1C8PA

Nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
102
structure length
102
Chain Sequence
MIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOKINE RECEPTOR COMMON BETA CHAIN
publication title The solution structure of the cytokine-binding domain of the common beta-chain of the receptors for granulocyte-macrophage colony-stimulating factor, interleukin-3 and interleukin-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 11
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1999-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c8pA00
4TUKL 1TCRA 1G7JB 2X4UA 4ODHL 3ILQC 2NZ9D 3GGWA 5BOPA 5IB1B 1MVUA 3MRIB 2FEDD 3I84A 2XWBB 5I1CH 1CG9A 1NGXA 2G60L 5DUBA 3P4OA 3TBTB 1BPVA 2ADGB 3QIWC 5HGBB 2R29H 1A6UH 1AIFB 1WZMA 4E5XB 3TLRA 4CN4A 4K7PL 5DHVA 1UQSA 4ODSH 3TT3H 3U7YH 3BKJL 1GOHA 4ZO6A 1OAZH 3DIFB 5DEGA 3SE4C 3V6OA 5T5NF 3O6FA 2V5YA 5BS0B 4XT1C 1TETL 2EEBA 4XCEB 3PGFH 5GHWH 1OGAE 2QADC 4YAQA 1B88A 3ROOA 43C9B 5KVEH 4X4ME 1NFIB 4TNVF 3LKOA 4DGVH 3DXAA 5JW5A 4NZRL 4HSQA 3E8UH 1G7LB 1I1AC 4B5EA 2ARWA 4X7TA 1XH3B 1YPZB 1ZA6A 2PO6C 3L1OH 4IIQA 3MREB 4XBGB 3D3VA 5FFLA 1YEHH 4FFWD 3U82B 3X17A 5KN5B 1P1ZB 1X5LA 3EFDH 3GRWH 2ITCA 2R0ZL 3NN8A 3KXFE 1VA9A 3O3EA 3VW3H 2WIMA 3HZMA 2OZ4A 5GRVL 4QOKB 1N3NB 3WNKA 5EORH 4JGUA 3WYRA 2KBGA 4GRWE 3VGHA 1I1YB 4PB0L 4UIMB 4WV1A 5DWUL 2C4FU 5ISZB 1HXMB 1CT8B 3K2UL 2Q6WB 1UACH 2WBKA 4WWKB 3DXAD 3M17B 1T21A 3BE1H 1AGEB 5GS0C 5CZVH 4Q9QL 4Y88A 2GT9B 3W0WA 1A0QH 4HC1H 3MGOB 3MV9E 2BOBA 2XZCL 3PWVA 1DBML 3BAEL 3NFSH 2XXMB 2VDKH 1MFEL 3QUXB 3D3VD 5I30H 1F5WA 1KTDB 2ESVA 2VLJA 2W0FB 2H9GB 5MENE 2G9HB 2UWEE 5E0QA 2VQ1B 4GMSH 4S2SA 3F58H 3OKLA 4XNXH 4FQLH 4LPCA 4RMTA 1NSNL 3O8XA 5E8OB 2GTZA 3QEUA 1IM9D 1ROWA 5HHMD 3D0LB 1NMCC 1JJUA 4GKNB 1HHJB 4QYOA 4OKDA 5FHBH 5C0CA 2FBOJ 5IROC 1P6FA 3W0WD 4N1CA 4R90H 5CJBA 4QRQA 3SKJL 5SX5H 4I3RL 5EOCL 5DFVD 3AY4C 2HTLC 2ESVD 2VLJD 3ARGA 4YHYC 5DRWA 1T5XB 1CQKA 1OD7A 4BZ2H 4MMZC 1CIDA 2AQ2A 3DMMA 5IIEB 3UO1H 4EJ1C 3VRLF 5D1ZB 3HNTH 3UBXI 4NQUA 3L9RA 3O8XD 4FQXC 3IETA 5C6TH 1K4DA 1PGRB 2AI0H 5FO7A 4XP9H 4Q2ZA 4P9HC 5D7JD 5LCVL 4LIQH 2ICEA 3QEQE 5F44A 1KV3A 4HPOL 5DK3A 4OGAC 2X7LB 5C0CD 3W2DL 1AQKH 1WUNT 3CVIH 3LAFA 1N59B 2F9BT 3WEXB 3D18B 1R0AH 4WTWA 3RWCA 1EPFA 4HKJA 4HWEL 4U05A 3ARGD 5TQ2L 1LGVA 3QP3A 3VXUA 1V3LA 4U1LA 4F3FA 4OI7A 3DMMD 4RGOH 3VFSB 5ITFB 4OZ4B 1ERNA 1F4AA 2YRPA 4OCWH 3VDBA 3T0EA 4OM1L 4YHPB 5EO9A 1L4IA 3K7UA 1T5WA 1U41A 3MV11 2VDML 1LO3L 3MLYL 4MD4B 1MCNA 1X7QA 1RHHA 4PS4L 2NY6B 5D7IE 5DK2B 2QTEA 1QLRB 1ZLSL 1G7IA 3OKDA 1Q9KB 3CDGB 1F02I 5F7EH 3S96A 3RL2B 1BOGB 2DQIH 3FQNA 4HWBL 1FNSH 3H9SA 3VXUD 2D7OA 2LAGB 5I1HH 2HTKD 32C2A 1F6AA 5T3ZE 3UTOA 1XT5A 1QACA 3GHEL 4ZUTB 3T0ED 3OXRA 3HI5H 4MXWH 4NQCE 1FBIH 5D7LB 1J88A 4POYA 4PJBB 1MREH 3L5IA 2A74B 3V0WL 1UWEL 2XNAA 4HPYL 3WSQL 4GQPH 3VDCA 1RUAL 4FXGA 1RULL 4X6CF 1UH2A 4WFHE 5DHVH 1YY8A 1EO5A 1Z5LA 4ZS6D 5I74B 4HIIB 2XTLA 3BPNB 4Q6IA 5D5MF 5D6DC 3O2WL 2APXA 3OBAA 3QDGB 3O0RH 3DURA 5I6XB 5F6IC 3O4LD 4LSPH 4HAFA 3CXDH 3NFPB 4L8DB 3CFKA 3FQTA 3HA0A 5EBMB 5D72H 1EA9C 4KQ4L 4JB9L 1RZJH 4KXZH 4Y4KD 3BRFA 4V1DA 1S7TA 4ZFOB 1KC5H 4R96A 5LWYH 1T89C 4G3YH 4YDVA 4OGXH 1YEDA 3S4SG 4YIQB 2QR0A 4EZMA 2HWZH 3ZKXB 2W9EL 4R7NB 3BGFB 1LP9F 4LVOB 1E4JA 4H26A 1TIUA 4DN3L 4JQIH 4WHTA 4ZUSB 3SOBL 1VFBB 5I2IB 2CLVA 1TVHB 4HQQH 4QRUA 2CIKB 2VDNL 1QKZL 5IQ7L 4IMKC 1MRDH 4PRHE 4OCMC 3U0TA 2BVOB 5IKCB 4XP1L 4L5FL 1P4LA 2G2RA 4LGPB 4PJAB 3BD3A 3MV01 4NQXA 5HTSA 5E00B 4JFXA 5J13C 5LXGH 2IBZY 3DRQA 5A2IH 1JUFA 1H5BB 3GSQB 3MZGB 2F74B 3BP7A 1TZHB 3F7VA 4YFLF 2F54B 1NFDA 1KN2L 1GVIA 2AJSH 1MHHB 3RA7H 4N5ED 2ZPKL 1NBVH 4YFLI 4QHNB 4YLQT 1RV6X 4HV8A 1DSFL 2A2QT 4K94H 1W0WB 1D5MB 2PYEA 4NKMB 4G9FB 4Y5VA 3QXDB 1L6ZA 4K3EH 1YN6A 3TPUA 1XGUB 1LK3H 1BM3H 5BZDB 3LZFL 1MNUL 4LRIA 3CUPA 1ZWIB 5GZND 2W92A 2K9UA 4WW2B 1BQHA 2Q87A 4E42B 5GRVK 5JLZA 2VTFA 1MLBB 3AMKA 4HK3J 1CU4L 5HHPB 3DI3B 1ITBB 1PSKL 4ZS7L 5C9KA 4WFHD 4DAGL 6FABH 1V3JA 2DQGL 4YGAB 2F8VA 5CBEB 3EZJB 3BKYH 3UCRA 1RU9H 5IJVA 3CSGA 4O4YL 4E0RA 4JFZL 2R4SH 4JHZA 4FFYH 1DP0A 5ICYA 2IADB 2PYED 4F7MB 2BY0A 4P5TC 2ILLA 1IGCL 1F4YH 2ZUUA 3UAJC 3HMXL 1C12A 3CH1A 1IL1A 1G9NC 4G8IA 3SKMA 1VPOL 2VLKB 1JPFA 4DQOL 4U0QB 2OL3A 4HS6B 3HNVL 4QHMB 4JDTL 3EHBC 2IANE 3TBVA 1JYNA 4LMQE 1K2DA 4RA3A 4U33A 4PTUA 5HHXH 3KPSB 3NABH 4PUBH 2CLRB 5T1MB 2OBGA 3WS3B 3BH9A 4J8RB 3EYOB 4PTTB 1YEJH 5ILTL 3G6DH 5FA4A 2Y07L 1QRNA 3N1QC 3LOWA 4L8CB 1FZMA 5IT2L 1NBZA 2D7MA 2EECA 4P49A 2YK1H 1ZEAL 1V8HA 3VFVA 4DGIL 3B9KD 2BY2A 5E7FA 2ZUXA 5F7YC 4M5ZL 5DC4B 1PVHA 2QHRH 3U7WL 3ET9F 3GSNL 5KJRH 5FA3A 1U2HA 3QNXA 5EB9A 1LEIB 1RI8A 3UZVB 1BJ1H 4U3HA 4RMSA 3GI9L 4DEPB 5ELIA 1S9WB 4GS7B 4NSKA 4PGDB 3D39E 5C09A 5EZJB 4XCNB 5IHZB 3CC5A 4F7CB 5HPMB 2J4WL 5KANG 4LCCC 4LHUA 3LDBB 1QRND 4I3SL 3OTTA 4WY7L 4Y89A 1XR8A 4JR9L 1VESA 5GXBB 2A73A 1W0VB 4U1MA 1A1MA 4RQQA 1RK0B 4ODTH 4YDKL 2IPTH 2Q7NA 4PJFF 1B4JH 1OL0A 5FO9A 2O5XH 2UZYB 5KAQF 4PJIE 4ZSOE 4R97C 5K93A 2CIIB 4GAGH 4XH2A 1NGZB 2BSSA 3QO1B 5LBSH 5AEAA 3WKNA 1UENA 1NEUA 1HHHA 3F7QA 1ADQA 2KZWA 5C09D 4FTVA 2P45B 3SE9L 4JFPA 2FIKA 5J06A 2B4CL 4OKVB 1I1FA 4GW4B 4NRYA 4P5KB 4P9MH 4XMKL 4U6YA 5D6CB 2BXYA 5INCB 5HD8C 1FFPA 4OFDA 1AXSB 2Y1VA 5HI5D 2V17L 2XZQH 3CNKA 2EDRA 1OAYH 5EOQL 4OUUA 5FM8A 4JKKA 1QEWA 1MPAH 4QY8B 3INUH 3T3MF 3VXSB 3DTXA 5EPMB 4K7FA 3WMSA 3QG7L 3ULVC 1TTUA 4JKPL 2EYTB 5TDNA 4BFIA 3B8YA 3PHOB 2NTFA 12E8H 2IAND 5C0GA 4PV9B 4HJJH 2NR6D 2HG5A 3QR2A 3RRQA 2BDNL 4WDIB 4Y5YC 4BJLA 4MCYA 3C6LC 4BKLB 3CIQA 4M1CC 4NO2A 1QR1B 2GJZB 2K7QA 5HYJB 3SGJC 3EYQC 3SEPA 4L1DA 2HA1A 4A6YB 3EIFA 3VD5A 3NCEB 4WHCA 2I5YL 1U8OA 3PP4L 4ZOBA 5D1XC 1PZ5B 1LO4L 4IBLT 1NUDA 2HT2C 4RBPK 4ZXBA 5T3XL 3KPRE 5IB3A 2OP4L 1JHLH 5FYKU 1HINL 4M48L 3OHXB 4BK5A 3MJ7B 4WO4B 5C0AA 3UC0L 2R1WB 4NUJB 3DYPA 4YHML 4R8WL 3V6FB 3CH8A 2D0GA 4TRPH 1JBJA 5CIPH 3O4OC 4AEIL 1HSBB 1R24A 1DEEA 1IEBA 1FZOA 3E2HC 5I8KL 1BMGA 3THML 4C58B 5IFHL 5K9QG 4LBEA 3RUGF 4EOWH 3GBNL 2AQ1A 4FFVD 3WN5B 3VWKC 5J6GA 5T1KA 4EIGB 3QQ4A 5DC0A 3LSOA 1U8LA 5HDQL 2VXUL 3U0PA 4KY1H 5CGTA 5DJZA 4ZXBD 2DDQH 3E6HB 1OTTC 2NY1D 4PP1D 4M6AA 1LEGA 3CFEA 3DX9B 2GUOB 3MA9L 4X6BB 1JYVA 1NMBL 1U3JA 1I3GH 4UIKL 2FWOA 4LSQL 3U2SB 4YZFF 1MJ8H 1I85C 3MJGX 1WEJL 2GSGA 2ICWB 3DYOA 3SPVA 1X5XA 3CPLB 4O2EB 5TH2B 3MACH 4JO2H 5I1EH 3MRGA 1TFHA 1N6VA 4KJYB 1FO0B 1I7UA 4AJ0A 4Y7MA 4PRNB 3TT1H 1CFVL 1I7TB 4J1UB 3K4ZA 1VGEL 3MMEA 5EOTB 2VXQL 2XI9A 5CJOH 3RTQA 1HHKA 3QQ3A 4XVUC 4HUUB 3QDHA 1S7SA 2W07A 1H8NA 3VXRA 5FUOH 5BV7B 5GS1B 1JN6B 2VOTA 2WBJD 1KB5L 4CU8A 4D9RD 1TQBB 1Q0YL 3T2PA 3MNWA 5F88A 4Z95H 2Z92B 4LSTH 4WENB 4QRPE 2NY2B 2FH6A 3UTZA 5GRJL 4EDWL 3GIZL 4XNQA 5I19H 1H3XA 4G6JL 1KT2A 5DYOB 2JCCE 4O2CB 4N5UA 2CXGA 1EHAA 1RJCA 4JPIB 3G08A 4MX7B 3RAJL 3C8DA 1INEH 3I3BA 3RTQD 5A2KH 5E5MB 5DK0A 2F5BH 3BI9X 2FZ3A 2XFXB 2ATKB 3B5HA 3ZYJA 3C8KB 4NNXA 3VXRD 4KRNA 3AAZA 3MJ8A 4I3GA 1A7NH 4KJWC 3RIAF 4GKSB 1MFBH 1JGEA 1S9XA 3EAKA 1PLGH 4PJDE 4OZIA 1VKXB 4I2XB 3NIFE 1Q8MA 5CP7B 2DQEL 4O5LL 1RVFH 5JXAH 3S3JA 4NBZB 2YD9A 2YSSB 4X9GA 1XGTA 3SDYL 3Q2CA 2ZUSA 2VDPH 1MFCH 5D2LF 3S36X 1NGQH 2LU7A 1I9IH 2IMMA 1FFQA 3RZCA 5L2KE 3VRJA 4XCCH 3HPLA 2XN9B 1G7MA 3QXUA 3CLEL 2A6DA 4APQC 3WXVH 1KG0B 1UFUA 1ZLVH 2HRPH 4J6RH 4NN5C 3VMNA 3V8OA 4R4FL 3IVKB 3EJYC 4JANA 1CD0A 5I73C 2IAMA 1CTOA 1ZT4A 4GXVH 2VH5L 4P59L 1RAMA 2E6JA 1QFWM 3LKPB 4G6FD 3VWJB 2Z93B 4LCWA 5DMGD 2H32A 4ZNCD 2K1MA 3OKOA 5E9DE 3VFUA 2DYPB 5CILL 1C1EH 5EU5A 2DBLH 4O58L 4XP6L 5AAWA 1RK1A 1U92A 1DDHA 1A7PH 1IBGL 1MCOL 5D71H 4GG6A 5FDYA 1U6AL 2DLGA 4Z0XA 5TDPA 3DO7B 1U3HA 5KS9E 4UU9B 1K5NB 3GK8H 4F2MA 3CCHA 3RWGB 4NZJA 3MUJA 1KPUA 4HZLB 3PGCA 3MLVH 4ZUVB 2A0LD 1A6ZA 5JPMA 3MLXL 4F9PA 4LCWD 4OD1L 3IDGB 1CFSA 2FL5A 2XTJC 3MX0A 4LSRL 1J1XL 4NDMA 3NIGE 1S7WA 4U49A 2J5LC 3ORJA 1FQ9C 2CKBB 4IRJA 2FGWL 3ARBA 2BJMH 4JHWL 4O2FA 3BN3B 2ZCKL 1GGIH 4U1IB 5H35B 1ND0A 4N8VG 1EFXB 5C07B 4F33A 3BFOA 2X70B 4KTEL 1CICB 1EK3A 4LF3A 1NC2B 4OB5H 4NWUL 1U3HD 4UV7L 1PG7W 1IC7H 2JTDA 4H1LA 4HGWA 2JLLA 1DVFD 4UTAH 4CVXA 2IC2A 1HQRA 4PJFB 1UM6H 1XGPB 3TBWA 1HWGB 1YY9C 4BH7A 1IMHC 2VR5A 4GRLA 1RY7B 1IARB 3SDAC 1WAAA 5D1QC 1NAML 4JDZA 2FECI 4XHQA 1AHWA 2FB4H 5E94B 3TBSA 5AWNL 4YFEA 1E27B 3MCLL 1A6WL 4JFHE 1NH6A 3DV4A 5DQDL 5DURB 4RGND 3TCLA 3GSVB 5DI8A 1FV1B 2FO4A 1HNFA 3P9LA 1DBBH 1PDKA 2DMCA 1JGVL 2PXYC 4RDQG 5I71C 1FJ1B 1RJYB 3MV8A 4P5MB 3WUWB 5D2NA 5GGRA 4XVTH 3RKDC 3HZYB 2V2TA 2H2PC 2NNAA 2HJKB 4D2NA 1ZV5A 5DJCA 3KLDA 4X5XB 3S36L 4IMLB 2R23A 5HGDB 3QCVH 3TIEB 2VXSL 2X4PB 4NZDA 5EC2A 3MUHL 4H5SB 4KK5C 2E8YA 3UPRA 1B0WA 1X5GA 5HYFA 3Q6GL 3HPJA 4KKBD 1MCPH 1ZVHA 5BS0E 2P1YA 1H8SA 4LEOA 1CE1L 3SKUD 4DFIA 2NZ9C 3BXNA 3VFMA 4KUCD 1NBQA 1MAJA 4XRCA 3HS0A 3RVUD 2R1YB 1FNAA 4GJTB 1AKJB 3V5HA 5C9JB 4OLZL 1E4WL 4JKMA 2ICWJ 3E1F1 1QSEA 3EYVB 2HFGL 4G6KH 4JG1L 1Y0LA 2VABB 4OT1H 3O41B 3SDDD 3O3DB 2Q86B 5T1LB 4M4PA 3QH3B 3C9NB 2QSCH 1BOYA 4UAOB 2H45A 3VFNA 2Y6SD 1GRWA 1XZ0A 4ZAKB 4OZGA 3P4NA 4QOKE 3A6BH 5DD1H 1G7PA 1OD9A 4NQVA 2P24A 3RUGB 1QSFB 1T22B 4FG6D 3HR5B 1KCVL 4QWWD 5B39A 2C1OA 4BQ8A 3TZVB 1A14L 5GPRA 3OF6A 5GSRA 2ITDB 5ISZE 2WNGA 1G1YA 1TLKA 2N56A 3H9HA 2IPKA 1I3RA 4I5BB 3EOBB 4P0DA 4YBLB 1QSED 4PGBB 1DJSA 4Y4FB 3MBEA 1D5XB 2VL5A 4H25B 3HUJF 4IOSD 3REVA 1B2WL 2V7NB 3E3QC 1JNNL 2NW3B 3LKNA 4GMTL 5E8EB 5CD5D 4G7YH 4FFWC 4ALAH 3TVMB 5J1SC 4WI6A 5L9DH 3DSFH 1FGNH 3V6OC 4OAWB 1MH5B 3IU3B 4Z7NE 4M8QA 1KTKE 4X9FA 4OCYH 3MPCA 1CFTB 4YJZL 3ARUA 3FQWB 4CADB 5J7CC 5C08A 3ZLQC 2FR4B 1RZJC 1IEAB 2H32H 3BYTA 5DJ8B 3WUZA 2AAVA 3MRCB 4NFCA 5HHOA 3MBED 4MA3A 2IALB 4NC2B 2AK4A 3OJMB 4UT6H 4H0IA 4IIQC 3VXPA 5KSVB 2Y9RT 3G6AB 3GNML 3QT2A 1OB1B 1T4KB 2L4OA 3WO4C 3FFCA 3BSZL 4HT1L 5CP3H 4JO1L 4KVCH 1QLEL 3PHQB 3KPPA 2ZZUT 4WV1C 4M7JL 4HWBA 4ODHH 5E2TH 1MCCA 5IV2A 2V7HA 5C08D 1ZS8B 4OFYA 2R8SL 1T3FB 2X4SB 3P9MA 5HHOD 2JK5B 1ZGLA 2G60H 3QUKA 2AK4D 1OM3L 3KLAB 3K8LA 3QIWB 1T1YB 5DFVC 3ES6B 5KSAA 4K7PH 1BD2A 4TVPE 5J4MA 3FFCD 4U1GC 1Y18A 2ATPB 5IR1A 4WUUB 4H1LH 2MHAB 5JIPA 3O8XC 2EYSA 4PP2B 3KR3L 1S9KC 1TETH 3P73A 3KS0H 5D7JC 4K94C 3FMGL 4W6YB 4OFYD 2LU4A 4KFZC 3IDJA 2UYLB 4NZRH 2UV3A 4N0UE 5FGCE 1I1AB 3VE0B 4Z7UA 4Y5XA 1UB5A 5D2LB 4D0DB 2I25N 3P4MB 3EW3B 3GMNB 3OKKA 3O3BA 3ARGC 1JHKL 4N0FA 2PO6B 4DW2L 1I4FB 3MRQB 1BD2D 3DMMC 2VAAA 2R0ZH 1JGDA 3L3DB 1F4XL 5F1NA 4QNPE 2ADJB 1U8IB 4JO4L 4Z78A 5D7LE 4PJBE 3ARVA 4YNYB 5DEFB 5DRXB 3AS0A 1VADA 1T66D 4PB0H 1MHCB 3W39B 1ZGLM 2QJDA 5DWUH 3AM8A 4QXTA 1WQVT 1YECL 5IMKB 1PY9A 4YHIB 3QWRD 1P84K 4KKLD 4Q9QH 2OCFD 2B1AL 2GEEA 2W60B 4X8JB 3U48A 3ARSA 3I2CH 1DUZA 3BAEH 3QDGE 4HIJB 1MFEH 3QZWA 1OARL 3GSRB 4LPTA 2HTKC 4W81A 4P3WA 1Q9LB 4ETQB 3T0EC 1XCTB 5FOBA 5ALCH 4LKXB 3KJ4C 5ADPL 1CLZL 2VITB 5EFIB 1NSNH 3IDIB 3VXTB 1A5FL 4EEEA 1JPTH 3T0WA 1CD1B 1NMCB 2H3NB 5EU6A 4ZS6C 1IAOB 1BREA 2RB8A 2Q3AA 1WVZA 2Z9TA 3CDFA 4RMWA 4PJEB 3SKJH 3B6SA 5EOCH 4YHYB 2FRGP 4JRXA 2P5WB 5FYLE 4NQEA 1X44A 1I1RA 2BVQA 1CFQB 1F8TL 2DJSA 3IKCB 1QFWI 1TPXC 4Y4KC 4HUNB 2A77L 3ULSB 1P7QD 3U46B 3IKKA 3W5MA 3PWJA 2Z8VC 3QUML 2BXZA 4PJ5E 2KZ1B 3VFWB 4P2RE 5EU6D 1ETZA 5DD6B 3W11D 3EGSB 5IQ9A 3RWEA 3J8F7 4HPOH 1UT9A 3C87A 3PIQB 3WL9B 4P57B 1KIQA 3BH8B 2F54E 5FECA 2D9QB 1JF6A 3KHQA 3DYMA 3MRHB 4H1LG 5B22A 2NY6D 3HMXA 4BQBA 4HWEH 4Z0BH 5TQ2H 4JRXD 1J18A 1CFNB 2MJWA 1ZVSA 5GS3A 4UNUA 3CFJA 1HHIA 4G9FE 1JHTB 3ULVF 4OM1H 4MXVF 1R6VA 4ODVL 4L4VA 3PABA 5CJXA 3MRDA 4BM7A 2XQYK 3I50L 3OAUL 5DJXB 4ZFGH 4UUJB 5DVLA 3IFPB 2X44D 4UB0H 4AMKH 1WCBA 2VDOL 5EU3B 5ADOH 1LO3H 2D0FA 1MCWM 2V9RA 3H42L 2R0WL 2DJ4A 1ZLSH 5DJYA 3BUYB 4N5EC 1D6EB 3ZKMD 2NCMA 4NQSB 3SHSA 3D85A 3NCYP 5A3ID 3WIHA 4HWBH 3ZE0F 1QFPA 3QFJE 2Y06L 3S37X 2JJTA 2VZ1A 2WZPD 3GHEH 4P3DA 3QG6B 4XZUA 1FCGA 4L4VD 1L7TL 3V0WH 2H26A 4HPYH 3WSQH 5GZNC 1AO7D 3GSNA 4UT9H 5MEPB 1ES0A 1RUAH 3TJEL 1MFNA 4OD3H 1RULH 1VACA 3U4EA 1DQLH 2VLKE 1ZT1A 5ESAA 4OD2A 3Q5OA 3ZHLA 3TO4A 1BIHA 1OGAA 3O2WH 1XF4B 4X4MA 3X14A 4C4KT 5H8DA 1LEKA 4C83B 2CDFA 4PJ8B 5SV3A 3KPSE 2VR4A 5TE7H 2XWTB 4WJ5A 5J9PB 1YA5A 4HUKB 5BRZA 4KQ4H 4JB9H 1I8KB 3LEVL 4MHHI 1JMXA 4U0RC 5FDWA 4LRIC 2DKSA 4RZCA 3MLPA 4OZHF 2EDWA 5I17B 2W65A 3SDXF 4Q74A 3U9UA 3O3AA 4C55A 5IVXA 1G6VK 1UH4A 2Z31A 3HUJB 4L29A 4XWGL 3DX7B 1OVZA 4MLSA 5HHQB 3TO4D 4DN3H 1UG9A 2VLMD 1YMMB 4MD0B 2ADIB 1CZ8L 3SOBH 4P46A 4QHKJ 4K71B 3VFPB 4LP5A 1KCSH 1QKZH 5BRZD 2L7JA 3EDKA 1GZQB 3S5LB 2A38A 5TQ0L 4XP1H 4LLUA 2F8OA 2DIAA 3GHBL 3CDCA 3EO0A 1BEYH 3GDBA 5TE6L 3BT2L 3AMLA 1MIEL 5J13B 4MD5B 2EDQA 3ARQA 4RMQA 5GSVB 1DLFH 3Q5YA 4WIQA 4G8EA 3B9KC 1A4KA 1A22B 4YDJB 1KN2H 1A6VL 3D48R 2ZPKH 4P46D 3VRLE 4OQTL 1KF9B 2MSPA 1F3RB 2LE9A 2IQAB 1QNZH 4PREB 4XPAL 1YN7B 1DSFH 5DO2D 5ICZA 3QJFB 3N50A 1CGYA 3B9EA 5AZ2H 4M1DH 3LZFH 4NN6C 1MNUH 3TN0A 1C7SA 4P99A 4LLVA 3LQZB 4NT6B 5E2JA 4Y8AA 1VDGA 1M71A 3PHSA 4X4XB 3MGTA 1MCEA 2DRUA 2C3VA 1PBYA 3IDXL 1DEDA 1VFOA 1AH1A 1CU4H 3BWAB 5JORB 4P2QB 4HWZB 4DAGH 2DQGH 4U6XA 3S37L 3NFNB 5EO0A 4MNGA 1KCLA 3VFTA 2BMKB 3KNBB 3QEQA 1HILB 3B9VA 4NCC2 4O4YH 5K9JL 4JFZH 3MFFA 5F7NC 1FL3B 4PJXB 4AL8H 5T3XD 2R1XA 1M7DA 3PL6A 4NRXA 2GJJA 4P5TB 3G04B 4GFTB 1IGCH 2RCSH 1XIWA 5HYJE 2WSKA 2ENSA 3TN0D 2AV1B 3FRPA 4LVNC 5IG7A 1CLOH 2EIZB 4L8SA 3VH8A 5LGJB 4BQCA 4JFED 4YXLL 1NDMA 1MLCA 1GIGH 1VPOH 3D25A 5HI5C 1S7VB 4KDWA 2DLFH 4DUVA 4XNUL 2EDBA 1OQOA 3N1PC 2NX5B 4L9LA 2MMXA 5DMKA 4DQOH 4PY7A 3HNVH 2X1QA 2FJHB 1S7RA 3SCMA 4ELMA 2O61A 2GTWA 3H3KA 4YHNB 2JF1A 3JWOC 5D7IA 4KVNL 4FQ2L 2NR6C 4N1EA 3IJSA 3PL6D 3CZJA 5HGAB 5EIIA 3GMMA 5GGTL 3ETBF 1XIWD 5C92A 2VDRL 1LO0L 5D5ME 3MR9A 2Y07H 3VG0L 3UTPD 4NQCA 1ZEAH 5BJTB 2OYPA 3GMRA 3DX6B 1OAXH 2XACC 4OTXL 3UTQA 4KU1A 4KKCC 3D0VB 3LKRB 3PWNA 1K4CB 3HZKA 3MOAL 3SCMD 3U7WH 3C6SA 4Y19A 1RJLB 3V0VA 5TDOA 2DOCA 5HVHC 4D9LL 1C08A 1LE9B 4M1GH 5ABDE 3GMOA 3R06A 4QF1B 3OJDA 4D9QE 4LCCB 2J4WH 4PRPA 3GKWL 1R5WA 2W1NA 4FFVC 3IFOA 3WBDA 1NANI 1W2KT 2YA1A 1GOGA 3RL1A 4I3SH 3TA3D 4WY7H 4JHBA 1U8KB 3MRRA 2Z35B 4JR9H 4ZXBC 4D8PB 5SX4H 3TIDA 4X98A 1B6UA 4ZODA 4J4PA 2NY1C 5C0JB 4PP1C 4O9HH 2CXKA 4YDKH 2ZG2A 1W8NA 4AH2A 3MLTB 3B9DA 1FL5B 4JREC 1R5VB 4Y19D 5I8CB 4HUXA 4R97B 5GGVY 3VXSD 2RGSA 3FB7A 5JA9A 4QRRB 3N1GC 1WWWX 2O26U 3MCKB 5E2VL 1X5IA 3N1FC 4POZD 3MXWL 3SE9H 5L8JB 4PRPD 5HVWA 2B4CH 1BFOB 1HOCB 4U1SA 2ARJA 5F9JA 4X5LA 4FFZL 5C0DA 2OR7A 3BWUC 3WLWD 2V17H 5HSFA 3STBA 5DJAA 5E8NB 4OI9A 5EOQH 1N5AB 3OGOE 4DK6A 1N2RB 1AGCA 1EEZB 3TO2A 3PDGA 4NO0B 5I66B 3QG7H 1F4HA 4JKPH 1JWMB 1IQWH 3B3IB 2OXGA 1BFSA 4LKCA 4WO4D 1TZIA 3HTLX 1ZT7A 1U8MA 1KPVA 2BDNH 2OJZL 4XC3L 4MS8D 4Y5YB 2WBJC 3C6LB 2SEBB 2M1KA 3EOAA 1J1PL 3PV6A 5GRWA 3ARFA 3I6LD 1MCHA 3SJVB 1O7VA 2WUCL 3FFDB 4DVRL 4F57H 5T33L 2J1KA 4I2XE 3U7AA 1NKRA 1LO4H 4L1HA 3DGGA 2IFFL 4RIRA 5T3XH 3V4VL 2OP4H 2GK2A 2N7BA 4M48H 3RTQC 4AT6B 4YO0B 4CVZB 5FM5M 3UC0H 1OAKL 1XEDA 3HE6A 4YHMH 4R8WH 5D9SA 3VXOA 5KSBB 1FL6B 3S34L 3O4OB 1HH9B 1GJIA 4U3CA 2XN9E 4LU5L 2DL2A 2BRRL 2DQTL 3THMH 1JPGA 1U8QB 2FLRT 2G75B 2W0PA 5TFSH 1T1XB 3GBNH 3Q3GA 1RQ5A 5MEQB 3VWKB 1UCBL 1MCIA 1P7KB 5SWQA 2YPLB 5MERB 3MOQA 5BO1H 3GBML 3RIFK 2YPVL 2AJ3B 3MLSL 5DR5H 5HDQH 1PEWA 1W72A 3L3KB 3VRIA 2HLAA 1K8IA 5HDBF 2LU3A 1H0DB 1NGWB 5A16B 2OQJB 1H8OA 3UJJL 3WD5L 5E6ZA 3WHE0 2VIRB 1OF2B 2R2BB 2Q76B 4PJGB 1NMBH 4JFFA 2IG2L 4UIKH 4LSQH 4OZHB 4RFOL 3NCYS 3SDXB 1NAMA 1A9BB 4ZPVA 5SWZA 4U3XA 3BJLA 3B8SA 3MRFA 3S35X 1VGKB 3NTCL 1IZKA 1OSZA 5F6HJ 4XMLH 1H3PL 3ZTNH 1A1OA 4HHAB 1WWCA 2CRMA 1CFVH 4ODWB 1MUJB 1UXWB 4EDXB 3T04D 5JQ6L 1VGEH 2BZDA 1NJ9A 5DMGC 3QIBA 3KLHC 4KRPB 3LKSA 5C6PB 1EHNA 4HX1A 2D7NA 1YMHA 2ZUTA 4JFFD 4PG9A 4ONHA 3RZCC 5H94B 4E41A 4Z7WA 1F3DH 2GJ6A 4HLJA 1J8HB 5C07E 1T7YA 4OLYL 2WINB 1OTSD 5SWZD 2EKJA 1KB5H 1CDJA 4PV8B 3VD3A 3PXHA 4KGLA 5CEYA 3WXWL 4UT7L 2CRYA 4O02H 3MRJA 5IB5A 2EH7L 3OX8B 4LCIL 3QXAB 1FC2D 5BVPL 4PJFE 4AEHH 1KNOB 2AXFA 4J3XA 2A0LC 3VA2C 4EDWH 3FB8B 4G6JH 4IRSA 3ARDA 4S1SL 3U36A 4BQ9A 3N9GH 3RAJH 3HAEA 1WK0A 5HGHB 4M6OH 1YJDL 2DD8L 5I15L 4ZMAT 1JZ2A 1JCKA 4LSSL 4E41D 4JZOB 4HUVB 2GJ6D 3KPNA 1LQSR 3RWHA 5DJ0B 1ZHNA 4EIZC 1KTLA 1FVEB 2P5EB 3GIVB 1U3HC 2DLEA 2DQFA 5EUKB 4RNRA 2D4DA 1DVFC 3VMPA 1A4JA 1BIIB 2WBWB 4MDJA 3T3ME 4OSUL 5LAXA 1CS6A 1UCTA 2DQEH 4JRWA 5F9AC 4F9PC 4IRSD 4YXKL 4Y1AB 3SO5A 5CD3B 1A1NA 2YZ1A 1T2QL 4RGNC 3V2AR 3UZQA 5F8RC 2ZOKA 5BZWB 4P23D 4Z76B 3RVTD 2VLLB 2YOCA 3KPTA 4R4ND 4XB8A 2DYPD 3CLEH 5IOPB 4ZUUA 4X8XA 2VKWA 4NKIL 3VCLA 4APQB 3M07A 1K6QL 2B39A 5CEXB 5IFJB 2FEEI 1FNEB 3IAPA 1RJZB 3FCTB 4R4FH 5E08L 3L3GA 5I73B 4JY4A 4GRLC 3ZDYF 1YUHA 4P59H 4OGYL 3RJDA 1KJ2L 3GSXA 1A6TB 1XF1A 4P4KA 1AHWC 1EGJL 1RURL 1EAPA 1FNGB 1CR9L 5A2LH 3WIFB 1KGCD 4KKBC 5IEHA 1PKQB 2Q8BH 3RUGE 1QSFE 5CILH 2BHYA 3S35L 3STZA 4O58H 4XP6H 4AIZB 2C7UB 3CSYB 5JW4Q 3H6JA 4EVNB 5E8PB 1Q94A 1IBGH 1MCOH 2UWEF 2VB5A 5IVZB 2APTA 4LK4A 1U6AH 5C07D 3RVUC 4LCUB 1CFBA 4HXAH 1QG3A 5D2NC 3MA7B 1KIRB 1HEZB 4DGYL 3T1WA 2VDQL 5ETUB 4FMFA 3T65A 3SDDC 2PYFA 4H20H 2RIKA 3OG4B 5IK3A 3MLXH 4P4KD 4OD1H 3WKML 1J1XH 1NUFA 3K8KA 5AZEL 4UINL 2Y6SC 4YZFE 5FK9A 2J5LB 2AEIT 4X6EB 4UDTA 5BV7H 1P4BH 1R3LA 4K3DL 2RFXA 4JDVA 4FG6C 4PBVC 1ZHBB 3GJEA 5HDLA 4QWWC 2CDGB 1P4IL 3BHBB 4KTEH 2PTUA 4QEGA 4UV7H 5AYUL 1OT1A 3QAZC 1DE4A 4PG2A 4NKDB 3EYFA 1TDQA 4U1KB 1EERB 5JOPD 2ZUVA 3EUUA 3NZHL 5MHSE 2AERT 2W9DL 4HK0B 2F15A 3SDAB 5CD5C 5D1QB 2E6PA 3CFCL 1NAMH 3FO9B 1UA6L 3MXVL 5CBAB 1OTUD 2XPGA 5AWNH 5DD0L 2H41A 1A6WH 3S4SB 4WCYH 5DQDH 2IQ9L 4DOHB 1I3UA 3L5JA 4EBQH 2NTSP 1NEZG 4HFWB 5I71B 4OLWL 3KPOA 1HCVA 1S7XA 3F7YB 3UTTB 3T08A 2O5ZL 3MBEC 2DQUL 3SBWA 2J2ZA 3T2QA 1NGYA 5JPNA 4NO3B 3P0GB 1IJ9A 2YPKB 1WV7T 3FQXB 4YHZL 1OHQA 4WFGE 2VXSH 3CZFA 2HN7B 3RNQA 5I8OH 3PUCA 1LE5B 4NJAL 4GAYA 4QRPA 1VFAA 4WUUE 4KAQL 1MJJB 5HHVH 3FQRA 2BVPA 3Q6GH 3KJ6L 3G9AB 2WWKT 2D31A 5ESQB 3Q1SL 4ZAKD 4JO3H 1CE1H 3I6GA 4LCYA 4BUHA 4C57C 3L3HB 2QHLA 4NQDE 2PETA 1A3LL 5CEZE 5IW3A 3AVEA 4MWFB 3BZFB 3TZVD 1E4WH 1L0QA 1F11A 1I7ZB 2HFGH 1RZ8B 4JG1H 4CW1A 5D2LE 1ZHKB 3O2DH 2WM0A 1BVKB 2HVJA 4I9WD 2YUVA 1DUYA 3H3PL 4CMMA 5HXMA 3VD9A 3NZ8A 1VEMA 2GITA 4OF8A 4GW5A 4KI5C 1TCRB 2X4UB 1KCVH 5DQJA 1J0HA 2YD8A 3GGWB 2EIBA 2FYYA 1JMZA 4MZ2A 1A14H 2JELL 1CG9B 1NGXB 3D9AL 3P4OB 4XPHL 4JPVL 3ZL4L 3EDFA 3MV7D 4X7EC 1A3RH 4K9EL 2HJLA 1B2WH 3QUMA 5KSAC 1JNNH 5DHVB 4GMTH 2CKBH 3FO1A 1UQSB 1P69B 1GYAA 3MLZL 4LDEB 5DEGB 2GIYA 3MRPA 1X4ZA 3SQOH 5GRZA 3O6FB 1REIA 3DETD 3HNSL 5CCKL 1VEOA 2DJUA 3M45A 4FQIL 3KPLA 4U31A 1T66C 4YAQB 3FAWA 3ROOB 4KPHL 5GGRY 4L8BB 2WUBL 2PTVA 3VD7A 5E9DA 4ZO9A 2HH0L 3LKOB 3DXAB 5JW5B 2P4AB 2AV7A 3VGGA 4Y5XC 4QXGL 1GGCL 3X13A 1WWAX 4PJEE 4X7TB 2Z91B 1ZA6B 4IIQB 5ICXA 3D3VB 3WFHA 3HC0A 3DVGA 3MLWL 2P5WE 2ITCB 3QIWD 3NN8B 1PQZA 3O3EB 3HZMB 4GSDL 3BSZH 1WFUA 3OPZL 2IGFL 4HKXA 1S7UA 2FD6L 4UI2A 5EU7C 4JO1H 3HC3L 3RWFA 1QLEH 1YDPA 3BP4A 3JV4A 1KPRA 1SEBA 4WV1B 5FCSH 1C5BL 4M7JH 1IM9B 4LP4A 1BFTA 3LY6A 3TYGH 3T8XB 2R8SH 3CAFA 2QL1A 3W0WB 2BOBB 5C2BL 3PWVB 1OM3H 5GRYA 2Y7QA 3AREA 2ESVB 2VLJB 1U2CA 1U8PA 4CJ0A 4DZBA 4OFPA 3T0AA 4U1GB 1Q1JL 1QUNA 4S2SB 2E8ZA 3OKLB 1X5AA 4JY6A 4OUOA 1P7HL 2I07B 4B7LA 3O8XB 4M7KH 1CDYA 1R3IL 4CMHC 5DRNA 2GTZB 3C60A 1SJVA 1HXYA 3QEUB 4Q97A 5D7JB 4AEFA 3K4AA 1QBML 4OZFA 3BPLC 1CF8L 3I75A 3W11C 5KSUA 4QYOB 3KG5A 1D5IH 5C0CB 2A9ML 1B0GA 4EN3A 1MCLA 1NGPH 4QRQB 2NY6C 4N90E 4PRBA 3ARGB 3RGVA 4NGHH 5EZOL 4Y2DA 4ZG1A 5HYSA 1XF5A 3L7EA 3DMMB 5L0QC 5ACZA 2DI9A 2M8XA 3L9RB 3FT3A 4JO4H 3PP3K 3IETB 5DHYA 1I7RA 1K4DB 5FO7B 1ZVYA 4Q2ZB 3EDEA 4OCSL 2ICEB 3DJ9A 1S5HA 2JIXA 1YECH 2D0HA 4LMQI 5FUZH 1KJVB 3T2OA 4EN3D 4XCEA 1ZANL 4PYHA 1T20A 2B1AH 3UXFA 4NOFA 3ZKMC 3NPSB 3RWCB 4HKJB 5JO5A 5K9OA 3RGVD 5A2FA 4Y2DD 5A3IC 1HHGA 4NFBA 3VXUB 4U1LB 2W59A 5EIVA 4F3FB 1OARH 2ZJSL 3HRZA 3NVQA 3T0EB 5I6XC 1XF2A 1JIBA 4XPFL 5CJXC 3I02A 1CLZH 1EJOL 3DLQR 5F7HA 1T5WB 5ADPH 4OQTA 6CGTA 4KC3B 4GQ9H 4PJCA 1MHPL 1NC4A 5IW1B 2JIXD 4Y16A 3HUJE 4XWOD 1F4WL 3F7RA 4PD4J 1TVDA 2NXYD 1G7IB 1MVFA 3U6RA 1YMME 3ZHDA 1EHLL 4LVOC 4YEEA 3CXHJ 3S96B 3DRTA 3FQNB 1HXMA 5C8JA 32C2B 1F6AB 3LRSA 2X42A 5JA8B 5H2BA 3M17A 3WUWG 1AGEA 1OPGL 2V2XA 1F8TH 3OXRB 1TPXB 4Y4KB 1M6OA 3GB7B 1YYLL 2A77H 3QHFH 1MWAL 2XNAB 1JPSL 4YDIL 2H9GA 3QCTL 1NC4D 3TJHD 5SWSA 4FXGB 1JTOA 2OTUA 3QUMH 2EH8L 3BIBX 1RIHH 4U6TA 1Z5LB 2NXZD 4LSDA 1QO3A 5IJKA 4LLYA 4Q6IB 3ECBA 3TO4C 3FB5A 2OSLB 2VZVA 4X7FC 2Z4QA 3DURB 3BDYH 1J0JA 1N26A 2JB5H 1J5OH 1BAFL 4G80A 5ALBL 4TUOA 4NO5A 5IVOA 4XTRD 3V52L 3DVIA 4V1DB 5EZLA 1S7TB 4R96B 4ODVH 3QDJA 4YDVB 1YEDB 2ORBL 3OAUH 4WFED 5SWSD 1T5XA 3WNNA 3I3DA 2QR0B 2Z31C 1CGSL 4B53A 3SQBA 3QI9A 1U93A 5D1ZA 4JLRA 2H1PH 4H26B 5GGTA 2R0WH 4WHTB 4CL7A 4MVBD 2JJSA 4Z77A 2B4CC 3C08L 1B90A 4ORGA 4P46C 1IEHA 4HS8L 2CLVB 4HF5L 4QRUB 4UILL 4UDUA 1QPXA 1CE6A 1JNLL 5DO2C 3AXLA 3U0TB 1N59A 3KHOA 4HMEA 4PJ8D 1ULVA 1P4LB 5F21B 2G2RB 1ZLWK 1AJ7L 1L7TH 3QDJD 4NQXB 2UZIL 2X6MA 2VSCA 3BKML 4JFXB 3HKFA 4PGCB 3DRQB 4POUB 3TJEH 1JUFB 3QI9D 3AU1A 3BP7B 1N6QL 3UYOD 5IEKA 4W68A 5T1DL 3F7VB 1NUNB 1NFDB 4RRPG 2NX5E 1UJ3A 3O9WD 4XP4L 2DQHL 4P3CL 2VZOA 1U8HA 1JFQL 2HP4A 1MJ7H 4OZFH 2KQNA 1SY6L 2GAZA 2PYEB 2CO7B 1FRGL 4Y5VB 2C3GA 4N0UA 5FGBC 2NPLX 1YN6B 3TPUB 2O93L 3LEVH 4U0RB 4X7SL 1EAJA 3TN0C 1BQHB 4XNMA 5JLZB 1EUUA 3KYKL 4XHJD 4KV5E 4K23H 4XWGH 4JAMA 5M7QA 1KULA 3RNKB 4QTHA 3H9ZA 4ZFFA 2VQTA 2AJUH 4JN2A 4URTB 4OBRA 4IEFB 1IC4L 1CZ8H 3SGEH 5IJVB 3WFBL 5F3HA 3G5YA 1BLNA 1KFAL 1WFOA 5ICYB 3L6FA 1J86A 2CD0A 3PL6C 2LTQC 3PNWA 1H3TA 2YXFA 4MJIA 1XIWC 5ERWB 1LO2L 5TQ0H 1UM4L 1C12B 3CH1B 3BT2H 1IL1B 5TE6H 1Z9MA 1F97A 4G8IB 5EBMA 5CEZL 2O5YL 3SKMB 1DQJA 3G5VA 1JPFB 4L9LC 2FJGA 2FGZA 2OL3B 4YIQA 3TBVB 1A6VH 3SCMC 3JTTA 4TOYH 1K2DB 4OQTH 4P2QD 2F19H 2PR4H 1BFVL 1ZA3A 1RSFA 4XPAH 4QRRE 3V7MA 2CJUL 5C71A 4MJID 2CGRL 1OY3B 3BH9B 2N7AA 4NN6B 1F90L 4XB7A 5E6IA 1EMTL 3DO3A 1DQDH 1UZ6F 1QRNB 2NYYC 2YC1A 3BRGC 1FZMB 5B4MD 1NBZB 3TA3C 1N5YL 4GG6F 1K3ZA 1CVRA 3ME0A 4HG4K 2HKFL 3IDXH 4WI4A 3VFVB 4OIBA 1NCWL 3CX5J 1FFNA 3S37H 4B50A 5GS2H 4PJ5A 3A6CH 4P2RA 3RU8L 5H37H 5FA3B 3ULVE 4PJDF 2F74A 5K9JH 3NIFF 1KELH 2F54A 1MI5A 1UWXH 4NSKB 3S3PA 5C09B 1MHHA 4KJPD 4JRYE 2RBLA 3CC5B 3OXSA 4POZC 4NBXB 4EKXA 2B20A 3MLUH 4LVNB 3SJVE 1DBAL 2V5SA 1T2JA 4JFYA 4MQ7A 1U0QA 3I6KA 2J88H 5B8CA 1XR8B 2EO1A 1BX2A 1MELA 3RY4A 3MZTA 1J8KA 3WLWC 4HGKC 4U1MB 1A1MB 4GLRI 4RQQB 3ZE0E 2FX9L 25C8L 4OZFG 4XNUH 1E4XI 3WV0A 3CFDA 3GO1L 4U1HA 1A02N 2X1OA 5FO9B 1IRAY 1X4XA 3U79A 3CFBA 4XH2B 1RIVL 5KSBE 2DI8A 1WFNA 4KVNH 4FQ2H 1HHHB 2VNCA 1OCWH 4M7LL 4MS8C 5GGTH 4JFPB 3VI4E 1OP3K 2OTWA 2R2HA 2E27L 1OAUL 1I1FB 2VDRH 2FECL 2GQHA 4NRYB 4P9HL 35C8H 1KIPA 1LO0H 5KG9A 3QFJA 4U6YB 1PW3A 3VG0H 1T7ZA 1FFPB 4KUCF 1J1OL 3HCVA 1KENL 2Q3ZA 5J6HA 1SBBA 1SJHA 4OUUB 3TV3L 1QEWB 1BJ1J 4OTXH 3DTXB 4K7FB 5KS9F 5F9OL 3VXQB 2NY4D 3MOAH 1MAKA 5TDNB 4BFIB 4R2GD 4RWYH 1I8MA 2EDYA 4L3EA 4D94A 2NTFB 3OR7B 2XA8L 5EC1A 5C0GB 5HVHB 4D9LH 2HG5B 4OZHE 1OAQL 1A7RL 1RUML 4MCYB 3SDXE 3T4YA 4R7DA 4NO2B 4MAYD 5FYJE 1DCLA 1S3KH 3ZKSD 1AGFA 1U8OB 5E5RB 1IC1A 4ZXBB 4TSCL 3QRGL 4H88L 5IB3B 3WS3A 1CGTA 2NY1B 3KWWA 1I9RL 4PTTA 2MKWA 5C0AB 1RZFL 4XBPA 4J3OC 4L3ED 1HN1A 4M00A 3CU7A 3IJYB 1R24B 1DEEB 2A9NL 2P43B 1J8HE 4OZGF 2LAAA 5E2VH 3ULUD 4LBEB 1YZZA 4P4RA 4RCAA 5BV7C 5IMMA 5J6GB 5T1KB 3L7FA 3QQ4B 3LSOB 1U8LB 3U0PB 1L9NA 3EYQD 5H37G 2D03H 3P11L 4G42A 5DJZB 1IAKA 1JPST 5HPMA 2EYRA 3FT2A 5D7KE 1UADC 5B21A 4PJ9A 3CFEB 1FLTX 1N0XH 5GZOD 4FOMA 1KTRL 2LABA 4XCFL 3VFOA 2FWOB 3D6GA 3UBXA 5JW4N 1RK0A 1KJ2A 1TZGL 1GCFA 2OJZH 4XC3H 1HKLL 3SPVB 1OTSC 2WBJB 2X9WA 3PQYE 1EGJA 1J1PH 2CPCA 3MC0A 3MRGB 4DWHA 3EYSH 5HGGS 2J12B 1I7UB 5T33H 4DVRH 4TPRL 1KBGL 1P2CA 2NLJA 4UNTA 5BMFL 2QKIA 2YPLD 4KKAD 4NC1C 5DVKA 2FJFB 2IFFH 2RJMA 4Y1AE 4PJ9D 2QLVB 3CMOH 3RTQB 1HHKB 5I1JL 3QQ3B 1BJMA 4C4KO 1OAKH 2FATL 5C1MB 5INCA 1OTTD 1S7SB 4WFFE 1GC1L 2V5MA 1I8IA 3S34H 3VXRB 1YPZF 5C0EA 1H3VA 4XXCA 4GG8A 2BRRH 2DQTH 1NLDL 3MNWB 5F88B 3NH7H 1RUPH 3R0MA 4CUCA 1UCBH 2DLIA 3ZSSA 4YBHA 3V5DA 5IMOB 5FYJD 3GBMH 1BECA 3UTZB 1S9VA 4WHYH 4W4OA 3MLSH 4XNQB 1LK2B 1Q0XL 4NYLA 5IMLA 5KVDL 1KT2B 4KK6D 4IRSC 3RIAK 3S5LG 5E4IA 3G08B 3KAAA 3M1BA 1T2XA 1YC7A 5FV1L 2B5IC 2IH3A 4G6ML 3UJJH 5DK0B 3RQ3A 1Q72H 2FZ3B 1PKQE 4KRPD 4P23C 2IG2H 3RVTC 1QFHA 4NNXB 5IBTL 4R4NC 2YMXL 3MJ8B 4MJ4A 4RFOH 1EBPA 4XVUD 5CKGA 1N7ML 3MJ7A 2YZ8A 1KN4L 2VE6A 3DGCR 3VXNA 1JGEB 1S9XB 4OZIB 1JF1A 4AEEA 1H3PH 5DJ6A 1YEIL 4X6CA 4AYFA 5IBUB 1C8PA 1XGTB 1NMAH 2XTJE 3BPOC 1WBYA 4TVSa 4OIAA 5D5MA 1R3HA 5D7KD 1SBSH 2E7LA 4JFDA 4IHOA 5BW7C 1UC6A 4ZPTA 3RZCB 3RGHA 1BJ8A 3VRJB 4AM0A 5DVOA 4IS6A 3HPLB 1G7MB 1A7QL 3LIZL 3ROLA 2A6DB 1JTPA 2DQDL 1AFVH 3FOLA 3G6JA 4X6BA 3P77A 3C2AL 3WXWH 4UT7H 4GBXA 1G9NL 5I0DA 1KCKA 5JIKA 2P5ED 4JANB 2EDOA 1J12A 2IAMB 5BVPH 1ZT4B 1CL7I 4KJWD 3QJHA 3O2VL 4P4KC 4LCWB 3FAXA 4O2EA 3MRLA 1JRHI 1LP9A 3CVHL 3ULUH 2H32B 5DA4A 2DQCH 4ONGL 2ZP0T 1YJDH 1G0XA 2DD8H 4JFDD 2F58H 1MRFL 1DQQB 4Y1AD 3VFUB 3IGAA 5EU5B 2IF7A 5ACLA 1RK1B 3DWTA 3OB0H 4LAQL 1Z6JT 4UQ2A 1U92B 4TUJB 1DDHB 4DOHE 1U42A 4GG6B 1QBAA 5KBNC 4Z0XB 5EU4A 5TDPB 1U3HB 4HUUA 3UTTE 3A0OA 4F2MB 3CCHB 1CN4A 3CGTA 1KPUB 3PGCB 3WIIL 5GS1A 3MGAA 4WU7A 1A6ZB 4CN6A 1TTGA 4LIQE 1CFSB 2FL5B 2F53A 2ICCA 2Z92A 4YXKH 1S7WB 1OTUC 1Q9OA 3BEVA 4UBDD 2A6KA 2NY5H 4IRJB 3ARBB 3NA4A 4RGNB 1ZSDB 1T2QH 3X3FL 1IC5L 3P30L 1ND0B 5FIEA 4F33B 4MAUL 4JPIA 4WHYG 4LF3B 4XX1G 3OAZK 4D0CA 4NKIH 2COQA 4H1LB 4HGWB 3PWLA 1K6QH 4CVXB 4QNPF 3GSUA 1HQRB 4PJBF 2A1WL 3TBWB 4GRLB 3BPCA 4CU7A 4OGYH 1KJ2H 4JDZB 2F53D 1AHWB 5MP6L 3TBSB 2IJ0C 1HI6A 3OV6A 1RURH 3A6OA 4KHXL 5MI0B 3GMQA 1CR9H 4WI7A 3DV4B 1ODAA 1FGVL 1EEYA 1OW0C 4LASL 4LSVL 3ESUF 5FYJH 5DI8B 4BUGA 3LN9A 4ZAKC 3S35H 3GJFK 3P9LB 3WFEL 3IDYC 2VUOA 4C56D 4U2YA 3WFDL 5D2NB 3TZVC 3SBWC 5GGRB 4DKEL 2V2TB 2OXHA 4WEBL 2NNAB 4DGYH 2YKLL 2UY7A 2VDQH 5DJCB 1RUQL 5F8QC 2XN9A 3SDDB 2R23B 2YN3A 3E3QE 3PP3H 5EC2B 4FA8A 1KG0A 1JI1A 2EE2A 3WKMH 5AZEH 4UINH 3UPRB 3HHRB 4XPBL 3ULVL 3HR6A 3HPJB 3V6OE 1CXHA 4K3DH 1QVOB 3LKPA 3VWJA 3LRGA 4LEOB 4DN4L 1IAII 5CLWA 2D7TL 5ID0A 3BXNB 2DTSA 3CJJA 1BZQK 5IESH 3IXAA 1P4IH 3LS5H 4XRCB 3HS0B 1Y6MR 5D8JL 1U8NA 3V5HB 4XPTL 1Y6KR 4HIXL 2CLZA 3DXAE 1QSEB 1J05A 4ZFZA 4PJAF 3UTTD 5ID1A 4U1JA 4OLVL 3BJ91 1FVDA 1CDBA 3WJLA 3D3VE 3ZE2F 2W9DH 3DO7A 1CWVA 3CFCH 3OL2A 3VFNB 2EE3A 3MXVH 4JCLA 1JZ7A 1XZ0B 4OZGB 4MA8L 3P4NB 5DD0H 3DETC 1G7PB 1IGFL 4HZLA 3K74B 4NQVB 1KLGA 4ELKA 3TH2T 1NCUA 4JFOA 4X7DC 5C0BD 5B39B 2FHCA 2C1OB 5I1LA 1MCRA 1EFQA 4GH7B 5HHME 2AW2A 5GSRB 4NUGH 2V9QA 2FX8L 3H9HB 2IPKB 1I3RB 4ZOEA 5DUPL 2O5ZH 3MBEB 3W0WE 2VL5B 3REVB 2KDGA 2Q8AH 3W9EA 4PRIA 4J12A 3LKNB 2D9CA 1CICA 5I1GL 2ESVE 2VLJE 4YHZH 1TNMA 4WW2F 2NY7L 1B4RA 3G5ZA 1M4KA 1T1WA 5M95B 4MCZA 4JPKL 4PJFA 4KAQH 5F96L 3DBXA 2YXMA 3KJ6H 4LPXA 4M8QB 4IJ3C 2DF3A 3Q1SH 4HIHA 3MRKA 2QQKL 5CGMA 1HKFA 5EDXA 3BZEB 1H9VA 4TSBL 1E27A 1L9MA 5C08B 3UBXG 4JQXA 1A3LH 1T1ZA 5C0CE 5TF1L 5HHOB 4OQ1A 4MA3B 3QPXL 1KLUB 2AK4B 1JYXA 4PRID 2FBJL 3IS0X 3VXPB 1RZKL 1CBVL 4S0TD 4YDLC 3PWPA 4P5MA 5IF0A 1CTNA 3H3PH 1IAMA 3FFCB 4EXKA 4R3SB 2BY1A 4ZNEA 1VFMA 3KPPB 2OJEB 4YFDB 5A43C 3B2VL 3O6FD 4NBYB 3T77A 2GSIA 5IV2B 2V7HB 4EQ2A 4DUWA 1ITCA 3ZDYE 5FV2A 2JELH 3P9MB 1M05A 5FHAL 1ZGLB 3D9AH 1D6VL 1MWAA 4JPVH 1XF3B 3OKEA 5E56A 2DMKA 4K9EH 4QGTA 1ZLWH 4AQ1B 5KSAB 3GMLA 1V7NL 1BD2B 5T5FL 3PWPD 3K0WA 3VXUE 5GGQH 2UUDK 5FYKL 1Y18B 5IR1B 3T0EE 4PGZA 4ETYA 3H0TA 3QEGL 2EYSB 3O41A 5DT1L 1MFDH 3HNSH 5CCKH 1ZMYA 3C60C 4FQIH 2L0DA 3P73B 5FF6A 4QRSA 4PPTA 2XY2A 2WUBH 2MPAL 3SGKA 3O3UN 4XBEL 2H8PA 3IDJB 2HH0H 4EN3C 2NY3D 2FO1A 4Z18A 3CFIC 4Y5XB 1UB5B 2CK0L 4ZUWA 1GGCH 3OKKB 3O3BB 3RGVC 4Y2DC 1U95A 3MLRL 2E7HA 4I4WA 4KROD 2VAAB 3O4LE 4KQ3H 1JGDB 3PG2A 4I5BA 3EOBA 5F1NB 2BVUA 1XGRA 4GSDH 2K3TA 4H25A 2IGFH 2FD6H 3FL7A 2R29L 4Z78B 1N8ZA 2FHBA 2I24N 5EG6C 5A2JH 4QGYA 4ORZC 1AGBA 4ODSL 3U7YL 1VADB 4R0LA 1MY7A 3I9GL 2HJFB 1C5BH 4PLOB 2K7PA 4QXTB 4PJHF 4XWOC 2EZ0D 5KVGL 5L6YL 5DVNA 2NXYC 5GHWL 1SHMA 3HI6H 4KMLB 2MFNA 7CGTA 2GK0A 3WLBA 3ARTA 2X4OA 4XC1H 3U1SL 3KS0J 1Q1JH 1BZ9A 5FOBB 4LQFL 1P7QB 1VFUA 1R3IH 4Z6AT 4CMHB 2MKLC 3TJHC 2VN7A 2C5DC 3GRWL 1U58A 2C3WA 5FB8A 3QNYA 2NY0D 2IFGA 3VW3L 2DN7A 5EU6B 3BPLB 4GAJL 3RPIA 1CF8H 1SY6A 3BGAA 1JWUB 2NXZC 4OCNC 2AKRA 1A2YB 4F7EA 2A6JA 3MTRA 2XT1B 1EZVY 3LN4A 4JRXB 4XCYA 1T3FA 3BE1L 5L0QB 1GSMA 1FYTA 1II4E 4XTRC 1YNTA 3QPQD 2NW2A 3QUYA 5CJQL 3NFSL 4FHBD 1C7TA 3PWJB 5F97E 3JWNC 1N64H 3RVXD 3RWEB 3P0VL 5IQ9B 4WUUA 1AQDA 4FZEL 2RR3A 1DFBL 5IJKC 4LLMA 1KIQB 3X11A 4PP2A 1NFDE 5FECB 4MVBC 4WUKL 5HVFB 1ZANH 5IHLB 3CLFL 4NQDA 2BNQA 1FH5L 5FHBL 1ZVSB 1PD6A 3CFJB 1FYTD 2ZJSH 2VZSA 1HYSD 2PYEE 3H9SD 4LGSB 4PJ8C 3QUYD 1Z9SA 4OFVA 4L4VB 2P47B 1R3KA 3PABB 3MRDB 1C5DA 1EJOH 3SY0A 1AO7B 3WDHA 4BZ2L 2DL9A 2FSEA 1MHPH 3QI9C 1WCBB 3HNTL 5EOCJ 2EO9A 1F4WH 4XNZC 3OAYK 1UGNA 5C6TL 2JJSC 2VZTA 5DJYB 3O9WC 4ZYKA 5CHNA 4MQSB 1EHLH 3D85B 2OZ4H 1OP3H 2DM2A 2BNQD 4I0PA 5JQHC 1AQKL 3NMEA 5DMJB 4NN7C 3MUY1 2LV4A 4I48A 1OPGH 4K71C 3C5ZA 4L4TA 5CJ8A 4P3DB 2W60A 4XZUB 1R0AL 1JZ3A 1UKTA 5CFHA 3TESA 1CGXA 1YYMH 1YYLH 3FONA 2H26B 1JPSH 4YDIH 1EVUA 3GSNB 5J3HD 3QCTH 4V1DD 4Q6YA 5KVFL 5DJ2B 1VACB 3U4EB 2EH8H 2APFA 3OSKA 4OM0H 1ZT1B 4XHJC 4OD2B 2Y4SA 2EDFA 3K4DA 3TO4B 1SVCP 1UJ3C 3VXTA 5F1IA 3X14B 4I0PD 1LEKB 2CDFB 4CDHA 4HS3A 2W0LA 4WJ5B 1BAFH 3DHMA 5ALBH 5BRZB 3C5ZD 4L4TD 1JNHB 5BVJA 4NOBA 3V5KA 4NC0B 3V52H 2X89A 5FDWB 2DQIL 4M3JA 3JV6A 2CKNA 5CZXD 3AY4A 4RZCB 4OLXL 2VO5A 3U9UB 1QRNE 1F2XK 3O3AB 4X4ZA 5IVXB 2Z31B 1CFQA 4L29B 1CGSH 3KPMA 3BQUA 2BNRA 3HI5L 4MXWL 5FEBA 4Z7QF 4GRWB 4FQXA 3BP6B 2W38A 4N8PA 4OF6A 1A64A 2VXVL 3ILPB 4P46B 4HS8H 1HZHH 3JUZA 2A6IA 4HF5H 3VXMA 1FE8H 4Z7VF 3FHAA 4UILH 5C09E 3IFLH 1IGML 5DTFA 4LLUB 3F62A 1DL7L 3EO0B 3CMGA 3O11A 3P9WB 1AJ7H 4ODUA 3EJJX 4K2UL 2BFVH 3BKMH 4LSPL 1CFNA 3CXDL 3KYOA 3W9DB 5KAQG 5B4MC 5D72L 3BQUD 2BNRD 4JG0H 5CWSA 1RZJL 5IB2B 4G8EB 2GCYA 3DARA 4W6WB 1KC5L 5JXEA 1A4KB 5T1DH 2MTPA 4LLDB 4N68A 4OGXL 4XP4H 4P3CH 4BSJA 5TE4L 2F5AH 1JFQH 3KLSA 4F7TA 4JQIL 3B83A 5I1IL 1SY6H 1FRGH 3BUYA 4KJPC 1D6EA 3LVEA 3GJFA 5F7UA 3GSOA 4X7SH 4HQQL 3TN0B 4LLVB 3C5SA 5F7DB 1M71B 3SN6N 3HRPA 4JFEB 1EJ6A 3MGTB 5I76A 1EXUA 2C3VB 4M62L 2EE6A 2P49B 5JXED 3WIHL 3KYNA 2Z8WC 4U6XB 5LXGL 5MEOA 3GZKA 1RZ7H 4MNQA 4MNGB 3VFTB 4FMKA 1IC4H 4OV5A 5JW4M 3WFBH 3MFFB 3TF7C 3UX9B 2AJSL 2R1XB 1M7DB 3PL6B 4NRXB 2LTQB 2R2CA 4MNHA 5D6DA 1XF4A 4HBCL 5FUCC 3MRMA 1XIWB 1LO2H 1JI2A 1UM4H 5EUOF 5IG7B 4L8SB 3VH8B 1E0OB 1T03L 1NDMB 1AR2A 1MLCB 3MUGA 4W6XB 3SKOA 1UWGL 3D25B 4K3EL 2BOCB 4L9LB 3IJHA 2HFFA 4WHDA 5DMKB 4PY7B 4MNQD 4S1QL 4Y4HA 5F7KC 1S7RB 1YNKL 3SCMB 2NY4C 4ELMB 1T0NA 5CSZA 2O61B 4M61B 2GTWB 4R2GC 3DX7A 1RZIA 1BFVH 5D7IB 5DD3L 4G9DA 2FEEL 5JMOC 3BP5A 5EIIB 4X4YA 3GMMB 4FQJL 2I60L 4MAYC 2ADIA 4PJHB 3RWJA 1FAIL 1KCRL 5FYJU 1OGTA 4IOFD 4LGRB 1F90H 2YD4A 3MR9B 3BVNA 4LHUD 3TA3B 1N5YH 5K9KA 4NQCB 3QEHA 1F4YL 1KOAA 3GMRB 1N4XL 1KB5B 3RKPA 3UTQB 1MAML 1NCWH 3P4LA 5C0RL 1U3YA 4Y4HD 1G6RL 3PWNB 3HZVA 4L3CA 4QHLA 1HQ4A 5JNYA 4Y19B 3JTSA 3RU8H 3VI3F 3V0VB 1B6DA 5TDOB 3P0YH 3OR6A 1C08B 4M9OA 1YEFL 3GMOB 4YX2L 5JHDA 3R06B 4PB9L 3ULUC 3OJDB 3AB0C 4FQQA 3PE9A 4D9RE 4ENED 1R5IA 1YJDC 4PRPB 5HHXL 4KDTC 4OV6F 1R5WB 2JB6A 3IFOB 4FTVD 3IDNB 5JDSA 3L5HA 1DBAH 4YE4L 4BH8A 1CK0L 5SX5K 1XR9A 1S9YA 2Y36H 3TIDB 4X98B 1IGJA 4XAWL 2Y5TA 2FX9H 25C8H 4M5YL 3GO1H 4AH2B 5GZOC 1HDMA 1XAUA 4R4BA 4HUXB 3QA3A 1HSAA 3UTSA 4KKCD 3Q48A 4OJFL 1NEZB 4KJQD 2ZUYA 5DZLA 3VXRE 1C5CL 5JHDD 3QO0A 4M7LH 1WBZA 2QHRL 2VWEC 2NY5C 2DKMA 2D7PA 3C09C 3JWDH 1ED3B 4U1SB 2CR3A 2ARJB 4M93C 5F9JB 5TGBA 4TQEH 3MRNA 3MRBA 5C0DB 3IDMA 2G5BB 4KKAC 3WNOA 5DJAB 4MDIA 3IS1X 4PJ9C 1FCCA 3LMJL 3TV3H 4AY0A 1AGCB 3TO2B 4ZO7A 1AGDA 3OAZH 3MYZA 1FZKA 3UTSD 4LKCB 5C0AD 1TZIB 1MEXL 1S7VA 5GGVH 1ZT7B 5HDOA 2XA8H 1U8MB 3HI1A 4GKOA 5JW4R 4YHKL 4ODTL 2B2XL 5IM7A 1OAQH 4P2CG 4P2OA 3PV6B 3EOAB 2OI9C 3CVHA 3ARFB 5C86A 4GAGL 4YHNA 1GHFH 3LH2L 2OL3H 3BMVA 4JM2A 4U4BA 1FG2A 3LN5B 5T1KD 1GGYA 4KK6C 3DGGB 4KH2A 4RIRB 3QRGH 4N0YL 4H88H 3F5WA 4P9ML 4Z9KB 1I9RH 2DAVA 1RZFH 3KPQA 4YR6A 3FQUB 4KK9D 5ACMA 3HE6B 2EE9A 1ZLUK 2AXGA 5D9SB 3WHXA 3VXOB 4KRPC 4XAKD 4X99A 3DX6A 3TPKA 2A9NH 4XXCC 3INUL 4P2OD 5IVNA 5T3ZL 3LKRA 4F9LC 3QUZA 1GH7A 3Q3GB 1UXSA 2HT4C 2ZNXA 3QQ9C 5SWQB 1LE9A 3H3BC 4JM2D 4W4OC 2V5RA 4BZ1L 2I27N 3VRIB 3P11H 3CDYA 3FN0L 1GL4B 4NHUA 4YXHH 3ZT6A 3HC4H 4LCWE 3NPZB 2ADFL 1IKFL 2KQMA 1QHPA 2PW2A 4JFFB 1NKOA 1Z0NA 2Z35A 3BZ4A 5F3BB 4JEGB 5KTEL 4QHKI 2AJYL 1K85A 1NAMB 1TZGH 1UZ6E 3WNMA 4WU5A 4S1RL 4ZPVB 3QUZD 2QSQA 5SWZB 1HKLH 4GG6E 4HAGA 1TJHL 1PEZA 4K3JL 3FB6A 1OSZB 4NM8L 4LNRB 3GM0A 1A1OB 3UDWA 1D5ZA 5DA0B 3MCKA 1DBKL 4F80A 4EOWL 5BMFH 2MCPH 3HG1A 4Z7VB 1NJ9B 1DZBA 2WW8A 3LEXA 1HOCA 3JWOH 3LKSB 4HJGA 2E7LC 4HX1B 4PGEA 1ADQH 1YMHB 1BQHG 3E6FA 1MIML 1Z9OA 1MCFA 4KY1L 4I0CC 4UOW0 4RGNE 4PG9B 1GC1H 1DQML 4E41B 4Z7WB 2GJ6B 4GRMA 3UROR 1GPOL 3T0VA 5CEYB 1I3GL 4DVBA 1V05A 4GBXC 5IB5B 1FFOA 1H3WM 1G9ML 1MQKH 2AXFB 5HYEA 2WQ8A 4JRYA 1J7VR 1Q0XH 4YGVA 5FCUL 4IRSB 5KVDH 1WAAE 3U36B 4JO2L 4KRLB 3HG1D 3SGJA 3SE3C 3HAEB 5KOVC 5IB4A 4UBDC 2CDEA 2HYMA 2B5IB 3QDAA 4G6MH 3TFKD 5D1XA 1A7OH 3KLHD 4P23B 4J7RA 3KPNB 5JR1L 5IBTH 2YMXH 3RWHB 1ZHNB 2X4TA 4EI6B 7FABH 3GSWA 3RZCD 1GAFL 1ACYL 3DROA 1LO5A 4F7PB 2DQFB 1BQLL 4RNRB 1KN4H 5DRZA 5D2NE 1FL6A 4DTGL 2WLZA 5FUOL 3GI8H 5LAXB 5DFWH 1YEIH 1S78D 4MA1C 1A7BA 2J8UA 1BVLA 2IAMD 2G75A 4LSTL 3BPOB 1F3DJ 3CX5K 1KUMA 4FQ1H 1DBJL 1KXVC 1FYHB 3IFNL 5I19L 2ZOKB 5FKPA 4KZEL 2ERJC 2DM4A 4K9EC 4PJEF 5EUOB 2VLRA 1INEL 4YPGA 4JN1L 1A7QH 2ZSWA 4ZUUB 3VCLB 2DQDH 1GGBL 1KYOK 1W72L 4XGZB 1OF2A 3TYFA 4U2ZA 4JZNA 1QSEE 3L3GB 4JY4B 5F70A 3QDMA 1YUHB 4KUZL 3O2VH 1FC1A 3GSXB 3IXTA 3LPGA 4P4KB 4LHUG 1PJ9A 4HH9A 4ONGH 2YUXA 3I3EA 4OZGE 3EJZD 5IEHB 1RVFL 1FIGL 3P2TA 1WIPA 1MUJA 2BCKA 3DNKA 4LLQA 4IRJD 3ARBD 1WBXB 1QA9A 1Q94B 5JOFB 2DBJA 1VSCA 4HKZA 4FRWA 2Q1EA 1WJ3A 4WGVB 3QDMD 3WIIH 2PYFB 3WXVL 2WINA 4XVSL 1F42A 4MQTB 4GRLD 3LD8C 3QFDA 2B7DT 5FK9B 4ODXA 3OX8A 1Q9WA 4UDTB 1R3LB 2RFXB 4JDVB 3X3FH 5CJ5A 4NM4L 3GJEB 2EXWD 4LOUD 4DUXA 5B38A 5C3LD 4MAUH 2HAZA 5C08E 2EDDA 5L7XL 1DE4B 4PY8J 3EYFB 4S1DD 5AAMA 4ZTOH 4K3HA 5HHOE 1T0MA 1DANT 2A1WH 3MV8D 2AK4E 4IM8A 3PQYA 4HFUL 1QFWH 1N0LA 3WJLC 5JMRA 3GIVA 3HMWH 4OFIA 5GISL 2Y25A 2XPGB 3MO1A 4G5ZL 4G8GA 4MSWA 5MP6H 4NHCL 3BO8A 3FFCE 4Q7DA 4PLNC 1BIIA 1YPZE 5FGRA 3MLVL 1FORL 1ZHLA 1FGVH 3MYJB 4LSVH 3IU4L 3BRDA 4KI5E 4AIXA 4JKLA 2Y23A 3WFEH 5CD3A 4TSAL 4UOJA 1IE5A 3IDYB 5FYKD 5GIRB 3D2UA 3KPOB 2I9LA 1S7XB 5I75C 1GGIL 2G5RA 3WFDH 5BZWA 5JPNB 1NGYB 4DKEH 3T09A 4WEBH 4I8DA 2QSTA 1U8JA 2YKLH 1RUQH 1JWSA 4RFEA 4OB5L 4JFQA 3CZFB 1BD2E 3ZMRA 4G8GD 3RNQB 4YHLH 1P84J 5CEXA 5JHLH 1QP1A 2R0LL 3FCTA 4GAYB 4XPBH 3PDDA 5TPWL 3FQRB 2BVPB 1P5UA 4MJ5A 2D31B 1LVEA 2M26A 4F37F 4DN4H 3I6GB 3O6FC 4LCYB 1TMCB 2D7TH 2Y5EA 1OLLA 3D2UD 2HMID 4JQXC 2UZXB 1WICA 5D8JH 15C8L 4XPTH 3X12A 5LJYH 2I9TA 1E6OL 4HIXH 1F11B 3OF6D 5LQBL 2QEJA 2YD3A 3MV7B 4CW1B 1DBBL 3GRWA 2HVJB 1MQ8A 1DUYB 1ORSA 5BXFA 4CMMB 1KEGH 1W0YT 3L3IA 3NZ8B 4ZQKB 3NIDF 1FN4A 2GITB 4MA8H 4H0GA 2FHFA 5EU7E 1IGFH 1LDPL 2YD1A 4GW5B 1L7IH 2VXTH 4MQXD 3K2MC 3RI5K 2FYYB 2YUZA 2ZSVA 4CNIA 4TUKH 3WDIA 5HYQA 1MCPL 4HC1A 5I1DA 4WTXA 2NY3C 4DFHA 1ZHBA 5DUPH 4ISVA 4CVUA 2HJLB 3QUMB 2CDGA 5F6HI 3FO1B 1RHFA 5I1GH 4KROC 4PRDA 2NY7H 3R8BB 3EFFA 3MRPB 4JPKH 4MMXC 1EZVX 3RP1A 1BHGA 5F96H 3BKJH 3JSSA 3BEWA 3KPLB 1I3VA 4IJ3B 1I1CA 4RX4A 3FO9A 1FSKC 3JZ7A 1RMFL 2QQKH 5D96B 2FCBA 3GMPA 1C16A 4KI5D 3C5JA 5EU6E 5IW6A 3SGKC 2EZ0C 3L5XL 4MB4A 4PJXF 3S4SA 4UQ3B 2AV7B 4XPGL 5TF1H 1QQDA 3X13B 4YPJA 3QPXH 4EI5A 1JE6A 4PIRF 3WFHB 3DVGB 4LSUL 2E9JA 1RZKH 2PXYA 4JRXE 1G1CA 4YDLB 2CRIA 5DMIL 1S8DA 4X80L 5KSAD 1B3JA 1S7UB 4HKXB 2XKSA 1T6WA 2C3XA 4FS0A 5ANMB 3RWFB 1PG7X 2PNDA 1YDPB 3F7PC 1CVSC 3BP4B 3LV3A 3JV4B 2XXCB 3PJSA 1ORQA 1SYVA 4PJ7F 5IBUG 4R0LC 1KPRB 1SEBB 3B2VH 2NY0C 4NNPL 1XCQB 1KACB 2WAHA 1LE5A 4BZYA 1MCWW 3VG9C 3FOMA 2FNBA 3EYUL 4GKZA 3VDAA 1F6LL 5FHAH 1JGUL 1D6VH 2XWJA 4OCYL 1X5ZA 4EI5D 4NKOA 1X9QA 3VFRA 3K2UH 3AREB 3L3HA 4GXUN 3SGDI 2DKUA 3EBAA 1U8PB 4FQHA 3DUSA 3OB8A 4JQVA 3L5WA 1V7NH 4PLJD 5T5FH 3NPSC 4DZBB 2XZCH 2HFTA 3NCMA 4KV5F 1DBMH 5FYKH 2R69L 1BBDL 2IH1A 3QPQC 3BN9D 1I7ZA 4JY6B 1OT2A 3L95A 1T80A 4UT6L 3QEGH 4L4VE 5DRNB 5DT1H 3C60B 4OLEA 1HXYB 2YUWA 3BMWA 1AO7E 3RVXC 4WI8A 5JOEA 4OZFB 3I75B 3SDCA 4J3SA 4Q9CA 5EBLA 5KSUB 2EDLA 2MPAH 4J3VA 1B0GB 4QT5A 4XBEH 1PAMA 3VJ6B 4EN3B 2P48B 1O7SA 1NFKA 5E2TL 2CK0H 1KB9K 3RY6A 4PRBB 3RGVB 4OI8A 2CO6B 4Y2DB 2BC4A 5HYSB 2V6HA 1XF5B 3L7EB 3TNMA 3MLRH 4IDJL 4I3RH 5ACZB 1HYSC 3QUYC 3FT3B 1YNLL 4XNYL 5DHYB 1I7RB 3ZTJH 1FVCA 1IQDA 1ZLVK 1E4XL 4NNYA 1CDUA 4X7CC 3SDCD 3I9GH 1S5HB 2JIXB 3SKNA 4PJAE 3V4PL 4AENA 4MHHG 2PW1A 2Y72A 5KVGH 5IWLA 3R0NA 5L6YH 1AD0A 3ZE2E 2NXYB 5LCVH 4X6DF 3F12A 1X5FA 2VLME 1T20B 3H7BB 5DGRA 4MXQD 2E9BA 5JO5B 4TNWF 5K9OB 4Q6IC 3HB3D 4L8BA 1JP5A 3W2DH 3D5OF 1HHGB 1IFHL 3U1SH 2ARJQ 3HRZB 5BRZE 1XF2B 4M3KB 5CSBA 4M6NL 1RZGA 4NQED 5F9DC 2P8PA 2Z91A 2XZAL 3I02B 4LQFH 1IT9L 4X0KA 5J3HC 4PJCB 1NC4B 3MBXL 3ZE1F 4Y16B 2X9XA 5IVXE 4GW1A 3ULUF 1JV5A 4Y8DC 2E7CA 4GAJH 1WC7A 3KVQA 2NXZB 2YR3A 3U6RB 2VDMH 3MLYH 1YC8A 4PS4H 5EBWA 1IM9A 5AG9A 1HK6A 3DRTB 1ZKAA 4I0PC 5C8JB 1PG7L 2MQ3A 5HI4D 3ZDXE 3LRSB 5H2BB 3T8XA 2AQ3A 4IDLA 1NANH 2V2XB 3C5ZC 3I2CL 1M6OB 4PRAA 5CJQH 5TF0A 5CZXC 1ONQA 5SWSB 2OTUB 5J1TC 5KSBF 1UWEH 3P0VH 1MF2L 5ALCL 3V7AG 5B38G 5J0BA 4FZEH 4YWGL 1DFBH 1QO3B 2I07A 4LLYB 3ECBB 2V2WA 3FB5B 3VI4F 4WUKH 2IBGA 1D5BB 2P7TB 3QULA 1JPTL 4DZ8A 5IGXL 5D7JA 5E1AA 2Z4QB 3CLFH 3MROA 4F8QA 4D3CL 4X6FA 1FH5H 4G80B 3D85D 4TUOB 2EDXA 4NO5B 1JZ4A 5T3XE 2VN4A 3LPWA 5EZLB 2W0KA 1PYWA 3NCBB 1EO8L 2E7MA 3VD4A 3QDJB 4Y5VC 2VQUA 1JK8A 5F9WC 4RBPH 4PJGF 4JFEE 3QI9B 3BQUC 1U93B 1BWWA 4JLRB 2YS4A 3LCYA 5INDB 4XNZB 3KXFA 1NLBL 4Z77B 2EDNA 3JWDC 3O9WB 2QSVA 2W9EH 4XI5D 3GUTA 1EBAA 4ZO8A 4ORGB 4MNGE 5B39G 3T4AA 2YBRA 3QBTB 3ZTJG 1W8OA 4YHOL 1OGAD 3MCG1 4UDUB 2IEPA 4M43L 1CE6B 5CMAA 1KJVA 4NN7B 3AXLB 5F89A 4M7ZC 2XQBL 1DLHA 4HUWB 1KIUA 1NL0L 2VDNH 1G6RA 4Z0BL 1OQXA 5IQ7H 4N9OB 5DF0A 1SJEA 3DECA 3MV9A 3QNZA 4N1HB 5DEZA 1MY5A 5KVFH 2OR9L 4L5FH 2PTTA 3UTPE 2WQRA 3AU1B 5MENA 5L2JA 2ZWLT 3QXWA 5IEKB 5JXEC 3RHWF 2UWEA 3KXFD 3KYMA 2Z31D 1UJ3B 3OKMA 4KZDL 4ZFGL 3ALXA 3AROA 3BIAX 3FTGA 4KKNA 4KTDL 4UB0L 4AMKL 5IW1A 4XMPL 1U8HB 5ADOL 4ELME 1D3CA 5IP4A 4N8CL 3BW9A 5IUSA 1FDLL 5IHBA 4JJ5A 2GAZB 5ESVA 9CGTA 4N0UB 5FGCB 4P2YA 1JNJA 4ZDHA 4PJHE 1CLYL 1G7QB 3MV9D 2H6PB 1AP2A 4OLXH 3O4LA 4XNMB 5MEND 1ZLUH 1TVBA 4JAMB 4Y4KA 2X4QA 3GB7A 2VYRE 4QTHB 3TBYA 2VISA 4ZFFB 5CS7A 4FXLA 4FN0A 1PKOA 4UT9L 4JN2B 4RAVA 4OD3L 2XG4A 4G43A 2WMPA 2VXVH 5F3HB 1PSKH 4ZS7H 1DQLL 3G5YB 3PWUA 4Y19E 1BLNB 1BZ7A 3LS4L 3VXSE 1G84A 3L6FB 5F7MC 5ENWA 2OSLA 3PNWB 1XGQA 3ZYIA 3BGMA 1KCUL 4MJIB 1IGMH 1MHEA 2X4NA 3L3OA 4TYUA 2VKXA 4IOFC 4PRPE 1DL7H 2GFBA 2C9AA 4K2UH 5TE7L 1AC0A 1BGXL 1FNHA 3RWIB 5DC9B 1RIUL 5AUMB 4QCIA 3V6BR 1DQJB 3G6JF 4CAGA 2PN5A 3AC0A 3G5VB 1IM3A 3HMXH 2FJGB 1A6AA 4JVWA 2EEDA 5E95B 5J12C 5TJWK 4Y4HC 4R9HA 5EN2A 3JTTB 2R9HD 3ARPA 5E2UL 1L0XA 3MNVA 5TE4H 1ZA3B 2QV2A 3M8OL 4JDTH 2EDHA 3EDJA 4PJ7B 3QEQD 5I1IH 4NPYA 1T83A 1CL7L 5KZCB 1B0RA 4ENEC 3I6LE 5E6IB 2XKUA 4BSVA 1JRHL 1KCSL 1GC1C 2YC1B 1TJGL 1CI5A 3ARRA 1FNFA 1WIOA 4M62H 5ILTH 1FFRA 3NA9L 4MJ6B 4G8FA 1BEYL 1INQA 3WIHH 1FFNB 5IT2H 3GKZA 4PGCA 4PJ5B 1TQCC 4P2RB 5ITBL 3B9AA 3S7GA 4DGIH 4HK3N 3P40A 1DLFL 3MSPA 4J3UA 4M5ZH 2XZZA 4FZ8L 4KJQC 1LNUA 1MI5B 2EC9T 4TVPL 3GSNH 4CBPA 3IF1A 1AR1D 3OXSB 2QQNL 4HBCH 3MNZA 1WFTA 3GI9H 2NZIA 1QNZL 3QZWG 4JFYB 5I8EA 4MQ7B 3I6KB 3CX2A 1T03H 5HI3C 5B8CB 1RPQA 1BX2B 1E28A 5AZ2L 1UWGH 4M1DL 5T3ZD 4WNQA 2NYYD 2PCPB 3UJTL 3CFDB 4U1HB 4NQCD 4NCC1 4S1QH 4X9IA 2DI7A 5F7LB 3GM8A 2BSED 5CIPA 2YD7A 2NY4B 1YNKH 3CFBB 4R2GB 1U91A 4HKBA 5DD3H 3RNKA 4BSWA 3VGFA 1H3GA 4PFEA 4FQJH 4FABL 4MAYB 2I60H 2OTWB 1GOFA 2R2HB 2A83B 4OBSA 4U7KA 3OZ9L 1FAIH 1KCRH 3NCFB 4RMRA 4YUEL 1KIPB 5KG9B 3QFJB 2EIEA 3VGEA 4X6DB 4GRWH 4AL8L 4LARL 5CZKA 3HCVB 5J6HB 2RCSL 5J11C 4XMKH 5ERWA 1SJHB 1N4XH 3H9YA 1CLOL 4IOIA 4PRHA 1MAMH 5C0RH 2ZCHL 1G6RH 3QHZL 4KK9C 5J1AA 5BQ7A 4J4PD 3U0WL 1GIGL 4QTIL 1HH6A 1I8MB 4L3EB 1QBLL 4JFFE 2DLFL 5DJDA 5EC1B 1UKSA 3IYLW 3B9KA 1YEFH 3BESR 4P2OC 3T4YB 4R7DB 4YX2H 3ZDZF 1F13A 4PB9H 4DCQA 2DB8A 3AB0B 5SWZE 1JZ8A 1VHPA 4Z7QE 4ZFOL 4K07A 1AGFB 4YE4H 4JM2C 1FZJA 1CK0H 2YEZA 1EV2E 3F8UB 2ZOLA 5CAYB 3BOVA 3KWWB 4XAWH 4NC1E 4PRHD 1QR4A 2I5YH 4M5YH 3PP4H 4O00A 4Z7VE 4XBPB 1IAIL 1NCBL 1QLFA 3NGBB 2MOVA 2BSTA 3WS6A 4O51A 1HINH 2R2EA 1CDIA 1SQ2N 4E41E 2BSRA 4OJFH 4Z7WE 1OAXL 2GJ6E 1NDGA 5FKAA 1NBYA 5FYLL 1C5CH 4PR5A 2EKSA 3QUZC 1F58L 5GGSA 4P4RB 4N8VA 4AEIH 5IMMB 3T0XA 3C09B 3L7FB 5I8KH 1X6NA 4M93B 3ARFD 1EHXA 4M1GL 5IFHH 3EO9L 3VMOA 4G42B 4D0BA 1IAKB 2DWDA 4DJMA 2EYRB 3FT2B 4PJ9B 1WT5A 3HLAA 2VXUH 3LMJH 2KL6A 2D3VA 4OCRL 2EDJA