1C8PA

Nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
102
structure length
102
Chain Sequence
MIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the cytokine-binding domain of the common beta-chain of the receptors for granulocyte-macrophage colony-stimulating factor, interleukin-3 and interleukin-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords CYTOKINE RECEPTOR COMMON BETA CHAIN
total genus 11
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1999-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c8pA00
2P8MA 2A83A 1EEYB 3CDFA 1J11A 4FQ1H 5EBWB 1BGXH 4HC1L 3JVGA 1JNLH 3FT4A 3HPJB 3I6GA 1A9BA 3MUJA 1MRDH 1QR1B 4LSPL 4D8PB 1CTNA 1DEEA 1MPAL 2E7LC 3IDJA 2ORBH 3CUPA 4QRPA 1C5DB 3MRCB 4GS7C 4YHLL 5HSFA 4L8DA 4WJ5A 3BIAX 4FFVC 4Q9BA 4KAQH 2C4XA 1GYAA 4NDMB 1TQBC 1OLZA 3AM8C 3VG9B 1UWGH 4LVHB 3LN5A 1CL7I 3WJLA 4PY7B 1HHHB 3R06B 3U2SA 2AS5M 2Y36H 2D4FA 5BW7A 1MJUH 1EEQA 2IQAA 4HKBA 4LFHG 2IPKB 4X99A 2GK0A 2YKLH 2EEBA 4PJ7A 3U9PH 2VLRD 8CGTA 1KJ2H 3FO0L 3D2UB 3S96B 3VGEA 3OKDA 2A9NH 3MJ8A 3NA4A 4J3XA 4YWGH 5C0JA 2VDMH 1DVFB 3TPKA 1I8LA 4R4FL 3QQNA 1I9RH 3LQZA 5DHVA 2Q7NA 2XOTA 4Q6IA 4UTBL 4YHYC 4OJFL 2NY3B 1A7OH 2FGZA 3I50H 1NLBL 1R3HB 5GHWH 3R4DA 1I9EA 4MAYB 5JXEC 1RUPL 1Q8MA 3HE6B 1N2RA 3BD5A 4GAGH 4P23D 5HGGS 4UINH 1G7IA 3T8XB 5D4QA 3HLAB 4L8SA 5TH2A 1QLRA 1YY8A 3IS1X 1FH5L 4AT6A 5IHZA 4H8WL 5JW3L 2ID5A 3LQZB 2WIMA 4Q6YA 1M4KA 1ZHBB 1NGYA 5DFWH 5KJRL 1IAKB 3LKRA 4P2RB 4AEIL 4DGVL 4NBXB 4OQTH 1JF1B 4YR6B 3I3BA 3RWDB 3CDGB 4WTZG 1DE4B 5IB4B 3CSYA 3IJYB 5CGMA 3QFDA 4XTRC 4MCYA 5GIRA 5DI8B 4OT1L 1J0KA 3OB8A 5C7XH 3RWEB 3ZKND 4CU7A 4M7LH 1GGCH 4HPOH 5DQJB 1F90H 2EDNA 5AWNH 4NUGH 4Y5VC 1FRGH 1RIHL 2FHFA 2F5AH 1JF1A 4HLZH 3NZ8B 2PYED 1FSKC 5F8RC 1UKTA 2FHBA 5C71A 4MQXC 1Z5LB 3UX9B 4P3CL 5TF1L 3LIZH 3JV6A 5CEZH 5ESAA 3MLTB 4GG8B 1ZEAH 5I17A 1HE7A 4U1MA 1KB9J 2CIKB 3QCUL 4Q6IC 4ONOA 1MQ8A 5B4MD 4I13B 1N0XH 2BDNL 2UWEE 5EC1B 3GB7B 1AO7E 3RL1B 2IALB 1I8IB 2DTMH 1A6UH 5KW9H 2AJZB 2FO4A 5EBMA 3PV6A 3EGSB 1T5WA 3IDNB 2GTWA 3SDXF 5ACZB 3MC0A 1MCIA 1G7HA 5DUMH 3SE3A 3PQYB 3S96A 5C09E 1JGLL 1EVUA 1XR8A 4M1GH 4Y19D 4PJFA 3GSNL 3P3YA 1EHLL 3HC3H 1I8IA 5EZJB 3QWOA 5EWIL 2C1PA 4JG0H 3AXLA 1RJCA 5A2KH 1ERNA 2G60L 3TZVD 1JUFB 4G7YL 3ZYOA 5BRZE 2XG5A 1A3RL 4Y4KA 5DJ8A 2DLIA 5LAXA 2LABA 4RAVA 4F8QA 3FQUA 1FAIL 1UQSA 2VDLL 5I8OL 3BKCL 3OL2A 3QA3B 3JTTB 4PJGB 3O6KL 4RAVB 2JCCE 4LARH 1XF5A 3OPZL 3WBDA 3DXAA 3X11B 3WHXA 1CFSB 2CLVA 2A73B 3PNWA 4NUJA 3WNMA 5DF0A 3UBXI 4Z7WB 3QISA 5ID1B 3HAEH 5K9QG 3MXWL 1A3LH 3RWDA 1GGIL 1MFNA 1QFWH 1C08A 2M2DA 2WINB 1QO3A 2FNBA 5F1OB 5C8JA 1WFNA 2Y07H 3RWHA 1S9KC 4L3EB 4OV5B 3C5ZA 2ZOKA 5D9SA 2G2RB 2W9EL 3QUMA 3NFNB 4JQVA 4QXUL 4PJGF 5I1JH 1MREL 4D0BA 3KNBA 3B6SA 1P7QA 5TDPA 4FFZL 2VN4A 2ZUSA 4O58H 3ARDC 4YJZL 1WITA 1X5ZA 2IADB 4I18B 5DMIL 3MZGB 4Z7WF 5D7SL 1R5IB 4UILL 1SJHA 4WRLA 2DQEH 3JUYA 4Y4FD 5I17B 2G2RA 3QUMB 3NFNA 1MCJA 3QEQB 3SDDA 3RWIB 5GS0C 3IU3B 1QEWB 1S9VB 5DZNA 3D85D 3MR9A 3NFPB 2R0LL 2GCYA 1W72L 5IIEB 3TBSB 4DVBB 4OI8A 1UCBH 3MMEA 4HF5H 5CSBA 3V79C 2EIDA 5DRWB 3BSZL 4M7KH 3EZ8A 4GW4A 1G0DA 3W9EA 2PUQT 3D18A 4UIMA 1RVFL 3VG0L 5CS7A 4Z0XB 3H7BB 3WFHB 1QRKA 3HR6A 1HWGB 1KOAA 1ETZB 3PWJB 1NBYB 1FQ9C 2BRRH 4JB9H 3SOBL 4WW1A 5I15L 2QQNL 1NL0L 2W0PA 3ZT7A 4ELKA 3HS0A 3GBNL 1FG2A 4POZD 2NXYD 1L7TH 3SDAB 4HKJA 5KSVB 4YAQB 2YUZA 5CHNB 3QIWB 5TQ2L 5J6HB 2ITCA 5D8JH 5DZLA 3O6MH 3P11H 1U8OA 4PB9L 3WFZA 5I1HH 1REIA 2DKUA 2F54A 4TVPE 1MCRA 3MLVL 4M5ZL 4X98A 4KK8C 4IRSA 2RCSL 1E0OB 1P4BH 1ROWA 3BDBA 4P2QE 5DDHB 4LGSB 4YQXH 4EKXA 4OLZL 4KJWC 1Q0YH 1VDGA 3HAEB 2HG5A 5AYUL 2E7CA 1H15B 1EEUA 1T83A 3U1SH 4XH2B 3HZYB 5LQBH 4M61A 5CINH 1ZWIB 5F9DC 3CK0L 4G6JH 2DD8H 3BESR 5DEFA 2QJDA 1ZLUK 4AIXA 4GG6B 3MOAL 2HKFH 4NO0B 3D0VB 1G6RL 1VGEL 3DX8B 2ZJSL 3MNZB 5J1TC 3PL6C 4NDMA 4FG6C 4NKMA 3MA7B 3GBML 4C59B 3QJHA 3U7AA 3GFUA 4E5XB 1MH5B 4KHTH 4M6ML 5I71B 3BZDA 2DQIH 5TPWH 3SDCA 3LRHA 4MA1B 2YC1B 3NCEB 4U6YB 3FFDA 3VU2A 3LKOB 1CL7H 4HKBB 1H5BB 5EA0H 1X7QB 2E7HA 1NCAL 2X70B 5C0GA 3NFPA 4UB0L 5E8NB 1MCPH 1D5ZA 3G5VA 2G9HB 1FORL 4FABL 1YEIH 4OV6F 5FOJA 1AGFA 4K3HA 3BKMH 1UT9A 5DK2A 3GUTB 3MRNB 1D9KD 3ZYIA 4F7MA 4PLJD 3PWLA 1DLHA 4MX7B 1DDHA 3MJ6A 5F44A 3BKYL 2Z8SA 4QY8B 4XNXH 4JZJC 1A6PA 4JFFA 2ZWLT 4TVSa 1JHLL 3WJLC 1QUNA 4FQIL 2VB5A 1WT5A 2ITDB 3TPUA 2EXWD 3W0WE 1HK6A 5JR1L 3PP4H 1OB1B 1YPZF 1DLHB 4N0RA 4OTXL 5GGQH 4M6OH 1T5XB 2PXYD 3AFLA 4WFGD 5INCB 1GVIA 4B50A 5KN5A 1RK1A 4LQFH 3RA7L 1MWAA 1OTTD 4PJEB 4U6XA 2BVOB 1IGMH 3CH1B 1PY4A 1T1WA 2PYFA 5IVOA 3KXFA 2CO6B 1HHJA 3STLA 2VIRB 1OP3K 4OM1L 5L2KD 4XMKH 2DDQH 4X5LA 4PR5A 5DWUH 4FQXD 3GMMB 5HYSA 1KBGL 3FKUS 3JSSA 3GHEL 1UACL 1WZ1H 2A83B 1D5BB 4YXHH 3OKYA 4MAYC 3ALXA 2FWOB 4G43A 5HHQB 4WWKA 5MEPA 5IP4A 2Q87A 1RIUH 3BKML 4R2GB 2Z31D 3ZE1F 3IT8D 5D2LF 5C0RH 1NC4A 4JO2H 3T04D 4NOBA 5DTFB 5JDJA 4XGZA 3DMMC 1QSFD 4XPBL 4MA1C 5ITFB 3D39B 1EAPA 2FECI 1IT9H 2VJXA 1XEDA 2IAMA 4N1CA 4HKXA 5J11B 4JFHD 4YHZL 4M48H 2ZCKL 2C7UB 4XNYL 5IMMA 4M1CD 4X4XA 3HI1A 2GUOA 2X70A 4U49A 1ZA6B 3MJGX 5M7QA 4YK4B 3C9NA 4NKOB 3BEWB 4RMWA 4ETYA 1TVBA 4QF1A 1EGJA 1U8QB 1QP1A 1RZJL 4BZ1H 4XZUA 3SE8H 1Q9WA 1H8NA 3B9EA 1SJEB 4GRLC 4P3WA 5HGBB 6FABH 1J05B 1I7RB 2WBJC 3BFOA 5E08H 1F4WH 4LASH 1KXVC 1JRHI 2X89A 4RGOL 4AYFA 4JQIH 2VDNL 3MRMA 3T09A 5CWSB 3QFJA 5D2NC 4Z18A 5C0AE 3DVGA 2EDXA 1KCRL 3BOVA 2VXVH 3QFJB 1CI5A 3NCJL 3TA3D 1AC6A 5I1GL 2FIKA 5CJ8A 3QIUC 4P2RA 3FO2B 1LEIB 2CK0H 1PBYA 3BD4A 5A3ID 1CFNA 3L9RB 4OLWH 1TPXB 5H94A 5JHLH 4TNWF 1ZMYA 4R7NB 4H5SB 5TDNB 5I1EL 1M6OB 4JFXB 2R9HC 1HDMA 3C5JB 4PY8J 4KZEL 4X6DE 1MFEL 1G9MC 5C70A 1RJLA 1HYSC 3BSZH 4MB5A 4UBDC 5BS0E 3G5YA 1DQMH 3KYAA 3QNYA 1Y0LA 3PWNB 5C3TA 5IWLC 2ADGA 1WUNT 3L3JA 3VFSA 3UTTA 1WBXB 1Z5LA 4D0DA 3M07A 5FIEA 1XMWA 5C08B 2UV3A 3VFNB 7CGTA 2IWGA 4F3FA 4WENB 3CFJB 4NYLA 4Z7QE 1S3KL 3NVQA 2OX5A 5CSGA 4C55A 3DMMA 4LFHD 4MAUL 5I8CB 4ZNEA 4Y8DC 2NX5A 5E5RB 1OTSD 2ZG3A 3ULVC 1AR2A 1RHHB 1SM3H 3DV6B 4JO4L 3S5LB 5DR5L 3QEUA 2Q8BL 1YC7A 4PLKC 3UP1A 3AAZA 4CBPA 4XB8A 3ARDB 5BS0A 4TOYL 3IDIA 1UKSA 5D96B 3F65A 3IGAB 4EN3A 1B2WL 3IJSB 3MCKA 4PJ7F 2JIXB 3EW3B 2VDRH 1E4JA 5IW6B 1AGCA 5GGRA 1FCCA 1I7RA 4NPYB 1DBAL 3BGFC 3QDMD 2V7NA 1R5WB 4JCLA 4F9PA 5C2BH 1MQKL 4PGDB 5GRXG 1INEL 4AENB 3AAZB 3RVVD 1VPOL 5BRZA 4KHXL 4W4OA 2CIIA 4IOFC 2VDQH 4PLNC 1OP3H 3O6LH 2CUHA 1R24A 4JPIB 5GRVL 3O6KH 3GK8H 3Q6GH 4P5TA 2AV1B 4XP6H 3MRBA 3H8NA 2HYMA 5HHOB 3O3DB 1AGCB 1AJ7H 2I9LA 3REWB 1UJ3C 3BDYH 3A6CL 1A9BB 1Q94B 5L8KB 1ITCA 1INDL 1YNTB 2X4UA 3J8F7 4J12A 1XGRB 3WO4B 2AEIT 3UTOA 5EZOH 3Q6FB 4NZTL 2PO6D 5GGTL 3ORJA 4K3DL 5FAAA 5JXAL 4ZNEE 2V5MA 4NRZB 1S7XB 3DV4B 4MMXC 4GUPA 5FM5M 2XIDA 5DO2C 4NQDA 3G6JA 4JY4A 5FHBL 3BZEA 4RX4A 3DGGB 4PD4K 1BWWA 4FMFA 1KIRA 3B4NA 3W2DH 3CLFH 4Y1AA 3IFNH 3V0AC 4TQEL 1IC4L 4EEEA 1KIPA 1RZ8A 2AJSL 3I6KA 3QIUD 2A77L 2BNUB 2FJFA 3BZFA 4X6FA 1J0HA 1KB5A 5AZEH 3SKOB 4L9DA 3RWIA 1CE6A 5E8NA 3OKLB 3MSPA 5FYJU 2UYLB 1T0NB 5FYJE 5TF1H 1OW0C 4ZPVA 4HCRL 5DS8B 4OB5L 3H3KA 5HTSA 5I1AB 1I85C 2Z93B 4ZTOL 5HYQA 2BVUA 4JM2C 4DGIH 5FUZH 3FB5B 4IHOB 5EZIH 1FE8L 3MMEB 1F13A 1A4KA 2APBA 4OD2A 1G7MA 3VXMB 2FB4L 3VFTA 3LMJL 4NO5A 1G7LB 1YN7A 1JGUL 2P4AB 3D3VB 4WY7H 5C7XL 4ZOCA 1Y18B 3EO1B 2F5BL 1HXYA 3BGFB 2WP3T 1T2JA 1AKJB 4NN6B 1A7PH 2SEBB 4JFPB 3SJVD 1IAKA 5I30H 5D7JB 4HIXH 1A4KB 2AEWA 5EZIL 1S9WA 4OGAD 4HMCA 4OFYD 4NO5B 2IADA 3ULUL 1HQRB 4JPWH 5DJZB 4HCRH 5SX5K 5C0EA 3ZLQC 4ZOAA 1JZ8A 3ZKMC 4YXKL 4IDJH 5GGSB 4W6WB 2AV1A 1Z9MA 2SEBA 3GJFA 4UV7H 4RAUA 3UYPA 4YX2L 3CX2A 5AZEL 2FO1A 4KK5C 5F7KC 3U0TB 1NLBH 3W9DB 1S8DA 3ABZA 2FD6L 3BI9X 4S1DC 1G9NH 3IDUA 2A6KB 4HT1H 2DOCA 2IBZX 4R90H 1D5XA 4QNPE 3ARGD 1O7VA 1Q9LA 2JCCB 3KR3H 5D1QD 1QKZH 4JHBA 3S3SA 3BPOB 1NFDA 2V7HA 3L3OA 3MOBL 1CBVH 4WW2B 1G9NC 3FO0H 5FUOH 4GUPB 2GTWB 2JJWA 4Q9RL 1WV7T 1RSFA 4LVNB 1B0GB 4LLMB 2Z8VC 5DD0H 2RFXA 2QQKH 3UZEA 1FVDB 3BWAB 1MRCL 1MVUB 1XR9A 1JUFA 1FIGL 2X1QA 1D5MB 4ZUTA 5DD5H 1MHHB 4ZYKA 4Y19A 5DEGA 2HRLA 5HHPB 4F57L 4WWKD 2FX7L 2Z35A 5FYLD 4FQHB 4NHUB 4AQOA 7FABL 3B2VH 5FGCE 1SYSA 2E9WA 4KUZH 4QOKD 4N0FB 3V0WL 2I25N 3FQXA 1Q9WB 3EDFA 4H1LG 4NO0D 4OD1H 3RL2A 4GMTH 1K3IA 2A1WH 2Z35B 3QXVA 4EI6A 4XBGA 4CJ0A 1F6LL 3WE6A 1QBBA 1Z6JT 4LBEB 3IAQA 3QUKA 2EYTA 3QULB 4ONGH 4M6NH 5T1LA 4EI6B 4LCIL 2NW2B 1GZQA 2X05A 4L3EA 1GOGA 3VXSE 3ZT6A 4G80B 3IETA 1AI1L 3IAPA 4O2FB 5L6YH 4LPXA 3ILQC 3MRRA 1IBGH 2D7TL 4PRPE 1NGWA 2MPAL 4GG6F 2XNAB 1FFNA 4PJCF 4G80A 3JV0A 3PHQB 4O2FA 5EBLA 2HLAB 4J7RA 3VXTA 4FQ2H 5GZNC 1F6AB 3QCTH 1P2CB 3GSWB 2YHGA 1UWEL 4HPYL 3SE3C 3O45A 1MHEB 3NIFF 3AU1B 3WN5B 4ZFGH 1N0LA 3MRHA 1YMHA 3QG6B 3ZTJG 2XZZA 3W0WB 1VADA 1RULL 4Z78B 4OZIE 4NWTL 1OAQH 5HGDB 1CK0L 1RUQL 3FJTA 2A0LC 2VR4A 1DBKH 4Q0XL 4OGYL 2QSTA 3V9FA 2ESVA 4G6FD 4NGHL 3QCVL 5BVJA 3HMWH 1G6VK 1YPZA 3BEVB 5K9KB 3SE9H 5HGAB 1XF2B 1A22B 3A67L 1WGOA 1JGDA 1R6VA 3DVNA 1IGIL 1NGPL 3IDXL 3R1GH 43C9A 4FQCH 1T7ZA 1NCBH 4XPHH 3MACH 1WCQA 2KZWA 4ZFGL 4ZPTB 4U3XA 2ESVB 3SKUD 3B2UC 4JKMA 1J1OH 3QI9C 1K8IA 2VXUL 5HBBA 5C0AB 3Q3GA 3VFPA 5IF0A 4NFBA 5I66B 5BXFB 4OQ1A 5D2LE 2HJLA 4HX1A 3BIBX 3NN8B 5DJ6A 3B9VA 3JTSA 3L3GB 4HS8L 2VDNH 3OKEB 2DMCA 2PF6A 3UTSE 1NGQL 3UTPE 4XPHL 2R1XA 4HWZB 3FT2A 2YZ1A 4FZ8H 5GJSL 3TV3L 3UJIH 3UYRH 3IGAA 4ELKB 1NGPH 3IDXH 1IC7H 4F15B 1DN0B 1W0WB 4GMSH 2I07B 3VXUE 2R4SL 2XKNA 1K8DA 2AV7B 2H26B 3VD9A 3ZO0A 2AP2A 3HMWL 4QT5B 5KSBF 4FTVD 4IJ3B 4UQ3A 4RGNB 2OL3B 1UB5B 4JKPL 1PDKA 1G84A 4YBQD 3C5SB 3MRCA 5FKPA 5DEZA 3LV3B 5D2LB 1RURL 4M7JH 5F7WC 1VKXA 5DRXB 4EBQL 4XNYH 3ECBB 3DIFA 2FX7H 2I9LB 3KPLA 4KY1L 5D2LA 1XGPA 1CGSL 1BVKB 4EI5C 4OCYL 2YD9A 1HZHL 3WIHL 4P4RB 5I1KL 3UC0H 4MZ2A 2ATPA 5E94B 1NKOA 2VITA 3NH7L 4DN3L 4RRPG 1IT9L 4N8CL 2UVEA 3SJVE 4LSUL 5A43C 1BAFL 4P4RA 4Y7MA 5JPNB 4PBWD 1NFIB 4WUUD 4U1LA 5DHYA 1LEKA 1YEHL 2P7TB 3L3HB 3QG6A 1ZHNB 3EJZC 1VADB 1LP9B 3QEGL 3S36X 3PXHA 4LSTH 5H2BB 3CVIL 3V6BR 1ZT1B 1CCZA 4WO4D 2VQ1A 2IQAB 1EO8L 4NQDB 1JV5B 2VDKL 4HXAL 3TGXA 5BVJB 3LKSB 1NANH 3IDMB 4DFIA 5C07A 2F8XC 5IB2B 1DBML 3TESA 4QXGH 4NWUH 1F4XH 4TTDD 4GQ9L 1A6ZB 2V17L 4NN7C 4XP5H 1J8HD 4P9MH 5DK3A 1FZMA 1D5ZB 4HQQL 4QHNA 5EU6D 2BNUA 2FJFB 4OM1H 4N68A 3QI9B 5JIHA 4L29A 5T3ZE 2P8PA 2GYSA 1XGYH 4F8TA 5F93C 5IHZB 4NQVB 1J1PH 2FBJL 3V7AG 1U3HC 2YD6A 3P30H 3VGGA 2BK8A 1N2RB 1YEDB 3Q3GB 5FUCC 3FQWA 2WWKT 4XVUC 1IAOA 4S0SD 1S7QA 4B5EA 3SGEI 1DQDL 3U30B 2C4FT 4AIOA 3FZUC 5GGQL 5IVXA 5FK9B 1PJ9A 3WNNA 3E8UL 3AVEA 1JYVA 1ACZA 1OB1A 4ONFL 3V2AR 5B38A 2JKXA 4B41A 5BO1H 4AH2A 3LSOB 4RGNC 5IMOB 3RVTC 4EUPA 5I76B 3T8XA 3MROB 3CXHJ 1GGYA 4NQEA 3BDXA 3VA2C 4MB3A 1MCQA 2EYSA 2ICWA 2CLRB 3KR3L 3MREA 1FE8H 3O3AA 4NKDB 4Y2DD 2BNRD 2XRAL 4EI5B 1WBYB 4L4TB 3UTTB 3MV8A 3TH3T 1I3GH 3GI8L 4JN2B 2EDWA 4ZQKB 1L6XA 4WGVB 4K8RL 5INDB 3DRTB 1TTUA 1X44A 1OSZA 4OUOA 5IFJB 2EYSB 3VWJC 3ZDYE 4X7TB 5FHAH 1PKQE 4WIQA 3V6ZB 1FPTH 3WIHH 5I1KH 1EJOH 1C16B 2Q6WB 3ULUH 3QNXB 4M7JL 2P7TA 2N4IA 2VZVA 1HYSD 5DD6A 4ZQKA 2CR3A 4GT7A 3S5LA 5GGSY 1FFPB 2AXGA 4KMLB 3CFBB 2DD8L 2OXGA 3EO0B 3BHBA 4UZGA 5DD6B 4Z0BH 5MEOA 3M1BB 5J3HD 1OSPH 4ERSL 1RHFA 1FL5A 1RFDH 5GGTH 5IR1A 5F89B 1RIVH 2DQHL 2XQBH 1OGAA 2DLTA 2X4PA 3UYOD 1SJVA 4LF3A 5DVMA 4Z7OF 3C9NB 1FNSH 2IH1A 4HWBA 3UYRL 1D5MA 2GIYA 2JJTC 4ZUTB 2ARWA 3S3PA 4ZTPH 3VRIA 5F7MC 1UVQA 1L0YA 4NNXA 3ARFA 4NRXB 1UB6B 3FZUD 3DX6A 4K07A 3SDXA 5FUCE 5KAQF 2UWEA 3HMXA 5KS9B 3WKNA 3NIGE 3P11L 1SYSB 3SDXB 4HFUL 3OMZA 2VDQL 1CDCA 1YEDA 1KLUA 5F1IA 4CKVX 3LVEA 2A77H 1UKQA 3QDHA 4WFHE 5H35A 5ID1A 4TQEH 2Y06H 1NC2D 3NMEA 4WI2A 5FOBB 2OJZH 4Y4HA 2LU7A 2F9BT 4JRXE 3X12B 2L4OA 1BJ1J 1QRNA 2RJMA 5KS9A 3MLPA 3P4LA 3C5ZB 4HUWA 1DJSA 1HKLL 1SY6L 3QXDB 4RCAA 3ZHKA 5IG7A 3S9DB 4Q74A 1SYVA 1DUZB 1QO3B 3GMOA 3NGBC 2CGRL 1D9KC 4ODXB 1KSRA 1NAMB 1RZJC 4OGYH 5JHDD 4NZRL 4JFEE 4UI2A 4P2YA 2HVJA 2YBRB 3CC5A 1FLTX 5IMKA 3THML 4MCYB 1NDGB 5GIRB 4K9EH 5DI8A 1FN4A 3L1OH 2WWKO 3BDYL 4M7ZB 5C9JB 4LVOC 4BM7A 4D0DB 2H8PA 4ODXA 4Q2ZB 4KTEL 1U2HA 4NP4L 3WUWB 1ZKAA 3Q6GL 1PG7H 4R3SB 3HFMH 5F9AC 3TNNB 2R2HB 3L1OL 1IQWH 3T3ME 1GOHA 2MPAH 4ZO7A 5DRWA 2ENSA 1MQKH 1ES0A 4FQLL 2ZKHL 4AL8H 1CDGA 3VCLB 1PFCA 3V6OA 1TZGH 2WQ8A 4F3FB 3CFJA 1JGDB 3MJ9L 2V5YA 1T21A 2NLJA 4LMQI 2DQGH 5D2NA 5IB5B 2Y07L 1S9VA 4G9DB 3S5LG 5CBEB 1QBLH 3AS2A 2BVTA 4I0CC 4RGMB 5MENE 1ZGLP 2B4CC 1NUDA 1CGTA 1KCVL 4MAYD 2IH1B 1SM3L 4MA8H 4PJAB 2QR0B 4IMLA 2ZKHH 3VWKD 4TVPH 5J6HA 3AGVA 2X4RA 3H42H 1U8OB 4GW4B 3W9EB 4JM2D 1IQWL 2DIBA 2H9GA 2BFVH 3O2DH 1YNKL 5DJ6B 2O5YH 3HS0B 3SDAA 3FCTB 2LVCA 5DHXB 3VD5A 4KTEH 4F80A 4KV5F 1EUTA 1MRCH 4MNHB 2HAZA 1SMAA 1W0WA 4XNZB 1BVLA 4KKBC 1HHIA 2JK5A 4X0KB 5EN2B 1YJDL 2XZCL 4Y5XA 3HMXL 4OCLC 2IBGA 2CUIA 3SY0A 3ZDZF 2R0KH 5L2KE 4NUJB 4EJ1C 4PRAA 2JCCF 4M1GL 4PB0H 1P6FA 3MRLA 3K81A 4ZDHB 3SO5A 3RX8A 5BV7C 4K3EH 4IEFB 3UTQB 1RU9H 3HA0A 3BPOC 1JGEB 5FO7A 5A16B 5E00B 4LVOB 1NGXA 1Z0NA 1G9EA 3IS0X 3UTQA 1PEZA 5DEFB 1EXUB 1R5IA 2IJ0C 1DBBH 4XCNB 4M61B 1QPXA 5HHPA 5EU6E 4HK3J 1EHNA 1KPUB 5TQ0L 3UXFA 3ULSA 3QUZD 5GGVL 2KL6A 5E7BA 2HJKB 1FL3A 2YD4A 1D5IL 4NRYB 4NT6B 1A6VH 3LD8C 1FRGL 4NUGL 1MY7A 3G5VB 1CXHA 2G9HA 3IJHB 3ZDXF 3GJFK 1XT5A 1S78D 2JTDA 1A7PL 2NLJB 4P5MA 3D18B 3RUGA 3SE8L 3OR6B 4WTZA 1JNJA 1X6NA 2DLHA 4KROD 5C1MB 3RY6C 4ONFH 5JNYA 1W2KT 2JB6A 4MJ6B 5D6CB 5GISL 1FFQA 4CN4A 4K23L 5ADOH 4KZDH 4F7MB 3E8UH 4TNWK 1IAIH 3MRRB 1IGML 4YEFA 1ED3B 2ADIA 5L0QC 1ETZA 1CN4A 4M48L 1IC5L 1K5NB 3MFGB 2W92A 4TTGA 4N9GA 4R0LB 3X14A 1AH1A 5F71A 2NY5C 2BNQD 4R8WL 1NMBH 3FCTA 2NMSA 2DKSA 4BKLA 2ICEA 1MUJA 1A47A 2P8LA 3KDMB 4PGZA 3SGKC 2PR4H 3BIKA 4OZIA 3MNWA 3CH1A 3UJTH 4QOKB 5E2JA 1OCWH 4LMQE 4DUXA 3RWFA 5C0DA 5C0BE 1T04B 5MEQB 4XP5L 1D7FA 4XNXL 5IM7B 2ATKB 1F4XL 2VDML 3V4PL 1T04A 4QWWD 3W81A 3V4PH 2QSQA 4PB0L 3MNWB 1LO3L 1YEIL 4PJEF 4U0RC 3JBG7 4LDEB 5BO1L 4IIQC 1MJUL 4UB0H 3HMXH 4M02A 4BUGA 2X7LA 3U30C 4PJBF 1NC4B 3LPGA 1CT8A 4GRWH 1QBAA 2ZG2A 2RFXB 3HR5B 4M6MH 2IBBA 4KHTL 5HHQA 5CEZE 5TGBB 5FO8A 1YYLL 4PRID 5F9JA 3SCMD 3U4BH 1FVEB 4QRUA 1LNUB 3EFDH 3UTSA 3WDIA 1G6RH 3G08A 1QLFB 3D85B 4J3OC 4P4KD 1T4KA 2X9YA 3H42L 5GGUA 4FQIH 5BOZG 1ZT1A 2VXTH 4MA8L 3IJHA 2ZZUT 2W38A 4IOIA 1U91B 3FB7A 3BKYH 3ULVL 4FHBD 4WFFD 2C7UA 2YWZA 2PO6C 5KSAA 3BPCB 4PLKD 1RZ7H 3T0ED 3ARFB 4HIHA 1KYOK 4PD4J 4LSTL 1D5IH 4QRPE 1NGQH 2PXYA 2NXYB 4JO4H 4BYHA 3MYZA 1P4IL 5DA4A 5EO9A 4IJ3C 5HI4D 4F2MA 1KN4L 3L5WB 5DVLA 5EA0L 4JKLA 3RGVD 5H35B 1XF4A 2DQIL 1YA5A 1OPGL 5TPWL 5TQ2H 2UVFA 2ARJB 3QUZB 5JPNA 1HILB 2QQNH 5B3NA 2VN7A 4GAYB 5IFAL 4P4KB 2OMBA 1ZS8A 1QFUH 4JHZA 1IE5A 1S78C 4RFNC 1RURH 4YC2B 4PJ5B 2OCFD 1GL4B 2AGJH 2DN7A 3CFDA 1MHEA 3RWFB 1E28A 3P9LA 3GMMA 1UA6H 2CPCA 2X4TB 1WFOA 1CXEA 4G6JL 4LP5A 1LP9F 4WEMB 2NQCA 2R15A 1U8MA 2WBJB 5GQBA 4L9LA 4I9WE 4U0RB 1FO0L 3SE9L 1UXSA 5KVFH 4H5SA 4WU5B 2HVJB 2YBRA 3TIDA 4APQB 2H3NA 5A2LH 5LXGH 3HZVB 5IKCB 3QDGD 3KLSA 4XCCL 4NWTH 1TVHB 4I3RH 1UA6L 1ZGLB 1W72H 3FFCA 4EI5A 1CFQB 4LAQH 1IEHA 3PWNA 1RPQA 5GRWA 1OTTC 1T6WA 1T22B 2YZ8A 5E2TL 5DURD 1WQVT 4NJ9H 4MCZB 4MNQE 5I1GH 3NIDE 1OPGH 3BVNA 4MJID 2BFVL 3FRPA 4OCXL 2V2XA 3EYQC 2B4CH 4KDTC 5LGJB 1P7HL 1DQJA 3QFJE 1L0XA 2VKWA 3MCLL 3LB6D 5IMMB 5D7IE 3B8YA 5C09D 3EFFB 2A6IA 2Q3ZA 3EOTH 4ZSOB 1KCVH 1M7IA 3G5ZA 4NBZB 1U3JA 4ODBD 4LAQL 5EIIA 3EFFA 5J06A 1ZLUH 1BOGB 3O6FD 4ACPA 2DQHH 4NQEB 1U3YA 4HUKB 1OGAB 4G8IB 4M7ZC 4OM0L 5SX5H 1WBZA 3ALWA 1RFDL 4OD1L 1GGIH 1QFWL 4R2GD 1DUYA 3OGCB 2IFFL 1DBKL 5CMAB 3QXAA 1PG7W 3V0WH 3CFEB 4RFEA 4HD9A 4UQ3B 2OL3A 1WEJH 5J6GA 1UB6A 3EYOB 5T1KA 1BD2D 4U1KA 5CBAB 4AENA 2XG4A 4LARL 5GS1A 3EJYD 4DGYH 3U4BL 3BX7C 4G6AC 4NQED 4QEGA 3L7FA 4BUHA 4LVEA 4X6BA 1U8KB 4P4KC 2G75B 1JMZA 1H0DB 3LKPA 4WJ5B 4XI5D 4N90E 2Z91B 2UZXB 4I48A 1U8KA 3VJ6A 4LAJH 1MCCA 3IKCA 3OXSA 4TNVF 4RRPA 3QUYC 3U36B 5JORA 1LEGA 3BUYA 4OZHE 3MRPA 3DWTA 4PY7A 4GRLD 4GRMA 2K1MA 4Q9RH 1XCQA 1LO3H 1EERB 1FDLH 2RAMA 2ATPB 5E94A 1RZ7L 2Y4SA 3PE9A 1EFXB 4H26A 1EH9A 5E9DA 2FDBP 5EFIA 2W0LA 4JANA 1JN6A 1M6OA 4ISVA 2DTML 5B21A 5KW9L 1YY9C 3UJTL 4JRXB 5IBTH 5C08A 2YD5A 3P40A 2VLKA 7FABH 4CAGA 1ZHLB 4C56E 1SEQL 5KS9F 2RBLA 3SKOA 2YD2A 1IC5H 4F9LA 5D71H 1HNGA 1J1PL 5ICZA 1CD1B 3DSNA 5B22A 3VFTB 4KTDL 5CKAA 3IDYC 5BV7H 4QGYA 4Z9KB 1PYWB 4G7YH 4WUUA 5FECA 3K0WA 3K2MC 3BH8A 2ADFL 5EWIH 3OKLA 1JGVH 5A1AA 1UEMA 3IDIB 2R2BB 1PSKH 3STZB 5ISZB 3LCYA 1JGLH 4NC0B 4X6CF 3MYJB 4ERSH 3GMOB 3BPLB 3GJEB 5DGQA 4WY7L 1GOFA 1K6QL 2BHYA 2NY0B 4LNRB 4OF0A 2R2BA 2K3TA 4OZHA 2R0WH 2E7LA 1A6TB 1CICC 2NCMA 5CGTA 5T1DH 5CMAA 5C0CA 3OV6A 4WV1C 1N6UA 3VRLE 3D3VD 4R90L 1V7ML 1OCWL 3CAFA 4EDWL 4MXVF 1YN6B 1HCVA 4HHAB 2HWZH 4K8RD 3LB6C 3L7FB 1BZ7A 3O3DA 1LK2B 3LH2L 1VFAA 4DN3H 2AJSH 4K71C 3QI9D 4ODUA 4XHJC 1LK2A 4JFDD 4IS6A 3VFOB 3MLSL 5EOQH 2VE6A 3WXVL 1T1ZB 2F8VA 1U8NB 1BPVA 4H25B 1OGTB 1SVCP 1UZ8A 3R8QA 2V7HB 4ENED 5ADOL 5GISH 1I1FA 2EYRA 5HPOA 3WIIH 1TITA 4JJ5A 3GSNB 4JRYA 1H3TA 3D48R 1PSKL 3U9PL 2IAMD 4PRHE 3VFOA 2R0KL 4BZ2L 2IF7A 4GMSL 4M03A 2CLZB 1S7UB 5FO7B 1YJDH 2V2WB 2XZCH 3VWKB 1S7WB 1P4LA 4ZODA 4JFYB 5EU3A 3FFCD 2DWDA 1BD2B 1NFDB 3L3OB 1D6EA 2XXCB 1KIQB 4QRRB 4OB5H 1HEZA 2YD7A 4WTWA 5HXMA 1S9YB 4WI8A 4HK0A 4TPRL 3P30L 4PB9H 3V6FA 5E24E 3BKJH 2VZOA 4K3GA 1P4LB 4KHXH 4RAHA 1VPOH 4HEPG 4NCC2 1IEBB 1KN2H 2CDEB 5FGRA 3H9ZA 4UTBH 1BX2A 3L3KA 1IQDA 4ZUWB 2VISB 3FQUB 4CDHA 2BRRL 4IRJA 4U2ZA 3RDTD 3SE4C 4BFEA 5FHBH 4RMQA 4QRSB 3DBXA 4LLYB 4H0HB 3MODL 3QWRA 4OFDA 1QBLL 3GSVA 2YPLD 3FT3A 5FV2A 4P59H 4UDTA 3VG0H 3C87A 4HXAH 3A67H 4X9BA 3K80A 2QQLL 2DQGL 3RL2B 1Z9SA 4DKFL 2AQ3A 2Y5TA 4NGHH 5HGHA 3BP7A 5CD5D 1OOAA 5KSUB 1AHWC 4HMDA 1M05A 4FQLH 4AL8L 5HYJE 3P2TA 5T5FH 2EDBA 1Y6MR 4KMTL 2IH3B 1PLGL 1CFVH 1BAFH 4MGXA 3TN0A 3CCHB 1G6RA 4GW5A 3HFML 3ARBA 5IOPA 3WL9B 5GGSA 3KG5A 3SKNB 3KPMB 2HVKA 3N1MC 2FECL 3DO7A 4XP6L 1HQRA 4KY1H 4DGYL 2O5YL 4FQ2L 2XPGB 4J3SA 1DEDA 1PLGH 2PO6B 2LE9A 4K9EL 1H3XA 1WEJL 5MP6H 4LSPH 1INEH 3TNNA 3AREB 3VXMD 5DRNB 1AI1H 3ZKXB 2MCG1 4OLVL 5CZXD 5EULV 3RUGE 3JWDC 2PW1B 2E7MA 3KJ4C 3M45A 3AREA 1TVHA 4XC1L 4PJCB 2W9LA 4QHLA 4WW2A 3LD8B 3FMGH 3SGEH 2A1WL 3WUZA 5DLMH 4DVRL 2YUWA 4I0PC 4FZ8L 2YEZA 4DVBA 3IAGC 1A3LL 5FCSH 8FABA 1F11B 1U8IA 3KLDA 3QUZC 1BMGA 2C5DC 3FQTA 4J8RA 4MWFA 4YDJB 4PJCA 4FFWC 1YPZB 5C86A 4HG4K 5I66A 4JGJA 9CGTA 5E6ZA 1V8HA 3VXNA 1KCRH 4RDQF 1AXIB 1JPFB 4TPRH 1S9XA 1J1OL 5I8OH 1WF5A 4OCWH 5C0IB 3OXRA 1FIGH 3PGCB 3BIKB 2X4RB 4CVUA 3IYLW 1RZGB 4KVCL 4I3RL 2C3XA 2EXWC 2GSIA 4XCCH 4AEEA 1DQML 2ZUYA 3HC3L 3FN9A 5DRZA 5KSAB 3NAAH 4PRBB 3FO1A 4TYUA 4O5LL 5A2FA 2QQLH 2OTWB 3AY4A 4JPVH 1J0JA 2VSDA 3CSBA 4PRIB 5I1EH 1OAQL 2FH8A 1HKLH 1SY6H 1YZZA 1N6VA 4NO3B 5IEKB 1A1MB 1XH3A 3UBXA 2RB8A 1IM9B 5E6YA 3FRUB 4NQUA 5E2VH 3TN0C 2NY4D 2Y06L 4PJBB 3MJ7A 3TBTA 1YEGH 4D0BB 1RZIB 4GW5B 2AKRB 1N0XL 4M8QA 4U1LB 3ROOB 5TGBA 2BSTA 1WAAE 4N0CD 4QCIB 3C8KA 3TO4C 3ZKXC 5SV4A 1FFOA 4OIIH 1T7YA 1UJTA 3GI8H 1SJHB 3CUPB 4HKZA 4PY8I 4P99A 4QRPB 5I1DA 2X6MA 1J10A 1V3MA 3WNKA 3VRJA 3VFGL 1U8MB 4J6RL 4L3CB 4DKEL 3CZFA 1LP9A 2R56H 2KUTA 2R0WL 2FATH 3F6IA 2XTJB 1U93A 4M7LL 2LTQC 5D70L 3S37H 3DECA 1RUML 4JKWA 2BP3A 5CFHA 5L9DH 2AJVL 2C3WA 4NNYB 1OSPL 4GFTB 1Q1JL 1FL3B 4N5EC 5SWZB 2WMPA 3E6FB 4R97C 2XZAH 4PJ5E 5D1QB 3ZSTA 2VLJA 3CZFB 4FXGB 5I74B 1JV5A 4DGVH 1LO2L 3SEPA 4LEOB 4AEIH 3ARFC 3HAEG 4PJ9D 5KJRH 1DQDH 4HBQA 5E9DD 2VLJB 4FXGA 1BIIB 1EJOL 2JJUA 3LHPL 2ED8A 1GGBH 2GFBB 4TUJA 5HPMA 4GAGL 1S9XB 4M6OL 3I85A 32C2B 4XPBH 3RIAF 1A7OL 2GQHA 4L8SC 3E0GA 2QQKL 3PHOB 3D0LB 2OI9C 3CLFL 5IHLB 43CAB 2MTPA 1I9RL 3D25A 3KWWB 3QQ3A 4NQXB 5CEYA 3WIFB 4JFZH 4QOKA 2VIRA 5F72S 4IIQA 1AD0B 1IKFL 4XCYB 4YFEA 5D7LA 2BNQB 2FJGA 4H1LB 2APXA 2A9NL 1WBZB 2ICEB 4U3HA 1AGEB 4XCYA 5CIPB 3I02B 2OTWA 2IMNA 2VLJE 3MUY1 4JN2A 3CDGA 5K33A 1A6WH 3OKKA 2ED9A 2HT2C 3HG1A 4PTUB 4MD0A 6CGTA 1V3LA 2RIKA 1INDH 5BV7L 4RDQG 5CLWA 5D7KD 5ENWA 4A6YA 2FIRT 1K85A 3IFLH 2C3HA 3B9KD 4PP2A 1GSMA 4IDJL 3ZE2F 1OSZB 3LHPH 2CIKA 1HHKA 3G5XA 4HK3N 4JZNA 4L9LC 3PJSB 1BQHA 5ETUB 1JE6A 5I1DB 1CDIA 3GSRB 2CMRH 2MHAB 2XZAL 3H9SE 3ZKQD 1RUAL 1Q1JH 4LPUA 1ZLVH 3OF6A 4UUJB 3N1GC 1JNLL 4Z5RA 3C60D 2IFFH 3GSRA 4D9RD 2VQUA 4HC1H 4G42A 1N5AB 3BP6A 5D1XA 3E1F1 3OKDB 4CVXB 5JPMB 4NWUL 4QF1B 5AYUH 3G04B 5E6IC 3S37L 1WT5C 1E4WH 2FYYA 4PJ7B 3O4OB 2FATL 3TN0D 1IC7L 3G04A 3P4OB 3VWJB 4EI5D 1T4KB 3R06A 5M94B 5JW5A 1IGJA 1CTOA 1HH9B 2HJFA 5DMYA 2JB5H 1JF5A 3BXNB 3LDBC 5EUKB 5B3JF 5HHOE 4M7LT 4AJ0A 5IMLA 4L8SB 5DQ9A 1NEUA 5J57B 1PX3A 2EE3A 3UC0L 2UUDH 3X12A 2Q1EA 5C0FB 3VJ6B 3SGDI 1T3FA 5E2VL 4OFIA 1NCBL 4JHWH 1AGBB 2VXSL 5DXWA 1J0YA 5F3BA 1IGIH 5IJVA 4JN1L 3TBYB 1Q9KB 1E6OL 4MNGA 1UZ6E 3NAAL 4LCWD 1U36A 2Y6SD 3HLAA 5TH2B 1INQA 3NPZB 3ARFD 5EZOL 1I1AC 3RIAK 4X4ZA 2ZSVB 4OQTA 4U1HA 1L7IL 1JI2A 1NCUA 2NYYC 4JFXA 1O0VA 1JZ4A 3VD7A 1OTUD 4HS8H 1WBXA 3GSXB 3RNQA 4HPYH 2FGWL 5KAQG 2B4CL 1HOCB 4HCRA 4TSBL 5TJWK 5I1HL 1JJUA 3G5YB 3QCTL 3U0TA 3I3EA 2H8PB 2XICA 3L5HA 5I8EB 1P69B 5IBLD 3KYNB 3O2DL 1E4XI 4ZUSB 4WEUD 3TJEL 1CXFA 4HV8B 2GAZA 5IFHL 3TFKC 4N90D 1H5BC 1TZIA 5I15H 2GJ6E 4ZOBA 2JCCA 1BQSA 3V6ZA 3VDBA 2DQFB 5C0NC 1JHTA 4RQQA 1ES0B 4MLIA 3ZKSD 3VE0A 4OI9A 2W9EH 2E6PA 4ONGL 1I75A 1T89C 1A0QL 5ESAB 1C12A 1RJZB 1CG9B 3FMGL 3MR9B 3ULVH 3KHOA 3GJEA 4J4PA 3WDHA 4LLMA 4NC2B 3MJ9H 4X6CB 1RJZA 2B1AH 1YUHA 5EPMB 4KC3B 3WFHA 4ETQB 1PQZA 1UCBL 3C6LB 4HF5L 4GKZA 4GXUN 1YECH 2W60B 3BW9B 4XZUB 4MNGE 3GZKA 5EZJA 2BOBA 1MAML 5IVZA 1IM3B 3QDJD 3QRFM 1OVZA 3MRIA 1HSBB 2GSGA 4NKIH 3BZ4A 1R3JB 1UWEH 4V1DE 5GS1B 2G5BB 2PKDA 4Z7OE 2HFEB 4O51A 4QHMA 3PDOA 1C1EH 4ONHB 1CFVL 2OS7A 4IRSB 2P1YA 4U1SA 4O51B 1IBGL 2D7TH 1KN4H 4MJIE 5EOCJ 4HUXB 1C08B 5EO1B 5DD0L 4KRPB 3OG4B 2FIKB 3T0AA 5C0RL 3D2UD 1I1FB 4ZDHA 1UCTA 4LLWA 1CFTB 1MAKA 1RIUL 4M6NL 4DKFH 1F4HA 4X9HA 2H45A 5HYFA 3CU1A 4WW2F 5C6WH 1P7QB 1CFSA 1DQTA 2IC2A 3MODH 4GMTL 3F12B 1S7XA 3DV4A 3KGRA 1C5BL 4PV9B 5EN2A 5DJ0A 1KBGH 4KK5D 3KPSA 4ZAKD 3E6HA 1FV1B 2K7QA 3RTQA 4DK3A 1OP5H 1V05A 5ID0B 3QBTB 2FBOJ 3RVWD 1HQ4B 3E3QE 4LCWE 3PHSA 5BZWB 3WUWG 3GKWL 4JHAL 1FAKT 4V1DA 4ZO9A 3OGOE 1NFDF 4MXQD 4UV7L 2YK1H 3B5GA 3DO7B 4X7SH 1A1OB 1YYLH 2GTZA 3D69B 3IXAB 1FNAA 4LHUG 2WIIA 4KI5F 4Q58C 5FKAA 3RKDD 1TENA 4DW2L 3FQNA 5EH1A 3SGDH 3VH8A 1KG0B 3IU3A 4FA8A 5HHNB 5F7FA 3BZFB 1F90L 3FQNB 1AR1C 2X4QB 3DX9B 3OB0H 4OGAC 4OD2B 2N1KA 4HBCL 1Q9OB 4LCWB 4P2OA 3EBAA 4L3EE 3VCLA 2R9HD 4P48A 3KYOB 5CJ5A 3CIQA 2BMKA 2WSKA 1QKZL 4ZO6A 3WIIL 2XFXB 3O9WA 1PQZB 4G8GE 3MZTA 4JFPA 4GKZB 4PBVC 4OFPA 4KRLB 5C3LD 4WFFE 3FONB 4LNVA 3MLSH 5K59F 3FOLB 4FTVA 3MPCA 4Y5YA 1CL7L 4LKXA 1JL8A 2YUXA 4NPYA 2GSGB 2BMKB 5B39A 2B8OT 1ZEAL 1FG2B 4R8WH 2HWZL 3I50L 4KRPC 5D7JD 1IC4H 2B5IC 5DJYB 5ALBL 2NY3D 5IW1A 1EZVY 2X44D 3T65A 5JIPA 3ESUF 5FYLE 3WYRA 5EIQA 4R4FH 2EDHA 4EIGB 5ICYB 4RMTA 5JOPD 2HN7B 5F1SA 4Y5XB 4KZDL 3RDTB 4K23H 3ARRA 3G6DH 3ULVD 2GI7A 5CUSH 5I74C 1K6QH 4JY6B 3HE6C 3V0VB 5FDWB 4HBCH 4K3DH 4C4KO 1TCMA 2L7UA 2ADFH 3U82B 3QWQB 3D39E 4YQXL 2BJML 2ED7A 4XXCC 1A6VL 2K7PA 3QZWB 4PRNB 4KTDH 4MYWB 1A7BA 4DW2H 1NC4D 1FVEA 4QRUB 1AJ7L 4M5ZH 4KAQL 3RVVC 3WEXA 4OZFA 4DTGL 2A0LD 5CZXC 1JF6A 1SEQH 4IOFD 1A1NA 3GK8L 4X7SL 4QRQA 1B0GA 2BNRB 1KNOB 4RZCB 5GSVA 3SQOH 1CVRA 1DANU 5LBSH 3PP4L 2F58H 1DBBL 2EKSB 3QZWA 4UT9H 4Y5VB 1XR9B 4JVPA 1JHLH 2EH7L 3W2DL 4HQQH 4I0PD 4NKOA 2EC9U 3QH3B 5HJ3A 2J3SA 4E42B 3DX9A 4GQ9H 3QEQE 3QUYD 4QXGL 4MX7A 4E5XA 2V5SA 4PS4H 4X5WA 3O4LA 4NFDA 3CFKB 4HH9A 3JV4B 3GMNA 4NRYA 2BY1A 3FB7B 1EO8H 3O11A 1IEBA 5C2UB 2CSPA 5F1KC 1FORH 1KACB 3BGMB 4S1RH 3P73B 5IEKA 3MRDA 1YEHH 1GHFL 1JPTH 5EUOE 1EA9C 3RY6A 4OF7A 3T0EA 3MRMB 4CU6A 1KGCD 3MRDB 4LSUH 4HLJA 3L6FB 2QEJA 3MBXL 2IH3A 1BJ1H 3T0DA 1CGSH 1QRND 3QDMB 4KVNL 5K93A 4CVZA 1KYOJ 2VZTA 3C8DA 5CP7A 1DL7H 1FO0B 1VENA 4O4YL 2NZ9C 4QO1A 4L8BA 1YECL 4RNRB 2PW2A 4JKPH 4NZUL 2VDRL 3U1SL 4OM0H 2QKIB 1CLCA 1PAMA 4U6XB 3LDBB 3WNOA 4MLSA 4F37F 5EUOA 1I4FB 5GJSH 3VFUB 2RQ8A 4NQTA 5DR5H 1GGUA 1ZGLA 4JM4L 1TZGL 5DYOA 5DO2D 2W59A 3MLVH 5BW7C 1U58A 3MCLH 4YHKH 5T3XD 3TVMC 4OCXH 2R8SL 2NY3C 1FP5A 2VXVL 4LCCC 4PV8B 3DETD 5MEPB 4NP4H 5C92A 3SHSA 4NJ9L 2FGWH 1L9MA 5C0AA 5JXEA 1P7KB 4WU7A 5HHMB 3GGWA 2CRYA 1A3RH 1CYGA 1R3IH 4GRWE 3BHBB 4LASL 5FO8B 4HS3B 1FNSL 4S1DD 1I1AB 2MQ0A 2EDDA 2Q86B 2DMKA 3FT2B 3A6OA 3NCBB 2C1PB 5T3XE 4H1LA 5MHSD 2CGRH 2LAGB 3PGFH 3Q5TA 5D5ME 1UXWB 2C9AA 4NN6C 1NMCC 5JUEH 2NZIA 4F9LC 2A2QT 1VEOA 4WI3A 2X1PA 4NQCD 5J6GB 1QQDB 4YHZH 1K4CA 1MCKA 1TJIH 1U8QA 1JMXA 5L8LB 4BFGA 3VI3F 3OXSB 4GKSB 3RKPA 2Q7YB 2PCPA 1X5JA 4ZUUB 4LPWA 4K7PY 5LWYH 4D8PA 2BCKB 1TETL 5GXBB 4YHNA 3GKZA 3L9RA 4RBPK 2HFTA 3VXTB 5CP7B 5L6YL 5TDOA 1P4IH 1EFXA 4P5TB 4ZTPL 3QPQC 2IBZY 3TBYA 3F62A 1ZLWH 3V5DB 2AABL 2NX5E 3RIFK 3TF7C 1UM5H 2YRPA 3SDAC 2EDJA 4PJXB 4N9OB 3QIWC 2VLKD 2H3NB 4XWOD 3UEZA 1UH2A 2EDLA 1RZJH 4QHKJ 4HMEA 1UM6L 3G6JB 4JY4B 4X6CE 5ICXB 4JDVB 2CMRL 3B2VL 3VDCA 3O4OC 3PIQA 2FSEA 1KT2B 4LSVL 3MGTB 3N06B 3V5KA 2Q76B 5I0DA 5IB2A 3RA7H 1GC1H 2VLKB 2KKQA 2FZ3A 3FB8B 3PWVB 2VDLH 4YPGB 1FPTL 5FHAL 3QP3A 1TNNA 2ENYA 2FBJH 4Z8FH 2NX5B 4WUUB 1J0IA 4PJXF 1QRNE 1I7TA 3LPWA 1B9ZA 3PWPB 3ARSA 3CNKA 1CD1A 4GW1A 1UADC 3VFPB 1SEBB 4Z76B 5FM4A 4P9ML 4TNVK 5I19L 3OX8B 1Q9KA 5DC4B 3V7AE 1TFHA 5DSCA 1CBVL 4L5FL 4MDJB 1ZVSA 3SDYH 3EO1A 4X6CA 1MY5A 3M17A 5FK9A 2HTLD 1NJ9B 5I71C 5DJCB 5E56A 4KJYA 1R5WA 4JFZL 3EYUL 1ZGLM 1KXQE 1AFVL 3I2CL 4YAQA 3ROLA 4GBXA 3QO0A 1G9NL 2JIXA 1IM3A 2FD6H 2YN5A 3DETC 3IU4H 2HT4D 2PR4L 1U9KA 3U9UA 4OI7A 2KQMA 2A38A 3DYOA 1XCTB 3MLTA 4GG8A 1A6TA 1G7PB 2BY0A 1NMBL 5GRUL 4Z7QF 2X1WL 2DBLH 3GBMH 2EDTA 5J3HC 5EG6C 4MJ5A 3VXQA 3O6FC 3MOQA 4Z7VF 2ORBL 1YN6A 1RIHH 5ACLA 3SY0B 1MRDL 2Z91A 3CK0H 3NBNA 5EC2A 4PTTB 3RRQA 1CDJA 2YD3A 2VDOH 1ZK9A 4PJFE 3M1BA 3D3VE 1G7HB 1IGTA 4G42B 4OLZH 3AS0A 1N59A 3U48A 1IVLA 3VFGH 3VXRB 1KTLA 1F3DJ 2F53D 5D72H 3MO1B 2DLEA 3BGAA 1MIEL 1S7TB 4WI7A 3C60B 1WC7B 3MBEB 4H8WH 2UZIL 4HIJB 2DRUA 2VWEE 3P4MA 4OFKA 4OLUL 3RWGA 3ZYZA 3BZEB 5TQ0H 1S7TA 2VO5A 3K74B 4AEHL 1X5HA 1RUPH 3NH7H 3MUGA 3BP4B 1GRWA 1Z9OA 3IFNL 2LQRA 4M62L 3B43A 4NNXB 3U4AA 4NRXA 5JW4M 3T2OA 2CDEA 3H9HA 4PFEA 3TO4D 1KJ3H 1AQDA 5EU7E 2A6JA 3R1GL 1TXKA 3FQWB 3VWKC 1PD6A 5GGRY 3T1WA 3T2QA 1VSCA 3CJJA 4KJPC 3TIEA 4P5KB 1OAXL 2OYPA 2CLVB 1PYWA 1ZOXA 3PNWB 1AIFA 1KJMA 5F9WB 2FJHB 5ESVA 2X4SB 5DJDB 4Y4FC 1OARL 1VFBB 4Q0XH 3T4YA 1DE4A 4R26L 5IB4A 2NY7H 1CR9H 3VXOA 1XIWD 1ZSDB 1RMFH 1FV1A 1RULH 4ELMB 3RTQB 1CIUA 4LOUD 2ADIB 4HUWB 3TV3H 3UJIL 1CICA 3RX5A 5CZVL 3CPLB 4RBPH 1I1YA 1HH6B 1PVHA 2ICWB 2MWCA 3P0YL 2EYTB 4OCWL 5CP3H 3T0XA 4J3VA 3TBVB 5ISZE 3N85H 3DVFA 1NH6A 4ODVH 1RY7B 2DQEL 3O6LL 3SKNA 4L8CA 1MNUH 3KPMA 5DMJB 4NC1C 3UTZB 2A6KA 2VXUH 3MRKB 4GRLB 1XGUA 3NACL 4L1HA 1T1ZA 3KYNA 5C2BL 2AK4A 5E8DH 2JJTA 4OZ4B 4FQQA 4YIQB 4I1NB 3SOBH 4FQCL 3DPBA 5I1JL 5KVGL 5HD8C 5DLML 4TUOB 3B5TA 1B2WH 1VEMA 4D9QD 1T1YB 1YMHB 1CGYA 5JA8B 1FNHA 2ZCHL 3MRKA 1QYGH 2VERN 3D39D 4XBEL 3WKML 3TO2A 1F42A 3UBXG 2CKNA 1CK0H 1RUQH 4AIZB 1VGKB 5IR1B 1G7QB 1YUHB 4KUZL 5EPMA 3VI4E 2R0LH 5IGXL 1BHGA 2H2PC 5HDOA 3EGSA 3L7EB 3QIBD 2HT2D 2CLZA 3N9GL 4QYOB 4YDJA 4ZXBD 1PG7L 1P7KA 4MXVE 4WU7B 4P2QD 3MRJA 3V4UL 5A2IH 1U8HA 5DD5L 1KLFA 2R2EB 3UTPD 4P2QB 5F7HA 1JYXA 4MHHG 5B8CC 1U8HB 3VXUB 3SKJH 1YEFL 3JTSB 4CMHC 5T5FL 3THMH 4E41B 1XF5B 4LLVB 3DXAB 4O58L 2EIBA 3FO1B 4OCNC 3CXHK 5IF0B 4NZRH 1HHIB 3MXVH 5EIVA 5DDHA 2FCBA 4FFZH 4HIIA 1X4XA 3K1DA 2DM2A 2H6PB 5HGBA 2XZQH 1PKOA 2G5BA 4KZEH 3TVMB 4XRCB 4NHUA 4OFYA 5F7DA 3RVTD 4LCCB 5JOFB 1VACB 5E6ID 3TCXA 4AY0A 4F2MB 4HWEH 3QDGE 3CFCL 3LEYH 2OJZL 4HT1L 1JWMA 2B1HL 4UOW1 2CK0L 3FTGA 4KUCF 4BH7B 4HAGA 4Y16B 3TLRA 3CCHA 1HI6B 1F6AA 4PRBA 4YGVA 3X3FH 1T20A 3VMNA 4MQXD 2WUCL 3BKJL 4YX2H 2VC2H 4P9HC 4DK6A 3OPZH 2VQTA 3FO9B 1TTFA 5I1LB 1KELL 4OV5A 1L6ZA 2VITB 1ND0B 4PLJC 4BQBA 3BKCH 3HCVB 4P3CH 3QT2A 4L3CA 5C9JA 4HXBL 5E4EC 4RGOH 4L8DB 5FV1L 3QDJB 4PJBA 4UMGA 3TBTB 5IB1A 4XVTH 3SKMA 3JZ7A 4F7TB 5E08L 3DI2B 1GGTA 1NMCB 4YHIA 4JDZA 2VSCA 2YPLB 1ZE3C 3BEVA 2XQBL 4BZ2H 4DKDC 4BZ1L 3NIFE 1XZ0A 4JFFE 5E8EB 1KCUH 3QUXB 5DUML 3ZTNH 3MOBH 4R4BA 5E7FA 5FKAB 2PW1A 4Z0BL 3LY6A 5J4MA 4U1JB 1BP3B 3E2HC 2IANE 1I3UA 4R9HA 1BBJB 5FUZL 2CO7B 4ODWA 3F5WB 4ZTOH 2JF1A 5EOQL 5JW3H 3HG1E 3RUGB 3VFRB 3BUTA 2NTSP 3MGOB 3T0WA 1NEZA 1R3KB 5DT1L 4BK4A 5K9KA 1CF8L 2J5LC 4PJAA 4WFED 5DHVB 4D0CB 5JOEA 1GZPA 5KN5B 3UZQA 3H9SD 4P46C 4CVZB 4UU9B 4U1NB 4QWWC 3LIZL 1M7IB 5CEZL 3VXNB 4PJIA 1I3GL 1JFQL 1V7MH 4EDWH 5J1AA 2VOTA 4J1UA 1WVZA 1A8JH 4LLVA 2GFBA 1AGEA 2DIJA 1VESA 4IRJC 4HPOL 4LSRH 1T1WB 1AD0A 2DQTL 4JG1L 2CDGA 3MROA 3EYVB 1KJ2L 4UNTA 5FGCB 2W0FB 2XTJE 2F5BH 3H6JA 3DHJA 1ODAA 5C6TL 4X7EC 4NZTH 5AD0A 1ACYL 1T2QH 1AC0A 5GRVK 2DLGA 3LMJH 4HWNA 5MEQA 3RGHA 3SCMC 3ULVF 2APTA 4L3AA 3VH8G 4TUKL 3DIFB 4WTXA 3MV9A 2W9DL 3A6CH 4DGIL 3QIBB 2VLLA 1RZIA 4XGZB 2ADJB 4OF3A 4X83A 1FH5H 4LQFL 1H3GA 3ULUC 1A1MA 1IM9A 4GLRI 2NYYD 3O8XD 4X7TA 3O8XA 2CJUL 3QJHB 5DUBA 1F2QA 4UUJA 4Z5RB 1FZKA 4KRMB 1XGYL 3UTSB 5IBTL 1RK0A 5D1ZB 1DBAH 1M7DA 2DB8A 3TBWB 2FLRT 3U46B 4FQ1L 2V17H 5C0GB 2H32B 1FNFA 5FFLA 3WS3B 2NY2C 4YPJA 2VXQL 2HFFB 5CJOH 2VDKH 1GAFH 1N4XL 4PJHB 3C60A 5DHYB 4Q6IB 4G9FA 4RGMC 1WWBX 3EOBA 5HHVH 3EO9H 1C5CL 2DM7A 1MCPL 3PQYA 5JHDA 1JPSL 4HIHB 3U46A 4EZMA 2J5LB 5T5NG 4ZS7L 2ARJQ 1EGJL 2PETA 3BP4A 4LPCA 1UWGL 1G7IB 3TM6A 4QHUB 5KSAD 2NW3A 3KPRD 3GMRA 4WHYG 3T0EB 2JELL 2Q7YA 3WLBA 4OCYH 3HE6A 3NTCL 1I7TB 1P9MC 4IRJD 4Y4HD 3CH8A 4NQSA 4YHLH 4C54A 1U8JA 3OF6D 4EBQH 1NGZB 2ZJSH 5E2WH 5F88B 2P47B 4YZFE 1F4YH 3LN4B 5ANMB 1UFUA 2E27L 3JV5A 1R0AH 1LE9B 3B5HA 1F45A 1MI5E 4NQDE 5F3BB 3QXDA 3VXOB 4PJDE 1KTKE 5DQJA 3GMQA 3WMSA 5CIPA 3T77A 5HVHC 2R4SH 4Y4HB 1UXSB 2EC9T 5C08E 1FGVL 3RVXD 4XVSH 3F7QA 2X4TA 5GRYA 2Q8BH 4BH8A 4HFWB 3G6JF 4LLDA 5INDA 1GIGH 2OZ4H 1EMTH 5TF0A 4JO3H 4Y0GA 1QG3A 3HE7C 3NCJH 4OLYL 4ODUB 2ADGB 3K3QA 5E8PA 5KS9E 3PQYE 1KEMH 4U1HB 3V95A 2OXHA 2ZPKL 5SWSB 1DQQA 3L5JA 3MACL 4NBYB 3O3BB 3O2VH 5MI0B 1IGFH 1CU4L 3CSGA 3DO3A 3G5ZB 2H32A 5FXCH 3GSOB 5LXGL 1TQCC 2MHAA 4GKOA 1FFPA 5D5MF 3QCVH 5KVFL 2X4NA 3OAUL 3EJYC 1RHHA 4OBSA 4KQ4L 4U1GC 4KPHH 5DQDH 2AJZA 4MS8D 5IW6A 3VE0B 4L4TE 1MFDH 5MEND 2P5WB 2Z92B 1NQBA 3D2UA 3ZSSA 3ROLB 4PJDA 3WFDH 5DA0B 2J4WL 5CJBA 2ZCLH 5IFAH 1M71A 2J6EH 2VZ3A 3WHXB 2DS4A 5T3ZL 1R24B 3B9AA 4U1SB 1PKQB 4R0LC 4KK9C 2HJFB 2O5ZH 4GXUM 1BZ9B 2YPVH 4PJ7E 5D7SH 2XN9E 4OKVA 3S7GA 3LKQB 4Y4KB 4MSWB 3HNSH 2HTLC 1F3DH 4QGTA 1MFAL 4Z7VB 5MENA 2OTUB 3HC0B 4TSCL 4YFLI 5SX4I 3I84A 1NBVH 5B8CA 1AQKH 4X8JB 5IJKA 5JA9A 1WIUA 4H0IA 4KXZH 2D0FA 3WLWC 1UACH 1WZ1L 1KV3A 3GHEH 2DL9A 5ID0A 1KB9K 5C8JB 2GITB 2O5XH 3UJJH 4YGVB 3Q6FA 4OF6A 5DUPL 2QHRH 1Z2KA 4XWGL 2VXTL 1W8NA 4XNMA 1RJLB 4QRRE 2D03H 5B8CB 3HI5H 1V7NL 2AK4D 5JXED 4ENEC 5IVXE 1LO5A 4F15C 1ZLVK 3EFDL 2NNAB 5JQ6L 1U3HD 3WCYA 4P23C 4F57H 3BYTA 1NBQA 1N64H 1T7XA 5FYJH 3B6SB 5TDPB 1KJVB 2FEDC 3H9YA 1SMOA 1EXUA 3U7YL 5DZOA 4M3KB 2R0ZH 4Q2ZA 5L2JA 4OSUL 4R3SA 1FJ1B 2G60H 1KUMA 2Y6SC 3PIQB 2F54E 4X80H 3ARVA 1W0VA 2AXFA 3TWCL 4U6YA 1A1OA 2P24A 5C0AD 3ULSB 2NZ9D 4U1GB 1KFAH 1XIWA 3EHBC 5FUOL 1I9JH 5HYQB 1A6AB 3P9MA 4LGRB 1SQ2N 3OR6A 1XIWB 1OTUC 3MV11 5EORL 3I9GH 3GIZH 5CGYC 2B2XH 3M17B 4ELMA 4HUUB 4CMMB 1CWVA 2MQ3A 3CX5K 3P77B 5I1IH 4WHDA 2BDNH 5ISZA 3STZA 3VD4A 3B3IB 2Z4QA 1U41A 4LKCB 2W07A 4G9DA 3ZDYF 2R1WA 2F54B 2DF3A 1GCFA 1UWXK 3OXRB 5I6XB 3OJDA 4YXKH 3L95A 4XHQA 4OZFH 4L8CB 1S5IH 3S35L 3S98A 3KVQA 3WO3B 1RD6A 1BQUA 4NJAH 1DFBL 5CJXA 1EZVX 3QQ4B 3CVHL 2VLRB 3FOLA 3MOAH 4EDXB 1MCWM 3BT2H 3QQ9D 4N9GB 4IS6B 4R0LA 1RK1B 3X14B 3B3IA 4OZ4A 3DUSB 3QRGL 3TT1H 3PQYD 2R1YA 1NCDH 4DQOL 3VRLF 1GGCL 2H6PA 5CINL 5IJKC 1NDMB 3DUSA 1D6VH 4JRYE 4KI5C 5L7XH 3FOMB 3IFPB 4PTTA 2EEDA 3O4LD 4U1IA 1JGUH 3OR7B 3LV3A 1Q0YL 4PRAB 4DAGH 3V5HA 1FYTA 4WWKC 1HSAB 2ADJA 2NY6D 1U6AH 3LOWA 1URLA 4M1DL 3UDWA 4FABH 1P4BL 2B5IB 2RCSH 1SY6A 2X40A 3ROOA 2WP3O 5DJ0B 4QYOA 1YQVL 1FZKB 1WWCA 1MI5D 4MZ3A 3O6ML 3RDTC 4Y1AB 5FA4B 2F74A 3SPVA 4JDTH 3O81A 2D3VA 1KIPB 1RZ8B 1KJVA 3OJVC 4JFOB 2GW5A 4XI5C 1NL0H 3VXUA 4FNLL 1U8LB 4WFEE 3D85A 1D6EB 1E4XL 3MV9D 4JB9L 4S10A 1XFPA 4HJGA 1M7XA 5F9JB 1W0VB 2AXFB 1RU9L 4V2CB 5F6HI 4Y88A 3T4AB 2WW8A 4HGKC 2WQRA 1RVFH 1EDQA 3MLWL 2DLFL 1WFTA 3U7WL 3QIBC 5HHNA 2FR4A 2VZ1A 3O4LB 5E8OA 5I16B 1Q72L 5JXAH 1YMMA 2E8YA 2ITDA 3TPUB 1EK3A 1ITBB 3O9WB 1A7QH 2KBGA 3QH3A 1LQSR 5HYJA 4AM0A 3ARDD 5K9OB 2J88L 4LLYA 3RPIA 3BO8B 1BQLH 2YPLE 5LVEA 1OGAD 3ZMRA 5D7JA 5D6DA 5JLZB 2XA3A 4WHTB 2FR4B 3CPLA 5JW4R 4G8FA 3IF1A 3WFEH 3IETB 4M5YH 1YNKH 1ZSDA 2DICA 2M8XA 2HRPL 4JR9L 2AJ3B 2ICWI 5DMIH 1WWWX 4TVPL 4WVRA 2IGFL 2ITCB 2P8LB 3WNPA 5ERWA 2Q20A 3QUYB 1Q0XL 2GEEA 4URTB 1HYRC 4NCDA 5DJYA 5IW1B 2D31A 5E4EB 2FWOA 4WWKB 4GJTB 5J56B 5FDWA 3F58L 4LPVA 4FFWD 4TOYH 2IANA 3QUXA 1MLCA 5AD0B 3MLYH 1E6JH 3MV8B 5J13C 25C8H 3CMGA 4JM2F 3OJ2C 3N1FC 3EKCA 5J89A 3P4NB 3MV8D 4M9PA 3QIUB 4PRNA 43C9B 2H1PL 1KC5H 1MCFA 1UGNA 3E2HB 1U3ZA 4MAUH 2DBJA 1MCOH 3OB0K 3RBGA 3RUGF 4UV4H 2WZPD 1S7SB 2APFA 1LO0H 1S3KH 5IROA 5K9JL 2JE8A 2P46B 3MNZA 1JPFA 1CD8A 3QIUA 1U0QA 1RZKL 1KJ2A 3MA9L 4JREC 4JFDE 1QHOA 4NQEE 4XPFH 3EIFA 4NQCA 4YEEA 1Q38A 4Y2OA 5HJ3B 3V4VH 5FYLL 4RGNE 4KJWD 4YDVA 3TH4T 2YC1A 3FQRB 3S3JA 3GSNH 2EDYA 4Y19B 2X4PB 5DEGB 4FQJL 5I2IB 1ZANL 1NBZA 2QBWA 3X3GL 4EIZC 5C0IA 5EU7C 3ARTA 2W91A 4F7PA 3LRSA 1QLFA 4K94L 2XY2A 1FZOB 3W82A 3HI6H 1XF1A 3C6SA 2BY3A 4XPTL 1OF2B 4OLWL 1FFRA 2APVA 2V2TA 3D9AL 4NHCL 4JZOA 1PKQA 3IVKB 2EEAA 3C8HA 2NW2A 4IOIB 1ZXQA 3OGCA 4XMPL 1J86A 4XCEB 3BMWA 4GOSA 4XBGB 4HFUH 3L5WA 1FGNH 3DVGB 3GBLA 3QUKB 3ZKMD 4MQ7B 5ESQA 3ZKNC 3WFCH 5EBLB 1OY3B 4OAWB 4BQCA 1RUKL 5EB9A 3V5DA 2G5RA 4JQIL 2MSPA 4KUCD 5F3HB 3IVKA 4WI5A 2OR9L 3QUZA 1F4WL 4QRTA 4LHUA 4CN6A 1QVOB 3RHWF 1MOEA 1BM3H 3PGDA 6FABL 2W1NA 3DGCR 4LSQL 4JG0L 3TIDB 4APQA 5F6IB 1EFQA 1EHLH 1YNTA 2X4UB 3KXFB 3QUXD 3P0VH 2GJZA 4WI9A 4G9FE 3W11D 1D3CA 4RNRA 3RAJL 1P5VA 4EQ3A 3C5JA 3ARGB 1JN6B 3AU1A 3WN5A 4YFLF 5EOTB 4X9IA 4M3JA 4BSWA 1NCCL 4PJHF 1P5UA 4PJ5A 4YHML 4UAOB 1UJ3B 2I9TA 3VFNA 5H94B 3GSQA 1OD7A 4E0RA 3PWVA 4P3DA 3H3PL 1A6UL 1NAKL 5H8DA 5GS0L 3F7VA 4MDIA 3UO1L 2FSEB 1TCRA 1KT2A 1QOKA 5CCKH 4P5TC 4DJMA 1ZT7A 4J4PD 2FX9H 4RGND 3QCUH 5DTFA 2I5YL 3LRGA 2X9XA 4K8RH 4R4NC 4KH2A 1BBJA 4OJFH 2EC8A 4ZMAT 1F3JB 4U0QB 3F5WA 5BJTA 4DOHE 4HS3A 4JO2L 5HYIA 1NSNH 3ETBF 3ARDA 4XBPA 3PHOA 1N6QH 1T0NA 1LDPH 2F5AL 4A6YH 3HB3D 5SV3A 3LKRB 4YXHL 1IARB 1ORQB 1DN0A 4F7PB 3S97C 4U7MA 3NGBB 4U6VL 4YGAB 2Z31C 2DDQL 5DWUL 5JIIA 1BF8A 4XMKL 1K4DA 4EUPB 5I76A 2DQJL 4GRWB 4Y4HC 5TFSH 1C7SA 4OQTL 1QSVA 4EVNB 4CU8A 3VFMA 1B4RA 1SVZA 3CDYA 4W81A 2YMXH 4HWUA 4N8VG 4BFIA 3ZE2E 1JYWA 3GIVB 2Z8WC 4UINL 4DFHA 4MA3A 3TC9A 1O7SA 5GRJH 1YEJL 3GIVA 4GAFB 5GGTA 1IM9D 1YDPA 1I85A 3BUYB 5GHWL 4G7VH 2WBKA 2OL3H 3O3BA 3REWA 2OTUA 4J2XA 4YDIL 1CFTA 2FX8H 4RFOH 3HN3A 4MNQD 2YSSB 3BJ91 4H26B 5E9DB 4NSKB 1FFOB 4OGXL 3RWCB 2CRZA 2ZOLA 3SDDD 3U2SB 1J18A 2AQ2A 1DBMH 1FNGB 2IPUK 1OGAE 1NCWL 1WIOA 5MI0C 1CFNB 4UAOC 4IMKC 5A16A 1VA9A 3E3QC 1QNZH 5DURB 2AXGB 5HYSG 4JVUA 5F96H 4PJ9B 3RZCC 3CVIH 1AE6L 4JDVA 1LEGB 1QACA 3PABA 2DQDL 1L9NA 3ARWA 4Z7VE 1P9MA 2WWMD 1DR9A 4PJDB 3WSQL 3DNKA 3O6FB 4POUB 1FLRH 1KIQA 2NNAA 4ODHH 3WS3A 4QRRA 3RFZC 3TH2T 5C0ND 3OKNB 5AUMB 4N8CH 3TA3C 5LGHL 1HZHH 1MFCH 2WLYA 2XWTA 3DYPA 1A6ZA 3MGTA 5FM8A 3OAYK 4OZGB 2HKFL 4XXCA 1F3JA 5BJTB 1K3ZA 1YY8B 3QHFH 4OIAA 5F88A 3WDJA 4XPGL 4XNZC 4UTAH 3C2AH 4PJDF 5LQBL 4LDOB 2ZUQB 3KYOA 1LO4L 5HYJB 1UM4L 1LD9B 3MBEC 3CD4A 2D9QB 3B9KA 3INUH 3QAZB 4I4WB 2VISA 4AH2B 5I1AA 5JTWA 4UBDD 4P2OD 4IDLA 4MVBC 3V52L 1PZ5A 4K3JH 3MYJA 4JGUA 2XWBB 1M05B 5H37G 3QJFA 4U7KA 4KU1A 2DM4A 4KGLA 4OZGF 3ZL4L 4LHUD 1Y18A 2YD1A 3VFMB 1P53A 4OZGE 1CXLA 5D7IA 5DJDA 4JRYD 4F9PC 3KPRB 1F3RB 3VFVA 3MJ9A 2P5EB 1L7TL 2EDEA 3GBNH 3JWDH 3NZHL 3QJFB 2R2HA 4I77H 4X7DC 3L5XH 1HIMH 2GJ6A 2VH5H 1G7PA 3VGDA 3RWJB 1FJ1A 4P9HL 3QHFL 5IT2H 3Q2CA 4AG4L 3EOYG 3Q5YA 2X42A 3ARYA 3MGAA 4EOWH 4MD5A 4XMLH 1JHTB 4RQQB 2DI9A 4QNPF 1LK3L 4POZC 2XN9B 3EYSL 1X5AA 3KPQA 1A6AA 2EYRB 4MXQC 1IMHC 5JW4Q 2KZ1B 2GAZB 1XGQB 1U3HA 3LQAC 4RWYL 1N8ZA 1OAZH 3O0RH 4M7KL 1QZ1A 4G8GB 3MRGA 3VI4F 5EU3B 1I9IH 4ZFOA 1FC1A 1FYTE 4FMKA 2VLJD 4XAWH 2DQDH 4NRZA 4JFEB 4BQ8A 2YWYA 1YEKL 3TA3B 3ARUA 4HUVB 4OZFB 3IDNA 1N59B 1B6DA 3P9WB 2D9CA 2YA0A 4JRYB 3IRZA 1H3VA 4KKCD 1J8KA 1JNNL 3UROR 3VRIB 2FO4B 5EBMB 5I1CL 3S6CA 4FXKB 4DZBB 3EAKA 4UILH 5FGSA 4OGZA 1BLNA 2XT1B 4KROC 1FVDA 3BWAA 2X9WA 2YN3A 4HJJL 3PDGA 1AP2A 1I7ZA 3OKMA 4F33B 2XKUA 2QSCL 3C08H 2UYLA 5I8KH 5JDSA 1MREH 4QXUH 1R3JA 2DM3A 2EDQA 3MV7B 4LCIH 3QA3A 1IQDB 1IKNA 4LIQE 3KPNA 5C09B 3ULUF 1GZQB 1LD9A 3T4YB 5C08D 4YE4H 1QSEA 2P44B 2A9ML 2DJ4A 4P5KA 2HG5B 5MENB 2ZNWA 4NO2A 4M4RA 3WD5H 1NAMA 2E7BA 1QD0A 4WCYL 1HH6A 1KENH 4NQDD 4JREB 4S2SB 4R7DA 1ND0A 2X1XR 1MJ7L 2X10A 4U6VH 5C09A 1OM3L 1SYVB 2F54D 3GNML 3QYCA 3S8WA 4NOFA 3ILPB 4JE4B 2VKXA 3CVHB 5K59E 1FAIH 2BXZA 4GRLA 1KPUA 1PX4A 3CXDH 1JWMB 3WHE1 2K9UA 1MCWW 2PW2B 4MJ4A 4L9LB 1BEYL 5IUSA 1ZV5A 2GJZB 4PG9A 1HXMA 4RA0C 4TUOA 2WNGA 1X5FA 2ICCA 4JO1L 4KQ3L 4OCMC 2X4QA 4LOUC 5HYJD 2YA2A 5HGDA 2FEEL 3FFCB 4YIQA 3QHTC 1F8TH 1YMMD 2HTKC 5CCKL 3EYFB 3MNVB 4HW6A 3PV6B 1OAUL 1T21B 1FVCA 2AJYH 3WXWL 5J1SC 4M1CC 5I18H 2XWJB 4KI5E 2JB6B 3DVNB 2BSRB 1NEZB 1R3KA 3F7YB 1JZ2A 3BRGC 5ITBH 4QY8A 4LEOA 5CJQH 3TO4A 4PRHB 4ETQA 2CDFB 1OHQA 4K2UH 3V8OA 5GJTL 1RJYB 4PP1C 1VFMA 1ADQH 4QXTB 2HLFD 3HZKA 2AERT 1J5OH 1MEXH 1X5IA 1OD9A 2CKBA 4XHJD 4JPWL 4HEME 2OMNA 3ARGC 1FCGA 4PRHA 4J23A 4HIXL 1I3RB 5I30L 2BX5A 4YC2C 3LZFL 2R1XB 4YUEL 5B39B 3DMMD 4X4YA 4UT7H 3WFCL 1HINL 3PF2A 1MHCA 3NPSB 4DWHA 4OT1H 5T1LD 2JK5B 3ZHDA 4WW1B 3QG7H 4HUXA 2D0HA 3D0LA 5B38B 4JY6A 2CKBB 2YPKA 2D7OA 3QWRD 2ZUTA 1CLYL 3VD3A 1EUUA 1QSFB 4W6YB 2FB4H 5DRZB 5EBWA 4PRDA 4KDTA 3RDTA 5E0QA 4N5UA 4U6HA 2CKBL 1J1XL 3DSFL 5DD3H 3FTGB 1ZWIA 4HDIA 3MJ7B 1BVKA 5GPRA 2ZUXA 5GS2D 3NFSL 1JZ5A 1MHCB 4PYHA 1BREA 2HKHH 5JOFA 2H41A 4DUVA 3HNTH 4PJIE 5HHXH 2NY1D 2VAAA 4YDLC 3H9SB 3PUCA 4PRIA 5BZWA 1ZHNA 1GPOH 1KXTB 1RZKC 5FA3B 2OP4L 4F7CB 1LNUA 2F74B 1MHPH 1T2XA 1U95B 4G3YL 4KK9D 4XXDB 1BQHB 3ZHLA 1OAKL 3BQUA 5J9PB 3FL7A 4ZFZB 5EZLB 4CUCA 3TYGH 3HG1D 2VAAB 1MLBB 3OAZH 3O8XB 1WAAF 4X99B 2VDPL 3LS4L 5TE7L 1KGCE 1OQXA 1LO0L 2FH6A 1LHZA 3W5MA 4I3GA 1A7NL 2BOCA 3PWLB 2YKLL 4I3SL 1FVCB 4YXLL 1X5XA 4G8EB 4FOMA 2F53A 1N5AA 3BP6B 4J3UA 5HDQH 1FZMB 3V5KB 1ZHLA 3HUJA 5JHDB 1CFBA 1EPFA 4I0KA 1NANI 1X7QA 1HCFX 3LKSA 5BZDA 1Z3GH 3RVUC 1KPRA 1UYWH 3BO8A 5GSRA 1QTYT 5EO9B 1BIIA 1IFHL 1XGTA 5TE6H 1U8PA 3FN0L 2COQA 2WBWB 3OZ9L 2AEPL 3DYMA 1MPAH 4K7PX 1YPZE 4J1UB 2BVOA 2NY5L 4P4KA 4LRNH 3OJMB 2OR8A 3WIHA 4CDGC 3TP4A 1TJGL 2NY5H 4UU9A 3B9KB 2HTKD 4U1NA 5EOCH 3PL6A 3FN0H 4N8VA 2R4RL 1QBML 4NM4L 2CLRA 1U2CA 4BH8B 1AGBA 3TVMD 5DK0A 3M8OL 4HWZA 1MFBL 4LSSL 1YEEL 3QPXH 5KVEH 4IRZL 5T3XL 4N0YL 4GBXD 4U2YA 2XI9A 5M95B 4ORGA 3K8MA 3WIFA 1KF9B 4P46D 4PIRF 2XTJD 2HLFC 5KTEH 4N1EA 3OKKB 3ILQD 5SWQB 2XQYG 4LEXL 4YXLH 1TLKA 5F21B 4MD0B 4MXWH 4LP4A 1ONQA 5FCUL 5DFTA 2GJ6B 5SWQA 5GZND 1C16A 4WUUE 3GRWL 3ESVF 3MUHL 1IRAY 1BFVH 1H9VA 2CXKA 1JVKA 5DRXA 1C5DA 4QLRA 4ZS6D 4WNQB 4V1DD 1CVSC 3NCCB 3BQUC 1CD9B 1I8KA 1X5KA 3QAZC 3BYYA 4RISH 2P42B 3HI1B 2E6QA 3K4DA 4UOW0 3G6AA 4CVXA 5JPMA 1EV2E 2OR7A 5GSVB 5T33L 1LE5B 1OP5K 5HYEA 4KI1A 2XA8H 5F7YC 4NIKB 1MFEH 5HY9A 4HC1A 3RJDA 2A6IB 1MWAH 3LKNA 5ITFA 3GHBH 3OKOB 2OM5A 3BPLC 2WUBL 4WO4A 3SBWA 5JW5B 1UVQB 5JMOC 5JHLL 4JY5L 3OWEA 3T0VA 4TSAH 1U42A 3AXLB 1JPST 4D9QE 3SJVA 1WAAA 3IRPX 1B6UA 1NCTA 1E4KC 1T80A 4JFFD 5EO0A 2LU3A 3Q1SL 4QHUA 2X4NB 3FN3A 4WUKH 5I73B 4XVJH 2DL2A 4BSJA 1C8PA 3EDEA 1J87A 4ODTL 3QG7L 3SN6N 5L7XL 4F33A 4YHOL 3SDAD 5C0JB 1V3JA 3WV0A 1TQCB 4DZ8A 5IQ9A 4K71B 2F19L 3LZFH 1IJ9A 1F58H 2Z8RA 3O2WH 5C07E 1LILA 1BIHA 3QRGH 3TT1L 2EO9A 3ZYJA 1YNLH 3KJ6L 4GXVH 4O00A 4GKSA 3KPOB 3D5OF 4MAYA 4ZSOE 5IMLB 1G7JB 1T7VA 4UNUA 3QQ9C 1FO0A 1BVLB 5DD1H 3LEVL 2IPUG 3PWUB 1DSFL 1PZ5B 1CLOH 3QUMH 1NUNB 1B3JA 4GAYA 4R7DB 4MA7L 3T2NL 4GRMB 5HYSB 1EHXA 4HFWA 1LGVA 3KPOA 1IGYA 5JO5B 1JIBA 5KANG 4BSWB 4YHPB 4C57C 1AD9B 4PJ9C 3RZCB 5I18L 2ZCKH 3AS3A 3JVGC 4L4VB 5MERA 2AJXL 3IDGB 4ZUSA 2J6EA 2X41A 3K1KC 2BVYA 4XVUD 1UEYA 2Z9TA 2DQUL 4BJLA 3CFIC 3GSQB 3DUUA 4DN4L 2O61A 1G9MH 3NCYS 4P57A 4YK4C 3RP1A 1EAPB 4FFYH 4P3DB 5LJYH 1CICD 4LLQB 5I8CA 5DC0A 5IQ7H 1DQJB 4GS7B 2D7PA 4I2XB 3D69A 3IXAA 2MCPL 1SEBA 2NPLX 4XTRD 1QFPA 4WI4A 4LRIA 4MJIA 4U1MB 4QRPD 1ZA6A 1Q9OA 4LCWA 4P2OB 3UPRA 4PYGA 5BRZD 1A2YB 3LKNB 1KB5L 4LNRA 3MX0A 3VGFA 3IXTB 4Y2DC 5SWSE 4ZFOL 1ORSA 3PWJA 4TRPH 4J3WA 4ELMF 5HVWA 1NBYA 3O3EB 3QEUB 2VL5A 2OQJA 3IFOB 5GGRB 5ELIA 5D2NB 1SHMA 4GAJH 4UIMB 1DSFH 5IB5A 1CG9A 1KB5H 3DUHA 1KCKA 5HI3D 4MJ6A 3BRDA 1DLFL 2LFGA 5CD3A 5CHNA 2R69H 5C0CB 1JWSB 1DVFC 4PGJA 1DTUA 1WZLA 3QWOB 4X0KA 1K5NA 4OTXH 3LS5H 1F00I 5E2UH 3VXQB 5JR1H 4KV5E 5ILTH 4X7FC 3WNLA 1MCLA 4MVBD 1I7UB 1MRFH 3EYOA 3BPNB 4OD3L 1CGUA 4HIIB 4R97B 5T1KB 5IESL 5DJ8B