58H 4NO0A 1A22B 2IH3A 2IQ9H 4LNRB 2LTQB 1GZQB 4CW1A 5JPMA 4GRLD 4RISL 4XMPL 1PX3A 4GSDL 3DVNB 3GBNL 2DLGA 2J1KA 1RUML 5EDXA 4WCYL 4YHKL 2YUVA 4F7CA 1QLRA 1TJGH 4IBLT 2IANA 4LHJB 3FOLB 4UAOB 3KLAA 2PO6A 2SEBA 1RZFL 1FYTB 4JGUA 2LV4A 4ZTPL 5JDSA 2AJVL 2ZCHL 1N5AA 4HJJL 5T1MA 2UZIH 2A6KA 5IMKB 4MDIA 3OR6B 3MGOB 1S7TA 1DDHA 3LVEA 4JN2A 3AAZA 5IB5A 3QIUA 1NSNL 4Z76A 1IGCL 1C12A 1RZFH 1ZANH 2XG5A 4XNYL 2JKXA 5KSBF 1E4JA 4FXLA 1S9WA 3UTPD 1TZGL 2KQNA 3K2MC 1HHIA 2FSEB 4JO2H 3C6LB 3TYGH 1H3PH 3QPXL 3EW3B 5BQ7B 1D5IL 5C09A 2OTWB 2C1PA 5EU6E 1YYML 4ODSL 5CILH 5EORH 2D4DA 4YIQB 1U8KA 3TIEB 5T3ZD 3PUCA 4HIXH 5IB4B 3GMMA 1N7ML 4HJ0D 4JO2L 3IYLW 3GJFB 1ORSA 1HSAB 5JZ7D 4NDMB 2MQ0A 2X9WA 4AZ8A 4PJHB 2H2SC 4LASH 1KULA 1TQBB 1CL7H 3DMMC 5DGQA 1G7IB 3MZTA 5DMGD 3NCJH 4F8QA 3VGHA 3KPNB 5GRZA 5LGJB 1XGQB 5F93C 4WI7A 4NRYB 5DD6B 1MREL 5KW9L 3HI6H 4PJ9C 3E6FB 1FNGB 3GRWL 4ZFOL 1VA9A 1HCVA 5DJZA 3QEQD 5ICXB 1L0XA 3ZDXE 5C0RH 3HHRB 3IDNB 4R26L 3CU7A 3NIFE 3RPIB 3A6BL 2D31A 2WW8A 3GSRA 2HMIC 1AHWA 2WWKO 4PJFE 3I6KB 1XIWB 2AEWA 3BH8B 3KPOB 4JKMA 4DKFL 1XGTA 5DT1H 3B9VA 1IAMA 4R26H 3QUYA 3ZKXC 4C59B 1RJZB 1TIUA 3D3VE 3TEUA 1C5DA 2AXGA 2BXZA 2NLJA 2DQEL 3MRFB 1X5HA 1FORH 4EXPX 4F7CB 2NW3B 3MJGX 4YHPA 1M7DB 2W0KA 3GNMH 3HMWH 4MQSB 4FMFA 4MCZA 2BFVH 1BEYL 4FFVC 2MHAB 3CFKA 3CH8A 4Z7UB 1ZT7A 2ARJB 5C8JB 3B83A 3VXPA 3T0VA 4I9WD 2Y6SD 1K8IB 3MREA 4XI5D 5L88L 1VB9A 4ZYKB 3OJVC 4WTZG 1XR8A 43CAA 1BEYH 3VXRA 4JDZA 2V2XB 4K71B 1NDGB 4ZUUB 1F11A 3MA9L 3ZDZE 1D9KA 4U1JA 3CSYB 3CFCL 3L5WB 4WFFD 5J13C 1RZKL 1KTKE 2UUDH 4F33B 2CUIA 2E7BA 4OZHE 3TCXA 1MCLA 3CFEB 4BSVB 3K3QA 3QEQA 4JQVC 2ZUXA 4X6CA 1XZ0B 2BSRB 1IEBA 4HFUL 4WUKH 1ZLVH 4CVWA 1HDMB 1MCEA 3MV7B 2VWEC 2VTFA 3RAJL 4Z7OF 2HFTA 3VWKD 1UQSA 1XF2B 5D7JA 4MD0B 3SKNB 5DJAA 1YUHA 3TT1L 2Y5EA 3DROB 2D7QA 1RIVL 4GXUM 2EIBA 5IW6A 5C0IB 3QEHA 3NIDE 1V3MA 1KJ3H 4Z5RB 1UADC 2DD8H 1YQVL 1B0GB 1KJ2L 2DRUA 2ZOLA 3QIWA 3T0BA 4HUXA 3GSXA 1HXYB 1Z3GH 2EDFA 2P8MA 4W6YB 4JY4A 2FJFB 5IB1B 3QH3A 4N1CA 5GHWL 2B4CL 5JQ6H 5BCAA 2GYSA 5BS0B 5I1IL 4WWKA 5HGDA 1DQLL 1F8TH 5ILTH 1K6QL 3SGEH 3V5HA 1T1YA 3QCTH 5DD3L 1CT8B 3ZT7A 1F6FB 4U6XA 1A9EB 1W0WA 1ZHBB 5EC1B 1L9NA 2ZSWA 3MXWH 1XF4A 1CDUA 1T1XA 3EOBB 3QPQD 5HYIA 4HG4K 1FJ1A 4JQIH 1LO4L 2WLZA 5E9DA 5F7HA 3MBXL 2ADGA 1O5DT 3JTTB 3UJIL 1QYGH 4YQXL 2FGZA 5JOFB 3CCHB 5SWSD 5JORA 3QAZB 5FKPA 1F42A 2HLAA 3WXVH 1R5VB 4M1DL 3G6JB 1IAOB 3RWHB 5HHQA 5TFSH 3QWQB 5ESAA 4OZIA 4GUPA 5D7IB 2Z4QB 5JIHA 4UNTA 4OZIF 4JFPA 2V5YA 2PR4H 4IRJA 4F15B 2UV3A 3PXHA 1I8KA 3S36X 3QDGA 1EZVX 4QHLA 3V7AE 4QWWD 4OAWB 4QHUA 3W9DB 4PJXB 3QJHA 2D7TH 5C07D 5CZXC 4KRPD 1FNFA 3GSNA 2YRZA 4LVNB 4H25A 4KAQH 3UBXG 5DHVH 3FQNA 1U95A 3DXAD 4EZMA 5DRNA 4OCSH 2YPLB 4PY7A 3LQZA 4AM0A 3TNMA 1H5BB 4QNPE 5E4EC 4XPBL 2W9LA 3ZT5A 3UTZB 3CVHH 3FRPA 3VD9A 4XPHL 1S7RA 4PLKD 1YEEL 4Y5VC 5E8DL 2O5YH 2P45B 1A6ZB 2BERA 1F13A 1QHOA 1YDPA 4XGZB 4GKNB 4JM2A 5IHUH 5C0IA 1RHHB 5LJYH 4KUZL 3W9EB 1OP5K 3CVHL 2NY0D 4XCCH 3BZEA 3BXNB 3O9WA 5FYJH 2PKDA 5D1XA 1R3LA 3CZFB 4X7EC 3Q0HA 1ZLUH 1S7SA 2NY2B 1SYVB 2ICEA 4IMLA 4RZCA 5CGYC 2IBGA 4JHAH 1HXMB 2DF3A 2J12B 1ACZA 3S3PA 1FP5A 4MDJB 1RJYA 1CFBA 1XAUA 5DMIH 1JGVH 3R4DA 4WU7A 4D0CA 1U3YA 2ICWB 3WIFA 1U6AH 3IFPB 4JFFE 3KXFE 3VH8B 1OQOA 4FQLL 4P2RD 3BGAA 4GJTB 4L4VE 1Z6JT 2G60L 3WXWH 1JMXA 2FJGA 2X44D 4N0UE 4JFDA 1YPZE 4ZO7A 1NLBL 1UT9A 1U6AL 4JRYB 2PW1B 4WHYG 1DN0B 3RVTD 5JIKA 3W39A 4NT6B 5HHQB 5EA0L 2XN9B 3QZWG 4XVTH 1MI5B 1P53A 5IMLB 3R8QA 2R39A 2VLRE 1OD7A 1LP9E 4B50A 4OJFL 5EOCL 4NN5C 5DGRA 1B0RB 5IKCB 4F9LC 1XH3A 4G8FB 4G6ML 1AY1H 4FHBD 1IILE 2KH2B 3ARED 5DI8A 1GYAA 1RK1B 1BFOB 4LSPL 3ZHDA 2V5TA 3QXTA 1FV1A 1T89A 1NC2D 1KB9J 5AYUH 4YPJA 4B7IA 2GFBA 4D9RE 3DVIA 2YA2A 1MIMH 4PJCF 3C8DA 4MS8C 4Z78B 1NBVH 4YHLL 4MNGA 5JHLL 4KROB 4P46A 1UCBL 3M8OH 4LPTA 5C07E 1WZMA 5ICYB 4MHHG 3JUYA 3FHQA 4XP1L 3QFDA 5BVJA 2VSCA 1JJUA 4I0CC 4TN9A 3RU8H 1NQBA 4QOKE 4ZDHB 3B8YA 4TNVK 3UDWC 3ES6B 3O2DL 5E56A 2WAHA 3H42L 4ZUTA 1SMOA 4TULL 4N0UA 1U8PA 4HC1L 3AREC 3BHBB 1HI6A 3AXLA 3QDGB 32C2A 3NAAL 2APWA 4K3GA 5FM5M 2YBRA 5A3IC 4AYFA 3WNKA 3BIKB 4BQ9A 2ATKB 1F3JB 3R06A 4EDXB 3VE0A 4X6BA 4JG0H 1EFQA 4JRWA 1KB9K 3CSYA 2Z35A 2DWEB 3VRJA 4AEEA 5EB9A 3ZTNH 1U91A 2NCMA 2R1XB 2BY3A 2C7UB 4P9HC 4XCFL 3QRGL 5HDBE 1XGUB 1I1RA 2D4FA 3BPNB 3FTGA 3TT3H 1V7ML 4LSSL 1NGWB 3GSOA 4GG6F 4ZNCD 4L3ED 4OF5A 2Q86A 4ETQA 5I66A 2P5EE 2AV7B 5SWZD 4XNQA 1T2QL 4XVUC 1ND0B 3ARSA 5H37G 4KKLC 3Q6GL 1WCQA 2J8HA 5A2JH 4Y5XA 3D39E 5HHOE 2XZAL 4JO3H 3VXNB 3WFBL 1FC2D 4Y2DB 4QRRE 3E2HB 2VXSL 3R0MA 4G5ZH 4ZTPH 4NQEB 1E4XH 5JOEA 1CXHA 5IHLB 2R1YB 5KVDH 2UYLA 5TPWH 2WM0A 3D18B 3G5YA 3NCBB 5AG9A 2ZUQB 2VR5A 1K4CB 3VXSA 3QHZL 2Y1VA 4TUJA 4GH7B 3CIQA 2CK0L 2WINB 3TBYB 4J3OC 4XHJD 4N5ED 3IDXH 4MNHB 5JW5B 3RZCD 2VDKL 1CGSH 3BE1L 1ETZA 4UILH 1D9KC 3HKFA 3IJSA 4PYGA 4TSCH 5F9JA 1FO0H 1EFXA 5DJ2B 2V9QA 4PJEA 4U6VH 5IVZA 2D2OA 3CFJA 1OAZH 5J56B 1WBYA 3LQAC 1FFPA 3CU1A 4JDTH 1X9QA 3G6JA 4RMTA 5T3ZH 4BZYA 1CL7L 3S9DB 3MODH 4GG8B 4PRIE 1U8QB 3JTSA 2ITDA 3MLTB 3MV8E 1N59B 1DL7H 5I18L 5FM5O 3HG1B 1S7QA 2YPLD 4FFYL 3V6OC 5GIRB 1NMAL 4XZUB 3ZYOA 1CIUA 2UY6A 1KB5L 2AXJA 4FQHB 4M3KB 1TNMA 4ODUA 3UYPA 5AG8A 2C4FU 1HQRA 1OCWL 5EOQL 4X83A 4H5SB 3IGAA 3QSKB 5DTFA 4QRUB 1KCSH 25C8L 2FH8A 2VITA 2VSDA 3SKUD 3HUJE 2DD8L 3V5KA 3F58L 4Y19B 4OI7A 1IJ9A 1MI5E 1VEOA 4X6DB 1T21A 2XPGA 1X4YA 4NZRL 1CDIA 4JRYE 4DKFH 3WSQL 5EOQH 4AY0A 1FPTL 4HGMA 3CSPA 5CIPB 3O3EA 3DJ9A 4XCNA 1H8SA 1UC6A 3PWPB 3KGRA 2NXZD 1P6AB 1HK6A 3ZT6A 4LEOA 3KPNA 4JKKA 5DMKB 4M7KL 4I0PC 4EI5C 1EJ6A 2Q6WB 3B4NA 4R0LA 3O8XB 5KVEH 2LE9A 1ZVYA 4Z7QF 4ENEC 5KS9A 1GVIA 1ACYL 4O2CA 4FZEL 3SKJH 4NQDD 2AJZB 1X7QB 3SKMB 3NA9L 2EIDA 3UYRH 2HFFB 3WHXA 5MEOA 1I3UA 4JE4B 2UWEF 4QXUH 2DTML 5DF0A 3MLZH 5FYLD 4P5KA 4YXLH 3AU1B 4HS6A 3GMRB 4FP8H 3SGEI 2X7LB 3OJMB 4LPUA 3WO3B 4NKMB 4GXUN 5C0CD 1T0MB 4X99B 3EYSL 5I16B 2OJEB 5FUOL 3OKNB 5I8CA 3VGBA 1Y6KR 2NYYD 2FO4B 1UH2A 5KTEL 5D1QB 4WUKL 4DN3H 3HFML 3LKPA 5ESQA 3LSOA 3ULVC 5L0QC 1E27B 4PTTB 1G6RB 4DGYL 4E41A 1CYGA 1DVFD 4H20L 3V9FA 4HK0B 3TF7C 4UT9L 4KHXH 5FO8B 5B22A 3GHBL 3RKDC 2GCYB 1J1XH 2VXVL 2WUCH 3E2HC 4PJXE 4TTDC 4OFIA 3B9KC 2X9YA 3QUZD 3VXUA 3HRZB 5B21A 4JRXA 1MJ7H 1LE9B 3GB7B 1D5MA 5EZLA 1IC5L 5D7IE 5IROA 3IJSB 2E5EA 4L9LA 5SX5H 3KYKH 5DLML 5C1MB 4X7CC 4Y4HC 4HFWB 1XR9B 4NYLB 3HZMB 5FDYA 5GRJL 5FDWB 1DTUA 4U1NB 4TRPH 3OAYH 4O9HL 1R5WA 1F4AA 2EXYC 3QFDB 2NY3C 4S1DC 3P9MB 1PSKH 4ZTOH 1EERB 4X6FA 1RUPL 2DBLL 4X9IA 1TCRB 2WANA 4J7RA 2ICCA 1BJ8A 2ZCLH 3WCYA 1QO3B 3VD4A 1LO4H 1NC4B 4NQCA 1A2YA 1ZHKA 1OQXA 5E1HB 4YDIL 5EUOA 4RAVA 3GJFK 5IMMB 1IT9H 1MFCH 3CLFL 3NTCH 4OGXL 5KG9A 5KSUB 2XA8L 1ZS8A 1RUQH 2CO7B 5IHZA 5GZND 3MOQA 4YK4C 5HHMB 4ELME 3DVGA 1NLBH 2PXYD 4N0YL 4XVJL 2G9HA 4OKVB 4X80H 1BLNA 5CEZH 1MUJA 1DN2A 3GBLA 4P5KB 4N0FA 4RGMC 2GTWA 3SY0B 4WWKB 3BEVA 4ZFOA 1B9ZA 1NGWA 4ORZC 3SPVB 4X7TB 4WTXA 1S5HB 3EFDH 2QQNH 1BIHA 4RWYH 3TA3B 3VXMB 4UUJB 3VWJB 3I3DA 1KIUA 4HS8H 3Q6FB 4N8CL 3L3OA 1BVZA 2WIIA 3KDMB 2M26A 4HZLB 3VFNA 2FO4A 4LLVA 5A3ID 2VYRE 3BKCL 2BRQA 3EFDL 2VLKB 2QQNL 3JV5A 1YEDA 4C57C 1Q72L 1QBBA 1N6VA 3AREB 4JG1H 4RA3A 3SO5A 2HN7B 4HPOL 4HH9B 3Q3GB 2HT4C 4WY7H 2Z31D 4NCDA 4HQQH 4HK0A 2I9TB 4Q2ZB 4NIKB 4E42B 4GAJH 4D3CL 2RGSA 4X7DC 5D8JH 3PWUA 4ZSOE 5EO0B 3M1BB 3VFOB 1GZQA 2ADFL 2W07A 5H94B 4I0KA 3RWEB 2VZOA 2AERT 3U9UA 2Y07H 1ZKAA 4FQQA 1YNTB 4KQ3H 4M5YH 1N5YH 3BGMB 1KENH 4HIIB 2A1WL 2RJMA 1OLZA 5J7CC 5I1GL 1BVKB 4X8JA 5D7LB 2P47B 1XGPA 2X4OB 1TVDA 1QSED 5MHSD 5DR5H 1OF2B 1F45A 5D5MF 4OFYD 3LDBC 1VFBA 5ALCL 3SQOL 3TN0C 5IR1B 3WFCL 3OL2A 3QDMB 3S97C 4F3FA 3OAZH 1E4WL 5JW4M 2Z31C 1LE5B 5TDNB 5GGTA 2DICA 1TTFA 2CSPA 2P46B 1HYSC 1HIMH 4LLAA 3UROR 1TITA 3X11A 5KSUA 1T0NB 4L8CA 2BXYA 2Z93B 2H9GA 5CJOL 4BSWB 1S9WB 3BXNA 2WBJA 2AEQL 5HI5C 5GGVL 2VDPH 1DZBA 1ZS8B 5GQBA 4AK1A 3UTSE 2OL3B 4L4TA 3LHPH 4R7DB 3TO2A 4EQ3A 3HR5A 2VE6A 1BWMA 1KCUL 1U3JA 1P5UA 4X7SL 1OWWA 5FIEA 2VXSH 4LAJH 2CQVA 4FOMA 3HUJA 4ZAKC 3FKUS 2RR3A 1EEZA 2DMBA 4I0PA 5E7FA 4NP4L 4JPIA 5HI5D 4TVPL 4NJ9H 4TYUA 3OF6D 3G6AB 1LO3H 1MJJA 4LIQL 4WFFE 1G1CA 4V2CB 4GS7B 4X4XA 4HLZH 3ZE2E 3QUYC 5D1ZD 3S98A 1RPQA 1NPUA 4RAVB 2FWOB 3G08A 1D5XB 4FQ2H 2YN3A 4JFZH 2YPVH 1E6JH 4XNMB 4P3DA 1F4YL 4NFCA 4IM8A 5FA4A 2PCPA 4F7EB 2BNQE 4L8SB 2UWEA 3FRUA 1EGJH 4F58L 1CGVA 2EH7H 4Y4KA 5KSAA 2MHAA 3CFKB 4X8XA 4EN3D 2EYRA 2J3SA 3H42H 2R23B 4U1MB 1FNSH 5FGBC 5CEZD 5J1TC 1OAZL 2CMRH 1LP9F 1S9YA 3CH1A 4KMLB 5IVNA 5D7LE 2NTSP 2YK1H 5DZLA 5FA3A 3L3GA 3CPLB 3BP5A 2AQ1A 3MRNB 1CXKA 5I9QC 5JHDA 3MOBL 4BH7A 1DANT 3WHE1 1AI1H 3LEYH 5BRZD 1BJ1J 2WV3A 5E2UL 1SHMA 1C5CL 5FM4A 5C0BB 3VFNB 4KVCH 4FXGA 4K94C 3PHSA 3VXSE 5CEXA 3PWLA 2YRLA 4PLJD 3GMQA 4GW4B 1WSST 4PY8I 3NVQA 3B9KD 1MHHB 3VRLF 2EH8L 1LE5A 5D93C 3WMSA 2ADJA 3P9LB 5IJVB 1YPZA 3TLRA 3QDMA 4F3FB 4BKLA 4RQQA 1OAKL 3H3PH 1R3HB 1YPZF 1FG2B 1JZ8A 1I8IB 5E94B 3OAZK 3E6HB 4S1RL 3RUGA 3VXOB 1P6FA 3TNNA 1HHJA 4MJIE 2JK5A 3OXSB 1FSKB 4MJ6B 3RWEA 3WIHH 2VZ1A 1IKFL 5J3HC 2L7UA 2F53D 1JPGA 2NY4B 4KK9D 1FNLA 4KJWD 2CR3A 2NYYC 3S36L 1MCDA 2HJLB 3ALWA 1FIEA 5C0AE 3WD5H 4XNXL 3TN0B 3FQXA 3OTTA 5DRWA 3NA9H 4MVBD 3KWWB 4Z95H 4F7TB 4LCYA 3B5HA 3OKDB 4QRSA 4DAGH 1FE8L 4JGMA 4I0PB 3KPRD 1KBGH 1RI8A 3UYOD 3RHWF 4BQ6A 3QPQC 5TDNA 3SE8H 3MRHB 4CN1A 4XNXH 2KL6A 3SDCA 4RMSA 4CMHC 4BUHA 3BZFA 2VLRD 4OB5H 4BYHA 2E7CA 4K9EC 3NPSC 4Z18A 1PLGL 1Z0MA 2E6QA 1AXTH 1H3WM 5IBTL 3MJ9H 5GJTH 3OKMA 3WFHA 1LWRA 3MV8A 1RAMA 4WUUE 5CD5D 5JPNB 1NBQA 3EYQC 4XC1L 1YNKL 3BPCB 3IDNA 3K8MA 1DR9A 3IDJB 3IFNL 1B6DA 1EEZB 1S9YB 5GGRA 1JI2A 3WL9B 5IB2B 1K2DB 2VL5A 1PKQB 3QIBC 3QG6A 1T7XA 3ULSB 1UWGL 1NCTA 1NFKA 1EO5A 1C16B 1LDPL 5C71A 3QDGE 5HGHA 4JANA 4HJGA 1QKZH 1EHAA 4YFLF 3ULUE 1MF2L 4MWFA 5HHNA 5K9OB 5CP7A 1KNOB 1INEH 1DQQB 4M62L 3SCMA 3QIBA 2H3NA 3QNZA 3U4BH 1ADQL 5FGSA 1RIVH 2P8LB 5CEZE 1W8OA 1EO8L 2C3GA 1D5ZB 4Y2OA 3THML 4HKZB 1R3HA 4L5FL 3TBSA 5I30L 3DLQR 3P9LA 4L9DA 5IJVA 4FFVD 2EDKA 3DURB 2HRPH 5C2BL 4MZ3A 4QRQB 1Q1JH 2GJZA 4V1DD 1VFMA 3L3GB 4GW1A 2B1HL 3BAEH 4OZGB 3VDBA 1U8MA 2B0SH 3V0VB 1QNZH 3IDYC 2CDEB 3CNKA 4K2UH 3VFUB 4H5SA 5C0BA 1DUYB 5F6HJ 4P49A 2P5EA 5IVXE 3B5GA 2HJLA 1WZ1L 5TQ0L 1FVDB 5GXBB 2VLRB 4P5TA 3GIVB 4W6XB 4GOSA 5LKNA 1YEJH 3PL6A 4NBZB 2MKLC 4LDOB 1FLRL 4GQPH 1YPZB 2FLBT 4OZ4A 1YN7B 5IR1A 5CMAB 2FHCA 4WUUA 1RUKH 1A9BB 1EHXA 3LD8C 3MMEB 1AR1D 1I8IA 2Q20A 2D7PA 5CWSB 5E94A 4U4BA 5F8RC 1BBDL 1OT2A 3IDIB 3I6LE 1OTSD 3TBTA 1CE1L 4OLXH 4NC0B 1EEQA 2BVQA 3ARFA 4OD2A 2H32B 4M1CD 3V79C 2PW1A 1PYWA 3HC3H 3O6FB 1IAII 3BEWB 4QCIB 1UEYA 4XAWH 1RZ7L 4PJ8A 2NY5C 2D7TL 3PABB 4QHKI 4DKDC 5T1DH 4UT9H 1I75A 5IKCA 2CLZA 3DO7A 2N56A 4L4TE 4TOYH 5F7DA 4Y19E 5EO9B 2KDGA 5DRZB 3HUJB 2IPTH 5JIIA 4I77L 3ARQA 1PJ9A 4D0DB 4HQQL 5T5FL 3C6SB 1UM4H 5EN2B 3BISA 3PHOB 1IC5H 4YFLI 5DVMA 4JO1L 2O5YL 3J7HA 4EQ2A 4PGDB 4I3RH 2X1QA 2WWMD 4MNGB 3GBNH 2A6DA 2DQUL 1A1OB 1C5BL 3MFFA 3PJSB 3WS3A 1BIIA 2PXYA 1T5XB 4PLNC 1S8DA 2BRRL 5JHDE 1N5AB 3BKJL 3EHBD 1E6OL 4OCMC 3T08A 1UZ8A 3P4MA 5ELIA 3S35L 5JXEA 1L0QA 2BNQD 3ZSTA 3U4EA 1E4WH 4CMMB 1IGCH 1G6RL 1GOGA 2DM4A 2V6HA 1V05A 4G6FB 3CFDA 3UBXI 4UT6L 1ZT4B 3GBML 4G8GD 1YEHH 2MWCA 3L3HB 2XQYK 3AM8C 3BYTA 3Q5OA 3D69A 3OQ3B 1SJVA 5EBGA 4G42B 3AMLA 1T5WB 2H3NB 2YOCA 1C8PA 1K3IA 1XIWC 4ONGL 4FQLH 2JJSC 1WBXB 3NIFF 4R2GB 4Z77B 3RRQA 2FX7H 3GMNB 1GGCL 5FYKH 4OD3L 5AZ2L 2E9WA 3F5WB 4PJ9B 5DK3A 5EC2B 1WLHA 1RUAH 4CJ1A 3QUZA 4EUPH 5I75C 1TXKA 1S9VB 4UB0L 4DZ8A 1RVFL 1IC7L 4J4PC 4ORGA 1OSZB 4NZDA 5DQDH 5F70A 1Q72H 2KUTA 2P5EB 4ODWB 1OLLA 5DZNA 1BBJA 4NJAL 4KK5D 2R4RL 1IKNC 2JE8A 4GBXD 5HHME 1J9CT 3RI5K 5IB3B 1A7PL 5ANME 4KK8D 3F7YB 5KVFH 5C0AB 3PHOA 4OF3A 5F7MC 3GJFA 5JXED 1GGIL 2ED8A 4ZFOB 1Q9OB 3UTSA 3RGVD 3HAEG 4OGAC 2XI9A 3QRFM 2P49B 3I3BA 4LU5H 4G80B 2RHEA 4WV1B 1SEQH 5BZDA 5CD3A 3EJJX 5I1JL 3GMOA 2PW2A 4TUKH 3MRFA 4RAUA 3X14B 3QXAA 2CRYA 2ZZUT 1BJMA 5JW4N 1GGUA 4PJEB 2R8SL 1JUFA 4HULB 3I85A 1MWAH 4LCCA 1I9IH 1AKJA 1SEQL 2NNAB 1L0YA 1QLFA 4P4KC 5BZWB 4KRLB 5I74B 2AAVA 3N1FC 2VH5H 2VZTA 1K4CA 3IDMB 1S7XB 3U4EB 4Z7UA 1WWWX 3PNWA 3GSRB 1XH3B 1S3KH 2A0LD 5C8JA 4XRCB 1EH9A 4QRTA 1LEKA 5GS0C 1MWAL 1NL0H 1VFUA 4V2BA 3EO9H 3EHBC 1A1NB 1GIGL 5GGVH 2HKFL 2IG2H 2B5IB 4PRAA 3KPRE 1SJHA 2D03L 4G6AC 1T2QH 4N5EC 1FVEA 5HDQL 1KNOA 3FB6B 1ERNA 1FQ9C 3F6LA 2OTUA 2R69L 4RX4A 5J11C 3V4UL 5E99H 2YKLL 3PIQB 4YE4H 4Y4KD 3SKNA 1NLDL 5CIPA 2CLRB 2VXUL 3DPBA 3C60C 3SDXE 1QPXA 2D7OA 2ED9A 4QGTA 1ZA6A 3QFJB 1BHGA 1D6VH 2APBA 2LU3A 3P3YA 4P2QE 4JO4L 4ZS7H 3IAQA 1JHLH 5IG7B 3OG6B 5CIPH 5C0DB 2OXHA 2GAZB 4JPWL 4M9PA 4KKBC 1J12A 3C09C 4R4NC 2HFEB 4ZUUA 3GSXB 4HUXB 3TH2T 3KXFB 1OAXL 1F3JA 1YQVH 4EDXA 3L5WA 4I4WB 1FYHB 2EH7L 4PY8J 5HTSA 1QSEE 5EH1A 3KJ6H 2DWEA 1WWAX 3D25A 1MCPL 3VFRB 2X4RA 1AGFB 4JPWH 1CZ8H 2MQCA 3G5XB 4HAGA 4PTUA 4DVBB 2OLDA 4NUJB 4XC1H 1V3KA 5C0FB 2XWTA 1XF2A 4XBGB 2A2QT 3GMMB 3TVMA 3UTSB 5H37H 2FL5A 1WC7B 3O2DA 1LNUB 2GUOB 2VLME 4JDTL 1U3HC 1DLFH 5C0EB 3QO0B 3WE6B 4HFUH 5GJSH 3LH2H 4P2QB 3JTTA 1QRNA 1T04B 1RQ5A 3S4SA 3SQBA 1F3RB 3N1GC 4Y2DA 1D5IH 5D1XD 3O6FA 1MRDL 4FFYH 2NXZB 4NN7C 3TA3C 5DD1H 3ROOA 5J13B 7CGTA 3DX6B 4N8VG 4JFPB 4ZPVB 4Z7VE 3F7YA 3LKSA 5I2IB 2WQ8A 1A1NA 1T1YB 3D87B 2NY1C 1PD6A 1WAAE 4K9EH 1V3JA 4G6KH 2ITCB 5EO1B 4FG6C 5C2BH 5DJXB 2BP3A 4OZGE 5IOPB 4Y1AA 1IAIH 5TE6H 5AEAA 1G7MB 2PTTA 1ES0B 3ARBB 3NH7H 2B2XL 3GMLB 3WFZA 2YUZA 3O3DA 2ZUWA 3Q48A 5D6DA 3UC0H 3RY6A 1K6QH 1JUFB 2COQA 1S78D 2ZUQC 4NFBA 2NY0B 4DVRL 1CE6B 3MV8D 3FOMB 1UZ6E 3MA7B 4MCYB 2E7LA 3CUPA 4LIQE 1HHGB 2ZG1A 3ISWA 4GMSL 5MENB 3WFEL 5C7XL 5H35B 1FLRH 3ZKMD 5C0DA 3TA3D 3VXMD 5DFVC 2YEZA 4OB5L 3SO3B 4OF0A 4YZFE 2ORBH 4F7PA 5DT1L 1T22B 5ISZE 3HMXH 5FYLE 4P2OC 2YN5A 4ZAKA 2BVPA 3VXME 2MKWA 2EC8A 5IGXL 4OLXL 1S7SB 1YNKH 3DIFB 2UVEA 1NCWL 2YD9A 5M7QA 4YDKH 1TTUA 1AIFA 1AJ7L 3BP7A 3MX0A 4X4ME 2Q76B 2Z0BA 1HHKB 1IGIL 3VG9B 3BP4B 3EYUH 4P2RB 4HWEH 3CC5B 5ERWA 4EDWL 2HH0H 1NMCB 5MI0B 1T83C 2ICWA 4JFHE 3WIFB 2HWZL 3SGJA 1MHEA 5HHOB 1QRNE 4YHYB 3DBXB 1AJ7H 4X7TA 4KXZH 5CGYD 1SY6H 1TLKA 3KS0H 2A74A 1YDPB 1ZLWH 3U6RA 4OQ1A 4JZJB 5D96B 2JB5H 3SDDC 4JRYA 1GJIA 2YS4A 5I8KH 3Q1SL 3U4BL 3RJQB 2FJGB 1IC4L 1MI5A 2Y36L 2VLKA 4GLRI 3S4SB 5LXGH 1A3LH 2G5BB 4ZMAT 4ODTL 1G7JA 4EI6B 2QEJA 4PP1D 2Q7YA 2X4RB 3U30B 2DQUH 5CUSH 1TZIA 1A1MA 3CFBA 3Q1SH 4K3DH 4WDIA 5ADPH 3KPOA 1F5WA 4JY5L 1CN4A 3KYKL 5I1DB 2K7QA 3RDTD 4FQCH 1QFOA 4HUKB 2GY7B 4OM1L 4L3EA 4OCLC 4NWTL 3GK8H 4OZFG 1ES0A 2DLFL 3ARBA 1QD0A 4F2MB 3V6OA 1I9JL 1R3IL 4PV8B 3L3IB 2FB4L 2VO5A 1BD2D 1REIA 3QUML 3U36B 3IU3B 1KN4H 4DGVH 5GS2H 4BA8A 5AWNH 1A7BA 2DQJH 4KC3B 4AEHH 3TGXA 1K3ZA 1RU9L 4Z7UE 3S3SA 1IGJB 4MB5A 2DQTH 2CIIA 3QUKB 2HVJA 1RZKC 3I2CH 4K23L 2Q8BH 2A6KB 4UNVA 2CRIA 3QCUH 4KRPC 4ZDHA 1YA5A 2BY1A 4M6OL 5D7IA 2OK0L 3DXAB 1OVZA 5INDA 3D3VB 1J87A 4JRXE 4U1JB 1JN6A 2HVKA 4UU9B 3FZUD 4IRSA 3IKKA 4PRID 4TNWK 2FH6A 2VJXA 3G5VB 1QFWM 5HHXL 4HKBB 4WGVB 3IU4H 1NCUA 2QQLL 3R06B 3RI5F 3DIFA 4LSRH 4RWYL 1AY1L 3ZTNL 3I02B 4PJAA 4ODHH 1UXWA 3HE7C 4PJDA 1J0KA 2VXTH 5I66B 1JGUH 5D1ZC 3S5LA 3ARXA 1QZ1A 3BKCH 3MYJB 1JCKA 5DJAB 5JOPD 4QXGH 1KGCD 1IEHA 4ZUTB 2EIZB 1J86A 1OL0A 3RGVC 3RX7A 3QR2A 5HGGS 4OUUB 4ZUWA 4OSUH 5JA8B 4L4VD 5FYLH 3C6LA 1I7UB 2W0FB 3N1MC 2X4UA 1G7LA 4QXGL 3ZZ1A 4JY4B 4PJ7A 3RU8L 3WJLA 5DWUL 4CADB 4ACPA 3EJYD 4Y4HA 1LO2L 4GFTB 4H0HB 1E4XL 4PJCB 5IBUG 1CS6A 2R8SH 4MNQB 1P7QA 4JHBA 4LLMB 5FGCE 5GGSA 4DOHB 3QIUC 5D2NE 4I8DA 3F12B 3JWDC 5GISL 3OGCB 1LEIB 1AHWB 3H8NA 3MV11 4UINL 1RJYB 1WISA 2DL9A 4JHZA 4U3XA 1YJDH 4NHCH 2R2EB 2CR6A 2HRLA 2JCCB 1DFBL 2BVTA 1LNUA 4KKAD 3RNQB 5AAMA 2VMFA 3BE1H 3MCG1 2EDBA 1JFQH 3ARUA 2ZWLT 1KELH 1QG3A 3FQTA 4L8SA 5C07A 1MFAH 1H0DA 5LWYH 1CBVL 4EJ1C 3CXDH 4UDUB 3QQ4B 4JDVB 2C1OB 2R0WL 2XZCH 1YYMH 4ODSH 5DEZA 4YLQT 3L7FB 1UXSB 3ALXA 12E8L 1B0RA 1RZJH 4KH2A 4L3EB 2FBJL 3HI5H 3JXAA 1MFAL 4HLZG 1JPFB 3QA3B 5I18H 2B39A 3QFJD 2FD6H 5KANG 3FB5B 2FZ3A 1B88A 2UZYB 1DQTA 3HRPA 1MIEL 4D8PB 1Z9SA 1VACA 4IRSB 4RISH 2UVFA 5FO7B 5J6HA 2VLJA 3LZFH 1A21A 4C4KT 1U8LA 3DVFA 4WCYH 5IIEA 3NCJL 1J5OH 1TQBC 4Y8AA 3CFEA 4KKNA 1CD9B 1E4KC 4Y19A 2JB6A 4WNQB 1RK0A 4M6ML 4MD5B 3QDGD 2VDML 4RQQB 4XXCA 3VGAB 1DVFA 5D7JB 5BRZB 3VA2C 5AUMB 3MRHA 3LPGA 3KXFD 1QR4A 3GHEL 1ZANL 3SDCB 1UM6L 4OKDA 3DXAA 5E0QA 5L8JB 1G6VK 4LPCA 1N6QH 2YEZB 4U6VL 4QHNB 3MROB 4NQDB 1H3PL 1UB6B 4N9GB 1FFOA 1NMBH 5MEPB 3SKMA 2DQCL 3FT4A 4MXVF 1I9IL 4Y5YB 5DMGC 3IGAB 3WUWA 1KYOJ 3OJ2C 3WUWG 2GSGA 1GSMA 5KOVC 3VW3H 3NGBB 4XPAL 3ULVH 4WFGE 4KDTC 3P2TA 4KVCL 4YDVB 3MV9B 3KJ4C 2QHRH 2F58L 3ZLQC 3LOWA 5DC9B 1JGLH 4JKLA 4NBYB 1QBLH 2P5WD 4WFHE 4JANB 2W38A 5D2LE 5HVHC 5I1EL 2V2TA 1XCTA 1BZ7B 4O51A 4G9DA 5F8QC 2HP4A 1H8NA 1B0GA 5E5UB 5TE6L 2ESVB 2VC2H 3MUHL 2FYYA 1HINH 3I9GH 4MLSA 3V0AC 3QXAB 2PCPB 5AD0A 3QWRA 1H0DB 4TSBL 2AEPL 5TF1L 4UTBH 1AE6L 3OAYK 4QOKB 1JZ2A 3GGWB 3A6BH 3WEXA 2XFXA 3FQUB 2IF7A 3SOBL 5SX4I 5B3NA 2FJHB 1A7RL 1DDHB 5SX4H 1ZAGA 3KYAA 3C5ZB 4XRCA 3VXSB 3UEZA 2F8OA 5C7XH 1AR2A 4FQPA 2CLVA 3FB7A 3ZMRA 3GJFH 3OKKB 4PV8A 3B9AA 3U7WH 4WV1C 5FM8A 3IJYA 3QDJE 5CBEA 4ZPTB 2VDNH 5IFHH 4LVHC 2JB6B 2YPLA 5D1QA 3WN5B 3MOAH 1INDL 4RFNC 1QLEL 1HE7A 4Y2DD 1XFPA 1ZVSA 2KBGA 3KPLA 1D6EA 1WF5A 4WFED 5T1MB 1HSAA 1ORSB 5JO5B 5I6XB 1PKOA 5FUOH 3PWPD 5I1IH 2XACC 5LGHL 4L8DB 4JN2B 4IRJB 1BX2A 2HWZH 5FV1L 2WBWB 3IDIA 4GAFB 4DN3L 2IFFL 4DTGH 4AEFA 2ZNXA 3IDXL 1I9RL 4KWUA 8FABB 5I0DA 4M43L 3QNXA 2FSEA 1MRDH 4PRDB 2XWJB 1F00I 4Y1AD 4BQBA 5DJ8B 4NHUA 2DLEA 1OP5H 5LG1A 1A6AA 2OTWA 1R3KA 3LEVH 4H8WH 4NOFA 4KHXL 3KR3H 1QKZL 2Y36H 1TZGH 1EXUA 2MPAH 4X80L 4OQTH 3FFDA 1LHZA 1NCDH 4I48A 1PY9A 3MBED 4I5BA 1ZGLM 1H15A 2EDRA 4Z7WE 1A6WL 4XPGL 5LBSH 4D0CB 4Y7MA 2MOVA 3BVNA 3C6SA 4MA3A 1XCTB 4YNYB 3CD4A 5E7BA 5B4MC 2EIZA 3THMH 1CTNA 4M5ZH 4PJXF 3U46B 2FR4B 2FEEL 5DYOA 4KRNA 3S5LG 2WBJD 3MQIA 1R3IH 1KTDB 3C5ZC 1KN2H 4DW2H 3N9GL 2A73B 3X3FH 1G0YR 2B4CH 3GRWA 5JQ6L 4K55A 5DK0B 3WBDA 4M7ZB 4KKCD 5SWSE 2GQHA 5E8EB 1CDCA 2ZCLL 5I71C 2DYPB 3LMJL 3PV6A 4CKVX 1NGZA 3VXPB 5FYJD 1M71B 4D0DA 3IFPA 5TDOB 1RK1A 5EU3B 4Z7VF 1NAKH 3INUL 3MUGA 4Y16B 2QADD 1U58A 1C16A 3RWDB 5DUML 3GMLA 4XH2B 1CXLA 1T03H 3QI9A 4LAQH 4PUBL 5BJTB 2IMNA 3V6FB 3CSGA 5FFLA 2BMKB 1OW0A 3W39B 4YX2L 1OF2A 3KJ4B 1MI5D 5D7LA 1U0QA 2F74B 1PZUB 4YDLC 1AGEA 5FO9A 5ISZD 4RMVA 4P3CH 3O6KL 5F9AC 3HG1A 4HWZA 4R8WH 4WO4B 4MJ5B 3P4MB 2VLKE 3FCTA 2ADIB 2BFVL 2W60A 4ZUSB 1I1AD 4X6EB 5FGRA 4HBCL 5T33H 4K3EH 4ZAKB 1S9VA 4P3CL 1Q9WA 3VGDA 4IMKA 3T0EB 4KAQL 4Q6IA 2XXCB 4OSUL 3G5ZB 4H88L 3UJTH 2PTUA 5IK3A 2X4OA 3BP7B 1JTPA 5D5MB 4NQEE 4D9LH 1MJUL 1QSFB 2PYEB 3QUMB 5EFIA 4HX1B 3DV4B 1V7NH 3UP1A 4QXTA 4OD1L 1M7XA 3BO8B 4ELMB 1YEKL 3NZ8B 3UJTL 4JZJA 3KNBA 1MRFL 3QI9D 4UINH 3BPOC 4LP5A 1VERA 3QB7C 1ZWIB 1XMWA 4QTHB 5DK2B 3LDBB 1FAIH 3WO4C 1LK3L 1KEMH 3ZE0E 2X10A 3UTSD 1AHWC 5ALCH 3SQOH 4ODWA 3CZJA 4P3DB 4RRPA 3ARDA 3EFFB 1UJ3A 4HUNB 2Y25A 4K8RH 1CLYH 4PGBB 1ZLSH 1S7WA 3O9WC 1UCBH 2DI9A 3QEGL 4F57L 5CJOH 4FQJL 4AH2B 3VMOA 3LRHA 2ESVD 3KPRA 4OZHB 4BH7B 5FOBA 4GSDH 2ZUSA 1I85A 4CU6A 2RBLA 4HIJB 5IBUB 4XXCC 1RUMH 4NNPL 1HN1A 2ZUVA 3MRNA 2NY6C 2NQCA 4PRAB 2FR4A 5C0NC 1IL1B 2JCCF 1AI1L 3HPJA 3IS0X 5D9SB 4F57H 4LSRL 4R4ND 3LKPB 5ESQB 1C5DB 2AXGB 5GPRA 5JORB 2W0PA 5CEXB 3F62A 3V5DB 3VDCA 3W11C 1JZ5A 1AKJB 2EDEA 2JIXD 1ZHNA 4MQTB 5AZEH 1RVFH 3QUXA 4X6CE 1CICC 4K7PL 3IJHB 1P7QD 3V6ZA 1JNHA 5FF6A 4LLYB 4GRLA 3RHWK 2VWEE 2VDMH 3ZE1E 3H3PL 3TT3L 3JZ7A 2I60H 3SGJC 1NCNA 3TNNB 1YY8B 5T3XL 4Z7QE 2DQGL 4K7PH 5CAYB 3CFDB 4HCRA 2Y6SC 3FB7B 4RGNE 1KB5A 1HQ4B 5D7JC 3EYQD 3OX8B 2XTJE 1VADB 3KYNA 3T0EC 5DRNB 4LU5L 4F33A 3RX5A 3RTQB 3K7UA 4PJFB 3DSFL 1A5FH 3WDHA 2AK4E 2XN9E 4NBXB 3EOAB 4WW1A 4WO4C 5TE4H 3D2UB 4XPAH 3ULVL 3EUUA 3BSZH 4G6JH 4MD0A 4CU7A 4M93C 3PGCA 4TUOA 2QHRL 4P9ML 4LPWA 1AO7E 2F53E 4ZXBC 3G9VA 1FL6A 1ZA3A 3TV3H 4Z7WA 2JJWA 4LDEB 1FSKC 5I1EH 5KS9B 1MCOH 3CX5K 5C0RL 1Z0NA 5C0BD 3SDXA 3OKMB 1SY6A 1Z9MA 1KJ2B 4PJ5D 3ARGC 2DJUA 2FRGP 5A2LH 5DZOA 4OZFH 5FUCE 5KBNC 4LLDA 1Z2KA 2MNUA 1RZIB 5DJ0B 5I8OL 4JFEB 1PAMA 4OCWH 4M1CC 5GRYA 1WCBB 4KK5C 1PKQA 2DI7A 5DMKA 3NABH 5E2WH 5SWZB 5T1KD 4Y4FD 5TQ2L 3H7BA 4XVSL 1IL1A 3K8LA 3BDYH 5DQJA 2A6JB 3U46A 5B39B 3OR7A 3LN4B 1X5LA 2BSSA 1NMAH 1MPAH 3DRQB 3SCMB 3WFHB 1ED3A 3PXJA 3RWCA 4Y4HD 3PV7A 3LKRA 4J6RH 4XVSH 3U7YL 5D2NC 3U0PB 2NR6C 2R2CA 4LLUA 1BGXH 4MA8L 3UCRA 3V6ZB 4P23A 4RGNB 1A4JA 2BVEA 3ARFC 3CFCH 1NDGA 2AI0L 4QRQA 2D7MA 2JIXB 3FB5A 4K7FB 3MJ9L 5GJTL 4C83B 1IARB 4X5WB 1Q0YL 1VPOH 5FO7A 1WVZA 3BP5B 5CJQL 4DZBA 3MRRB 4S0TD 1CGTA 3AROA 4LKXA 5ACMA 4X6CB 3C5JA 4PD4J 3RAJH 5JPMB 2C1PB 2CH8A 3IFNH 4P46B 4O4YL 1CQKA 3QIBB 2YZ1A 4GKZA 1DLHA 2D0HA 4J1UB 5C08E 5CZVL 4X6DF 1CG9B 4CN4A 3LEVL 1J88A 2O5XL 3O8XC 1NBVL 4YHLH 4X4YA 3KR3L 4QO1A 1FDLH 2X4SB 2QSCH 1FCCA 1DL7L 4O4YH 4QRRB 1OARL 1ZHKB 3A6CH 1ZLVK 1YEFH 1Y18B 3P30H 2BVQB 3ARFB 4Z76B 5DD0H 3NFSH 5GHWH 3O3BB 2X1OA 4U05A 1F58H 1DQLH 1EO8H 4PB0H 4YO0B 1AXSB 4C56A 3O9WB 3H0TA 1KPUA 4XBEH 4Z7UF 6CGTA 5L2JA 2BCKB 4LNVA 3PHQB 3FN9A 3LRSB 4XP9L 4P2RA 1KN2L 3WJJA 3A67L 4WFHD 1KIPB 2OMNA 3EJYC 5EIQA 1I7TB 3OMZA 3WS6C 5KTEH 4DK3A 1IQWH 1AFVL 4PTUB 4DVBA 5DXWA 2J88L 3GSOB 1XF4B 1H9VA 2EDYA 3JV6A 5KSAD 3K8KA 2HTKC 1QYGL 4J3VA 3TWCL 4M3JA 2P4AB 4KVNH 4E0RB 2GJ6B 3IF1B 3LN4A 2J88H 2O61B 3U7AA 5DS8A 4QXWA 3WYRA 5B39A 3F6IA 4HD9A 1N0LA 2IAND 1AQDA 5C6PB 1FZMA 5CLWA 3V8OA 5I19L 1X6LA 3MFFB 4IRZL 5E6YA 4PJ8B 3ZKQD 1QOKA 5AD0B 3TIDA 3VXQA 3O2VH 5ITBH 1BQSA 3TESA 4LHUD 3TH3T 3ARTA 1RZIA 5CGTA 1IGTB 4OM0L 3HE6C 3C09B 3X3GL 3PWUB 3QHTC 5TPWL 4J3WA 5EN2A 2OI9C 3STZB 4GG6E 3O2VL 2HH0L 3OKKA 1N6UA 3S3JA 1QUNA 4CUCA 3T0ED 5C9KA 4NFDA 4XPHH 2AK1H 1SY6L 2A83B 2FBOJ 1PLGH 4BSVA 4YDLB 5F6IC 4YHML 4LMQI 1FZKA 3BP6A 4NKOA 3CFJB 3AREA 4UILL 4JFFD 3QNZB 2K9UA 5DUPL 4X4YB 1K8DA 4JJ5B 5DFTA 1FNAA 5I1CH 5JMOC 1CLZH 4Y8DC 3OJDB 4XCCL 1IM3B 2N1KA 2VXVH 4YHMH 3NFPB 1N59A 4GO6B 2F54B 1HHHB 5EOTA 5GSVB 3BD3A 2HLFC 3X11B 4L8CB 3SE4C 5E8NB 4N0UB 4KROC 1N2RB 3H9HB 4JZJC 2GSIB 1BD2E 4YO0A 4EVNA 5F1NA 5BS0D 4MDJA 2P1YA 1HNFA 1P7KA 3LMJH 2CDFB 4CL7A 1PZ5A 5HD8C 1WBXA 3OKDA 4LSQH 1U8IA 1OTTD 1CFVL 3LS5H 1INQB 4XMKL 3BKYH 5D70L 4WW1B 5T1LB 1ZLWK 1XGRA 5K59F 3PWPA 4PJ8D 3AU1A 3EJZD 4FQJH 2H2SD 3U6RB 1T0MA 4HWBH 3U1SL 5CD5C 4LCWB 4FRWA 4XP5L 4ZUWB 3P4OA 4XMKH 1P84K 5DHYA 1KCRH 3F7QA 4DFIA 4EUPA 4X0KB 1LEGB 3VFWA 1G9NL 2DIAA 4NO2A 4YHNA 2OR9H 4NRZB 1P7HL 5B38B 3B9KB 2C3VA 4OF7A 4M6OH 3VXNA 3QIWB 3M07A 5L2KD 4XVJH 2X70A 4XP5H 5I1LA 3O6KH 4LCCB 4BQCA 1I7RA 4DEPB 1ACYH 4OV5A 2P48B 3VXQB 3JWOH 3MBEA 3R1GH 2RCSH 5EC1A 1MWAB 1OTUC 4QHUB 1CWVA 3WFCH 2BOBA 3V95A 1TTGA 3D85D 5E2VH 2VXQL 1JRHL 2BMKA 1IGYA 3MRLA 3MXVL 3EDFA 3CVHB 5IW1B 3SKOB 3P0GB 4XX1E 4WW2B 5K9KB 3O2DH 4Y4KB 1CFSA 4HPOH 1U2CA 1FCGA 3G6JF 1RMFL 5FYLL 3DMMA 3QQ3A 3L9RA 1AGEB 4OZIB 2QV2A 5IB5B 4IDLA 1Z9OA 2F5BL 1TCRA 3D39D 1U8MB 3P0VL 5DMYA 3TO4C 2JK5B 3OXSA 3L7EB 3QIBD 4HMDA 3MRMA 1S7QB 1JZ3A 3MROA 2XG4A 3GHBH 5IHBA 2APFA 2GSIA 4WI8A 4PJBA 1R3JA 4XCYB 3FQRA 5IF0B 4P9HH 1CD0A 5B8CB 2VH5L 1DBAL 1MJ7L 3ARPA 4N0CC 1FVCB 3MUJA 1JFQL 1UXWB 4FFZH 4JQXC 2L4OA 4MAUH 1CVSC 1DQMH 5GRJH 3MNVB 2OR8A 1DBML 3D85A 2D03H 4JCMA 2A38A 1HHJB 2W65B 3MGTA 5E8PA 43C9A 4OV6F 2H32A 1T80A 4P5TD 4ISVA 1WWCA 3KAAA 4OLZH 1P4LA 2VDPL 4YUEL 3BZ4A 4AQOA 2DQDL 3MJ8A 4M8QA 5KVDL 5E6IA 1KXVC 2FBJH 2P5WA 3LHPL 5C0AD 2UYLB 1NEZA 4R97C 4O5LH 5KVGL 1V8HA 3WEXB 2XA8H 4APQA 4PD4K 1HILB 1YMME 1D6VL 1MCHA 1UJ3B 5FYKE 3S34L 2FX7L 4JPKL 3GI8H 5IESL 4I9WE 3MV9A 4PJ7E 3QG7H 4MD4B 5J57B 2DQGH 3WHE0 1CDBA 2GFBB 1H3VA 4M61B 5EZJB 2X7LA 5F1SA 4DUWA 2AI0H 3VI4E 4LSTH 5J8OA 2PTTB 4M6AA 4G80A 5CBEB 3QWOB 4X0KA 4QLRA 3BZDA 1CZ8L 4KZEL 1IC7H 3ULUL 2DI8A 2QADB 3P77B 5K59E 3VFGL 4RA0C 4LRIC 2P8LA 1YECH 1SMAA 4BZ2H 3ARDD 2AV1B 2MCG1 3Q3GA 1GAFH 4HKZA 1NAMB 1NMBL 1ZHNB 1Q9KB 1HWGB 4YHYC 2N7AA 4P9MH 4U1IA 1C7SA 1NMCC 5MI0C 5IT2H 4D0BA 1S7TB 4RDQF 3W5MA 1X44A 1UB5B 2QSTA 2ORBL 1LEKB 3T3PF 2WBJB 3CAFA 3DOSA 1X5ZA 4Z0XA 1YY8A 1MAJA 3N50A 3MLYH 3RKDD 1IGYB 3MRLB 5DJ8A 1HHIB 5KW9H 4PP1C 3VRJB 3QXDA 5E4IA 1KXTB 1JWSB 4KKCC 4BFIB 3CC5A 5BVJB 2VE6B 2IWGA 1XR9A 5I8OH 2IAMA 4KI5D 4M48H 1VEPA 5I1GH 4NNYA 3TP4A 4MNQD 3MCKA 3DUSB 1U8JB 4R96A 2AEPH 3DROA 2JCCE 1ND0A 4MA7H 4OZGA 3TJEH 1PEZA 1F2QA 1G0XA 2HT3C 4DZ8B 1CFNB 2XWJA 5I8KL 4UBDD 1MCQA 2OL3H 3CDGA 4Z7NF 1FL3B 5E1AB 5C09B 1A3LL 3ARBC 3V4PL 1DSFL 4ODTH 3TJEL 2Z35B 2BOCA 2NX5D 4OCYL 2DLIA 1FNGA 3DVGB 4WDIB 1QFWI 2B20A 3LIZL 4LLDB 3LEXA 3QHFH 4OBRA 4R2GC 1PW3A 4JFEA 4YDVA 4LQFH 1G7PB 5EUKB 1NH6A 4EBQH 2WINA 1T3FA 3TO4D 4P99A 1FNEA 4X7SH 5J12C 1AO7B 3QCVL 2EXWD 3C08H 1A3RH 3EYOB 4NC1C 1NBYA 4LCUA 4KI5C 3BJLA 2FB4H 4NJ9L 3NCFB 4XPFH 5HPMA 3ULUF 2B1HH 4P5TC 3RWGA 5EIIB 4PPTA 4HPYL 2BHUA 4XI5C 3GI9H 1ZEAL 2WUCL 1BQUA 4APQB 3GGWA 1YC8A 4F9PA 1JV5B 1VKXA 1ZOXA 1Q9KA 2X89D 5DC4B 3I75B 4RX4D 4XP6L 4AJ0A 3P30L 5FXCH 4JRXB 4H8WC 1NJ9B 5I0ZA 1FGNH 1XGTB 5LXGL 5ISZA 3AVEA 4ALAL 4OCRL 3MRIA 3MACH 2W9EL 2GT9A 1MAML 5GRVK 4M9OA 4ZUVB 1CK0L 1IQWL 1CQYA 2OZ4A 1OOAA 4MXQC 5FB8B 1RUPH 2NY5L 2F19H 1BVKA 2AVGA 4JFED 1N0XH 1D5BB 3SDYL 4HDIA 3TC9A 1U3HD 3C87A 3QISA 3WDJA 3O45A 5IV2B 2ENSA 1Z5LA 3RPKA 3V0WL 2H26B 1YEGL 2APXA 3HAEH 3GMPA 5HYSA 3U2SB 2P8PA 4OGXH 5EOCJ 1NUFA 1KT2B 2IH1B 5GS0D 1YUHB 1MFBL 4U1HB 5I15H 2DN7A 4IEFB 4K2UL 1TZHB 3UPRB 3KPSA 1XF1A 1OAKH 2ID5A 4PJ7B 3RBGA 4C56B 4ONOA 4F7PB 3MJ7B 5ADOH 2DQTL 3QNXB 2JF1A 5HYJA 4QYOB 2YHGA 2Z8WC 1J1PL 1LGVA 1MUJB 1G9NH 4KKAC 3QNYA 4DQOL 4HG4J 1XZ0A 4R7DA 2VR9A 15C8H 3TO2B 3N1PC 2PYEA 2WBJC 4KGJA 1WT5A 4Q9RH 4LF3A 3ZKND 1BFSA 3VRLE 2F15A 4HS8L 4JB9H 1LQSR 5IW3A 1RHFA 3Q6FA 4Z8FH 4D9QE 5GGTL 4KMQA 1FHGA 3IDYB 5DK2A 1KBGL 4WWKD 1RZGA 5DYOB 1S9KC 3FQTB 1RIHL 3VJ6B 1MCWW 1F4HA 5I9QB 4FNLH 1JNLL 4HJ0C 3PDGA 5EUOE 1FH5H 5TE7L 4XAWL 4G7VH 5D1QC 4XP4H 5E6IB 4I0PD 1HZHH 1QEWA 1E27A 1CFTB 2UWEB 2IC2A 5F7EL 3RIFF 3OHXA 2YUWA 4R4FH 4XMPH 1S78C 1RMFH 4U0RC 4YHKH 1W8NA 4XBPB 2VZSA 1GZPB 4X99A 3VXUB 5T3XD 5IOPA 2Y4SA 1QA9A 3TJHD 1UJ3C 1JZ7A 1MOEA 3V6BR 3QDMD 2VZVA 4I3RL 2WSKA 4R9HA 1DVFC 4WJ5A 5JUEL 4AMKH 4YFEA 1WQVT 1U95B 4U0QB 3FONB 4EN3B 4PTTA 3MRQB 2HLAB 4QGYA 1KTLB 3FO2B 4J3TA 1JGVL 3OB8A 4WNQA 4Y16D 1PG7W 5F9DC 3BX7C 3BKJH 1CD1A 4JFOA 3O45B 1EEUA 4NO3A 5D1XC 2HVJB 2AEQH 1MEXL 1P1ZB 1YYLH 4MDIB 1KFAH 3B2VH 2PO6C 3HRZA 3U9PH 3RIAK 4HIXL 4K8RD 4L4VB 4F37K 1LDSA 4Z7VB 3T0EA 2R0WH 1KN4L 3BFOA 2CUHA 3CZFA 4JFEE 3HZVB 3OKEA 4U1NA 1AGFA 5D1QD 5MP6L 1B2WH 4OCXH 5KJRH 3WNMA 3HZMA 3FTGB 3LQAH 4JKPH 3BEVB 2CLZB 3DO7B 1A6VL 3SE3A 2AJSH 1JPSL 3RVTC 5EU6D 3ILPA 1DVFB 2NZ9C 1NFIB 4RSVA 4PS4L 3GMPB 2HG5A 1XGYH 5DO2D 4HXAH 1NANH 2XTJD 3KPMB 2A9MH 1D5XA 4JKPL 2Q3ZA 3HZKB 2E6PA 1KOAA 3DV6B 2V2TB 1KCKA 3CDFA 4LVOC 5IEHA 3HNVH 4B5EA 2HKFH 1HINL 1NBZA 3LB6D 4XNUH 5I8EB 1L6XA 4ZXBD 5K9QI 1CE1H 1LILA 4PJAF 2YK1L 3K2UH 1IAKB 4P4RB 4NZUL 1QSEB 3QJFB 4YK4B 1DEEA 3JWDH 4ODHL 1M6OA 1MHCA 4KV5E 4XAKE 3W2DH 5C0FA 1EAPB 5D96C 3MPCA 5E2UH 1XIWA 1W0YT 2YPLE 2DS4A 3O6ML 2R2HA 4MJ4A 1K4DB 1AR1C 2KZWA 5E2JA 1QA9B 1V3LA 1WFTA 1S5HA 5I1JH 3DX9A 1G7MA 4QOKD 1WUNT 1HEZA 3BW9B 1VHPA 4P9HL 5D71H 1A6PA 3UDWA 5ALBH 3T1WA 1P9MA 3H9SB 3BSZL 1NFDA 1MY7A 2OZ4H 3J8F7 3WLWD 3EDEA 3SEPA 1ZK9A 2ZJSL 4U2YA 1QBLL 2PXYB 3N85H 5FAAA 5D7JD 1EMTH 1P4IH 1CD1B 3IJHA 5DVNA 1NGXA 4ZYKA 1QBMH 2WLYA 5CJXA 4NSKB 3MV9D 5CZXD 5GIRA 1MCRA 4BQ8A 3BHBA 3EO0A 4MB4A 3G5VA 3NN8A 1UCTA 2DIJA 5HXMA 3RDTC 5BXFA 4HC1A 5JR1H 4PJBB 3V0VA 3C5JB 3ZDXF 2AJYH 4QHMB 3MRIB 3SJVB 3DYOA 5ACLA 1HH9B 2E7MA 2R69H 5D7KD 3FQRB 4GAYA 3D6GA 4XMLL 4X6DA 1VGEL 2BSRA 4LARL 1I8MA 2IQ9L 3ZHLA 3CXDL 3PL6B 1HOCA 1HHGA 4DUXA 3DMMD 4LEXH 1P1ZA 3BKML 3G04B 3QUYD 1RZJL 5D2LB 1UM5H 2WIMA 5IFHL 3BWAA 2FD6L 3G08B 3MLWH 3HI1B 1ZA3B 3QCVH 2XXMB 5DJYA 2H9GB 4BSWA 1F8TL 4O02H 4QRPD 5J6GB 5D7SH 3FB8A 4ORGB 4JFXB 2AJ3A 5F1IB 4HJJH 1EEYA 5DVOA 4U6HA 3G6DL 3RVWD 3C2AH 3EKCA 4W4OC 3QJFA 1PG7X 4D94A 3FT4B 5FCUH 3CSBA 3X12A 4CDHA 2OL3A 2R1XA 3V5HB 4HPYH 1JYNA 1TZIB 3VU2A 5IJKC 5BZWA 1A1MB 4AG4H 2V17L 1O0VA 1ZVHA 3HE7D 3E8UH 3MCLL 2DLTA 4WU5B 4XB7A 4U3HA 5T1LD 1U3HB 3DUUB 1GC1H 1ROWA 5CZVH 3VGFA 3OSKA 3KPMA 4W6WB 3ZDYF 1EUUA 2IPKA 1GGIH 5F3BA 3FZUC 1P5VA 4V1DB 3RNKA 2XKNA 3IXAB 4KRMB 4G6FD 5I30H 5BO1L 3MNWA 5KZCD 3O81A 2Q8AL 5DD1L 2XQBH 1Q1JL 1MHHA 2R23A 3EAKA 3QUKA 5GS1B 4OBSA 4WO4A 1S7XA 2IPUG 2AKRA 4NSKA 3AY4C 4Q0XH 3LKNB 4U1IB 3HI6L 1IBGL 3O4LA 5F89B 4PGJA 1MRCL 3H9SE 4XBPA 3W82A 3NH7L 3PWVB 3KPPB 4HBCH 5T33L 4J3SA 4L1HA 1CR9L 5JHDB 3BYYA 3RZCC 4ZQKB 1P9MC 3KXFA 2NY2C 1J18A 2V2WA 3L3HA 4L4TD 3HE6A 2VC2L 5L7XH 5IHUL 1IAIM 3QHFL 3E1F1 4YBHA 5DD5H 3T4AB 4F80A 2DKMA 1T7ZA 3CMOH 4WWKC 1RUKL 4HT1L 4HEME 4F7TA 1AE6H 4HV8B 1RFDH 4QXUL 3WNPA 4JR9H 3UTZA 2W91A 2MCPL 3IXTA 3CDYA 4NNYB 4ZOCA 5FYJL 4Z7OE 2CLRA 4C55A 2IAMB 3TBTB 2QKIA 4IS6B 5SWZE 1BVLB 3D3VD 1CGYA 3E6HA 2FHBA 1QQDB 3HZYB 3PL6D 4YPGA 3VFWB 1HSBB 1OB1A 2I07A 1X3DA 4LRNH 4LVEA 1PBYA 2X4QA 1RIHH 4JO4H 4ZS7L 1SEBB 2D7NA 3OB0H