1C8XA

Endo-beta-n-acetylglucosaminidase h, d130e mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFEDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
total genus 91
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c8xA00
3VNYA 1EO5A 2XVGA 1HJSA 1L8NA 2DPEA 2VX7A 4OZOA 3W82A 4HMEA 3II1A 3NYDA 3ZJ7A 4AZIA 3SCWA 2WSKA 4GI6A 1JIBA 1ISZA 2XJ7A 3WMCA 1MFUA 3CZLA 1MW1A 3GYCA 1AQMA 2WHLA 4MAZA 2WC7A 3AYRA 3WBAA 1DHKA 4FMVA 4CUCA 1ZJBA 1PZ2A 1UH4A 2Y5EA 3AS3A 2VVNA 3AMGA 3ZT7A 3POHA 2WMFA 2J77A 4W7UA 1B3XA 4D6CA 4UNIA 4UFIA 3IK2A 2X09A 5FL1A 3TONA 1WE5A 1IV8A 1MFVA 2CHOA 5KZ6A 4OIFA 5LA1A 3WL0A 5EMYA 4HOWA 2XGIA 2PWDA 3N12A 4EE9A 3NDZA 3MV01 5CSYA 2DQXA 1H41A 3SUVA 1GOOA 3WF0A 3I3DA 5HOSA 4D6DA 2E9MA 1NWSA 2XPKA 3BAKA 4V27A 1XCXA 2XUCA 4PMNA 3B9DA 3DECA 3G6LA 3AMDA 4AW7A 2Y8VA 3WL1A 5FD0A 4DM1A 4KH2A 1GONA 4ATLA 1VJZA 1ISWA 1EQCA 4LYPA 4E4PA 1J9YA 4JFSA 3T09A 3MANA 1W9XA 4AD4A 1GPFA 3VPLA 5CLTA 1AQ0A 1TA3B 1QI3A 3AXXA 1KWGA 5D4YA 2D0HA 2FHBA 2WCGA 4FF5A 2QPSA 2JE8A 2WLZA 1M53A 2OYLA 4PUEA 2HISA 4TOQA 3WF4A 2EPOA 3M7SA 5A8MA 2VZOA 3GH7A 3GBDA 1HKIA 4D6JA 4K68A 2W67A 1I75A 4MADA 3AIWA 4U5KA 1QI5A 5BWFA 1RH9A 3BAJA 3VILA 1WZKA 3MO4A 4J3WA 4RL3A 1QVBA 2X0HA 1MQRA 3RIKA 3WEMA 3W0KA 3MUAA 3TTSA 1E1FA 2O9TA 1JGIA 4MPKA 3E1F1 1RP9A 1NH6A 3EMZA 4AD1A 2CYGA 1OINA 4PTVA 3ZT5A 4W5ZA 3VD7A 4DWSB 3IJ8A 2WZHA 4CU6A 5E0CA 4GKLA 1JXJA 3W27A 2EPNA 2J7BA 3UEQA 2VX6A 2EJ1A 3CZKA 3ECQA 1QW8A 3GXDA 4X9YA 2UY4A 2DT3A 3K8LA 2Z1KA 2QMJA 3PZQA 4WJXA 4F66A 4MJ2A 1JDCA 4E8DA 1OCQA 1CEOA 1S46A 3DYMA 4L4PA 4TVDA 3OLEA 1A47A 1JDDA 4AZCA 1JAKA 1UKSA 3BLKA 3ZT6A 4DUVA 1BPLB 2CETA 4HA3A 4HZ8A 1G9HA 4MAVA 1ZB5A 1ISVA 2BY3A 2F2HA 3KE0A 4AD3A 4GZJA 2A3EA 2D23A 3ARWA 3VUPA 1JD7A 2YLLA 3AMKA 2YL5A 5DT7A 3O2LA 4MB3A 1F4HA 3CUFA 5LA0A 1AQHA 5JBFA 1ZU8A 5TD4A 3WDQA 1WZMA 1BSIA 3GBEA 1K9DA 3EDFA 2XIBA 1EOMA 4P8XA 2DSVA 1DWJM 2WXDM 4UQDA 1E6XM 1LWHA 3DYOA 5M3WA 1UWSA 4KMQA 1LL4A 2NSXA 1V02E 2ZX6A 4ZE4A 4EK7A 4GPNA 1QNSA 3WUGA 4F79A 1J0YA 1KXHA 3VD5A 1NARA 1KQZA 2CBVA 5DMYA 1W9UA 3BCDA 3VU2A 3NSXA 2XWEA 4AIEA 4FLRA 4GI9A 4XUYA 3IAQA 3RPMA 1JL8A 3TTQA 1KGXA 1VF8A 4R27A 3F5LA 3WNMA 4M80A 3ARTA 3N1AA 1E5NA 1MW2A 1ZJAA 1MYRA 5M5DA 2OWCA 2D3NA 3GDBA 5IFPA 3W6LA 2GJPA 2VX5A 4F9DA 4GINA 3BAWA 3A6OA 2GDVA 4JFVA 2WVUA 2E3ZA 3SIMA 4C7GA 4TUFA 4DWSD 2VNCA 4RE2A 1BGAA 1MVYA 1O6IA 3AS0A 4DWSC 3ARRA 1BYDA 4NI3A 4OOUA 4PMQA 2ZX5A 3CLWA 1Q6EA 4JL2A 4CCCA 1UD5A 4C7FA 2YL8A 4AZHA 4WKAA 1PAMA 2XTKA 5FKYA 3B9EA 5I5RA 5CJ5A 2YOCA 1UA7A 1WPCA 3CMGA 2VCBA 2BXYA 1ZBKA 1EDGA 1QI0A 4YHEA 3N17A 3WKZA 4DUXA 3VIHA 2FH6A 4J27A 1CXFA 1SR0A 5JIWA 5CPSA 4PTMA 1JZ2A 5A6BA 2QMKA 4PTXA 1G01A 4B9ZA 4HOXA 2CNCA 1G0CA 2DSKA 1V0NA 2XFYA 3FN9A 4MDOA 3WF3A 4URIA 1BG4A 1KGWA 2WVSA 4A3HA 4HPGA 2PF0A 4HA4A 5A6JA 1MWOA 5CG0A 1XGZA 2IUZA 2WMJA 1G1YA 3NUKA 1XSJA 2JEPA 1JI2A 5HBFA 1LL6A 1UG6A 2J8FA 1I1XA 4W7WA 1B3WA 2GVYA 1E6SM 1BVNP 3MMWA 4LGXA 4W88A 3N13A 3VKKA 2ZUTA 1RPKA 3QOMA 4QLKA 3RJXA 1UZ1A 3LMYA 3BC9A 4HZ6A 1V3IA 1VEOA 1M03A 4GIAA 3LPGA 1JI1A 2WBKA 5ABHA 3GNPA 5M03A 1KBKA 2D24A 5I23A 1UA3A 1E55A 4WSKA 5FL0A 3VIMA 1G5AA 4H8UA 2EPMX 5JBEA 3L4XA 2AOSA 4D6GA 1VAHA 3L2LA 2ZICA 2XVNA 4MJ4A 3F4VA 2ZX8A 1H2JA 1ZBVA 2BVYA 3U5UA 1W1TA 2W5FA 2GUYA 3QHOA 2ZXBA 3W26A 2WPGA 3WQWA 1XV8A 3W53A 3UR8A 3MKKA 3AHZA 3WDPP 2ZOXA 2VUYA 1CWYA 1W2VA 3LPPA 1TG7A 5AYIA 2WMGA 1OWQA 4M56A 2YA1A 3AMCA 4Z2HA 2UY5A 2F8QA 1E5JA 4BS0A 4ATDA 4D72A 1JNEA 3BAYA 1LF1A 3OZPA 1E6PA 1XSKA 4CN6A 3VGGA 3OG2A 1QBAA 1C8YA 3VIOA 1E6ZA 4UFLA 5A6SA 1GNXA 4GZIA 4CN1A 1IZKA 1E4IA 1PZ3A 3ARPA 2YA2A 1JD9A 4PMYA 1WKYA 4D6HA 2J7HA 4J28A 3PBGA 3APGA 4JKLA 4NRSA 4HPHA 2C0HA 3K1DA 4UQ9A 4JFUA 2A3AA 2RGLA 2J4GA 3WH5A 3HJEA 3UG3A 3AMLA 4TX8A 3K8MA 4FLSA 4OBSA 1SYTA 4R5EA 4Z2KA 2X1IA 3QR3A 4UTFA 4UFMA 2ZUNA 3BMVA 4CD4A 3MS8A 4WLCA 1V3HA 1E73M 1I1WA 3RO8A 1E0VA 1UWTA 4D71A 4P7NA 1C3FA 3VX0A 4RE4A 1J01A 1OD8A 3M07A 1CNVA 4CVUA 4AEEA 4HP5A 4BCEA 1W3LA 4UOZA 1YHTA 4F8XA 1L0PA 1J11A 4EAMA 1H0GA 1FP8A 1JF6A 5LYRA 1WZLA 4BA0A 4QDMA 3VVGA 5HNNA 5IFTA 4LX4A 1K9FA 2DT0A 3RDKA 4CKQA 1EA9C 4AMCA 2ZE0A 3AXIA 2GJXA 3SCNA 2IXUA 1ISXA 3GXIA 2WSPA 1UR0A 3F5JA 1HXJA 2OSYA 5CGTA 1E43A 4W87A 2CCRA 1UUQA 1CGVA 2G3NA 3G6MA 4ATWA 1W9VA 1GVIA 1CXLA 1UWRA 1JYVA 1H09A 2ZXAA 2JIEA 1C8XA 4TTUA 1RP8A 1UR4A 1XC6A 2DT2A 1CXKA 2PWEA 4PUDA 2XVKA 3SCUA 3VD4A 4W89A 1GOKA 1HX0A 3L4VA 1JNDA 3MMUA 4A3YA 4U2ZA 1CENA 2JF6A 1JZ4A 4GO8A 3BSGA 5AC5A 3SUWA 1H49A 1K9EA 4RE3A 1X1NA 1V3MA 4M81A 3A47A 1WZAA 4FLQA 4N0RA 4ZEPA 2PWGA 3GTNA 2JALA 2CBUA 4PMDA 1ITCA 1QNPA 2BNJA 1PPIA 5BRQA 4UCFA 2Y24A 2OWWA 2O9PA 3FXYA 1KBBA 2CXGA 2BVTA 3VDAA 3AZSA 1JDAA 5IXEA 1UKTA 7CGTA 3PZNA 1WDRA 2W92A 3PZIA 1EHNA 4UFHA 3VTRA 2WVVA 1XH0A 4AC1X 1MXGA 1W1VA 5EBAA 2PWFA 3TP4A 3UR7A 1SMAA 3RM8A 1SMDA 1V0LA 3WSUA 1UR2A 2J7CA 3CUJA 3LPFA 1GJUA 3CHDA 4JCLA 5BXPA 3K8KA 1CZ1A 2G4FA 4XV0A 1C92A 1DWGM 1E4NA 4AYSA 1J18A 1NWUA 3SEPA 3NDYA 1EXPA 3N9KA 2G41A 1Q6GA 3T2QA 1PX3A 3SUUA 1UWIA 4JCMA 2E4TA 1WCGA 2D22A 1HP5A 3ALFA 2WHKA 3CHEA 1CXHA 2WCAA 4GQQA 4CU8A 1B9ZA 1W3KA 1CYGA 2VX4A 4PSPA 3VM5A 1Y7VA 4AZGA 2VR5A 1FP9A 3POCA 4QP0A 3O9NA 2VZUA 4W93A 2V3FA 4MB1A 1Q6CA 3WNNA 1VIWA 2WZIA 1QHZA 3AZRA 1WDSA 2J8GA 2WMKA 2XVPA 1KQYA 4WKFA 1FFQA 1C7SA 2FGZA 5CPQA 3WD2A 2E8ZA 8CGTA 3CUHA 1X6LA 1KFWA 3VGEA 2WMHA 3W25A 4MNKA 4PCTA 3WD1A 3TTOA 1E4MM 2BS9A 2YBTA 2GK1A 1OIMA 3WFLA 2WKGA 2A3BA 4MDPA 5HPOA 1OGSA 3TTYA 1NP2A 3DYPA 4JHZA 1PX8A 3GNRA 4UOJA 1HF6A 4W7VA 4CD8A 3GH5A 4N42A 3VX1A 4UFJA 2NT0A 1VFFA 3ZO9A 4M1RA 4KRTA 4J3SA 1W3HA 3RCNA 1D7FA 2B31A 5M17A 1QBBA 1UOKA 3AHVA 1W9BM 2YIHA 3OGVA 1V6XA 1NOWA 3EMQA 4UOQA 4GO9A 1AMYA 1GVYA 2E40A 5HPCA 2PBOA 3NIYA 4JL1A 3ARUA 2YBUA 4QAWA 1V03A 2X8RA 1K6AA 4PN2A 5A6BD 1E4LA 3JUGA 1C91A 2CHNA 1J0HA 5I3DA 1UKQA 4OOZA 5C71A 2WW5A 1H3GA 1W1YA 2VMFA 4TVCA 4AD2A 1HJQA 1JYXA 4U33A 3VGDA 3L4TA 1BHGA 3NJ3A 4KRUA 1B3VA 2XVLA 4BQ5A 1GQKA 5A2CA 1UH2A 4TX6A 3BAIA 2WWDA 3I3EA 4UZUA 5ECUA 4Z2GA 3IJ7A 4F9JA 1HJWA 4H8HA 4BZYA 5CQ1A 2WB5A 1KCLA 1G94A 3KL5A 2V3EA 2E0PA 3T08A 1JYWA 3PZUA 5GQBA 2HVMA 1FA2A 1CTNA 3UG4A 2EBNA 4ACZA 1OB0A 1QNOA 2PBGA 3WH7A 4XZBA 4AXNA 2WLYA 3AIBA 4IUGA 1GW1A 4B3LA 2GDUA 3WMBA 1B30A 5A2BA 3RM9A 3WNPA 3A4AA 1UD6A 5JBDA 4M8UA 5A6MA 4OBRA 4M82A 5E6YA 3KZSA 4D6EA 3WD4A 3AS1A 3GXFA 3N15A 3KL0A 3PHAA 2DEPA 4V28A 1MXDA 3UERA 1V3KA 1WP6A 2FHFA 1B3ZA 1GCYA 3CPUA 3NSNA 4MNLA 2UY2A 5D9NA 3ZSSA 1DEDA 5IHRA 1E6NA 1CECA 3SCQA 3IJ9A 3GZAA 1BGGA 1CGYA 4LPCA 2J78A 1M7XA 4JIEA 1QHPA 3T0BA 1FH7A 3QGVA 2YKKA 1E56A 1ISYA 2UWFA 3AQUA 3WNKA 1BTCA 4OJYA 3ARZA 3FAWA 1LG2A 2FDMA 5BXRA 2G3MA 1CIUA 4CVWA 3VIKA 1XH2A 2BHUA 5EFFA 1GOIA 3VDHA 5A8NA 4AD0A 3EYPA 1HN1A 2UY3A 3VIGA 3WDHA 2J7DA 3A4XA 2V3GA 5D8ZA 1GHSA 2E9BA 4LYRA 4U2YA 3BCFA 5DT5A 4GZEA 2O9OA 1K9TA 1CLXA 4D1JA 1JZ6A 2OSXA 2XFFA 3WH9A 2F61A 5I78A 1UR9A 4ZXLA 4PMUA 1MQQA 5A8PA 4B3KA 3MSDA 1FHLA 1TVNA 4H2CA 1HKKA 4JZ5A 1QPKA 1LLOA 2ZX7A 4MTVA 1OM0A 2DDXA 1H0IA 2C7FA 1BF2A 2IXVA 4HU0A 4TVUA 3WDRA 4PMZA 3VO0A 4Z2JA 2BXZA 4CN4A 2WZEA 3ZJ8A 3VMNA 4B16A 2J74A 2YDQA 1XSIA 5F7UA 2OLHA 1BYAA 1VBUA 1KXVA 2WVVB 4LYQA 1CXIA 1B1YA 2E9LA 1CDGA 2VQTA 1E40A 1V0MA 4IPLA 2FHCA 4W8AA 1CGXA 4Z2IA 1VJSA 4BQ2A 2WBGA 3GNOA 1OGGA 3SURA 2X2YA 4U31A 6TAAA 4S3KA 3WD0A 1HP4A 1BG9A 3T0AA 2FGLA 4GI8A 3CMJA 3WQ6A 3WENA 1HT6A 3BSHA 3EDJA 3VDCA 1UHVA 1KCKA 1TMQA 3WNOA 2Z1SA 2DSUA 4JFWA 1NM9A 5BROA 1AVAA 3IAPA 2WC3A 5GNZA 4GXPA 3WMSA 4ACZB 5CGMA 1ZS2A 1VEMA 1V3JA 2ZUSA 3SCPA 1V08A 3ARVA 3W6MA 4AZCB 2VJXA 1E6RA 3N04A 1HNYA 1JAEA 1J0KA 3WQ4A 1V6YA 3ARYA 4W8BA 3VD3A 2WMIA 5BCAA 1B90A 4QLJA 4UQAA 3PN8A 3AIUA 4WSJA 4W5UA 1VENA 4LXFA 5BYWA 2JIWA 5C70A 3PTMA 1ODUA 5HXMA 1GQJA 3WH8A 1GORA 4BF7A 4C7DA 2J7GA 2QV4A 1ITXA 3OLGA 1MW3A 2VCAA 5IDIA 3SCSA 1KXQA 1UR8A 3B8SA 1B2YA 1Q4NX 3THCA 1E71M 3AJ7A 1W1PA 1GOWA 1US3A 3U5YA 4B15A 4HA1A 4P8WA 3ZOAA 1E6QM 2J62A 5GNYA 4P7LA 3WBEA 2C8NA 1MQPA 4Y7EA 1JZ3A 4X0VA 1IT0A 3CH9A 4P8UA 1EDTA 4V2XA 2GJXB 1HL9A 2BY0A 3VIPA 3W28A 4U3CA 1D3CA 4CD5A 4YPJA 3W81A 1GQIA 1HKMA 1NOFA 2Y2WA 3WNLA 4PCSA 3BLPX 2BY2A 1EDQA 3VGFA 3WQVA 1UD2A 1BYBA 1TE1A 3EDEA 3FAXA 2J25A 5E9AA 4WIWA 1LL7A 3FHQA 1BYCA 2VZTA 4WK9A 4HMDA 3PZVA 3OLDA 7A3HA 1SFSA 1JG9A 2V5DA 3S2CA 4HOZA 2GK1B 1PIGA 1UH3A 4PMOA 2VRQA 2W63A 1UQYA 1KXTA 2GSJA 2O9RA 3FNDA 3AIRA 2XIIA 1W32A 3T2PA 1ECEA 2ZIDA 1J0IA 4FLOA 1U30A 4JFTA 4MNJA 3N18A 3OB8A 1FFRA 2AMGA 1B0IA 1R7AA 4H7VA 4HU8A 5A6LA 1KWKA 2BFGA 1UZ4A 1E15A 1FOBA 2Y8KA 1GUVA 3FY1A 5E6ZA 1R7OA 1TZ7A 3VIJA 1M01A 3J7HA 2A3HA 3EBVA 1EO7A 2V5CA 2ZX9A 1W9PA 3AZTA 3VMOA 1VFMA 1VRXA 5I0DA 1E72M 5D8WA 3SCRA 3ZSTA 2XG9A 2YDSA 3CIVA 4W86A 5KEZA 5CXPA 3RMEA 1J0JA 2WKLA 5IHSA 2QF8A 4ZE5A 1E0WA 5I24A 4AEFA 3WDJA 2WC4A 2ZXQA 6CGTA 3AISA 3VNZA 2BHZA 3ZM8A 4TXEA 3W29A 1WO2A 3RJYA 5HDRA 3DHUA 5E09A 5FCZA 1H1NA 1QNRA 1E70M 1HJXA 1JFHA 1O7AA 1V6WA 3W37A 1BVZA 1ZBWA 5C8BB 2TAAA 2ZUMA 3AS2A 2XWDA 4MB4A 7TAAA 3RILA 5A1AA 4H41A 2DSZA 1GOQA 3VD9A 3GXMA 1XCWA 2OSWA 1QI2A 1XD0A 2W4XA 2J7FA 1UD3A 4P7RA 2DGAA 1N82A 3THDA 4BQ4A 2FH8A 2CKSA 3OGSA 1GJWA 4H8VA 4D6IA 3TA9A 2W91A 3B9AA 3HU7A 5AYBA 3A3HA 2WMIB 2OYMA 1H11A 3CZ8A 2XHYA 4PSRA 3HN3A 5A2AA 1H5VA 1R8LA 4Z2LA 2GJRA 5LA2A 3O6AA 1UKOA 3BXWA 1OBAA 3RM4A 3QHMA 5CSUA 1BAGA 2AAAA 1DWIM 1V02A 2DIJA 3VIFA 3UESA 4KGJA 1ZBCA 2X05A 1HVXA 2D20A 3AIEA 1HJUA 1VFUA 1OSEA 4AZBA 4UQCA 1WB0A 2V38A 2VQUA 4PTWA 3CZJA 1JF5A 1KB3A 4YN5A 3N11A 3WDIA 1XH1A 1PEZA 2XSAA 4ZENA 5D9PA 2VRJA 3I3BA 2ZUUA 1EIBA 1YQ2A 3CHCA 1TCMA 1WAWA 3ALGA 3WEOA 1UWUA 2YL6A 3W24A 1EQPA 2G3JA 3FHAA 3T2OA 4AZ7A 4MB5A 2BVDA 3ZQ9A 3SUSA 1CXEA 4JKMA 3WUBA 3EDKA 1W2PA 2W66A 1CGTA 5JIPA 5DF0A 3VDBA 3UCQA 2D2OA 2J47A 4UQEA 4W84A 2WVTA 1RD6A 3PTKA 3BH4A 4UZSA 1GZJA 1XYZA 1OGBA 1UD8A 4P7OA 4WF7A 5FOOA 4AIUA 3ARSA 4PMRA 2PC8A 1H4PA 4M29A 3FW6A 4AWEA 2G8ZA 2BHYA 1TUXA 1JZ8A 4CCDA 3L2MA 3CTTA 2WCSA 4BQ3A 1J12A 4PMVA 1B31A 4WKHA 5DEZA 4U3AA 1HL8A 1EOKA 1KR0A 4IISA 1DWAM 1W91A 1C7TA 1PIFA 2CESA 1HJVA 2PB1A 4EKJA 3CZEA 2V3DA 3BMWA 2D0GA 5A95A 1JFXA 3VIIA 4TTGA 2EXOA 3MUIA 3F5KA 4IPNB 5AC4A 1PBGA 2BY1A 2VT0A 5CPTA 3OBAA 1DTUA 3CUGA 1JYNA 3VOCA 1QHOA 4UR9A 1EH9A 1DWHM 4J3VA 1LWJA 1C8QA 3AI0A 3K4DA 3OZOA 1JZ5A 4Q7NA 3ZR5A 2EPLX 6A3HA 4CD6A 1KGUA 1VFOA 4PMXA 1ODZA 3WIJA 2EPKX 3CBWA 2CKRA 3ZJKA 3ZR6A 1VB9A 1VBRA 3S6TA 4D6FA 1PX4A 1UD4A 5A6AA 3WFZA 4W85A 1FHDA 1R86A 1KR1A 1V3LA 2VOTA 3D5HA 5CLWA 2WK2A 4E2OA 5ABFA 2X0YA 1J0ZA 1CPUA 1UWQA 3KWXA 3L4WA 1UYQA 4W8LA 3WF2A 1C90A 4CU7A 5BRPA 1U2YA 1E0XA 3MMDA 3SUTA 3L4YA 2QLYA 3BAXA 2EQDA 5A3HA 1EHAA 2CERA 1EGZA 1CGWA 4CGTA 4AD5A 5DFAA 2WM0A 2VCCA 1VEPA 1E3ZA 2WNWA 1HVQA 4HTYA 1LJYA 2G3IA 1GQLA 9CGTA 3DC0A 4P8VA 5I2UA 4HMCA 2XM2A 2OYKA 1NP0A 4FK9A 1E9LA 2JF7A 5D9OA 3PZGA 5E0FA 3KEHA 1BLIA 1TR1A 2CIPA 3PTQA 1X6NA 3GM8A 4ML4A 4X0NA 5BXSA 1US2A 2D3LA 4S3JA 3PZTA 2ZUVA 5AY7A 1V6UA 4PBGA 5A94A 1BQCA 2A3CA 1XHGA 2QHAA 1TFVA 4ACYA 2CITA 1DWFM 1HKJA 1W9DM 2BV9A 3AFBA 4NF7A 1R87A 3D3AA 4OUEA 1R85A 3UETA 3VGBA 1GOMA 1NOUA 2J79A 2Q8XA 2ZWZA 3IANA 3OA5A 4HZ7A 1MW0A 1QNQA 2DIEA 2WAGA 4J3UA 5EFDA 2CBJA 1OIFA 3A4WA 1P6WA 1NWRA 2VZVA 2OWXA 3CUIA 1F4AA 2JEQA 3VGHA 1DP0A 1WDQA 3WQ5A 2WWCA 4UFKA 3W38A 1PJ9A 1FH8A 2CBIA 4QCEA 3T0DA 5ABEA 3WUEA 2VC9A 3WEZA 2VVSA 3L4ZA 4J3XA 4GQRA 2EEXA 1M04A 4OKDA 3AIQA 3AROA 1JXKA 2YJQA 3PZOA 2PWHA 1W3JA 3NSMA 2RGMA 4J3TA 2O92A 1OD0A 4QFUA 3CGTA 1U33A 2WHJA 3M6DA 5A69A 1QOXA 2VO5A 2E8YA 2ZWYA 1D2KA 1CGUA 4PYSA 3MUZ1 5GPRA 3BGAA 4YHGA 3SCTA 3VMPA 2VZSA 2ZXDA 4XZWA 1Q6DA 1C93A 3K4AA 2W61A 4AY1A 1UR1A 3AOFA 1B3YA 3CZGA 2GFTA 4JAWA 2D1ZA 3OGRA 4XX6A 3CO4A 4KGLA 4ZFMA 2YDRA 5A8OA 2ZUWA 4LQ1A 2MANA 2NT1A 3OIHA 2DH2A 4DUWA 3WN6A 4AZ6A 5A6KA 1LG1A 2CPUA 2EO7A 5ABGA 1UQZA 3WD3A 5FIPA 3U7BA 5D9MA 2VURA 3QHNA 4XB3A 2XSBA 3AIVA 1WDPA 5E70A 3ARXA 1Z32X 4B9YA 4L4OA 5CZKA 2YL9A 4NSBA 4PRWA 1Q6FA 3ARQA 2D0FA 4AIOA 1XYFA 5GNXA 1J10A 2Y4SA 1UKPA 4CCEA 4D1IA 5A8QA 3AICA 3PZMA 1NWTA 3WUFA 3ZJ6A 4H04A 1OT2A 3W4RA 2WANA 4PEEA 1XD1A 2PI6A 4EANA 2VL4A 2J75A 4AISA 2QPUA 4JHOA 1NQ6A 2W62A 2YA0A 5I77A 2XYLA 3WQ8A 2J7EA 3MV11 3AYSA 3AXHA 2VTFA 3HMCA 4E8CA 2XFRA 4IM4A 3WF1A 1CBGA 4J7RA 4DWSA 3OLIA 2NW0A 3U7VA 4MNMA 3UG5A 1TVPA 3EMCA 3WY1A 3ZIZA 3KL3A 2WHMA 5I6SA 5I79A 4QCFA 3DHPA 3AHYA 3VM7A 3U57A 3QOKA 3MU7A 1JZ7A 1QW9A 3AHXA 4CD7A 4JKKA 1IZJA 2DT1A 3CHFA 2DSWA 4NRRA 1V0KA 2WYSA 2VR4A 3GH4A 5BXTA 3SCOA 2XGBA 2VRKA 3WELA 1A3HA 4U5IA 1HIZA 2JFEX 4A4AA 4QLLA 1GHRA 1E1EA 1WNOA 1LQ0A 2YLAA 3ZMRA 1TA3A 4Q22A 3LPOA 3K46A 2DH3A 1BFNA 4AZ5A 3MSGA 4KWUA 3EDDA 3M46A 2ESCA 3PZ9A 4ZXOA 1ZL1A 4P7QA 4M24A 1CLVA 4NZCA 3SCVA 5DO8A 2VI0A 5EB8A 3WH6A 1OT1A 5ABFB 3AHTA 3TOPA 3NCOA 2XM1A 3L4UA 2CEQA 3MUY1 1QI4A 1V6VA 4DM2A 8A3HA 4UQBA 5JUVA 1E3XA 1XRVA 3VINA 1ESWA 1FH9A
chains in the Genus database with same CATH superfamily
1EO5A 1H7PA 2QJMA 1EX1A 2XVGA 2YXXA 1HJSA 5L6UA 4AYGA 3CQ0A 3HJZA 3QY8A 4JBRA 2WSKA 4GI6A 4YLWA 1BTMA 1KFBA 2C18A 3BW3A 3GYCA 1AQMA 2WHLA 3H23A 1DHKA 3ERPA 1V77A 4FMVA 3T81A 3PSWA 1EJTC 4CUCA 3W1MA 3HGSA 1ZJBA 3LCWA 2QCCA 1UH4A 3TOYA 3H7UA 4L6OA 1ECQA 1PL9A 1P6BA 1W5MA 2VVNA 3AMGA 3P3BA 4NYUA 5L9FA 3ZT7A 4MYXA 2WMFA 4W7UA 1B3XA 4D6CA 1R2TA 2PTYA 1YE4A 1ADSA 4UFIA 2X09A 1E1CB 2CHOA 5KZ6A 2DZBA 3USBA 3DFPA 3RCMA 3KP1A 2REQA 3BWWA 2XGIA 2PWDA 1O1HA 2BBFA 1Y8BA 4LY8A 4ASTA 1B4EA 3NL3A 3N34A 4WX2A 4US6A 3WF0A 4DF2A 5CC6A 4G5DA 2QZRA 5T91A 2GOUA 4XO6A 1VJZA 4GYFA 4LAOA 3OJGA 1K8CA 3D3FA 1W9XA 1Q5MA 2ZC8A 3RPDA 1M7JA 4FNSA 2D0HA 4FF5A 2QPSA 3N4AA 2JE8A 4IJBA 1PKMA 4R7OA 3MYPA 2HISA 3WF4A 2GVGA 2TSYA 2VZOA 1DIOA 1VYPX 3GBDA 1HKIA 4K68A 4ZB5A 2FJUB 2W67A 2PDGA 3BL3A 1QI5A 3BAJA 1DJGA 3LHYA 3W0KA 4DJDD 3N4FA 4YL2A 1JGIA 3G1DA 1NH6A 2C1HA 4WXZA 4AD1A 1MEWA 4YVXA 1OINA 1Q2RA 4DWSB 3H2OA 5AYYA 4CU6A 6REQA 1JDFA 1JQXA 3CZKA 2XISA 4DNHA 5LNVA 4MZ1A 4F66A 4KFOA 4PRTA 1OCQA 3TR9A 1S46A 3PVFA 3OLEA 4AZCA 1JAKA 1UKSA 4C6BA 3BLKA 3APTA 3LTPA 1G7VA 4DUVA 3KHDA 1JULA 3AUOA 2CETA 2P5NA 2YB4A 2F2HA 5C2GA 4Q8VA 3EEGA 2ZVRA 3IK4A 2A3EA 2D23A 3NQMA 1CB2A 3CUFA 1TVLA 1ZU8A 5JH2A 3P14A 4D8AA 1TWZA 3IV3A 2NUWA 5TNVA 2XIQA 3GBEA 3KFTA 1DWJM 4LT9A 2XZ7A 1DIEA 4UQDA 1LWHA 3MP5A 1FBAA 5M3WA 2NSXA 3RLHA 2ZX6A 3WUGA 4F79A 1J0YA 1XIMA 1KXHA 1NARA 5ENLA 3QQ1A 5DMYA 5LGXA 2INFA 3T44A 3SSZA 3TV8A 2MUCA 3QZ6A 3NSXA 4AIEA 4GI9A 1TTIA 1RR2A 3G24A 3QH2A 4XAGA 4Q4RA 4DZ5A 3WNMA 4MIMA 1Y5VA 1VLWA 3ARTA 4IP4A 2ZRUA 4B5VA 4FAMA 4HVXA 1MW2A 4I5UA 1ZJAA 4O1AA 5M5DA 1EGVA 3GDBA 3WLMA 2GJPA 2VX5A 3MBFA 3RXZA 1UMLA 3A6OA 5AHMA 2WVUA 2QUVA 3SIMA 3C86A 5F2GA 8RUCA 1M41A 2OGJA 1V7YA 1VJIA 4Q8TA 1YRRA 4IXXA 4PMQA 4GH3A 2R6OA 3CLWA 3HZ3A 1FVPA 4CCCA 2WJZA 3OQEA 1UD5A 1RPXA 4I9MA 4AZHA 1PAMA 1H50A 3QGKC 3B8VA 2AL1A 5H6HA 3OVGA 3LV6A 1EDGA 4LTSA 3EZ4A 4XD5A 4YHEA 3WKZA 1XIIA 3VIHA 3E0LA 2FH6A 4J27A 2IPWA 4QQUA 3O3RA 3EX3A 2X0SA 1PKNA 3M0IA 4MWAA 4PTXA 5D37A 2WNQA 2DSKA 1K8ZA 1YPFA 3N29A 3FN9A 5DMNA 4S3FA 3WF3A 4URIA 5U7SA 4A3HA 3U6WA 3B03A 4NXKA 5CZSA 2B7PA 5AC8A 2PD9A 5CG0A 2IUZA 3WG6A 2IW0A 1Q3NA 4NYYA 3P67A 1XSJA 1LTDA 1ME9A 4LC6A 2C3ZA 2PGWA 3WBWA 1A4MA 4O28A 3I6EA 1B3WA 3EOSA 4L65A 2R1LA 3N13A 3VKKA 2PUZA 1GZ1A 4OUIA 3UR5A 1M03A 4GIAA 2WBKA 3GNPA 5M03A 3PF3A 3H24A 1I2RA 1UA3A 4C6DA 1ZAIA 4WSKA 4H8UA 1VPXA 1QUMA 4D6GA 3L2LA 1HW6A 1R38A 3N14A 5LXXA 5AVHA 1H2JA 1W1TA 2W5FA 2GUYA 3W22A 2ZXBA 4IJCA 1W3TA 4JYFA 1FKXA 2Z4GA 3FEQA 3QQWA 3WQWA 4ERAA 3MKKA 3L23A 1M7OA 1RXOB 1DJWA 1EZ2A 1CWYA 1U5JA 1S5VA 3LPPA 2Z29A 1G69A 2VC7A 4NZ1A 1FWNA 4M56A 1JNEA 3BAYA 2PPGA 1E6PA 1JGMA 4CN6A 1KW1A 2OZ3A 3CASA 3VIOA 4ZCWA 3OHIA 1E6ZA 3GG0A 5A6SA 1XLKA 5HWNA 1E4IA 3CHVA 2ZDRA 4PUJA 4D6HA 3DFSA 3QSRA 3PBGA 5DX7A 1VRDA 2FVMA 4GWEA 1LCOA 2C0HA 3K1DA 4JFUA 2XH2A 4V1YA 3CQJA 3WH5A 2VENA 3HJEA 3C2FA 1R3QA 4DIAA 5G4HC 4WY0F 1SYTA 4LUJA 3N2MA 5EKYA 2ZZ6A 7PTDA 4EIVA 1I1WA 3DH7A 3AWNA 1E0VA 4F2UA 1C3FA 3GFYA 3VX0A 1OD8A 1PVNA 4G1KA 5HJLA 4IZGA 3GG1A 1NF0A 3BLDA 1B4KA 3TH6A 1J6PA 4ROQA 1Q6RA 2OTDA 1BXNA 4H6KA 1Q7ZA 5LYRA 4BA0A 1HZYA 2I7GA 1DYSA 4LX4A 2F6XA 1K9FA 2DT0A 4CEUC 2I16A 4XTIA 4DHGA 1S2UA 3REQA 1FWSA 3SQLA 1F61A 3LHTA 4JTKA 1P7TB 2WSPA 1UR0A 2Z25A 3F5JA 4IMCA 3H6OA 4GMEA 3UPBA 2OSYA 3D47A 3QRHA 5CGTA 4DO5A 4MKNA 2R1MA 3IEBA 4OT7A 3TSDA 3UWUA 4XD6A 4ATWA 1JRCA 1I0BA 1V7AA 3E74A 1JYVA 3UVAA 3P62A 3CIWA 3PBUA 2ZXAA 1VC4A 1TPH1 4EXBA 1XPGA 4K3ZA 1RP8A 1UR4A 1QOPA 1RA5A 3K2GA 4W89A 1HX0A 1EEXA 2HPIA 4IX0A 1CENA 5CSSA 1JZ4A 2J13A 4AHPA 4PMJA 4R7JA 3SUWA 2O7QA 3KVKA 4XBKA 3UZZA 2C91A 4RE3A 1SFJA 4FXSA 2Q8LA 4LS2A 3QPYA 2VEPA 5EMJA 2VFIA 4N7QA 3W76A 4H00A 5HANA 3GAYA 4N0RA 4MWAE 5K3VA 2O7SA 3V18A 1GT8A 1ITCA 1QNPA 3EOEA 5BRQA 2Z1VA 4G56A 1PHQA 3FXYA 2BWGA 5B80A 3IGHX 2CXGA 4C6IA 1KFLA 4AY7A 1JDAA 3WLPA 3C4UA 3EPMA 5D2TA 2KZHA 1WDRA 3R4IA 4PH6A 3VTRA 4XZLX 4XIAA 2H9AA 2WVVA 1FCQA 4QJ3B 3LM7A 1SUXA 1E9IA 2PA6A 5I3KA 1QT1A 2ON3A 1Q66A 3WJYA 1SMAA 2E77A 4B5NA 5CJNA 3QV8A 3W7RA 1UR2A 3WSUA 3CHDA 2AQOA 2YCEA 3L0GA 4OVXA 5BXPA 1SQ7A 2G4FA 1E4NA 3P0WA 2FVLA 1U83A 3VC6A 2R1NA 1ZZMA 1VQTA 1PKYA 2POZA 3BGGA 4O1FA 1Q6GA 4F0SA 4LCSA 3T2QA 3B0VC 5E9XA 1HP5A 2WHKA 3CHEA 4E4FA 2WCAA 1B9ZA 1W3KA 4N9EA 1CYGA 2VX4A 3KOFA 1TQJA 3LBCA 4UTUA 2VR5A 4Q4SA 1O68A 1KM3A 4QP0A 4BWLA 4DJFA 2V3FA 4UTTC 1ITQA 3QW4B 1QHZA 3AZRA 2NWSA 1YMYA 3L12A 4RDWA 1OFAA 3F4CA 8CGTA 1ZAHA 3CUHA 3DOPA 4GQ0A 2VEFA 2C1GA 4MNKA 4PCTA 3VOFA 3TTOA 2YBTA 3WFLA 2A3BA 4Z1CA 5HPOA 3B40A 3HF3A 3TTYA 4GUGA 1NP2A 1KTCA 4HJWA 4W7VA 2INZA 4N42A 4ZB2A 1AZ2A 1VFFA 3M5ZA 3K30A 4C6JA 3IUDA 4Q4PA 3SR7A 3S9IA 1GWJA 4DPPA 4IMDA 2YIHA 3ITOA 3QM3A 1AMYA 1GVYA 2E40A 4AF0A 4M0XA 3NIYA 2YBUA 2FIQA 4MF4A 3V7PA 4DAFA 5I07A 4JIHA 3CB3A 3T0TA 2OEMA 3RR1A 4Q8QA 1K6AA 5A6BD 5CBJA 2MNRA 2CHNA 2V68A 3DN5A 4EACA 3LI0A 4KEUA 1UKQA 2JBMA 3OO2A 4OOZA 3G1HA 3HG3A 1H3GA 2VMFA 1FWGC 4MLRA 4AD2A 1S5NA 2YGYA 3SRFA 1JYXA 1BKHA 2E68A 3VGDA 1KTNA 5IBXA 3L4TA 4KRUA 4JTAA 4UTWA 1OY0A 1IHIA 2XSXA 2PS2A 3S46A 3HV8A 4PGLA 4GQBA 3KOZA 5ECUA 4QG9A 4XWUA 4H8HA 3M9YA 3E3HA 3GVGA 3UXLA 4WOQA 5BZAA 3DFTA 5DXXA 3R13A 5GQBA 4IOTA 2WNZA 1CTNA 2E7FA 3TMQA 1YDVA 3WH7A 1JPDX 2PBGA 4AXNA 1Z3NA 2WLYA 3WMBA 1B30A 3LCIA 3RM9A 5C55A 1Z89A 4WJEA 4LSBA 4MFDA 4M82A 4A3QA 2Q8ZA 2VKZG 2V2HA 3CWNA 1WKDA 3LHVA 4OE7A 2Q09A 1POJA 2H6RA 4OV4A 1AH4A 1GCYA 3CPUA 2G0WA 3QZEA 4GFIA 1DEDA 3R8HA 3FIGA 4GNKB 1TPDA 4K39A 3GTIA 3SCQA 1BGGA 5XIAA 3KOYA 4CCZA 3M7WA 2GGHA 2FZNA 2XH0A 1NFPA 3QGVA 4C5ZA 3AQUA 3BZGA 3L7RA 3C5QA 2AQVA 3ARZA 2DJLA 2CXEA 3FAWA 2G3MA 3TNBA 4CVWA 4H4IA 3U2OA 5EFFA 3VIGA 1QMLA 3E6EA 3DHDA 1FWEC 3W85A 2Q3RA 4H3DA 4U2YA 2B0MA 2OCZA 4GZEA 2CZVA 1OHLA 4D1JA 2OSXA 4ZTXA 3WH9A 2DZVA 1UR9A 3PAOA 4PMUA 5A8PA 4B3KA 2IPGA 2G3FA 3M0ZA 4ILSA 1TVNA 4H2CA 3IRDA 1Q4WA 3VKAA 1CI1A 4OECA 2Y61A 3QYQA 1H0IA 5FA5A 2EG6A 3VO0A 4F0MA 2CHRA 1EC7A 4IX2A 4K2SA 3QFWA 3ZJ8A 2DVUA 2VP8A 2YDQA 1ONEA 1BYAA 3LY0A 4A05A 2E9LA 1W5PA 1CDGA 3N3MA 3T6CA 2VQTA 2FHCA 3EX2A 3SURA 2X2YA 4U31A 1FWWA 3ABZA 3MA8A 1HP4A 2FGLA 4Y8FA 3CMJA 1DORA 3TK7A 1PYMA 3EDJA 3BSHA 1UHVA 1TMQA 2ABBA 2QR6A 1VCVA 3UQNA 3C3UA 2QUNA 1TB3A 2J27A 3WMSA 2BOEX 3F4DA 1V3JA 2ZUSA 3ARVA 3FYYA 3N04A 1OX4A 2QJJA 4GD0A 1J0KA 5DRIA 4DLFA 3VD3A 3RG6A 5MKGA 1Z9AA 5AYXA 5C9XA 1VENA 5BYWA 5C70A 2JIWA 1TMHA 2HBVA 3R12A 4A6GA 3CL6A 4IG2A 4XD3A 1ODUA 4BY3A 1GQJA 1XIEA 4BF7A 2QV4A 1M1BA 2HNEA 5IDIA 3IJDA 3QMRA 2OO0A 3N19B 4QBXA 4Z1DA 4CQ8A 3B8SA 1SJCA 1U5HA 4MJMA 2CLEA 4FPSA 3THCA 1WUEA 1US3A 4B15A 4X63A 4OBTA 5GNYA 1MEHA 4Y7EA 4X0VA 4IXHA 3VK5A 3EAUA 2I17A 2BY0A 2P53A 3UWVA 1GKRA 4U3CA 4DZIA 5FACA 3S2NA 3LXBA 1E51A 3OTRA 2BLEA 2ATMA 1S1PA 3AWOA 2HV5A 3IGXA 3PY2A 4PTDA 3BLPX 4LRTA 4H9XA 3PJXA 1XYCA 4JQ1A 1BYBA 3E9AA 4WIWA 1QPRA 1L2UA 1LL7A 3FHQA 1TZZA 5F1UA 2VZTA 4PZVA 1XRTA 4NY2A 4HMDA 2P3EA 4BK9A 1OJXA 2GK1B 1PIGA 1LORA 1XGEA 3S83A 1FWAC 3AIRA 3NPVA 1W32A 5JH1A 4O1BA 2D73A 4ZODA 3T2PA 1J0IA 3P8JA 4HN4A 1O5QA 4JY9A 4HU8A 2ZTJA 5D02A 1E15A 1FOBA 4NX5A 1EKOA 1Z48A 2DY3A 4RDYA 4NJKA 4B4FA 4JOMA 3W1RA 3S1VA 1ITUA 3F03K 2GVEA 3AXKA 1VRXA 1VD6A 5I0DA 4HGXA 2W27A 2YDSA 1IGSA 3A5VA 3CC1A 4XKMA 4W86A 3KZPA 4A22A 1BRLB 4ECLA 5CXPA 3OG3A 5IHSA 4ZE5A 1E0WA 5I24A 2WC4A 3VNZA 2BHZA 3PPHA 3ZM8A 1IXOA 4MFEA 2OB3A 4GNVA 3RJYA 5HDRA 3DHUA 1Q8AA 2G97A 2YW4A 5E09A 5FCZA 4LAUA 1JFHA 1P43A 1BVZA 1GYMA 3PFRA 1JUEA 4O1CA 1TIWA 3AS2A 4O8AA 4GC3A 4UMAA 2DSZA 4CLMA 1GOQA 3C0JA 3GXMA 1JUKA 1GPWA 1Y0EA 3EWUA 4GQGA 5XIMA 1SSGA 4NI8A 1KO0A 5DMLA 4RPQA 3NFUA 4ADTA 2W91A 4I9TA 1TX0A 2P3ZA 1EJWC 2OYMA 1H11A 1ZCOA 3CZ8A 1B54A 1XC4A 2ATSA 3R5EA 4UC5A 1R8LA 3NEVA 3O6YX 3PBYA 5LA2A 4ZOBA 3GZ3A 4AVOA 5DANA 1A80A 3RM4A 4H1ZA 2PDJA 5CSUA 1BAGA 3MUCA 4GNJA 1KM4A 1TELA 2AAAA 4I8DA 5T9CE 4NG3A 1V02A 2R94A 3MPGA 2FYMA 3GIYA 1ZBCA 3FDGA 4GCAA 4H2HA 1WBJA 1HJUA 2V38A 1P0DA 1JF5A 4H9VA 1KB3A 3NQ2A 1PTGA 4ALDA 3NOYA 1H7NA 2F9RA 2RDTA 3N9SA 4ZENA 3WLTA 2B81A 1XIFA 2Z24A 3CHCA 1WAWA 3ALGA 3NDOA 3CYVA 3W24A 3LD5A 3NPWA 4LVDA 3TSBA 3T2OA 5D30A 4MB5A 1KM5A 2ZZ1A 2J8TA 2BGQA 4JKMA 3WUBA 2C6QA 2W66A 2E5DA 3GNNA 4O53A 1Z7AA 3ZFHA 3UCQA 1SJBA 3E0VA 4UQEA 3TEVA 3TFXA 3VCRA 2E09A 3N2TA 3OP2A 4NP7A 5GVJA 1HG3A 4WJ8A 3S42A 5G4WA 1ADDA 4LNCA 1TV4A 1XYZA 3S0CA 1UD8A 4AIUA 3RAOA 2PC8A 2OQLA 2QCLA 2BHYA 3C0LA 5PTDA 1PZ1A 1TUXA 3EKGA 5FJJA 4CCDA 1TPFA 5CC5A 2WCSA 4BQ3A 4LOCA 4WKHA 5DEZA 4U3AA 1FWTA 5D2WA 2NQ9A 4JXCA 1XINA 3L5LA 1C7TA 3W7GA 1HJVA 3MZNA 2Z28A 3GHRA 5A5WA 2V3DA 3VIIA 3A24A 3H2MA 3F5KA 3U8GA 3LLFA 4K1WA 4O19A 1TV3A 1PBGA 2BY1A 3BV7A 4GBDA 5CPLA 1DTUA 4XZIA 1E0UA 3WJWA 4K8HA 3VOCA 3C2RA 1EH9A 4WUIA 1C8QA 4E6MA 3QY6A 1XG3A 4J2MA 3WQFA 2HVNA 1M3UA 4IL0A 6A3HA 5LHFA 4CD6A 4F2BA 2PDWA 3ZR6A 2IKHA 5ECVA 2ABAA 1VB9A 1XIHA 4GKTA 1PX4A 4D6FA 1UD4A 5A6AA 1KR1A 1V3LA 4UTHA 5CLWA 2WK2A 4U10A 3W7PA 4QSFA 3KWXA 3RCYA 3A22A 3WF2A 2ZYFA 1E0XA 3L4YA 2DZSA 2QLYA 3BAXA 2YW3A 3FJ6A 5LIXX 3N4EA 2L5HA 2ACRA 4CGTA 1RV8A 4AD5A 5DFAA 3SRDA 2WNWA 1HVQA 2JQXA 1LJYA 3PJUA 4OV9A 1RCQA 1GQLA 2QPXA 2ALDA 3TJIA 3FS2A 4HMCA 2NV1A 4IIEA 3THUA 1UR3M 3A3WA 4GIYA 1KV5A 2IQ0A 3OW1A 3QV6A 4KRZA 4K37A 2GVJA 4B91A 1O5XA 2A21A 4HNNA 3HGRA 2POTA 3GM8A 4ZOAA 2R91A 1TR9A 3AC0A 2OEKA 1LQ2A 1A49A 3GHTA 4S3JA 5DCDA 3BANA 4WDXA 2Y5JA 1V6UA 1BQCA 1W56A 7ENLA 1QR7A 3B0YA 1DWFM 3FA4A 1IEWA 4NF7A 3D3AA 4KWVA 2Y7FA 1P0BA 2CLKA 2J79A 4HK5A 3SAZA 1XLAA 4PB4A 3SY8A 4XAZA 3FFSA 2OX1A 5AHFA 4PFHA 1R3VA 2VD9A 1QNQA 2WZTA 2DIEA 3SJ3A 3RX4A 2WAGA 1FX6A 2PGFA 1EP2A 3A4WA 4GUHA 2Z2BA 3TR2A 3CUIA 1LM1A 1DP0A 3VNLA 2BODX 2WWCA 3W38A 1PJ9A 3BOLA 2EKGA 2OT1A 2VC9A 3HG4A 3PG8A 3L4ZA 3GXNA 4GFSA 4OKDA 5DY3A 2Z6JA 2DVXA 2B7OA 3QEZA 4GYPC 3AIQA 2YJQA 2OODA 3F4NA 1A0CA 3DXIA 4QFUA 3UG8A 1E1CA 2WHJA 3DAQA 4IMFA 1QOXA 2VO5A 1X39A 3VOJA 4PYSA 3SFKA 3MUZ1 5C5YA 3OYXA 1AW1A 3VMPA 4XZNX 4G7EB 1SGJA 2CLFA 3HFTA 4Q7IA 2PSNA 3LUTA 3NVDA 5JQ9A 1UR1A 4ZOEA 1KBIA 3U48A 3ITLA 4H8NA 4JYEA 5AECA 4N6FA 3JVAA 5LNRA 4LQ1A 1JCNA 2MANA 3QBUA 2FKPA 3CV2A 4DUWA 4AZ6A 2XIJA 5FIPA 3TW9A 1XDMA 2XSBA 2V82A 3ARXA 1Z32X 3HPFA 3W02A 4DBSA 4NSBA 2Z1XA 3WJZA 4AIOA 1IWPA 1UKPA 4CCEA 2D69A 4D1IA 3UNTA 3DFQA 1NWTA 1I6NA 3WUFA 4E2VA 3NL2A 5AKQA 2ZKMX 1XD1A 4ZO7A 3GXPA 2VL4A 3TN3A 3IIZA 3KW3A 2WSYA 4W4QA 2W62A 2XYLA 3MV11 3AYSA 2VWSA 1QFEA 3CS2A 3EOOA 1EUAA 1TRIA 3HMCA 1BSLA 4IM4A 3G1YA 1TIMA 4J7RA 3OLIA 3UG5A 4MUZA 2G50A 3SFWA 3ZIZA 2WHMA 5I6SA 5I79A 1PE1A 3F7JA 3TYDA 2BP1A 4YTUA 3U57A 1RQHA 4UUIA 2RDXA 4AX6A 4IFRA 4K6AA 1S3TC 4RW5A 4H9TA 1SVDA 4NRRA 1TREA 4ERGA 2VR4A 4BFAA 1W54A 5BXTA 3SCOA 2XGBA 2BVWA 2SFPA 4U5IA 1W37A 2PLCA 1TJPA 2BMBA 4NZ3A 2F38A 3T0CA 1LQ0A 3GY1A 2YLAA 3ZMRA 5I3IA 1LZOA 3BSMA 3V0TA 3BICA 4RV8A 1UIPA 2BGNE 5C0QA 1OFRA 4I9AA 3K46A 2DH3A 1BFNA 4AZ5A 4C1LA 2E5CA 2PODA 5HULA 3C8FA 4FOUA 1RD5A 3PZ9A 1ZL1A 4P7QA 4M24A 3HV9A 1AZ1A 4X61A 3FVMA 3WH6A 5ABFB 3R89A 3MB9A 3AHTA 3NCOA 3L4UA 4XUGA 2ZC1A 3MUY1 4GH1A 1TPC1 1WYIA 2BSLA 1HUVA 3P74A 1E3XA 3KM8A 3VINA 1FH9A 1R46A 4B2DA 4NASA 2HXUA 4HMEA 3W82A 3II1A 2CLLA 4AZIA 1QASA 1JPHA 2XJ7A 3WMCA 1A5AA 3CWOX 2J9XA 3MW7A 3E5BA 4MAZA 2WC7A 1TV8A 1LBLA 1A5SA 2E67A 2PCEA 3UR2A 4PR4A 2OPJA 3G1FA 3FSUA 3DIPA 3D0CA 3TVAA 1XDLA 3MWAA 3COTA 3HM7A 2GQ9A 3POHA 3BDKA 3R79A 1Y5WA 2VGFA 1XG4A 2GQAA 3GB6A 2PP0A 4DRSA 5CEWA 3IK2A 5FL1A 1W8GA 3TZNA 3BG9A 2D2HA 4DJFD 4ADUA 2VC6A 3SO7A 3B8WA 3IACA 4YIWA 3SY1A 2DQXA 3DHFA 3SUVA 1KM2A 1IWAA 2RJGA 3NQBA 1NDYA 1OZQA 5CAHA 3KBJA 2GVLA 3IPWA 4KKXA 2Y8VA 1LBFA 2GZXA 5FD0A 3WL1A 4HCLA 2R9RA 3BMXA 1PIIA 4KH2A 3I6RA 1WXJA 4LS0A 3M43A 4JFSA 3T09A 4JPGA 3V0SA 4RPPA 1TPEA 4AD4A 5CLTA 1AQ0A 3TXVA 3MO7A 5D4YA 1GVQA 3GFZA 2QCNA 1P5BA 5K7JA 3VABA 2WLZA 1M53A 2GJNA 4TOQA 4XO7A 5A8MA 4WRHA 3NQAA 4MADA 3EWWA 4U5KA 5BWFA 3TWBA 4J3WA 4AIBA 3TTSA 1E1FA 4QJ5B 4POCA 1VBJA 2VHLA 4HSHA 4L4MA 1V8EA 2F7FA 3UZ5A 2PRMA 4W5ZA 5CC3A 1F6YA 3IJ8A 2WZHA 3HPAA 5E0CA 1T40A 3W27A 5E1QA 1QW8A 4HNOA 4Q4QA 3AO0A 1DQUA 2Y63A 4DB7A 2QMJA 3FKKA 3LQGA 4WJXA 4L6HA 4O12A 4H01A 3P61A 1TKKA 2O55A 1BQGA 2B7QA 3DEQA 3B0UX 1A47A 3I4EA 1JDDA 3F2BA 1U1HA 4G9PA 1OCJA 5DMMA 4MAVA 1ZB5A 1ISVA 3KE0A 4AD3A 1E0TA 2YLLA 4MHBA 3AMKA 5GJNA 4AWTA 3G3MA 2YL5A 5DT7A 4DAIA 5LA0A 1HO4A 5JBFA 3OPSA 1VYSX 3M44A 1JVNA 2GQ8A 5CPOA 1CW2A 1BWVA 1WZMA 2HXTA 4DBUA 3EDFA 5MF5A 3B8UA 5FF3A 4KWSA 3SN1A 3ANVA 4MJZA 1F5ZA 3Q67A 3KS6A 1K77A 4O16A 3VD5A 1KQZA 3B4UA 3QTPA 4LWWA 5CZTA 1W9UA 3BCDA 1EJUC 4XVDA 2XWEA 4JHMA 3HQ1A 3TTQA 3WQCA 4XD4A 4XKYA 2Q6ZA 2VGBA 3W70A 5CBBA 2Y1HA 5IBXC 1VHNA 1MYRA 2YCLA 5I03A 3ITTA 4HPJA 4F9DA 3BAWA 3GS6A 1GGOA 2FZBA 4C7GA 3O7UA 4TUFA 3FX4A 5LKYA 4RE2A 1MVYA 5T9BG 4QX4A 3QV9A 3EOUA 3WO8A 2HVOA 4OOUA 2DORA 1Q6EA 4JL2A 3KCLA 4UTJA 1OFQA 2YL8A 3QZAA 2XTKA 3G22A 5EMLA 1XLLA 1ZRQA 2YOCA 5KSWA 3WCZA 1NDVA 3CMGA 2BXYA 4FA3A 1YIXA 2DFAA 3N17A 2YSWA 1QU4A 1Z44A 1JZ2A 4GUJA 5FJOA 2QMKA 3B05A 4B9ZA 5D09A 1ADOA 3PUOA 5FEXA 1BG4A 4S3AA 1KGWA 1OCNA 4HA4A 1K3UA 1MWOA 2Y6ZA 3CQHA 1PHWA 3NUKA 2JEPA 5HBFA 3WQEA 1ZUAX 1XXXA 2J8FA 3TC6A 2ZZ4A 2GVYA 1BVNP 1T8QA 3LV5A 5AVNA 4LUSB 4M1BA 7REQA 3N2BA 1FHUA 1QW7A 1WQ5A 3V5FA 4CEXC 3CAKA 1RPKA 1I8JA 1P0NA 3QOMA 3RJXA 4JD4A 2RKXA 4HZ6A 1VEOA 4DZAA 1DVJA 3LPGA 1JI1A 3O6CA 5ABHA 3U2CA 1KBKA 1E55A 3UU0A 4KQNA 3MC5A 1OX4B 3L4XA 1TSIA 2A5HA 4E0CA 2Y89A 2QGHA 1X96A 3RF9A 1SO5A 5HQEA 1REQA 3GC2A 4YTTA 3NXLA 4HHMA 2VGGA 4OHQA 3AHZA 2PDCA 5EA9A 2ZOXA 1H7WA 2VUYA 2Q02A 3G77A 1IXPA 1W2VA 3VNKA 6ENLA 3HBLA 3UPMA 2YA1A 4HSNA 2F8QA 3NL5A 3R8RA 1F8IA 4BS0A 3OZPA 1DE5A 5F4WA 3CAVA 4I7WA 3IIVA 2ZZ3A 4WCJA 4GUIA 1KV8A 4UTWC 3LCGA 1GNXA 2DZPA 4GZIA 4CN1A 3HG5A 1PZ3A 2PLMA 1JD9A 1EF3A 3HQPA 2GLKA 2OVLA 3BJTA 4E2DA 1RBLA 5C54A 4PMYA 1BF6A 4FSAA 2J7HA 1EJXC 5K2ZA 1HQTA 4NRSA 1H7XA 2FDSA 4C60A 4CQAA 4YTQA 3CV7A 4U28A 2RGLA 3WQOA 1ICSA 2V2CA 4IFKA 5JU6A 3QXBA 3AMLA 3EXRA 1JUBA 4OBSA 3V0UA 4R5EA 2X1IA 4EF9A 1H63A 4TU1A 3NURA 4IQLA 3TQ0A 3R43A 3QPZA 1VCFA 4AAJA 1V3HA 1JCTA 3RO8A 4D71A 1A53A 3EEZA 3MP3A 2OMAA 4RE4A 1T6MA 2PGRA 1XBVA 2NX9A 3NQDA 4CVUA 4AEEA 4HP5A 4BCEA 1VPQA 3O0KA 1YHTA 4QROA 2RDUA 2ZRXA 1TO3A 1H0GA 1FP8A 1JF6A 3MHUA 1PO9A 1Q6LA 4QDMA 4V1XA 5HNNA 2QDDA 5IFTA 5FEWA 1YTDA 4CKQA 4AMCA 1ZSXA 4GJIA 3S1UA 3KVMA 2DQWA 1OADA 2O56A 5RUBA 1F3WA 1FY6A 4DPQA 4BF9A 3PB0A 3GU9A 3KRSA 1YTKA 2Z7GA 1E43A 4K36A 1P0KA 4XZMX 3NQVA 1UUQA 4PCFA 1BKSA 1CXLA 3V1PA 1EYEA 4EX4A 3M5VA 1XF0A 4RV3A 1R9YA 2JIEA 4LAZA 1C8XA 4MG4A 3BJSA 2DT2A 3N2OA 3W6YA 3IRSA 2YXGA 2XVKA 1G4TA 4EF8A 3VD4A 3H2CA 4NJJA 1FWBC 3LI1A 1JNDA 4A3YA 1FCBA 1TV7A 8XIAA 4J40A 4LCQA 1ICPA 2JF6A 2QUMA 1FRBA 4GO8A 2I14A 6XIAA 2PDNA 1H49A 1K9EA 1V3MA 3A13A 4X9SA 3T07A 2IKIA 4JNMA 4ZEPA 2PWGA 3GTNA 3H7VA 1GVRA 4LF2A 1PPIA 4IMAA 2Y24A 2V5JA 2YCIX 4YS1A 1YTEA 3KBMA 8TIMA 2BVTA 3FA3A 3VDAA 4OFCA 4JTEA 1UKTA 3GTXA 2OGYA 2HROA 5JXQA 1EHNA 5HAOA 1XH0A 4AC1X 1CT5A 3P6LA 2Z26A 1MXGA 3ATYA 4AUBA 2PWFA 3UR7A 2I1OA 1TRDA 2HK1A 3LPFA 1GJUA 1NVMA 4R53A 2DZTA 3R94A 3K8KA 1CZ1A 4XV0A 3GNDA 4AYSA 1J18A 1GEQA 1TPB1 3ELFA 3NDYA 3N9KA 2QIWA 2QNEA 1PX3A 3SUUA 1UWIA 4ZQRA 1ZENA 3QC3A 3H4XA 3ALFA 3TYEA 1CXHA 2G5WA 1P0EA 3RITA 3AYVA 1FP9A 3POCA 2E1DA 3O9NA 2VZUA 4AMAA 2A7PA 1VIWA 3MSYA 3WJSA 2WMKA 1FFQA 2B7NA 3EXSA 1C7SA 2E8ZA 2OKTA 4DVOA 3CQKA 5XINA 2Z7KA 1A3WA 3VGEA 1XBXA 2PRHA 4IPJA 1A5BA 4IH3A 4I90A 2BS9A 2J6XA 4MDPA 4QXIA 5AOUA 3DYPA 4PL1A 4FS9A 3VXGA 3GNRA 2R1PA 4NL1A 4D8LA 4UFJA 2NT0A 4YMZA 3ZO9A 4M1RA 4Q8PA 4KRTA 4PFMA 3TTEA 1W3HA 3RCNA 2ZRYA 1D7FA 2B31A 3IS4A 4IIFA 5M17A 3CIXA 2A4AA 4LU0A 5HPCA 1S39A 3UZXA 1EA0A 3ARUA 1NY1A 1V03A 2X8RA 3I7QA 1Q85A 3TKFA 4PN2A 3KRUA 1E4LA 1J4EA 2P8BA 4ZOCA 3HPXA 2DU2A 2WW5A 4S1FA 4P61A 5C2XA 5H8MA 1HJQA 4ZSTA 3URQA 3L21A 3P84A 1BHGA 4YVVA 1B3VA 1IXQA 2XVLA 3EWXA 4BQ5A 3PUEA 4DN1A 2FZDA 2GYIA 1UPMB 1UH2A 5EMUA 3BTNA 3NYZA 1Q65A 2IKJA 4LUIA 4BZYA 2VOMA 3QJAA 1SO4A 2F84A 1K7FA 5I09A 1KCLA 1G94A 7REQB 4XSMA 4PEKA 1EC9A 1F3TA 1KFCA 3PZUA 1BXCA 2Z2UA 1FA2A 3UG4A 5C9UA 3W7CA 3UJRA 1QNOA 3IARA 1MDLA 3W2MA 3AIBA 3GVRA 1GW1A 4B3LA 2GDUA 2CZDA 3VI2A 3M64A 3S2MA 3L0NA 1JCYA 3EWDA 2VUNA 3B9NA 3TE9A 5E6YA 3LHUA 2Z1BA 4HNUA 3IJQA 4D6EA 4ZSUA 4ENLA 4KIRA 1MXDA 3UERA 3DDMA 3SN4A 1WP6A 2FHFA 3NSNA 1A4LA 2GGIA 1O5RA 1W31A 4MNLA 3SADA 2OJPA 2PE4A 4I5RA 3Q58A 1CECA 4L9XA 4M7SA 3GZAA 1CGYA 1AODA 4QQ3A 4QR6A 1FTXA 5C7HA 4FIRA 1M7XA 4JIEA 1QHPA 3T0BA 1Z6KA 3G1RA 3SSJA 1FH7A 2UBPC 1X7FA 3U9IA 4YYCA 4N4PA 3WNKA 2HCVA 1QWGA 3RR4A 4LVBA 5HMDA 5BXRA 2PZ0A 3W1LA 1CIUA 3M16A 3VIKA 3VDHA 5A8NA 3EYPA 1HN1A 1G4SA 3WDHA 2J7DA 4LAMA 3A4XA 3BARA 1V5XA 4AWUA 3BCFA 5DT5A 2WKJA 3PWIA 3W88A 3EX6A 1SFLA 2O9OA 2A7RA 3LHZA 1K8YA 5CCZA 2X1UA 1DL3A 3SQSA 4PBEA 2FTWA 4IWWA 4ZXLA 2HWGA 5K4ZA 2ZA2A 1HGWA 4TR9A 1PDYA 1EWEA 3H26A 1RY0A 2ZX7A 4GXWA 2DDXA 2IPFA 4X2PA 1BF2A 1POKA 2IXVA 3UCCA 3UXKA 5K9XA 2BXZA 4FHAA 3M0YA 3VMNA 4B16A 2OLHA 3OIXA 1VBUA 2H9AB 2WVVB 2YFOA 1R3YA 1VJSA 4GXMA 4BQ2A 2WBGA 3GNOA 3TJ4A 4NVTA 3T0AA 4GI8A 2GGGA 3GDRA 5FF2A 1XIBA 3WQ6A 3WENA 4C6KA 2VDHA 4ERIA 3ORWA 1AL8A 2DSUA 1AVAA 5LHEA 4RZ6A 3WLKX 1R3SA 3IAPA 4AG0A 5GNZA 1ZS2A 1VEMA 1GG1A 4DO7A 2YR1A 4WZHA 3SCPA 3W6MA 4AZCB 4ROPA 2VJXA 1ZNNA 3STFA 1ML1A 4ZO6A 3DI1A 2QCGA 9XIAA 1V6YA 4W8BA 3LK6A 4XSLA 1XQKA 4DNMA 1B90A 3OVQA 4UQAA 3LOTA 2V5KA 2A6NA 3PN8A 4WSJA 3T1GA 4W5UA 2NVCA 1H60A 1Q6QA 4RW3A 4C6PA 3GKAA 1KM6A 3S4TA 2I9EA 1U22A 1OX6A 3QY7A 5HXMA 1GORA 3WBXA 2J7GA 1ITXA 1MW3A 1QXLA 1OEPA 1KXQA 3QMTA 3PULA 2Y70A 4A29A 1W1PA 2BB0A 1GOWA 4HA1A 3ZOAA 4P7LA 3TMLA 3VNJA 1JZ3A 3ITGA 4P8UA 4V2XA 3RNDA 2CWXA 4BHYA 1HL9A 3W28A 4HYWA 3REQB 5HUPA 4DY1A 4O13A 1D3CA 3S1GA 4UWMA 1GQIA 2Y2WA 5DELA 2HBXA 3ABSA 4PRRA 4GOAA 3VGFA 1XBZA 1I0DA 2C1IA 3EDEA 2J25A 1BWLA 3E2RA 1BYCA 4NKCA 3PZVA 3OLDA 3S2CA 1WDDA 5AHEA 1HL2A 3AUJA 2XIIA 2ZIDA 4FLOA 1U30A 4J5NA 1NU5A 1IQ8A 3VA8A 1B0IA 3XIMA 1R7AA 1IEVA 2BFGA 4IIDA 1UZ4A 4LUTA 1KKOA 2Y8KA 2JGQA 1GUVA 1VH7A 3FY1A 3G1SA 1MUCA 1R7OA 1TZ7A 1M01A 4UNLA 1Q6OA 3P60A 3AZTA 1PWMA 3T4WA 3MYOA 4N9CA 5I3FA 5CZJA 4RR4A 1E72M 5D8WA 4LY4A 1RJQA 4DXVA 3CIVA 3RMEA 3AXMA 2WKLA 4Z1BA 2PDIA 3MI6A 4MWAC 4KEZA 4HD5A 1QDSA 2FFCA 1MRQA 4PE8A 3AISA 4O0QA 4JN6A 4O0ZA 3W29A 1QCWA 3PM6A 1KLZA 1FUYA 3I7RA 5EL1A 3H2AA 4B3ZA 3NTYA 5E0KA 1H1NA 1ZCCA 4Y9MA 1VHCA 5C8BB 7TAAA 2XWDA 4QAIA 2PURA 4B92A 3RILA 4GC4A 2F6UA 5DLCA 1TJ1A 3TN4A 1AD4A 4RJEA 4DJFC 4O1EA 4LEQA 3K5XA 1VBHA 1DJYA 4GY7A 1J2BA 4BQ4A 2CKSA 3OGSA 1GJWA 3V5OA 4GVFA 2ODOA 3GK0A 1J79A 3A3HA 5KZMA 3TQKA 5TBOA 2XHYA 3HN3A 1W5QA 3QSTA 2IPJA 4PUMA 3BLLA 3FYPA 4O50A 5HUOA 1TCDA 3NQFA 3ONCA 3RUBL 4QIUA 2J66A 2NXHA 4DJDA 1XR2A 3VIFA 3UESA 3R0UA 3HB9A 2X05A 1HVXA 4M5PA 2X16A 2D20A 3FA5A 1OSEA 3OEXA 4PTWA 1SR9A 3LGGA 3OHMB 3LTYA 3N11A 3C2EA 2XSAA 3WFAA 4XAYA 3EX4A 1MSSA 1DOSA 3F4WA 2V69A 3WEOA 4JDYA 1UWUA 2YL6A 1EQPA 4WVXA 2G3JA 1NDWA 1IWBA 2UV8G 3ZQ9A 3SUSA 4EWJA 2PU1A 2F6KA 4YVPA 3EDKA 4GIRA 1TJRA 3FV9A 4AXKA 5GJMA 1XRSA 1DV7A 1FQ0A 1ZQ5A 5JIPA 5DF0A 2HE8A 3VDBA 2D2OA 1NFBA 4W84A 1GQNA 4Q33A 3BH4A 2RH9A 2Z6IA 1ZALA 1GZJA 1H51A 4Q6XA 1UP3A 4P7OA 2Y85A 3DBNA 4QRNA 3ARSA 1H4PA 3HGOA 2NSOA 1TQXA 4MGGA 1H1YA 4Z1YA 3A9BA 3CTTA 1J12A 3FVDA 1KR0A 1DWAM 1W91A 2PDYA 3B0XA 4S2BA 2CESA 4EKJA 3CTLA 3GYEA 2D0GA 3USZA 2EXOA 3MUIA 3HPSA 4QM1A 4XQ6A 2WJFA 1N8IA 3UGRA 2VT0A 2PLKA 3CUGA 3TQPA 4H9UA 1R5YA 1R47A 4GI4A 3MZ2A 1GKPA 3G0UA 1TX2A 4UR9A 1DWHM 4J3VA 1LWJA 2V67A 1H61A 1O94A 5FSDC 4PMXA 2AL2B 3ZS4A 1XCFA 2P0IA 1VBRA 4GK8A 4IGNA 3CQIA 1I2OA 1FHDA 1R86A 5CJMA 2NV9A 2VOTA 2ZRZA 4I9JA 5ABFA 2X0YA 7ODCA 1J0ZA 1CPUA 4CQCA 1UWQA 1FCUA 2C19A 3L4WA 1M68A 1C90A 4EXQA 1U2YA 4JTHA 4KS0A 2EQDA 3PB2A 3OYZA 4DF0A 2WQDA 2VCCA 1VEPA 4HTYA 3TAOA 4PL2A 4HCDA 4P8VA 5I2UA 3TW7A 2DIKA 1S38A 1NP0A 4DBWA 4HPXA 4L1XA 1AMKA 1D8CA 1PB0A 3G0SA 1E9LA 1X8FA 2D2JA 3PZGA 3N6JA 1W1IE 5E0FA 3MBDA 3LS9A 4LC8A 2YCKX 3E0FA 3O06A 3FLUA 4ML4A 4O52A 4X0NA 1PSCA 4FNUA 2FB2A 1JCXA 3W00A 4PBFA 1SZNA 4X60A 2V2DA 2HRWA 4EOUA 5A94A 5BMWA 3Q45A 4K7VA 1TFVA 2CITA 1HKJA 1W9DM 3E0WA 1R87A 4IPPA 4KCTA 5CKSA 3P7YA 4OUEA 3MHGA 3BE7A 1R85A 1NOUA 3TROA 3ZZ1A 1A5NC 2FB3A 3CT2A 3U4FA 2VD8A 3OA5A 1V6TA 2E6YA 1MW0A 3DGRA 3O6DA 3PBWA 4S3DA 2ADAA 2YX0A 2HJPA 1H1ZA 1SW7A 1OK6A 3T8QA 1EFZA 5I7GA 1P6WA 1NWRA 3DUGA 1XLBA 3FOKA 4NXSA 4RXFA 3WQ5A 4JTRA 3T0DA 4IFOA 1TYGA 3WUEA 2HE5A 3WEZA 1ZP3A 1THFD 4FEZA 4J3XA 2ZQ0A 1EP3A 5HATA 1M04A 1HFBA 4PB5A 1XICA 3AROA 3UBPC 3PZOA 4AHOA 2PWHA 1W6TA 2RGMA 2O92A 1OD0A 3CGTA 4IP7A 1X8CA 2ZDSA 3W7IA 2Y62A 2E8YA 4S3BA 2ZWYA 3BQ6A 1CGUA 4CNNA 3ICJA 1NQKA 2VZSA 2ZXDA 3W2JA 1GG0A 1GVSA 3ZXWA 4WD0A 2OT0A 2W61A 2FVKA 3CL7A 3AOFA 4L61A 2D1ZA 3LG3A 3OGRA 4F0RA 2WQPA 3W2LA 3DG6A 3CO4A 4D8ZA 3ME3A 3UWYA 1VBGA 4A2SA 2NT1A 4PC8A 5IM51 3OIHA 2WSRA 1W1ZA 2DH2A 1M6JA 3P82A 1DJXA 4MKVA 3TX9A 5ABGA 3VFLA 5C6MA 3U7BA 5D9MA 4L80A 1DIDA 2VURA 3GRIA 3AIVA 5E70A 1LT7A 1WDPA 4QE4A 4PRWA 4MZYA 5HK4A 2VC5A 3LENA 3TDFA 4WGHA 4Q4OA 3ITYA 3AICA 3NA8A 3N73A 3R25A 3ZJ6A 3W4RA 2WANA 1WKEA 3QKEA 2PC4A 3E5PA 2PDFA 2QF7A 2Y7DA 5H8UA 4AISA 5G2WA 4NAFB 2NQHA 3R0KA 4JHOA 1EF2A 1PDZA 3B0PA 3WK3A 2YA0A 3UWEA 4M7TA 3W7NA 2J7EA 3LBMA 3AXHA 2C79A 4QE1A 4E8CA 4JQ2A 3VOIA 3PS7A 1XGDA 5B7ZA 4DWSA 3JRKA 2NW0A 5CSRA 1TVPA 3WY1A 2PTDA 1BXBA 4EPBC 3E96A 2WM1A 3C0SA 3VM7A 1ALDA 1FDJA 3UPWA 3UXAA 2VFFA 3VC5A 3CYJA 1JZ7A 4O54A 4CD7A 4JKKA 3QF0A 1UBPC 2DT1A 3CHFA 5DXYA 3G0XA 3E2QA 4LB3A 3E0IA 1MO0A 1V0KA 3NZRA 4JTCA 1R0MA 2VRKA 3WELA 1A3HA 1HIZA 4QLLA 4Y2WA 1GHRA 1T99A 4AVNA 4MM1A 2H8ZA 4Q22A 2A0NA 3TN5A 1QPOA 2DZWA 1DJZA 5DO8A 2VI0A 1UIOA 1L6GA 2PZNA 4E38A 3IJ6A 4IMEA 2CEQA 4IP5A 3KVLA 1MDRA 1QI4A 4DM2A 2HS8A 4XZ9A 5FF7A 5JUVA 4H9YA 1XRVA 4AF0B 3MMTA 4CQDA 5DQPA 2NWRA 2P76A 1BVWA 2DPEA 2VX7A 4OZOA 3DCPA 1F07A 3NYDA 3B9OA 3A21A 3SCWA 5K9CA 1XLFA 1JIBA 1GW9A 4J9JA 2Y5SA 3W1NA 2A85A 3CZLA 1MW1A 3ZLFA 3INPA 3AYRA 3WBAA 1GVOA 3WBYA 4ONVA 1PZ2A 2OEJA 6PTDA 3ONBA 3F2CA 4QGCA 4PA8A 2F2KA 3BK0A 2WZMA 4HKPA 4LCRA 4Q7BA 3C6CA 4ZQNA 4UNIA 4A3UA 3RLVA 1WE5A 2QVHA 5LA1A 4OIFA 2Q3OA 1RVKA 3DERA 4HOWA 3LNPA 4XKYB 3MV01 1EEPA 3TWAA 3I3DA 5HOSA 4AFYA 4D6DA 1NWSA 2XPKA 3BAKA 3SB0A 2XFWA 1XCXA 3CUZA 5G2IA 2XUCA 4PMNA 3S9ZA 2X30A 4O1DA 3BLFA 4AW7A 3KRBA 2J6VA 3R2GA 3QLDA 4NNBA 4DM1A 2ZVIA 1RAKA 4BEUA 4ATLA 1GONA 2FTPA 4M6UA 4RZ5A 1ISWA 2H3BA 4S39A 4FB7A 2OZTA 5AHIA 4LYPA 4E4PA 3MANA 5D04C 4Z08A 1S2AA 4C6NA 4PUKA 1XP3A 2PDPA 1GPFA 3VPLA 4YJ5A 1TA3B 3HA1A 3AXXA 1KWGA 2ZADA 2PP3A 3WMLA 2XN0A 4OWGA 2OYLA 4PUEA 1XLGA 2GWNA 3SGZA 3AIWA 3U3HA 3MO4A 4S38A 1D3GA 1MQRA 1VFSA 3WEMA 3MUAA 4FNPA 4IPIA 2X1RA 2O9TA 2VEGA 1SPQA 4MPKA 1L6YA 4JEJA 4A35A 1RP9A 1R2SA 1DKWA 2HNHA 3ZT5A 4H6EA 2HK0A 5E93A 2NV2A 5LIKX 5DBUA 3G8RA 3HO8A 2EJ1A 3ECQA 4X9YA 2UY4A 3NM1A 2Z1KA 3PZQA 3S5ZA 3NAVA 1FKWA 4MJ2A 1EL3A 2DVTA 4E8DA 1F76A 4L4PA 4TVDA 3W75A 3NO3A 5CBIA 3B8DA 4HA3A 4H6RA 2BY3A 3IIOA 4GJ1A 4LAKA 5AHNA 3RFAA 4DBEA 3ARWA 1F7BA 4K38A 1SJDA 3VYLA 3BW2A 4MB3A 3CM4A 2H8XA 4JTUA 1EJRC 4XK2A 2JK2A 4FX7A 3NQ6A 1O5KA 1K9DA 1EOMA 4P8XA 4IUOA 2WXDM 2IKGA 4J35A 3O63A 1VFHA 3WLLA 1OZMA 4KMQA 1V02E 4ZE4A 4GPNA 1QNSA 2KAUC 1K70A 2CBVA 4DBDA 2YFNA 4J1OA 4B5XA 3TN6A 3GU2A 3IAQA 3LX9A 3RPMA 5LXEA 1JL8A 4R27A 3F5LA 1NSJA 4M80A 5AC7A 1EBGA 5D03A 3N1AA 4JTFA 4YWSA 3P8IA 2D3NA 3EA1A 5IFPA 4N9BA 1QJWA 4GINA 3BPWA 3EA3A 3JZUA 4JFVA 2HTMA 4DJEA 2VNCA 4KCVA 1O6IA 6TIMA 3ARRA 2G4JA 4NI3A 2P0OA 3DC8A 2ZX5A 2Z0IA 2TMDA 1UC4A 3UYCA 4WKAA 1K4GA 4A8NA 5I5RA 3NL6A 3KX6A 3VNDA 3IWPA 2VCBA 3P5ZA 1ZBKA 3MJYA 4R88A 1YXDA 4HHLA 5HWMA 3EB4A 1NIUA 2QUTA 3LZ3A 1KC7A 4I3GA 1VR6A 4E2BA 1SR0A 4IGSA 5CPSA 3UD6A 5J5DA 3GU1A 1G01A 1KD0A 4HOXA 4G7FA 2XFYA 4MDOA 3TUUA 1OYBA 2HEJA 4HYVA 3SW6A 3MT1A 4HPGA 1YX1A 1SSDA 1N55A 1XGZA 4RXGA 3G1XA 3PPGA 1G1YA 4L1WA 3DU0A 3MVTA 4F4RA 3M0HA 1JI2A 1LL6A 4RLIA 4EVZA 3NO1A 1PTDA 4GABA 4GACA 4HNTA 1I1XA 4HPNA 5FSEC 1XLJA 5I06A 1UPPA 1V3IA 3SDOA 1N2VA 4MWAD 5K9DA 2NUYA 2D24A 5I23A 5FL0A 3VIMA 4ZQOA 1AJZA 2V5LA 2V63A 3LHWA 2EPMX 5FF0A 5JBEA 3AAMA 4L9YA 4MY8A 2AOSA 2ZICA 2XVNA 3LLXA 4MJ4A 2CLOA 1Q13A 2ZX8A 5BWAA 5HR7A 5HMEA 1ZBVA 2BVYA 1UMYA 4HK7A 4NUWA 3UGVA 3W26A 3G5EA 4S3EA 4EPEC 2WPGA 3GG7A 1XV8A 2VEMA 1XYAA 4DJDC 5H91A 4QSHA 2V30A 2P10A 1H5YA 1Z42A 3M0VA 3TNOA 1S5MA 2OX4A 4L1GA 3UJ2A 4DXKA 1VS1A 3IJLA 5AYIA 3W1TA 1OWQA 4LV4A 1L9WA 1XM3A 5B7YA 2UY5A 1E5JA 4ATDA 4WDUA 1LF1A 4KCUA 5MHBA 3RYSA 2WV8A 1C8YA 4UXDA 4H19A 4UFLA 3ARPA 2YA2A 2BXVA 1WKYA 4EXAA 3RRAA 3W7DA 4J28A 5KETA 4Q4MA 4NAEA 4JKLA 3GKFA 4FALA 4C6CA 4IGMA 6XIMA 2AAMA 2J4GA 3ITVA 3VKBA 3UG3A 4Q3MA 4TX8A 3K8MA 2QV5A 4Z2KA 3QR3A 4KW2A 4QG8A 4UFMA 2QVNA 3VE7A 2ZUNA 5CH9A 3NGFA 3PWAA 2ISWA 4RZ4A 4LRSA 2ZCGA 5KTLA 4UMBA 3ZLHA 1TJ2A 5EU9A 1PYFA 3NQGA 5GJPA 3KCJA 4UOZA 2AGTA 3K4WA 1C9DA 2DZXA 1VYRA 1L0PA 2CLPA 3QQ0A 4EAMA 1WZLA 3VVGA 3R7MA 4UR8A 1OFDA 1DPMA 3T40A 1W17A 3C52A 3AXIA 2GJXA 3GUWA 1RCXB 3GXIA 1K4HA 1HXJA 3TYAA 3VUSA 2C13A 2IS7A 4AH7A 3RMJA 2QEZA 4B5TA 3VCCA 2VFHA 4W87A 4JN7A 4HNVA 3C3NA 4N9DA 3G6MA 4AX7A 1X7IA 4NJHA 3TYUA 1H09A 1IR1A 1XLMA 2QJHA 4LVGA 3GR4A 3BVJA 3PBMA 4QS5A 3SQMA 1CXKA 4RDVA 3BQ5A 3L4VA 4NIRA 3MMUA 4YCPA 3FSTA 6REQB 3S6OA 1ICQA 2FLIA 3BSGA 3DZ1A 1K7XA 2YYUA 1RVGA 4HNLA 2JKAA 2WO5A 3H2FA 5AC5A 2OOFA 4RZBA 1JCLA 3WZ0E 3A47A 2PAJA 4FLQA 2OZ8A 4LUSA 2CLIA 3G8EA 3WK1A 1DQXA 2CBUA 4AEOA 1AUSL 1TTPA 4C6LA 1QRQA 4CQ9A 2OWWA 4WGXA 4QE5A 2QT3A 4N02A 1FWHC 1KBBA 1FXPA 2J88A 2VEIA 1G4PA 1X97A 5IXEA 5EMKA 7CGTA 1XIGA 3I68A 2AL2A 2ZA3A 4HNCA 1LBMA 1F73A 2PDMA 4L5ZA 2ZRVA 4PUWA 3F1QA 1WOBA 2PWUA 2QULA 4GUFA 1MMFA 4NQ1A 3TP4A 1Y65A 3RM8A 1VP5A 1OVDA 1N8WA 1FWDC 1KFEA 4JCLA 3EWYA 2ZA1A 1C92A 1DWGM 5FI8A 1IYXA 4QISA 1NWUA 2G41A 4F3HA 3LM3A 4K1GA 4JNZA 2E4TA 3CNYA 1WCGA 2D22A 4LANA 5SWUA 1B5TA 2Z27A 4GQQA 1D3HA 4CU8A 4P5UA 4MLJA 3MJMA 4AZGA 1E9ZB 2FPTA 3L5AA 1PTAA 4W93A 1AG1O 4MB1A 3WNNA 3URAA 1WDSA 1KQYA 4GY0A 3R0DA 2FGZA 5CPQA 1FWCC 2YCJA 1W3NA 4DO4A 4LJ3A 2W6RA 5BU9A 1E4MM 4QG6A 2GK1A 5I02A 2WKGA 2R14A 3GR7A 3HGJA 2XGZA 3KTSA 1HKWA 4JHZA 1PX8A 3I7SA 4Z17A 1KM1A 3V35A 3VX1A 1CCWB 1RLDA 2OR2A 1LOSA 1TPVA 4J3SA 2PMQA 4DJED 1EIXA 4JQ4A 4KWWA 1QBBA 3A64A 1W9BM 3OGVA 1V6XA 1NOWA 3EMQA 3VCNA 4GO9A 2GWGA 4JTIA 1MXSA 5TF0A 4QAWA 1XW8A 4MZ8A 4FXJA 3NQ7A 2ZBTA 4MSSA 4UTMA 4UTIA 4OTKA 4LV9A 3RLUA 4KEMA 3V3WA 1I9CB 1WXYA 1YYAA 1GVFA 2ACQA 4GHRA 2IQDA 4HTBA 1YE6A 1Z69A 3EB3A 1W1YA 5CAKA 3I10A 3OODA 4TVCA 4JX6A 3UP8A 4U33A 3NG3A 3TC3A 4PB3A 1TTQA 4C5YA 4GCXA 5G1MA 4K7YA 5A2CA 3GW3A 5J8LA 4TX6A 1TWDA 3I3EA 1UCWA 4ZL1A 1HJWA 2Z2AA 4ZVJA 2VFDA 2UZ9A 3E49A 3KL5A 2E0PA 3T08A 1JYWA 2QJGA 4O57A 4E3VA 3GR8A 4A8IA 4FOJA 4RUBA 4ACZA 1OB0A 1P1XA 1EJVC 4XZBA 4IUGA 4LNYA 4YWIA 3L65A 4QNEA 4RX0A 3SECA 5HINA 3C8NA 3ABQA 4BI6A 4ICNA 1Z8AA 5JBDA 5A6MA 2D2GA 3S9YA 5T8GA 3KZSA 3B06A 4WHBA 3M5XA 1QWKA 3AS1A 3N15A 3CWHA 3PHAA 4MWAB 3DG3A 9XIMA 4C6OA 3NPXA 3APYA 2ALRA 3EWZA 4GLEA 2UY2A 5BW6A 2AQWA 5JVLA 3M0XA 4WY0B 5FF4A 5IHRA 3T42A 3RX2A 1K8XA 4UIOA 3IJ9A 3QFEA 4LPCA 2B4GA 5CZ0A 2Y88A 3MCMA 1EPXA 3P93A 2UWFA 1BTCA 4OGZA 4OJYA 2R1KA 4OU1A 3SIZA 3B3DA 2HSAA 3FJLA 4G7EA 2BZNA 1UROA 5CPNA 3BZJA 1YPIA 2KX9A 1GOIA 1NELA 4WDTA 3ID7A 2UY3A 1L8PA 4Q32A 3IVTA 3HQNA 1R30A 4LUYA 5D8ZA 2A6LA 1GHSA 1OG0A 4XTDA 4IQJA 1XKYA 4NZJA 5H2ZA 4LYRA 4M6PA 2PRLA 1LYXA 1EBHA 4A2RA 4ZMGA 5D2YA 3I4KA 3NO5A 4TV6A 1CLXA 1Z41A 1RQBA 1JZ6A 1VIZA 3VZZA 2XFFA 4NZ4A 5I78A 4L6DA 4NHVA 4MYAA 3M0MA 1MQQA 4JR5A 4LW7A 3LSCA 1FHLA 2BX7A 5AZ1A 2A2IA 4KWOA 2GL5A 5HNTA 4MVAA 2QCHA 1L6WA 4DEFA 3NR0A 3PTDA 1DTNA 2QCDA 1SU5A 4HU0A 4PMZA 2PDXA 4UCGA 4CN4A 1IEQA 4AWSA 4LBUA 4NILA 3BLEA 4CNPA 3G1VA 1X6UA 1XSIA 5F7UA 3WLQA