1C91A

Endo-beta-n-acetylglucosaminidase h, e132d
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDDYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c91A00
1M04A 4AXNA 1BGAA 1CGVA 1E6QM 2BY0A 4CCCA 3AMKA 3WNOA 2E8ZA 3PZTA 4CD5A 2ZX8A 3J7HA 3ZIZA 1UH3A 2WHMA 3TA9A 1E70M 1DWIM 4UOQA 1QHPA 1V6WA 1EDGA 2G3MA 3W4RA 4RE3A 2GSJA 1B3XA 3VNYA 3RIKA 4FLRA 1QW8A 1F4AA 1DWFM 2O9RA 5A6MA 2WW5A 1E0WA 4CU6A 1H49A 2FGLA 1KGXA 2XGIA 1KR0A 3A3HA 3GXMA 1GOWA 3SUVA 2BY2A 1GOQA 1R7AA 3EDFA 5A94A 3VTRA 1MQPA 4F8XA 5AYBA 2WNWA 1QHZA 3RJYA 4D71A 3CZKA 1E0VA 3WENA 3AMDA 1UD5A 4HA3A 3DECA 3L4TA 1W2PA 3QHOA 5A3HA 4GZIA 1KWGA 1HKMA 3ZJ8A 1EH9A 3UR8A 3FHQA 5D9MA 3N17A 4FLOA 4W5ZA 2BHYA 4S3KA 1IT0A 1MFUA 2D20A 2BXYA 4H2CA 1EIBA 3SUTA 4D6GA 2XTKA 2EO7A 4P7QA 4D6JA 1GONA 3GH7A 4NRRA 4AZHA 1OB0A 1BYAA 1UG6A 2TAAA 4U5IA 1TVNA 1W9XA 5CXPA 1JDCA 1VENA 4AD3A 4AISA 1B3VA 1B9ZA 2Z1KA 3RM9A 2GFTA 1JYXA 1W1TA 1ITCA 5A6BD 3VD9A 3POHA 1JAKA 5AC4A 5D9OA 4PRWA 3K8LA 2BHZA 3IANA 1HF6A 2XFFA 2FHCA 1VEMA 1MW2A 1FP9A 1FFRA 3WMSA 4MDOA 3I3BA 2GJXA 4AIEA 1TMQA 3ARVA 2DQXA 1J01A 3OLGA 4BF7A 3T2OA 3AOFA 3A4WA 1WZAA 2CEQA 4JCLA 1H41A 1W3KA 3AHYA 3AS2A 2XFYA 1SMDA 4Z2LA 2PWHA 2WZHA 3AI0A 5D9NA 1HP5A 4GO9A 3WH8A 3CO4A 3TTQA 4PMVA 2F61A 4C7GA 1KWKA 1OBAA 1B2YA 1OCQA 2WANA 4CN4A 2VOTA 1G9HA 3UEQA 1SFSA 1M53A 5FL1A 4J3UA 4W85A 4CN1A 1NWUA 2ZUVA 2A3HA 2W66A 1CECA 2VQTA 3E1F1 3MMDA 4UQEA 3WEZA 3NSXA 4D6IA 1E5NA 1LL4A 2WCGA 2DT1A 3ARZA 3K4AA 3CZEA 1KGWA 4PYSA 3VIPA 3NDYA 4H41A 2ZUWA 1UOKA 4CGTA 3AIRA 1E3XA 3SCUA 3F4VA 5HPOA 2WK2A 2FH8A 2DPEA 2X2YA 3M46A 1VFFA 2EPMX 2CHOA 1BF2A 5TD4A 5BXRA 1R87A 2ZE0A 4D6HA 4QLKA 1PIGA 4UZSA 1V0NA 1V0LA 2PB1A 3I3DA 2CKRA 1C7SA 1LG1A 5ABHA 3SCOA 4R5EA 4P7NA 1W1VA 3POCA 2PWEA 1UYQA 2UY5A 3AS3A 2X05A 1QI2A 1WAWA 5GNXA 1LF1A 1BGGA 1JDDA 4B3KA 4E2OA 3BMVA 2DH2A 4QAWA 3BCDA 1IV8A 4PMDA 2XVPA 1S46A 3KL5A 3EDEA 1EDTA 4QFUA 2WC7A 2WKLA 2VCAA 7A3HA 1EHAA 1H11A 3GXDA 4DWSA 2EJ1A 1IZKA 4MADA 1FFQA 1Q6FA 1V6VA 4LQ1A 1NARA 6TAAA 4J3WA 3AMLA 3VPLA 5LA0A 2PBOA 2A3AA 1VF8A 4BA0A 1W2VA 3B9EA 2VUYA 3FNDA 1GPFA 4U3AA 2J77A 4BQ5A 1PX3A 4UTFA 1MQRA 1HJQA 1AQHA 3CUFA 3PZIA 4XZWA 1V02E 3OB8A 1W9BM 2D0GA 4Q22A 4ML4A 2B31A 3K1DA 4GKLA 2X0HA 4V27A 3WBEA 4PSPA 5ECUA 4K68A 1YHTA 2PBGA 2D0HA 3DYMA 4NZCA 1C7TA 4E4PA 4AY1A 5F7UA 5EBAA 1F4HA 1UWQA 2ZXDA 2W5FA 3KE0A 4AD2A 1LWHA 3VGBA 1XH2A 3ALGA 3QOMA 3AROA 1MW1A 1VFOA 2QMKA 3AMGA 2V3DA 3ZMRA 3WDIA 5A8QA 3CH9A 3S6TA 3WSUA 1W3HA 4PTWA 3WELA 4CKQA 2WYSA 5BXSA 3ARQA 4HU0A 5DEZA 2IUZA 2DH3A 4KGJA 1JDAA 1DEDA 3WD1A 1B3WA 2V5CA 4PN2A 1CGXA 3PZQA 2QHAA 1WZLA 4PMZA 1E6ZA 1VEPA 2WC4A 1RD6A 4W88A 1J0ZA 1XSIA 1E0XA 6A3HA 2VZTA 2OLHA 4L4PA 1G0CA 2CNCA 3CZGA 3L2LA 1GOIA 3WKZA 1JAEA 3ARPA 1JG9A 4GPNA 1JD7A 2Y24A 4P7OA 1W9DM 3L4UA 4MB3A 3AXIA 5HNNA 5I77A 1PZ2A 1KBBA 3S2CA 1LWJA 4U5KA 1ITXA 3L2MA 2BS9A 6CGTA 1BFNA 1B0IA 4J27A 1OM0A 1V3HA 1WDSA 5JBFA 1OD8A 1UWSA 3U5UA 3W53A 2YOCA 1E6SM 3BLKA 1LJYA 3BAYA 1KXVA 1WB0A 2ZICA 4J7RA 4ZXOA 3WD4A 1BSIA 1V0KA 1R85A 1ZBKA 1PX8A 2WWDA 2W67A 3W6MA 3EBVA 2BY3A 1GJUA 4D1JA 1VJSA 1M7XA 2E9MA 2EPNA 3VIOA 1VB9A 3OZPA 4W8BA 5A6KA 2WMGA 5C71A 3VD5A 3VMNA 1E4NA 4OKDA 4UFJA 1JXKA 1KQYA 1KXHA 2ZUUA 1CXEA 1J10A 1VFMA 2VTFA 3CUHA 3O6AA 2WZIA 3WQWA 4DUXA 2E40A 4HPHA 3SUSA 4HZ7A 3ZJ6A 3OBAA 5E6YA 1H2JA 1WNOA 4YPJA 1V3LA 2W63A 2XG9A 1JFXA 2XWEA 4U31A 1J12A 4WIWA 4FMVA 3AIVA 1ZB5A 4GIAA 2CBIA 3PZMA 3MO4A 2XHYA 2J62A 1C91A 4CVWA 4BS0A 3ZO9A 2DT0A 1EOMA 4AWEA 1KCLA 3OLEA 4GQQA 1X6LA 3SEPA 4HZ8A 4XUYA 2CPUA 1UKQA 1V02A 3GZAA 4E8DA 3WH7A 1E5JA 3ZR5A 4PBGA 1JZ2A 2VRJA 1ZL1A 4EAMA 3PZ9A 2BVTA 4KRTA 3MUIA 4F79A 4MTVA 5CG0A 1UH4A 3U5YA 3WDHA 1BYDA 1V6YA 4CN6A 1FP8A 1DTUA 2J47A 1G94A 3OGVA 4NRSA 3WDPP 4LPCA 2BVYA 3AMCA 1E4MM 1B3ZA 3HJEA 2JALA 2EBNA 5I2UA 2OYKA 3WF0A 5CSUA 3VM5A 3RM8A 1AVAA 1EOKA 1CXHA 4CD8A 2NSXA 3W25A 2VURA 4KWUA 4WKFA 4ACZB 4ATLA 2VMFA 3UCQA 2WVUA 1JYWA 3SUUA 4AMCA 3CUJA 2OSXA 2QV4A 3FY1A 5DFAA 3AXHA 3T0BA 2ZX7A 2YL5A 3VGDA 3W29A 1GW1A 3T08A 3F5KA 1GQKA 1TUXA 4JKMA 3WF2A 1XH1A 2GK1A 1K9EA 2C0HA 2JIWA 3WFZA 1IZJA 2YBTA 1VIWA 3GBEA 2WHKA 1CGTA 2D0FA 2V3FA 4PTMA 3DC0A 2G4FA 5I5RA 4JCMA 2CXGA 4UNIA 4H7VA 4R27A 3WQ5A 3WNPA 4UFKA 5BXTA 1A47A 3BXWA 5AYIA 3VDBA 2WHLA 2A3CA 2VJXA 3GM8A 3WNLA 1KXTA 2VC9A 5I23A 4AEFA 1L0PA 3VO0A 1E4IA 1QNQA 3WDRA 1HT6A 2MANA 2WMIA 5EFFA 4CUCA 3EMCA 1C8YA 2QF8A 1C93A 1DWJM 2BXZA 1US3A 3WQ4A 3M6DA 3N11A 3GNOA 3GNPA 1W3LA 4P8UA 5JIWA 4ZE5A 2XSBA 1JFHA 5FL0A 2Y4SA 3K8MA 2YKKA 3NUKA 3DYOA 4PSRA 3ARUA 1CGWA 1TR1A 3WD0A 4GXPA 4MB5A 4D6DA 2AMGA 3WDQA 3JUGA 2NT1A 1UQYA 2YDQA 4BZYA 3AJ7A 4KGLA 2JIEA 1ODZA 1NWRA 3VIIA 3NYDA 1TZ7A 1BVNP 1CXKA 3B9AA 4TVDA 4AC1X 2WMHA 2VNCA 3RM4A 4QCEA 3QGVA 4UCFA 3VDCA 2J7GA 4HOXA 3ARRA 5A6AA 2YLLA 2BHUA 3WH6A 7CGTA 4U3CA 1VAHA 5GQBA 3RCNA 3MMWA 2FGZA 3IJ7A 5IHRA 5DT5A 2XWDA 1PJ9A 3W81A 1CXLA 2HISA 2ZXAA 5A8PA 3T0AA 2DT2A 4AD0A 1UUQA 4H04A 5DMYA 3UG5A 4CCEA 3FW6A 3IJ9A 1UKOA 2WZEA 4ATWA 4LXFA 1WDRA 3VMPA 1EGZA 1OT1A 3K46A 3BC9A 3VDAA 3VGHA 4XZBA 3CUGA 2GVYA 1CLXA 1JNEA 4F9JA 3BAWA 1XGZA 4V2XA 3D3AA 1E6PA 4UQAA 4D72A 3K8KA 3D5HA 3F5JA 5CLWA 3ZR6A 1R8LA 4WLCA 3A47A 4BQ2A 4M80A 4P7RA 3N18A 4LGXA 1FA2A 1GHSA 2V38A 2A3EA 1XYFA 2Q8XA 1HJVA 2J25A 2VVNA 3AIBA 1R7OA 1UA7A 3BAJA 4C7FA 3AS0A 3WL0A 2G3IA 4QLLA 1E1EA 3UG3A 3GXFA 4W7UA 5LYRA 2ZUNA 4GI8A 1E43A 4MB1A 4X0VA 5ABEA 5BXPA 1QI4A 2IXUA 1FH7A 3OIHA 4CVUA 2WLZA 1HL9A 4PMQA 1UD6A 1AQMA 4NSBA 1W1PA 3KZSA 1NOUA 5DO8A 4A4AA 3WF4A 2X8RA 5LA1A 3PZGA 4N42A 3SCPA 4LYQA 4U2ZA 1E1FA 1C3FA 2VZVA 1ZJBA 1CZ1A 3FHAA 4WSJA 2WVVA 1PX4A 3WF3A 1UD4A 2JEQA 3WNNA 3ZM8A 2V3EA 5FKYA 4WSKA 2ZIDA 4PMYA 1JL8A 4M81A 3L4WA 1ISYA 1W91A 2UY3A 5A95A 3W38A 5EB8A 3II1A 4QLJA 4M8UA 2DIEA 3VGGA 1V6UA 3VIHA 4ZEPA 2D1ZA 2VRQA 5IFPA 4ZFMA 3RPMA 2D3NA 2VX7A 1UD8A 3MSGA 1U2YA 2CBUA 2FHFA 4RE4A 2O9PA 3MUZ1 3SUWA 1NWSA 4U2YA 2XFRA 2GJRA 4WF7A 1K9DA 1UZ4A 2VI0A 4XB3A 2PC8A 3A4AA 2D3LA 3SIMA 3AIUA 1HIZA 4S3JA 3BSGA 2YIHA 1H4PA 3RJXA 3SCTA 2A3BA 4A3YA 3ZJ7A 3EDJA 2CBVA 3KL0A 4JHZA 1DWHM 1RP9A 4W93A 3N15A 3BAIA 3N04A 2OWXA 4PUDA 3MU7A 1GJWA 2VCCA 3SCQA 4AZ7A 4AD5A 4FF5A 4PMOA 5CJ5A 1WPCA 4DWSB 2VCBA 3WEMA 1PZ3A 3O2LA 1BTCA 2E9BA 1WZMA 5M03A 4U33A 2VL4A 5A8NA 3OLDA 5A6SA 5DT7A 3CUIA 1XCXA 3AIWA 4JKKA 2J7HA 3VUPA 2EPLX 3IAPA 5HOSA 4DWSC 4BQ4A 1CBGA 3ZT7A 4OOZA 3LPFA 1H5VA 1NP0A 1MVYA 1FHLA 1QNOA 3AQUA 1WZKA 5GPRA 1UR8A 4X0NA 2V5DA 2WSKA 4TTGA 3RO8A 5BROA 3ARSA 1UR1A 3UG4A 2FDMA 2ZUMA 1AMYA 1CNVA 3GH4A 1EQPA 5M5DA 1JF6A 1JNDA 3T2PA 1UWTA 4BQ3A 1SYTA 4H8HA 5D4YA 3L4XA 4GO8A 1X6NA 3ALFA 2ZUSA 5CPTA 1ZS2A 2G8ZA 5FIPA 2WC3A 3VOCA 3PHAA 3IK2A 2J8FA 4DM1A 2VT0A 1JZ8A 5E6ZA 5CPSA 1XSKA 1VBUA 1OIFA 5A6LA 1XYZA 3ZOAA 1VEOA 3U57A 2C7FA 4GZJA 1BYBA 5EFDA 1ISXA 1HVQA 2CITA 4Z2JA 5JBDA 2XSAA 4OZOA 1W9UA 3VD7A 4AIUA 1B30A 5C8BB 1OGSA 3NCOA 4QCFA 1JF5A 4TTUA 1E56A 4JL2A 3UR7A 1BQCA 2X09A 3AYRA 4F66A 2YL6A 3VIKA 4EE9A 1Q6GA 4YHGA 3LPPA 4V28A 2IXVA 1XC6A 3BCFA 4W87A 2JF6A 1DWGM 1QPKA 2WMKA 2ZX6A 1UR9A 4J3TA 2WBGA 3EDDA 5E09A 5HBFA 4F9DA 3ARWA 1HP4A 2GJPA 4RE2A 1H3GA 1KXQA 3CHDA 2XJ7A 1HN1A 3MV01 4IUGA 4Q7NA 2DSUA 4HTYA 2VR4A 3FN9A 4DWSD 2PF0A 3AXXA 5BRQA 4JHOA 1D3CA 3NSMA 4AD4A 1NWTA 3WUGA 1UQZA 3CHFA 1TA3B 1DP0A 1MW0A 3VIJA 4TX8A 2XPKA 3WQ8A 1M03A 2XIBA 4LYPA 5M3WA 1V3JA 1XRVA 3WEOA 3WN6A 2XYLA 2ZWZA 3DHUA 4MNJA 3G6MA 1CEOA 3OZOA 1WCGA 4B16A 2WXDM 4HMDA 3VKKA 1J0HA 1M01A 4MJ4A 1Q4NX 1QBBA 3VU2A 3WUEA 2VQUA 2E4TA 4MNLA 3BLPX 4H8VA 3BH4A 2JEPA 1NOWA 3TTOA 4AZCB 1CYGA 1JZ5A 2GDUA 3OLIA 1G1YA 1ISVA 3O9NA 1V3KA 4HMEA 2X1IA 3N9KA 5FD0A 2YDRA 5I6SA 1ZU8A 3N12A 4UFIA 2J7BA 2YA0A 3WH9A 3AHTA 4CD6A 3SCSA 1E3ZA 4GI9A 2DGAA 1WE5A 5LA2A 1XSJA 1HKKA 5GNZA 4J28A 1OINA 2DIJA 1CIUA 1B3YA 2X0YA 4DUWA 3ARYA 1QOXA 1J0IA 2WVSA 4OOUA 2W92A 4UOJA 1CWYA 1H1NA 3KEHA 1TCMA 1D7FA 2CCRA 3QR3A 5I3DA 5CPQA 5A1AA 1ZBWA 3W0KA 9CGTA 1H0GA 3PN8A 2WLYA 1E15A 5ABGA 2ZX9A 3AHZA 5A2AA 4OBSA 1J0YA 4HA4A 2J75A 3U7VA 2CERA 2G3JA 1ZBVA 1PAMA 4UQDA 5D9PA 2W91A 2O92A 4TVCA 3TTYA 2UWFA 3MANA 2O9TA 1JD9A 2QPSA 4W8AA 3VX1A 3PZUA 2UY4A 3VVGA 4BCEA 4ACZA 1I75A 4EANA 3AZTA 1HVXA 1QNRA 3AHXA 2CHNA 5BWFA 3IJ8A 4KMQA 1HJWA 1E6XM 4J3XA 4TVUA 1GHRA 4W7WA 4JZ5A 1G01A 3EYPA 1W9PA 1OSEA 3W6LA 2XM2A 1PIFA 4P8WA 1CXFA 5D8WA 1BG9A 1NOFA 2WMIB 1MYRA 4JFUA 4AZIA 5A6BA 1HJXA 2BY1A 3A4XA 3BMWA 5ABFB 1QVBA 2Z1SA 2J79A 4W8LA 3OA5A 1JIBA 1VFUA 2WB5A 3GXIA 5D8ZA 2ZWYA 3GTNA 4HZ6A 1E72M 2XUCA 8CGTA 1D2KA 1V3IA 4MJ2A 3NJ3A 1HKIA 3OGRA 1I1XA 1GVYA 4UQCA 4WKHA 2OWCA 4P8XA 1E6NA 2WVTA 3VIFA 1GQJA 1H0IA 2ZUTA 3KWXA 1MXGA 1QNSA 1VBRA 2O9OA 4HOZA 1EA9C 3U7BA 1CXIA 2G3NA 1BHGA 3W28A 1HL8A 1CENA 5A6JA 1GOOA 3WD2A 4B15A 3MMUA 1J0KA 1O7AA 1U30A 4PTXA 2QPUA 4L4OA 2WAGA 4XX6A 3MUAA 3W27A 4EKJA 1W32A 4M56A 5DF0A 4D6FA 4FLSA 1OIMA 3WUFA 3CMJA 1ISWA 3RILA 3APGA 4Z2IA 4TXEA 2F8QA 4AZ5A 2V3GA 1WDQA 2E9LA 2WPGA 1LLOA 4H8UA 1UD2A 2YBUA 2NW0A 3WL1A 1FH8A 2F2HA 4W7VA 4B9YA 5E9AA 3ZSSA 1E73M 2E8YA 1J9YA 3EMQA 1GCYA 2CYGA 1W3JA 1XV8A 1MQQA 1KGUA 1MW3A 2D22A 4PMRA 1E55A 4OIFA 1PPIA 3PTQA 4Z2KA 5CSYA 4AZGA 2WWCA 2VR5A 1PBGA 2VX5A 3AZRA 3WDJA 3VD4A 1XH0A 1B1YA 3NSNA 3NDZA 3HU7A 3SCWA 1LL6A 3MKKA 4AW7A 1KFWA 4GQRA 1EQCA 4FK9A 1ECEA 3TP4A 1TE1A 1KQZA 1HKJA 3F5LA 1HNYA 1GUVA 3KL3A 3CHCA 2W4XA 4HMCA 3PZVA 1ZJAA 2WCAA 4Z2HA 2GJXB 1H09A 1UHVA 4WKAA 4HU8A 4M29A 3TONA 3BAXA 3RDKA 3CZLA 4YHEA 4HPGA 2DDXA 2YA2A 2EXOA 2VZOA 1JZ6A 2CIPA 1K9FA 4D1IA 1CGYA 2J7DA 1KR1A 2YA1A 1OWQA 5I24A 2VRKA 5HDRA 4M1RA 3IAQA 4LYRA 1QNPA 4B3LA 4IPLA 4ZE4A 3DHPA 2EQDA 5CZKA 1KCKA 2J7CA 3BGAA 5HXMA 1WO2A 2WVVB 2CBJA 3GBDA 3LMYA 3CHEA 1UKSA 4J3SA 5A8MA 4QP0A 3SCVA 2RGLA 2J8GA 4CU7A 1CDGA 3VM7A 1WKYA 1C8QA 2VZUA 3WQVA 4EK7A 2E3ZA 1GQLA 3EMZA 4M82A 4CD4A 3HMCA 5FOOA 1RP8A 3CTTA 3FXYA 1TG7A 5A69A 1BLIA 4UFHA 2XVLA 2PI6A 3W82A 3K4DA 4KH2A 1KBKA 3EDKA 5JBEA 4CU8A 3MSDA 1TVPA 4N0RA 3WH5A 4JKLA 3W24A 4MAVA 1CPUA 2J74A 3VDHA 5AY7A 2AAAA 4X9YA 1V03A 2JF7A 3T09A 2DT3A 3WQ6A 4W5UA 4TX6A 3VX0A 1RH9A 3PZNA 1HJUA 1OGGA 4MNMA 3T0DA 5IFTA 1JZ3A 1LL7A 4UQ9A 1WP6A 4ACYA 4HA1A 4RL3A 1BPLB 4D6CA 4MPKA 4FLQA 4UOZA 1UWUA 1C8XA 2XVNA 1QI0A 3L4ZA 1RPKA 1FOBA 1U33A 4A3HA 4WK9A 3GNRA 3QHNA 1LQ0A 3CBWA 3QOKA 2XM1A 4OJYA 1QHOA 1UKPA 1J0JA 4QDMA 4PCSA 2VZSA 3ARTA 3WY1A 3TTSA 3WIJA 3WF1A 1QI5A 3PBGA 2EPOA 4CCDA 3AFBA 5JUVA 1GZJA 2D24A 3SURA 1B31A 2DEPA 2UY2A 2VVSA 4PMXA 3RMEA 1UKTA 4MB4A 1VJZA 1UR0A 1OGBA 2J7FA 5E0FA 1EO7A 1N82A 1P6WA 3ZJKA 1UD3A 1FH9A 4GINA 3WNMA 4MDPA 2AOSA 4JIEA 4UR9A 1E4LA 2W62A 3NIYA 2DSKA 3AHVA 3L4VA 3SCRA 2ZX5A 1O6IA 4HP5A 3VILA 1BVZA 4TOQA 3ARXA 1KB3A 2BVDA 2Y8KA 2BFGA 3PTMA 1EDQA 3VGFA 1WDPA 4B9ZA 1QI3A 2QMJA 4JL1A 4MNKA 1JI2A 5BYWA 2WMFA 1Q6CA 3OG2A 3LPOA 2BV9A 3VGEA 1Q6EA 3CZ8A 3WMBA 4NI3A 1EO5A 2XVKA 4OBRA 4KRUA 4PUEA 2WCSA 2WKGA 4W86A 3N13A 3CZJA 1E40A 2ZXBA 4D6EA 2YLAA 4JFWA 4AZBA 2WHJA 3UERA 3ZT5A 3THCA 3UESA 1XHGA 1UH2A 8A3HA 2VX4A 2FHBA 3CPUA 2XIIA 2D2OA 1GVIA 3QHMA 1BAGA 4W89A 3WUBA 3HN3A 1X1NA 2CESA 1K9TA 3AIEA 4AEEA 4PMNA 3VNZA 1GOMA 1ESWA 2XVGA 1EXPA 1MWOA 5C70A 3MV11 1MXDA 3W37A 1UA3A 2CKSA 1UR2A 2HVMA 4GI6A 2BNJA 3BAKA 4M24A 5EMYA 4W84A 1R86A 3CLWA 1XD0A 4PCTA 3VMOA 2FH6A 3TOPA 1JZ4A 4UZUA 3B8SA 2OYLA 1C92A 2JFEX 2NT0A 2QLYA 3PTKA 2DSWA 2VX6A 5E0CA 1W9VA 1XCWA 2PWGA 2OWWA 4Z2GA 3I3EA 1Y7VA 4XV0A 4UQBA 3WMCA 2PWDA 1K6AA 4DUVA 1UWRA 1OD0A 5CGTA 4YN5A 1GQIA 1V08A 4IPNB 5E70A 4E8CA 1BG4A 3VIMA 2YDSA 4AIOA 1C90A 2D23A 3MUY1 1HJSA 4JFVA 3W26A 3LPGA 1TA3A 2OSWA 1UWIA 1GNXA 1E6RA 1CTNA 3WNKA 4P7LA 4NF7A 3THDA 3AS1A 2JE8A 3ECQA 5I78A 7TAAA 1Q6DA 1PEZA 1E9LA 3CMGA 4J3VA 1J11A 1V0MA 3BSHA 3GDBA 2DSVA 1US2A 3AISA 1FHDA 1GOKA 1NM9A 3WFLA 4P8VA 5KEZA 2G41A 1JXJA 3AYSA 1LG2A 2WM0A 5AC5A 2ZXQA 4AZCA 2VO5A 1QW9A 2WSPA 2Y8VA 3N1AA 4GZEA 3WD3A 1UZ1A 1ISZA 3A6OA 5M17A 1NH6A 1JI1A 1A3HA 4Y7EA 1EHNA 4PMUA 3CGTA 1I1WA 5CLTA 1JYNA 1ZBCA 4DM2A 1BYCA 2OYMA 4URIA 4AD1A 3AICA 4ATDA 1V6XA 2Y2WA 1JYVA 4ZENA 3UETA 5A8OA 5GNYA 2C8NA 2XGBA 3OGSA 5BCAA 1UR4A 4TUFA 2GK1B 2ESCA 5A2BA 5BRPA 2WBKA 2GDVA 1VRXA 5I79A 1HX0A 1DHKA 1DWAM 2J7EA 2GUYA 1JZ7A 3AIQA 2YL8A 2CETA 3G6LA 3WBAA 5IXEA 1CLVA 4AYSA 3MS8A 2J78A 1CGUA 5FCZA 1G5AA 1ODUA 5CGMA 4JFSA 1J18A 2E0PA 3VINA 1AQ0A 4PEEA 1MFVA 3VIGA 4OUEA 1TFVA 2EPKX 1NP2A 3GYCA 3B9DA 1W1YA 2WMJA 3M07A 4JAWA 2W61A 3T2QA 3GH5A 1XD1A 3VD3A 3PZOA 2DSZA 5A2CA 1YQ2A 3DYPA 4C7DA 1SR0A 4WJXA 1B90A 2RGMA 3SCNA 4JFTA 2EEXA 5IDIA 4MAZA 4AZ6A 3ZT6A 2YL9A 5HPCA 1QBAA 5IHSA 1HXJA 4ZXLA 2J4GA 1Z32X 2OSYA 4UFLA 1SMAA 3AZSA 4UFMA 2Y5EA 1JGIA 2ZOXA 1NQ6A 3ZQ9A 4LX4A 3FAXA 1E71M 3M7SA 1L8NA 2PWFA 3ZSTA 3CIVA 5CQ1A 5ABFA 1V3MA 4IM4A 5JIPA 4HOWA 1GORA 4CD7A 1OT2A 5KZ6A 3FAWA 5I0DA 4PTVA 2YJQA 3L4YA 4IISA
chains in the Genus database with same CATH superfamily
4S23A 1T0OA 2FB3A 4ADSA 1CGVA 4DNHA 1N8IA 3M0XA 1R30A 4Y6GA 5K4XA 4AC7C 3L23A 2DVTA 5CJNA 3W4RA 2VFIA 1W3NA 4FLRA 1L6GA 5I06A 3G1YA 2O9RA 1J8VA 3UWZA 4P2VA 3B4YA 4WHBA 4MF4A 1CT5A 3KW3A 2FGLA 3GXMA 5D03A 3A3HA 4JNYA 4HU4A 2BY2A 3DC8A 3M16A 3EDFA 1YTDA 1PUDA 3C56A 5A94A 3VTRA 1MQPA 3MJMA 4IGHA 2WNWA 3URNA 4GMEA 1UW9A 2PWUA 3AMDA 4HA3A 1H7WA 2ISVA 1NFBA 5A3HA 3R0UA 1QOPA 5FACA 1ITUA 3GNNA 1F07A 4RW5A 1TV3A 4FLOA 4KEZA 3IIVA 2OZTA 4NZ3A 2IS7A 2BXYA 3TN4A 3AXKA 4D6GA 4FHAA 3B97A 3FJ6A 1OB0A 4TU1A 3SQMA 2TAAA 4EPKA 1XIBA 5CXPA 1UCWA 1MZHA 4O13A 3G1RA 4AD3A 4Z1CA 4Z1DA 1B3VA 4FS9A 3RM9A 3BUVA 1B54A 1ITCA 3HZ3A 1FHUA 4Q4MA 3B3DA 3VD9A 4PRRA 5AC4A 5D9OA 4LTSA 4AFYA 1VBHA 2HVOA 4Z1AA 4IPJA 3K8LA 2A6NA 3E0VA 3IANA 1HF6A 3STFA 4DHGA 1FP9A 3QC3A 3JZUA 1JUBA 1L6SA 2B7PA 2FPVA 3ARVA 3TFCA 1LOLA 4BF7A 2YDAA 3A4WA 1WZAA 4JCLA 1H41A 1W3KA 3AHYA 4Z2LA 4R9OA 3L21A 3A12A 1SZGA 5D9NA 3KHDA 1HP5A 2F61A 2CLPA 4DO7A 2R9RA 1B2YA 1VH7A 1NU5A 3CK5A 2I5QA 2VOTA 3I7QA 5F2IA 3FA3A 1SFSA 2ZZ7A 1XGEA 1NWUA 3UG8A 2Q01A 3FIGA 3QJAA 4B5VA 3E1F1 3MMDA 4Q4SA 1RPXA 3QSRA 3WJYA 3B05A 3ZVHB 2BGNE 3RHGA 1KGWA 4A8NA 3AU6A 4DF0A 2QXWA 1OC5A 2VM8A 1H7XA 1UOKA 4CGTA 3R2GA 3S1XA 1JDEA 4LRSA 1XX1A 4H3DA 2FH8A 4S2CA 3M46A 3T4WA 3N2CA 2FZMA 3M64A 1BF2A 3QR1A 1R87A 4QLKA 1MXSA 4UZSA 3EX3A 3LTYA 1LG1A 5ABHA 1W1VA 5IBXA 2PWEA 2P50A 1QAPA 1QI2A 1WAWA 2PDNA 5GNXA 1LF1A 3O0FA 1JDDA 2P0OA 4PRTA 3BMVA 1CI1A 1LRQA 2A4AA 1IV8A 3GFYA 1T40A 1EDTA 2FZ9A 2WC7A 2WKLA 4Q3MA 3UJRA 2Z24A 4NAEB 4PFMA 5HUOA 5BRBA 1FFQA 1TWSA 3N14A 2VKZG 1VF8A 4Q4KA 4Y2WA 2VUYA 2V30A 1PX3A 1EWEA 3NURA 3WQFA 1MQRA 3M0VA 1K77A 4ZCWA 3APYA 3LNPA 3S9IA 1V02E 1XBXA 4XBJA 3V4BA 4GKLA 5HR6A 3F4DA 4DXKA 1QO2A 3KVKA 4PSPA 4GACA 4E3VA 1XLHA 3SRDA 4JPGA 4NZCA 4QEHA 5EBAA 2HTMA 1GK8A 3KE0A 1XH2A 1OFOA 1V5XA 1RAKA 5DBTA 3AMGA 2V3DA 3OOQA 4JX5A 3CH9A 3PBMA 5BXSA 1C29A 4HU0A 3RU6A 2PSNA 4UNLA 4RZ4A 1I0BA 1Z48A 5DRCA 4E0CA 4GGBA 4C60A 4FNSA 4MZYA 4GIRA 2GQAA 1BKSA 3WLOA 3WFAA 2OGYA 1DJZA 4JTIA 4W88A 4XZNX 3E5PA 1XSIA 5CJMA 3CM4A 1XI3A 2RKXA 3WKZA 1JG9A 4R3UA 3PUDA 4P7OA 1W9DM 2OQYA 4GVGA 5I77A 5B7ZA 1KBBA 2PD9A 3EWDA 6CGTA 4J40A 4REQB 2HPMA 4GI4A 1UWSA 3LCWA 2IPJA 5CH9A 3U5UA 3W53A 2YR1A 1Z9AA 1E6SM 2BZNA 4IGMA 2FQIA 3SB0A 4KW2A 4LUSA 4WDXA 5G2IA 3WD4A 1V0KA 3P14A 3EBVA 2IKGA 2BY3A 2R8WA 4ES4A 2F38A 3R10A 2E9MA 2EPNA 5XIAA 2VGGA 3VMNA 1E4NA 3MHGA 2ZUUA 3DGRA 3M41A 2G37A 3VCRA 3CUHA 2ZZ6A 5G4EA 2WZIA 3WQWA 4GQ0A 2E40A 3REQA 4A05A 5E6YA 2NLYA 3WLLA 1V3LA 3P0WA 2W63A 1QNVA 2HROA 4GUJA 1J12A 2PDPA 4MLJA 5FF0A 3S5ZA 3CT7A 1Q2RA 2J62A 1IEQA 4CVWA 5T26A 1SFLA 2PDWA 3OLEA 3BO9A 3RCYA 4Q8QA 1UKQA 4O1EA 4H7CA 3SJNA 3WH7A 2VRJA 4OV9A 4UTMA 1KTNA 4KRTA 3WMLA 1AD4A 3MUIA 4JTAA 4F79A 1UROA 3G0SA 4A8RA 4HSHA 1BYDA 3BZGA 3WDPP 3G8RA 4LPCA 1QRQA 2ISWA 3HJEA 1WUFA 2EBNA 2QCLA 3ANUA 4M51A 3TCSA 3RM8A 1AVAA 4CD8A 3S2LA 2VURA 2VMFA 2WVUA 3SUUA 3MP5A 5C9XA 4XWUA 3CUZA 3UVAA 2J66A 4PB5A 2ZX7A 3MWAA 2MNRA 3F5KA 1GEHA 3W1XA 3UY8A 1IZJA 2I5GA 2WHKA 1UOZA 2OCZA 1IEIA 2PA6A 3DUGA 1CGTA 3SSZA 5CCZA 2V3FA 3QRHA 3DC0A 2DU2A 3EA1A 1RBLA 2NQZA 4CEXC 3U0HA 4EPBC 5I5RA 4UNIA 3G24A 4JY8A 3WNPA 1V7AA 3TK7A 1BWKA 3UZWA 1VLIA 4AY7A 3EX1A 3V18A 2JKPA 1PWMA 1V7YA 4YIWA 3SN0A 4DJDD 9RUBA 3B8WA 3ANYA 1PYMA 1W5MA 2WQDA 4NJKA 4AEFA 1SUXA 1QNQA 1HT6A 2WMIA 3QV9A 4Q8NA 1FX6A 1ICPA 2EG8A 4CUCA 3EMCA 4Y9OA 1ME8A 3VNLA 1ML1A 4CNOA 5K3VA 4WZHA 4C6MA 2FPTA 4HYVA 4MFDA 3EPNA 3CL6A 3C5QA 3IUDA 1FTXA 3BSMA 4P8UA 5FL0A 3P60A 2YKKA 3NUKA 1TR1A 3W2JA 3ITGA 1XLLA 2AMGA 1XYAA 3M1ZA 4ZO6A 1JJKA 3O6DA 1FKXA 2YDQA 4XO7A 2YGYA 2Y5JA 1Z7AA 1RQEA 1SO5A 1K8YA 4QDWA 3R5EA 3NYDA 1ENUA 1TZ7A 3CV6A 1S2WA 3GC5A 3DHFA 2P8CA 2LLEA 2P8BA 4ICCX 3RM4A 4QCEA 4UCFA 3MY9A 4XZLX 1TPFA 4HOXA 5A6AA 2CWXA 2OOFA 2NUXA 2P88A 3WH6A 3NZQA 4F0SA 4U3CA 3ELFA 1I0DA 2IKHA 3IJ7A 1PJ9A 2IPFA 2Y7GA 3Q37A 4FSAA 1PCKA 1CXLA 1P0EA 3T0AA 3LD5A 3VCCA 4H04A 1TIMA 4CCEA 2PU1A 3IJ9A 3F4NA 5H8PA 4LXFA 4B5UA 1OT1A 3HQNA 3VDAA 4XZBA 3DEQA 3AYTA 2DJLA 2OZ0A 4F9JA 1XGZA 3TWBA 4PUUA 2UV8G 4GNKB 4D72A 2BSLA 1EC9A 3Q67A 4NJHA 2X7VA 1S2UA 3HPSA 4H83A 4KWSA 1TWIA 3PF3A 2OLSA 3KOXA 3WLJA 2Q8XA 1HJVA 1BXCA 2VVNA 1R0MA 1UA7A 3DENA 4QLLA 1DJWA 1E43A 4HSOA 1XRFA 1QI4A 4JN7A 2NZLA 4GYKA 4CVUA 3OYZA 1HL9A 4ZA0A 1UD6A 3EGJA 3VNMA 3QEZA 3E6EA 1NOUA 4RXGA 4FEZA 3N73A 1FWFC 3PZGA 3PULA 4GZ7A 1E1FA 1C3FA 4XK2A 1XP3A 4WSJA 4LAMA 1PX4A 4CQ9A 3ZM8A 2V3EA 5FKYA 4JTDA 1K8XA 2OKTA 2ZIDA 1JCXA 3U2CA 1JL8A 2BG5A 3GVQA 4K7YA 1W91A 2OO0A 2UY3A 4Y8EA 5A95A 4KPLA 1AW2A 2DIEA 3VIHA 3S8HA 2FMOA 2ZQ0A 2DY3A 2VRQA 3OQEA 5IFPA 1F6KA 3LRMA 1F3TA 5HNUA 4XD5A 2VX7A 3MSGA 2PPGA 1U2YA 2CBUA 1IEVA 1ICQA 1R2RA 4K1GA 3S2JA 3MUZ1 4MUZA 3SUWA 1W3IA 5EY5A 4WF7A 1NY1A 3RLHA 3PJWA 4LEFA 1KNWA 2PC8A 3SIMA 4MWAB 3G1VA 2A3BA 3ZJ7A 3EDJA 4ZL1A 5IOBA 1JUEA 5I3FA 5I3IA 2DUXA 3M5ZA 3E02A 3N15A 3BAIA 3CLMA 3MU7A 1RJQA 4A8IA 3TXZA 5LNRA 4OE7A 4LVDA 4CNUA 4LBRA 4AZ7A 3B0XA 3TMLA 4PMOA 3OW1A 1WPCA 3V0SA 4EOUA 1PZ3A 1BTCA 1WZMA 4WX2A 2C18A 4YLWA 4YWSA 1Q65A 3S3GA 5A8NA 1D9EA 2ACQA 3FS2A 3CUIA 3LXCA 2VENA 4JKKA 1DE5A 3LCHA 3VUPA 4DWSC 3P93A 3WLIA 4IIDA 4H6KA 1T99A 3LPFA 4ZQRA 3G1HA 2XSXA 5A5WA 4A3UA 1H5VA 1QU4A 1NP0A 1I2OA 4JIRA 4BF9A 1QNOA 2Z1XA 4GG9A 1P0KA 1WZKA 3NQMA 3L67A 3QGAC 5AHEA 4PB4A 4TTGA 3RO8A 5HQEA 4K8EA 3R8HA 3UG4A 3NXFA 2FDMA 2NQHA 3A5FA 1K02A 3QW3A 5F4WA 1EQPA 1JF6A 2GUBA 1UWTA 1PIIA 4DLMA 4Z0JA 5T91A 3L4XA 2PU0A 2Z2AA 1SSDA 2ZUSA 4AAJA 1NVMA 3KWSA 3CU2A 3IK2A 3TU9A 4DM1A 3C0SA 3FX4A 5DXXA 2OX1A 1RK6A 4GE8A 3ZS4A 5IRPA 1XYZA 3QY7A 1FRBA 2C7FA 1IWBA 3TW6A 4HA0A 1ISXA 4FZIA 1ZAJA 4Z1BA 4N6FA 3VOJA 5F2GA 2CITA 2H9AB 1YIXA 1JULA 4Z2JA 2Z1BA 2PP1A 2F6KA 5AHIA 4OZOA 4AIUA 4K39A 1ZHAA 3EAUA 1GYNA 1G7UA 3NCOA 3GAYA 5I00A 1JF5A 2BLEA 4O53A 1ALDA 4JL2A 4F66A 3RN6A 3TDFA 5EBUA 4LWWA 4ZZ9A 1W1ZA 2BOEX 2IXVA 1XC6A 3GKAA 1DWGM 1QPKA 5DBUA 3EDDA 3M0YA 5E09A 4F9DA 3H2EA 3E12A 1FCBA 3S2MA 3VC5A 2UZ9A 3MV01 4Q7NA 5AB3A 1ME9A 3BURA 3NQCA 4LS1A 3HJZA 4REQA 4JHOA 4JTQA 4AD4A 1X1OA 4NASA 2GQ8A 2Y61A 1UQZA 3CHFA 4FX6M 4CCZA 3TN3A 3W1AA 4DJDC 3FSUA 4LYPA 3S1GA 1KFJA 1XRVA 3BJFA 3DHUA 2FVMA 1BRLB 3G1FA 4MNJA 1BXBA 1XIFA 1MSSA 1R3TA 2R14A 1B5TA 5XIMA 2WXDM 3VKKA 2CZFA 2XISA 4M19A 4N6EA 1QBBA 1XJBA 3GAKA 5HK4A 4XVEA 3TA6A 3VU2A 4M0XA 1TV2A 3DERA 4MPQA 2JEPA 3SAZA 2ON3A 3TTOA 1P5BA 4AZCB 1CYGA 2YCLB 4GCAA 4BWLA 3OLIA 3QC0A 4P5UA 4K8GA 4KWOA 2E6DA 1GG0A 3O9NA 3ENLA 3QPYA 4A8LA 1EYWA 2YDRA 5I6SA 3BJTA 3WH9A 4QS6A 3FFSA 1E3ZA 1EZWA 3QN3A 4GI9A 4JY9A 1WE5A 5LA2A 2IKIA 1HKKA 5GNZA 4EPEC 4LUTA 3GU9A 1PTGA 3R89A 4DIAA 4DUWA 1FWTA 2Z25A 3A3XA 3T8QA 1EB3A 1QOXA 4DZAA 1H1NA 4DZ5A 4E4FA 3KEHA 1TCMA 2CCRA 4GBUA 5A1AA 3M7WA 9CGTA 2WSQA 2ZA1A 4ORIA 1X8CA 2WLYA 5A2AA 3CYJA 4OBSA 4RDWA 1J0YA 4HA4A 1XF0A 2OLAA 2PDJA 4A6GA 1O1ZA 5K7JA 1XLBA 3TTYA 2QS8A 4JIIX 2UWFA 3MANA 4W8AA 3UWYA 1U83A 3VAVA 1F3WA 3L12A 2UY4A 3VVGA 3W72A 1I75A 2I14A 3P2VA 4DJEC 1VYPX 1GTHA 1DXIA 3AHXA 3ABZA 2Y62A 3PUGA 3B9OA 3KX6A 1UMLA 3FXGA 2G96A 3QFWA 4JZ5A 3I65A 3IJQA 3EYPA 2DVUA 3W6LA 4WCJA 1PIFA 4KCTA 1MYRA 1HGYA 4JFUA 5A6BA 2O7SA 3OHIA 1H5YA 1TX2A 5FAGA 1W8SA 4AIBA 4O14A 3M0ZA 4MMWA 1U5HA 1OFDA 4W8LA 3NZ1A 4TX9A 3HV8A 3RU8X 3ZYZA 2X1TA 3MI2A 4FX7A 1XLJA 3H2CA 1Y5VA 2IQTA 2XUCA 3UU0A 4GABA 3WJSA 1V3IA 1I1XA 4DBWA 4WKHA 1YNQA 1XDLA 1T8XA 5EMKA 4PB3A 3VIFA 1GQJA 2FTPA 5C9WA 3THAA 4DO4A 3KWXA 2Q71A 1EP2A 1KM6A 2CLIA 4JX6A 4DELA 1EA9C 1RVGA 1SZNA 3U7BA 5ABTA 5HR7A 3W28A 1CENA 5A6JA 4B15A 3BDKA 2QPUA 4HTBA 4I9AA 1VGAA 1W32A 5C54A 4LC6A 3HV9A 4FLSA 1PS9A 1OIMA 2ZDSA 5JH1A 1LOSA 4NX5A 4Z2IA 2F8QA 4AZ5A 1WOBA 3DFTA 5GJMA 1UUOA 1EA0A 1NTHA 4ICNA 3LDVA 4JQAA 4PL2A 1EP1A 1RBOB 2UBPC 3CV2A 4OECA 2TYSA 4PTNA 4H8UA 3KXQA 3QF0A 1SGJA 3ITXA 2ZRXA 1FH8A 2F2HA 2ACUA 4GUHA 2FB2A 1TTIA 3EWZA 1Q7ZA 2YCKX 3EMQA 2CYGA 4GXMA 2R1LA 5H6HA 2WM1A 1PPIA 3PTQA 1DQWA 4Z2KA 1JRCA 2BBFA 1AH4A 1RCQA 1Y5WA 2VR5A 2PGWA 4AB4A 1PBGA 3WDJA 3HU7A 1KV8A 4JTRA 1LL6A 3N3MA 3MKKA 4AW7A 4KERA 4H9YA 4TV6A 1TV8A 4FK9A 5DRIA 1EBGA 3AYVA 3TP4A 1KQZA 1YBQB 2ATMA 5HNRA 1TELA 2CWNA 3WQOA 4WKAA 4IGNA 3ZWSA 4M29A 4YHEA 1DV7A 1WKDA 5FEXA 1S5VA 2VZOA 1PKNA 2H3DA 1CGYA 4KRZA 1W8GA 1KR1A 1F3EA 3BK0A 1IR2A 2VRKA 3G1XA 5HDRA 3IAQA 2VEFA 3B0PA 5F1UA 3PPHA 2PFHA 3DHPA 1A5BA 2H90A 4J35A 5HJYA 3RXZA 5CZKA 3BOLA 2DUAA 4U28A 3H70A 2A0NA 2WVVB 1NIUA 3BL3A 4B92A 2QDEA 2SFPA 3T81A 4TR9A 2VC6A 3HGRA 1FQ0A 3UYCA 3ZLGA 4HHPA 2QJIA 3UJSA 1EPVA 3C2RA 4NJGA 3VM7A 3O8AA 3TC6A 5CBIA 3IV8A 3OBEA 4IG2A 3W23A 3BQ6A 3CTTA 3FXYA 5A69A 2PI6A 3TQ0A 3PFMA 4KH2A 3EDKA 3WJXA 5JBEA 4NY2A 1POKA 4UTTC 4MAVA 1TTPA 4LT9A 3D3FA 4YYFA 1T6MA 2JF7A 1ONWA 1JQXA 5AHMA 2TSYA 1RZMA 3THQA 3VX0A 3PZNA 3QLLA 1HJUA 1SJAA 3V0UA 2DUZA 3CPRA 4PGLA 5IFTA 4JD4A 1LL7A 4UQ9A 2GUUA 3UY7A 4RL3A 4RUBA 1JPDX 8TIMA 1QI0A 1HQTA 3O05A 4MJZA 2EAWA 2C0AA 4MWAA 3H2MA 3L4ZA 7PTDA 5EU9A 3B8DA 1I60A 3ISIX 3OJGA 3WO8A 1H1ZA 1RY8A 3GX9A 2INZA 3IK4A 3OZYA 1D3GA 1B57A 3QOKA 3N34A 1QHOA 1UKPA 1J0JA 4WUIA 2FZ8A 1W0MA 2VZSA 3WY1A 3WIJA 2OZ8A 3WF1A 2OU4A 3NO5A 3DFNA 1FDJA 4YYCA 5JUVA 4XAPA 4PMXA 2QJHA 4XTIA 1VJZA 2BMBA 4LFYA 2AKMA 3IWPA 3ZJKA 3WNMA 1DJYA 5J04A 5AYZA 4UR9A 1E4LA 2W62A 3NIYA 2DP3A 4NILA 1QJWA 3B9NA 3CL8A 3T0CA 2BVDA 1A50A 5KTLA 1T41A 2CLFA 3UZJA 3USZA 2A7PA 5DN1A 4ZSUA 5L9FA 4B9ZA 4MNKA 1JI2A 3WCZA 4M3PA 1Q6CA 3LPOA 4GIEA 3NDOA 4I3GA 4NI3A 2PC4A 4OBRA 3NZPA 3R6IA 3PAJA 3R8RA 3A3WA 1ZTVA 2WKGA 3GWQA 3N13A 3CZJA 4C91A 1OEPA 1E40A 4H9XA 5GJPA 4HMNA 4D6EA 2YLAA 2WHJA 3NL3A 3THCA 3UESA 1XHGA 1UH2A 2FHBA 3HIJA 2XZ9A 2XIIA 3QHMA 3GU1A 1E51A 3NNTA 1I2QA 4W89A 3HN3A 2XH2A 1K9TA 4WOQA 2BOGX 4IPIA 4CNNA 4HNOA 4QE4A 2P76A 2XVGA 2ICSA 4NJJA 2TPSA 1WXYA 3W37A 2PDCA 1YW1A 4HPNA 4M24A 1UASA 5EMYA 4ZB0A 1FBAA 2X0SA 2POTA 3H4WA 4TV5A 1RVKA 2OYLA 1C92A 4YTSA 2NT0A 2DSWA 6XIAA 3TE9A 1MEIA 4Z2GA 1AD1A 1Y7VA 4L1XA 1MUCA 4XV0A 3LGGA 1UJQA 3WMCA 2WJFA 4F4RA 4DUVA 1OFPA 3GY1A 4KIRA 3ABOA 4R88A 1N7KA 5I07A 4G5DA 2E67A 3VIMA 1AFSA 1EJSC 4AIOA 3GYEA 4GKTA 1HJSA 3AUOA 3CQIA 3W26A 1PO9A 1UWIA 3WLPA 1E6RA 2PDHA 4NF7A 2JE8A 3LBMA 7TAAA 1Q6DA 2PDGA 1BRLA 3CMGA 4S39A 2VEKA 3HB9A 4HNUA 3KTCA 3NVDA 4C6KA 1US2A 2FTWA 1GOKA 4R85A 4JN8A 4S3FA 1JXJA 1KRMA 3AYSA 3STPA 2WM0A 3KDNA 4AZCA 2Y8VA 2YCLA 4GZEA 1ISZA 3GG1A 4CNPA 1RK5A 4TMCA 3IARA 1ZBCA 4IGSA 2E5BA 4DM2A 4K3ZA 2DW6A 2OYMA 1G4PA 3AICA 4ZENA 5A8OA 1ZCCA 3GFXA 3WLRA 7REQA 2ADAA 3H23A 4L64A 4F2TA 1WXJA 2GK1B 2WBKA 3L0KA 2GDVA 5J8LA 1KKRA 3P74A 2ZE3A 3LUTA 4D9PA 2GUYA 1EFZA 2VYOA 2YL8A 3IVSA 3G6LA 2V2HA 1ZAIA 4AYSA 4AYGA 5FCZA 2YB4A 2YB1A 1DQUA 2QR6A 4JFSA 4B3ZA 4H9ZA 3VIGA 4OUEA 1SQ7A 2ATSA 2NQLA 1YDVA 5F2MA 4JAWA 4QBXA 3T2QA 3GH5A 3MHUA 1OX4B 1R47A 3PZOA 3GVVA 1EWDA 4WJXA 1F9CA 2RGMA 3SCNA 2EEXA 1DIOA 4AZ6A 5FJPA 3ZT6A 3EPMA 1QBAA 4GOAA 5IHSA 4ZXLA 3GDMA 2OSYA 3GR4A 1J5SA 4A35A 4MYAA 1E71M 1L8NA 2PWFA 3QXBA 3O3RA 3ZSTA 3TYCA 3MBFA 3CO8A 3CIVA 4M6QA 5JIPA 4HOWA 3AXMA 3GTXA 3FAWA 4POCA 1YYAA 4PTVA 1KV5A 1VLWA 2J24A 3NQ6A 2BY0A 3EXTA 4AF0B 5DY2A 3OP2A 4PBFA 1GQNA 3AMKA 2YXGA 3TN5A 1I8JA 3WQDA 3PZTA 4IWWA 2PTYA 4K7VA 3UJ2A 3J7HA 1S5WA 1Y5XA 4KCUA 5JXQA 1DWIM 1BWVA 1A5OC 1QHPA 2FKPA 2PUZA 3W1LA 1ZCOA 3BLEA 5CPMA 3UWEA 1B3XA 1F4AA 4WGHA 3EEGA 2PDLA 1ZAHA 4Y9AA 2D2HA 2WW5A 2XGIA 4B5NA 2YW3A 3SUVA 3UJFA 4K6AA 2X40A 3R7MA 1R7AA 3HQ1A 2HE5A 3R13A 1QHZA 2GSHA 2NWSA 4C1KA 3RJYA 4D71A 1E0VA 3TKFA 1T5AA 5H2ZA 4BK9A 2YZ5A 1L6FA 1KWGA 1EH9A 4FO4A 3UNTA 2VELA 3FHQA 3N17A 3GHTA 2CLHA 4U10A 4W5ZA 4S3KA 1IT0A 1MFUA 1FWHC 4H2CA 3H8AA 4Y9NA 2ZRWA 4FIRA 5G1MA 1UG6A 2GWNA 1TVNA 3PC0A 1L9WA 4Y9MA 4RDVA 4Q8UA 1W1A1 4RLIA 3E3HA 3BARA 1Z8AA 1W54A 3MJYA 1TPH1 5H1WA 4DRSA 5A6BD 4O1FA 2XIQA 5CSSA 2HNHA 2BHZA 2DZWA 2FHCA 2HK1A 1MW2A 1EKOA 1HW6A 4RPPA 2NV1A 4MDOA 5CBBA 5KZMA 1K1DA 2C1HA 2ALDA 1X7FA 2DQXA 1ZPTA 1NDYA 5AOUA 2GOKA 3OLGA 1JCJA 2ODOA 4Q4PA 2OEMA 3UVIA 5FSEC 3AS2A 4CQDA 1SMDA 5BU6A 3MBDA 2PWHA 3IEBA 2QJMA 8XIMA 3TTQA 4N7QA 3RITA 1LDCA 1OBAA 2A7RA 1GYLA 3QPEA 3FK4A 1HKVA 3C2OA 5CZJA 3EEZA 4AHOA 4BJHA 1FY6A 1G9HA 1K3UA 1Q8JA 5LNWA 1LM1A 4E8GA 2A3HA 1S1PA 5D33A 1JPKA 1CECA 2R1NA 4UQEA 3WEZA 1Q45A 2VEMA 2WCGA 3NL6A 3ARZA 2PZ0A 2G5WA 2ZUWA 1PCWA 3NGJA 2ZDRA 3C2FA 3NO1A 4KFOA 2HPIA 2CHOA 1OF8A 3GR8A 4LU0A 5BXRA 4QGCA 1UIOA 4D6HA 3LLXA 1PIGA 1IR1A 1EX5A 1CX9A 1TPDA 2VC5A 1GZGA 2V2CA 3M0JA 3SCOA 2HRWA 2R1MA 4P7NA 1PYFA 2UY5A 2X05A 1UBPC 1P4CA 3LM3A 2BGQA 4XSLA 4NU7A 1O5RA 5MHBA 3BCDA 2XVPA 5A8GA 1S46A 3W2KA 4F2BA 4IICA 1G7VA 4N9BA 2VCAA 1VCVA 1H11A 4NAFA 3E5BA 4EPDC 2EJ1A 3TYZA 4LQ1A 2R24A 1NARA 4FNTA 4ZOBA 4H9UA 1DYSA 2A3AA 4BA0A 1FWEC 1W2VA 3B9EA 5C7VA 3WLSA 1F8IA 5C2GA 1KTCA 2REQB 1AQHA 3PZIA 4XZWA 1XG3A 5FEWA 3OB8A 1W9BM 2D0GA 4Q22A 4ML4A 3K1DA 3SQSA 1AW1A 4XIMA 2Y85A 3G77A 4K68A 4B91A 4L61A 2PBGA 1C7TA 3N4EA 4DO5A 3SSJA 2VWSA 4I7WA 1VIZA 3LHVA 1LWHA 3ABSA 3VGBA 3AROA 2QMKA 5D38A 1KM5A 3ZMRA 3GVRA 4IMDA 3QTGA 3S6TA 1KM1A 3WELA 1XQLA 3E49A 2WYSA 3N4FA 3BCJA 4US5A 5DEZA 2IUZA 4IP4A 4JIPA 2DH3A 2IPGA 3U9IA 1DEDA 3E74A 1QUMA 5XINA 3R0DA 4PN2A 2QHAA 4PMZA 1QATA 1UUMA 2WC4A 1RD6A 3S9YA 3H2AA 2Z1WA 1BQGA 3TW7A 1D3HA 3U2EA 4GFSA 5LKYA 1E0XA 2VZTA 4LCRA 1JRBA 1HL2A 4RR4A 3OO2A 2CNCA 1YDNA 3UNDA 1JAEA 3HG3A 4QAIA 4GPNA 1JD7A 2QZRA 1XLFA 3L4UA 4JTJA 5HNNA 1PZ2A 3W1QA 4GHRA 3SO7A 3GG8A 1LWJA 1EJVC 4U5KA 1F2JA 4OTKA 3GTHA 3L2MA 4MWAD 1BFNA 1L2QA 2NWRA 1V3HA 1WDSA 3KLLA 2D2GA 3TH6A 4L6HA 3NVTA 2WQPA 3T78A 3BLKA 4DXXA 1KXVA 1FWGC 2CW6A 1SVDA 3GNXA 1R85A 3MI3A 1PX8A 1B9BA 2WWDA 1D7KA 4FXFA 4D1JA 4IJCA 3TNBA 4IIGA 4AG0A 3VIOA 4JDYA 2WMGA 2AGTA 1GW9A 2PP3A 4BI5A 1KXHA 4LBUA 1CXEA 4DJFC 5HMSA 1VFMA 5FA5A 3O6AA 2QVNA 3MI6A 1A5SA 4HPHA 1M1BA 3OBAA 3DU0A 4EF8A 1H2JA 1WNOA 2XG9A 1A0CA 2XWEA 4DF2A 3C3NA 1A5NC 4Z08A 1REQA 2QCDB 3OHMB 4GIAA 4IQEA 2VUNA 3PZMA 2R6OA 2DZTA 4WEVX 1C91A 2VR2A 2VFFA 4KCWA 3SDOA 1G67A 3CB3A 1A3XA 3W7NA 1X6LA 4XUYA 1V02A 3O6YX 4E8DA 3H12A 4GX9A 1JZ2A 3CH0A 1FXPA 1ZL1A 4EAMA 2XGZA 3QFEA 4MTVA 5CG0A 1UH4A 1F7BA 3WDHA 3EOOA 3P0XA 1FWNA 2YCJA 4QG8A 3EWCA 1J79A 5JQ9A 2PTXA 3Q58A 5DXYA 2J47A 2O7QA 3UA4A 4NRSA 2BVYA 1OCBA 3L2IA 1EUNA 1V51A 1KD0A 1O60A 1EOKA 3CEUA 1CXHA 4S3CA 4NNCA 4WKFA 3T1GA 3IJ6A 3UCQA 3BW2A 3M9YA 5U7SA 4AMCA 4B5SA 2QV4A 2PEVA 3T0BA 3KTSA 2QJGA 3CQJA 6PTDA 3VGDA 3AO0A 4GGHA 3W29A 3T08A 3OBKA 2Z27A 2GK1A 3L5LA 2PDFA 1XS2A 5FF3A 3B8TA 1QW7A 2YBTA 3VKAA 1VIWA 2NUYA 1OFBA 2D0FA 3VZXA 2P5NA 4W9TA 2V2DA 3ME3A 3VK5A 1YNPA 2G4FA 5IDZA 4MYXA 1TWWA 2CXGA 4I8YA 3C0LA 3A24A 4LS2A 3B03A 1AZ1A 1YPFA 5BXTA 1A47A 2Y89A 3BXWA 1QT1A 3LMZA 4XBKA 3USBA 2A3CA 3GXNA 3GM8A 3L0NA 1OY0A 1VPYA 4HPXA 2VC9A 5I23A 1L0PA 1E4IA 1A5LC 4QR6A 4IMGA 3MCOA 1OX4A 1HZYA 3NQBA 3GTFA 5ECVA 2ISFA 1E1CB 1C8YA 4RK8A 2OT1A 3M6DA 4CEUC 4Q32A 1GVFA 1ZP4A 3GNPA 4JQ4A 5G1TA 2WOQA 3HG4A 3BANA 3N2MA 1M7PA 3DBNA 4GYPC 5JIWA 3GFZA 3BVJA 3K1GA 3U2OA 2Y4SA 3K8MA 1YPIA 1CGWA 3LGEA 4H19A 5LXEA 1Y65A 3JUGA 3KM8A 1XIMA 2NT1A 3AJ7A 4KGLA 2JIEA 3S2NA 1ODZA 3CPGA 1CLKA 4JTLA 3FYYA 4AF0A 1CXKA 3B9AA 3T4CA 4TVDA 4RNIA 4PC8A 3N2TA 2EPHA 2RDUA 2YCIX 2OQLA 3QGVA 4IMAA 3KBVA 3S4TA 3GHUA 3TC3A 1ZLPA 1WX0A 2YLLA 4YXGA 2FGBA 4GVHA 1KFCA 5GQBA 1PE1A 2Y63A 3MMWA 3BG3A 3SRFA 5IHRA 2XWDA 1Q4WA 3UQNA 3WQEA 2R94A 3M0IA 3P84A 3R4IA 4O52A 5A6TC 4AQLA 1QASA 5DMYA 2X7WA 3VOFA 1CW2A 3EKGA 4O0ZA 1PKYA 1UKOA 2WZEA 1WDRA 3VMPA 4RJEA 3SFKA 1H50A 5D2XA 3K46A 3VGHA 2GVYA 3TN6A 4XO6A 1CLXA 3BAWA 4V2XA 1XINA 3GU2A 3GC4A 5AYYA 3K8KA 2PDUA 3VXGA 2P53A 4N9DA 3DKJA 4DQWA 5FJOA 3DI0A 4LOCA 4H1ZA 1IQ8A 2A3EA 3HURA 1J6PA 5I7GA 4JIQA 3AS0A 3WL0A 2G3IA 1E1EA 3UG3A 5KINA 2ZUNA 2PDBA 4MB1A 4PE8A 3SZ8A 4X0VA 4GYFA 5BXPA 2IXUA 2WLZA 2ZTJA 2OKOA 3ZXWA 4AHQA 4FOJA 4L9YA 2TMDA 3HTWA 5LA1A 5CZTA 4X3ZA 4YVPA 3QW4B 4LYQA 2CZEA 3BV4A 5G2WA 3PJTA 3QMRA 3WF3A 2NVAA 1ZSXA 4GISA 4HNTA 4XZIA 3QZ6A 1KRBC 2JKAA 1ISYA 3WK2A 1K6WA 3W84A 3W38A 3II1A 4QLJA 5FESA 4X63A 3VGGA 1V6UA 1ZQ5A 4ZBCA 4H01A 2EG6A 1DIEA 4ZFMA 3LENA 3HM7A 4JICA 3PBUA 3GO2A 1XLDA 2B7OA 4E2DA 4DNMA 3LHYA 2XFRA 3SQLA 1UZ4A 4XB3A 2QJJA 1HIZA 2JGYA 3TROA 2VFDA 3SCTA 1O94A 2E6AA 4FNPA 5CGQA 2CBVA 4G8TA 4M6VA 3M5XA 2QCMA 3A4JA 1RP9A 2OWXA 1EPXA 3MDUA 3U6WA 3W83A 2VFHA 3CEPA 3WLHA 3SCQA 3KOFA 4TMBA 2ZFAA 3MSYA 1U22A 4UC5A 3O2LA 4G7EA 3W7QA 1Q7QA 1WOAA 3IUHA 1XCXA 2J7HA 1KM0A 3IAPA 5HOSA 4C1NA 3ZT7A 5I02A 1LP6A 4WY0F 1FHLA 1P1XA 3CAVA 1WV2A 3W3OA 4S1FA 3AQUA 5GPRA 1UR8A 5KZEA 4O11A 1UR1A 3LV6A 4RX0A 3VKDA 4LRTA 2CZDA 5M5DA 3CAWA 1JNDA 3UR5A 2REQA 2Z2UA 2WO5A 4O1BA 1SYTA 4H8HA 2WNNA 3FV9A 1Z44A 5D4YA 2TRSA 3ALFA 5CPTA 1IEWA 1ZS2A 2G8ZA 3GIYA 1Y8BA 3VOCA 3GVWA 4K38A 3G2GA 4UTUA 1ECQA 1XSKA 3LXBA 9XIMA 5A6LA 3ZOAA 4GZJA 1BYBA 1OABA 2BDQA 2XSAA 1W9UA 1B30A 4IMCA 1DL3A 4PUWA 4J2MA 4YTUA 2QUVA 3P8IA 3UR7A 1BQCA 1R6WA 3AYRA 1TMHA 1X6UA 2RHGA 3MCNA 1TVLA 4JQ3A 4YHGA 1MRQA 1PHWA 1TJ0A 4W87A 4NUWA 2JF6A 2WMKA 2ZX6A 1EC8A 2WBGA 5HBFA 4LV9A 3ZFHA 2ZTKA 3LHZA 1QPQA 4NXSA 1H3GA 2XJ7A 1RBAA 3CV1A 2DSUA 2F7FA 1DJXA 3FN9A 1OCJA 1D3CA 3F7JA 1MDRA 1K8CA 3WUGA 3THUA 2QPXA 3TSBA 1KO0A 3L5MA 3REQB 1DP0A 3WQ8A 4HQVA 1M03A 2XIBA 5M3WA 3MUXA 2XN1A 3TZNA 3WN6A 2XYLA 3M44A 5HMDA 1CEOA 4LUJA 4ZGYA 1WCGA 1I2NA 4HMDA 2A21A 1J0HA 3LBCA 2Z7KA 3GE7A 4MJ4A 2ZBTA 3WLTA 3V7PA 1LRTA 2NQ9A 4H8VA 4AX6A 4RV8A 3TR2A 5CPLA 1GVRA 1TB3A 1TQXA 5HMEA 1DHPA 3FSTA 1SFTA 1T96A 4R7JA 3N6HA 1ISVA 1V3KA 3R79A 4HMEA 2PDXA 4GY1A 3B40A 1DJNA 3N9KA 5FD0A 4NYUA 2Y0FA 4GNVA 4FR6A 4C6CA 1XFCA 2QCDA 1AW5A 3SCSA 2Z28A 3P82A 3XIMA 1HO4A 3W22A 1VCFA 2CLOA 5D2VA 2PE4A 2HK0A 3SGGA 4UCGA 3QTPA 2PRHA 4UOJA 3ZLFA 2GSEA 2QAPA 1I4NA 3QR3A 1ZBWA 3W0KA 1ZFJA 3PP7A 1S5MA 1A0EA 5ABGA 3AHZA 1P6BA 5EMJA 1R9YA 1NDZA 3B8IA 4WD0A 2V5BA 2QUTA 1EZ2A 2DORA 4MIMA 4UQDA 3OVRA 4BI6A 2W91A 4TVCA 2XIOA 1FUYA 3VX1A 3W6YA 2Z29A 4JTEA 3MZ2A 3AZTA 1BWLA 5HWMA 3HGOA 2CHNA 3CTLA 3IJ8A 4KMQA 3IRDA 2NSOA 4TVUA 1ZP3A 1GHRA 3GHRA 1SZFA 3LHUA 4JNZA 3PB0A 3W7LA 1W9PA 2XM2A 4P8WA 1CXFA 1PZ1A 1X97A 5J5DA 2ZZ1A 1NOFA 2WMIB 4AZIA 3LX9A 4ZTXA 3OPSA 3W02A 3A4XA 3M5VA 3VKBA 5ABFB 2FYMA 2Z1SA 2J79A 1TYGA 4L6DA 1VFUA 2GGJA 1KCZA 4C6DA 2AGKA 4LAKA 1E72M 1DE6A 8CGTA 1D2KA 1HKIA 3UWVA 5FAJA 5U4NA 4WRHA 5HWNA 1G4SA 1THFD 3RNDA 2B7QA 3A9IA 4BR1A 4WJEA 4GUIA 2RFGA 3BGGA 4ZOAA 1MXGA 1QNSA 4UTLA 1VBRA 3TJ4A 4HOZA 1E1CA 3L68A 1WUEA 2GVEA 4D8AA 4NL1A 3BLFA 1GOOA 5FSDC 1TV7A 3MMUA 1J0KA 1O7AA 1F76A 3CQKA 4L4OA 5KMYA 4XX6A 3MUAA 1TPC1 4KFNA 3EB3A 2FJUB 3P7YA 2E5DA 4J2PA 1ISWA 3RILA 2XH7A 2YBVA 4AVFA 3DESA 1Z3NA 5GVJA 4UTHA 1WDQA 3LSCA 2WPGA 3M6YA 3RK8A 3DZ1A 4PTDA 2V82A 3BW3A 1FXQA 2E5CA 4O18A 4B9YA 4ML9A 1E73M 5CZ0A 1KKOA 1QPOA 3UZXA 4LH8A 4JYFA 1J9YA 1X98A 2NV9A 4G56A 1KGUA 1E55A 3LERA 4OIFA 5HJXA 5LNVA 2FTYA 2HS8A 4AZGA 4H00A 2WWCA 4RZ6A 1XBVA 5I3GA 3AZRA 1B1YA 3NDZA 4PEKA 5KZDA 4KIEA 1FWCC 1KFWA 3F4WA 4A2SA 4ZR8A 5EYWA 1Z69A 4N02A 3BLDA 1AJ0A 1YTKA 3S83A 3KRUA 1GUVA 1WBHA 4U4MA 5LSMA 4Z2HA 4PODA 3TOYA 2GJXB 1H09A 3CJPA 4HU8A 1JEZA 3RDKA 3CZLA 4K2SA 2YA2A 2EXOA 3TAKA 3PJUA 4UWMA 1K9FA 3W7PA 2J7DA 3P62A 4JDBA 2YA1A 1OWQA 2J6XA 2Z00A 5TAOA 4J1OA 2QKFA 4IFKB 1QNPA 1UP3A 5CC6A 4Q8VA 3DFQA 4ZE4A 1DJHA 1OYBA 3N6JA 5E1QA 3UWQA 4DXVA 4JTFA 3BG5A 4LALA 3VNDA 1J6OA 2CBJA 2E25A 1EYEA 3O6CA 1VJIA 3LMYA 3SFWA 1OFRA 1XLKA 5A8MA 3QZAA 2QNEA 3SCVA 4CQBA 5C2XA 4FX8A 1LBLA 2RGLA 3W2UA 3KLKA 2F6XA 2VZUA 4H4IA 1GQLA 3BPWA 4M82A 4CD4A 3HMCA 3NZGA 4LNCA 1TG7A 4Y90A 2YPIA 2XVLA 4LF2A 3S47A 4ZMGA 3H2OA 1KBKA 2FZDA 4CU8A 3MSDA 1TVPA 3WK3A 4O28A 4N9EA 4KF1A 1PZ0A 2J74A 4DPQA 4C6EA 1ZNNA 3LI1A 3T09A 3BGJA 4B5TA 1A80A 1XIHA 3VC6A 4W5UA 4WVXA 1AL8A 1K8ZA 3W1UA 4TX6A 3CQHA 3PVFA 3N9RA 3WZ0E 1ADSA 4UMBA 3W7DA 1WP6A 4JTGA 4MPKA 4GJIA 4FLQA 4Z17A 2HCVA 4HD5A 6ALDA 1C9WA 3WG6A 1C8XA 4KS0A 4GK8A 3WK0A 5LZLA 3EX4A 3CT2A 2X1SA 1RPKA 4Q8TA 1TREA 3KTXA 1FOBA 1U33A 1IXOA 4WK9A 5AC7A 3GNRA 3LU2A 3EX2A 4YVVA 1FDZA 3P80A 1KCXA 1LBFA 1UP2A 5T9BG 4PCSA 3ARTA 4DBEA 3PBGA 2EPOA 2DVXA 2XN2A 4NZ4A 2D24A 3MT1A 2UY2A 3S1VA 1T7LA 4FOUA 1OGBA 4O10A 1EO7A 1UD3A 4NKCA 1KM4A 4MDPA 3VOGA 3K4WA 1FWAC 1FDYA 2DSKA 2ZX5A 1O6IA 1O5QA 4TOQA 3ARXA 4UB9A 3FA4A 3S1UA 4LW7A 3GVGA 3MW7A 4FPSA 4AVNA 4DN1A 3W7CA 2BFGA 3LCXA 1EDQA 1K7FA 2GGIA 3VGFA 1WDPA 3DKLA 3LB0A 4YCOA 1PHQA 1EC7A 1Q6EA 3WMBA 4DI8A 2W79A 3EOLA 2G0WA 3T07A 3UXAA 4X2RA 3C2YA 4O8AA 2WCSA 4W86A 4H9TA 4IIHA 3S5OA 3QPZA 2VWTA 1VCGA 5FJRA 3UERA 4L4MA 4RDYA 3CPUA 1NF0A 1XLCA 4EX4A 3BZJA 2VXNA 3WUBA 3FEQA 3TLQA 1R3QA 3R12A 4AEEA 3VNZA 2V8ZA 5D04C 3LTSA 1EXPA 3MV11 3W7HA 4L65A 3HPAA 1AZ2A 5AZ1A 3BW4A 4GI6A 4FXSA 5IM51 3O7UA 1R86A 4DYEA 1XD0A 1JCYA 2FH6A 4HIBA 3B8SA 1UPMB 2XFWA 3NXLA 1MZRA 2YYUA 2NX3A 2QLYA 4BKNA 1PDYA 5DX7A 2V69A 2VX6A 2PTZA 1WAUA 1W9VA 5T8GA 2OWWA 4O4VA 4HHMA 1XISA 1X1ZA 3LCIA 4UQBA 4GC4A 3TYDA 2PWDA 4OFCA 2QEZA 3BV7A 1V08A 4IPNB 4ASTA 1ME7A 1XIIA 1ONEA 2D23A 3E96A 4JFVA 3LPGA 2OSWA 1GNXA 1TUFA 1CTNA 3WNKA 4P7LA 4GCXA 1XGDA 1OF6A 5I78A 3DG3A 2QCHA 5F4SA 4O54A 1J11A 3BSHA 3GDBA 2DSVA 3AISA 1OYCA 4QXIA 1FHDA 2Y7EA 4MM1A 3Q45A 4LUTB 2W3ZA 4P8VA 5KEZA 2G41A 3TYAA 1XFBA 3HG2A 1LG2A 2ABAA 1MUMA 2VO5A 2WSPA 3N1AA 1H7RA 3WD3A 3PY2A 3A6OA 2CFFA 1NFGA 1A3HA 1YE4A 3H7VA 1EHNA 4QG9A 3CGTA 3W1PA 5EMLA 4CLMA 3LCLA 3SADA 2V5JA 1BYCA 5I09A 1V6XA 2Y2WA 3BE7A 3EWXA 1JYVA 3UETA 4LCSA 3M47A 5GNYA 4IXHA 2XGBA 3A23A 3C86A 3T0TA 1B4KA 1H61A 1W37A 4PBEA 2ESCA 1XIDA 5A2BA 3GNDA 1VRXA 1HX0A 4HK5A 3GW0A 4LAOA 1A5KC 2OODA 4IIFA 3IGHX 4YWIA 5FI8A 1IXNA 1FCVA 4MKNA 4R9XA 3WBAA 3NEHA 1CLVA 3MS8A 1CGUA 3G5EA 1G5AA 1GT8A 4LNYA 1J18A 4M7SA 2YZRA 2O56A 2HS6A 4Q7BA 3RUBL 4D8LA 5GJNA 2ZRYA 5DLCA 1TFVA 4KWWA 3E0FA 3KRZA 1W1YA 3LBOA 1VHCA 4YVXA 2OX4A 3DXIA 3VD3A 4XVDA 4X22A 1YQ2A 3DYPA 4C7DA 1SR0A 6XIMA 1B90A 4JFTA 1B4EA 3WLMA 3PJXA 3HG5A 3UZZA 4BF5A 3LGDA 1KA9F 4UFLA 1SMAA 1TWZA 1TE6A 1JGIA 5KETA 2ZOXA 1BD0A 1GG1A 3E0LA 2DZUA 1RY0A 3FAXA 2QW5A 3V1PA 2GDQA 2GGEA 3TZFA 2V6AA 3XISA 5ABFA 5BMWA 1GORA 1W3TA 1AQFA 4CD7A 5KZ6A 2RJGA 3QV6A 5I0DA 1XICA 3LK6A 4LEQA 2YW4A 8XIAA 1M04A 4AXNA 4GVIA 4C6IA 1BGAA 1E6QM 1UJPA 3LV5A 4CCCA 1K03A 1VRDA 2I17A 3F03K 1J5TA 3FCPA 3E2RA 3WNOA 2E8ZA 4JYDA 1BSLA 3M0KA 5TBOA 3WX7A 4CD5A 4B2DA 1UH3A 1E70M 1W17A 1E9ZB 4UOQA 3NFUA 3O07A 3W7EA 2G3MA 2NQJA 4X2PA 4RE3A 3NQDA 5A6MA 2C15A 4B5XA 3CXOA 2BWGA 4MKSA 2PGRA 3V36A 1KR0A 1GOWA 3I68A 1GOQA 1YTEA 1GVEA 1LRNA 4F8XA 2WZTA 5AYBA 1TCDA 2C1GA 1OG0A 3T55A 4PCNA 2PCEA 3WENA 3DECA 4UTWC 1W2PA 3QHOA 4FIQA 1I6NA 4GZIA 4XSMA 3UR8A 5D9MA 4HNVA 2BHYA 2Q8ZA 4YTTA 2D20A 2VEIA 1EIBA 3MMTA 3NQFA 4O17A 3SUTA 2XTKA 3I4KA 3S1WA 3WLNA 3GH7A 4NRRA 3MVTA 4U5IA 2VD8A 1JDCA 5AC6A 1VFHA 4AISA 4F0RA 2Z1KA 1O5KA 3TEVA 5H8UA 1JYXA 1W1TA 3POHA 1JAKA 4O16A 4EXAA 5HWJA 3LY0A 1GVQA 5LIKX 2ZYFA 1I9CB 1VD6A 1VEMA 3ONCA 3CYVA 3RR4A 3OVPA 1VQTA 2GJXA 4AIEA 4GH3A 4UUIA 1TMQA 1LLWA 3DDMA 4LJ3A 4ZQNA 4HT3A 3VFCA 1XBZA 4FNQA 3OVQA 3TQKA 4OVXA 3T2OA 1DIKA 4NXKA 3AOFA 2CEQA 4IG2B 4IFKA 4ERAA 3QGKC 2WZHA 3CV7A 3AI0A 3P8JA 4GO9A 3P5YA 3WH8A 3UW6A 2QDDA 3PS7A 4PMVA 4C7GA 1OCQA 2WANA 1P0DA 3BOFA 1M53A 3ITOA 5FL1A 2G4JA 2W66A 1EXBA 1LL4A 4R53A 3K4AA 4PYSA 4DYJA 3GD6A 2QULA 1XBYA 3NDYA 1EIXA 1GKRA 2FIQA 3AIRA 1E3XA 3SCUA 3F4VA 5HPOA 1LUCB 4I6KA 1MEHA 3LTPA 3SRHA 2EPMX 3LSBA 4HPJA 1J2WA 1V0NA 1V0LA 2PB1A 3DX5A 3I3DA 2CKRA 2VHLA 1FWIC 4M5PA 2DV0A 1IT8A 4R5EA 3AS3A 3E0IA 1JCTA 2VDHA 1S5TA 3SY8A 4B3KA 4PUJA 3TYBA 1R3YA 4F0HA 5KSWA 4QRNA 1GGOA 4PMDA 5BWAA 3W86A 3NQ8A 3EA3A 4QFUA 2QCCA 1EHAA 3DFHA 4J4KA 3GXDA 4DWSA 5F2LA 1IZKA 2QJNA 4LV4A 2WSYA 2Y7FA 6TAAA 4J3WA 3TW9A 4YU1A 1L2UA 5F1VA 4F40A 2PBOA 3C0JA 2ZZ3A 3FNDA 4U3AA 3QKZA 1FWRA 4IJBA 3AJXA 3CASA 2E1DA 4ZQOA 4UTFA 1HJQA 1YXYA 3B06A 5G5IA 2P0IA 2I5IA 3KP1A 3TVAA 3UCDA 3O15A 4JTCA 8RUCA 4V27A 4IQJA 3HFTA 1YHTA 1DJGA 1FCUA 4CQAA 3O1NA 4J3ZA 5K4ZA 2RDXA 2ZXDA 3CIXA 2W5FA 1O95A 4AD2A 3IIXA 4RKAA 3ALGA 1W5QA 2XDFA 1VFOA 1BEUA 1GVOA 2DZAA 2QYGA 1U5VA 3WDIA 5A8QA 1W3HA 3DAQA 3GSMA 3ARQA 3S5SA 2DQWA 3EXRA 4KGJA 3WD1A 3NZRA 4LAUA 3W07A 3PZQA 4QISA 1WZLA 2GJLA 3UGRA 3RX4A 1V77A 4KEUA 4JQ2A 3VOHA 4PULA 1J0ZA 1DXFA 6A3HA 5DCDA 2OLHA 3HPZA 4WR3A 3FDKA 1G0CA 2E28A 3CZGA 1LT7A 1GOIA 4ZFCA 4KEVA 4MB3A 1NJJA 3RX3A 1AH0A 1AMKA 1B0IA 4RDZA 1RQBA 1OM0A 5D02A 4BY3A 5JBFA 1XLIA 3FKKA 4GX8A 1IWAA 4PUNA 2YOCA 4V1YA 7ODCA 5LIYX 5AECA 3BAYA 1WB0A 2ZICA 4AH7A 4ZXOA 6REQA 2PF8A 1BSIA 2QDGA 3B0YA 3W6MA 2W67A 1VFSA 5BOFA 1GJUA 3Q65A 3TX9A 4IIBA 5BNKA 3MO7A 3OZPA 3S5NA 5A6KA 4DJDA 2NV2A 3KRBA 1WDWA 4X9SA 3CUXA 2GZXA 3BTNA 4UFJA 3WQPA 1JXKA 2YXOA 1J10A 5K9XA 2ISSA 1DVJA 4I90A 4N9CA 5DMMA 4XD6A 2FMNA 4YMZA 3SUSA 2ACSA 1H60A 1EEXA 1Q2SA 1JFXA 4U31A 1MRAA 3UXLA 4WIWA 4CNTA 5HINA 4JHMA 2EHHA 3W1NA 3MSRA 2CBIA 2XHYA 3IIZA 3FJNA 4XAYA 3ZO9A 1EOMA 4AWEA 1IGWA 4OHQA 3W1MA 4ADUA 1DIDA 4HZ8A 2CPUA 1RHCA 1JCNA 3GZAA 1E5JA 3ZR5A 3GC2A 4PBGA 3CWHA 3PZ9A 3V5OA 3T40A 3VI2A 4L6OA 7REQB 2HNEA 2A7NA 4A21A 4CN6A 1KTBA 4IQDA 1UIPA 1EF2A 1DTUA 1I45A 3KRSA 4Z1YA 3OGVA 1KFKA 1ZJIA 2FLIA 3AMCA 3LRLA 4Q33A 1B3ZA 2PTDA 2JALA 4JIHA 5I2UA 4QHRA 3WF0A 5HQLA 2J6VA 4LCQA 2D73A 3W25A 2QQ6A 4ACZB 3RX2A 2Q8LA 2Q6ZA 1OC7A 3CUJA 2OSXA 5DFAA 3FY1A 3RLUA 1F73A 1GJPA 5PTDA 1IZCA 4I7UA 5BMXA 2KZHA 2YL5A 1HGWA 1GW1A 1GQKA 4JKMA 3WF2A 2ZA3A 1XH1A 3AALA 2C0HA 2JIWA 1EUAA 4HHHA 1IEXA 3NPWA 3P81A 4DJEA 2RDWA 3GBEA 3U48A 3NQ7A 2NQ5A 1EJUC 1EGVA 4C5YA 4INFA 1YXDA 3R0KA 1GWJA 4JYEA 3WQ5A 4FR1A 2W0UA 2XH0A 3FYOA 2FDSA 3F1QA 2VJXA 3GDKA 3WNLA 2VGFA 4RNJA 2CLMA 3VO0A 3WDRA 4DPPA 4GJ1A 1UBSA 5EFFA 2C19A 3W75A 1M65A 3UPMA 5MF5A 3H55A 2VGIA 4IF2A 1DWJM 3WQ4A 1T8QA 3N11A 3GNOA 3IJLA 3OG3A 4NI8A 1W3LA 1R9XA 2PDKA 2VC7A 2XSBA 1JFHA 1V79A 4PSRA 3W71A 5C6MA 3WD0A 5C0QA 4GXPA 3PBYA 4MB5A 4D6DA 1FWDC 2PDYA 3FGCB 4ZO8A 4IOTA 1UQYA 3F2CA 4BZYA 3TNOA 3Q2DA 5CC5A 3KCJA 2NLIA 3W2MA 4FI4A 5EMUA 1BVNP 4PUKA 5MKGB 3NQAA 1RD5A 3W2NA 4AX7A 2Z1VA 3A9BA 3ARRA 1PDZA 1OFEA 3OYXA 2A3LA 3LN3A 7CGTA 1VAHA 5HAOA 3RCNA 2FGZA 3PUOA 3C61A 2HDJA 5DT5A 3TQPA 3W81A 4AVOA 4B90A 2HISA 1J4EA 5A8PA 3AC0A 1TQJA 2DT2A 3IJIA 4X61A 3GHSA 1R2TA 3UG5A 1IGSA 4PH6A 2QUNA 3H54A 1QOQA 4FP1A 1Q3NA 3ZZ1A 1EGZA 4PMJA 3TAOA 2PDMA 4G6CA 4O4WA 3VNJA 3BC9A 2BB0A 1IWPA 1JNEA 2X41A 1K4GA 2GYIA 2P3ZA 1E6PA 2A79A 2OO6A 3ERPA 4XKYA 3D5HA 4Y9PA 3BQ5A 1LYXA 4MGGA 5CLWA 1R8LA 3GB6A 4M80A 4P7RA 3AUJA 2AKZA 1IE7C 1FA2A 3M4HA 1GHSA 5EMMA 1GPWA 3W87A 3TYEA 3GXFA 1AL7A 2ZC8A 4GI8A 4O57A 4Q4OA 5RUBA 3T44A 3DFPA 1FH7A 3SI9A 7ENLA 1L8PA 3NOEA 1MNSA 3RRAA 4K1WA 4N4QA 1AQMA 1U1UA 4NSBA 4S38A 1W1PA 5DO8A 3CQ0A 1OG6A 4QEEA 4I8DA 2PLJA 3A5VA 3SCPA 4U2ZA 1IIHA 2ASHA 3FHAA 4B2DD 3ZLHA 2QGYA 2JEQA 2Y88A 1VR6A 3IS4A 4GNJA 1QO5A 4ZEPA 4UTTA 1YPXA 1QPRA 1EL3A 4NJIA 3RPMA 1R3RA 2D3NA 1UD8A 4H2HA 2GVLA 2O9PA 4DEFA 2PZNA 1XLEA 1F6PA 4HCLA 1UZDA 1UC4A 3E9AA 4U2YA 4C65A 3G0UA 2D3LA 3S0CA 1VHNA 3TJLA 2YIHA 1H4PA 3RJXA 2YX0A 4Q8MA 4KEMA 1DJIA 1M3UA 4F48A 3KL0A 2JBMA 4JHZA 3DGBA 4W93A 3N04A 1H1YA 1O5XA 1GJWA 1NFPA 2VCCA 2ZC1A 5IBXC 1LUCA 2QV5A 1XLMA 4AD5A 4AUBA 3HMJG 4FF5A 4NAFB 5CJ5A 4M6UA 1TRDA 2IPWA 1G6CA 4ZOCA 2E9BA 5M03A 4U33A 1OVDA 2W6RA 3TV8A 3Q4DA 5A6SA 1Z6KA 5DT7A 3NQEA 3AIWA 4RZ5A 4C5ZA 2WJDA 3N6QA 2EPLX 4JOMA 4HYRA 3GZ3A 4OOZA 1E0UA 1AG1O 1LLZA 1MVYA 3GQYA 4XZMX 2G95A 1R3WA 3QM3A 4HNCA 5LHEA 3NR0A 2C71A 2V5DA 3GTIA 2WSKA 1J96A 1Z42A 5BROA 1OC6A 3C6CA 1ADDA 4E3TA 1ZRQA 1AMYA 2ZUMA 2CLLA 1CNVA 4XD4A 5K2ZA 3LCFA 4FNUA 1E9IA 5HQMA 3QSTA 3RO6A 5C55A 1X6NA 5K9DA 2QAFA 4AY8A 2WC3A 3NG3A 3PHAA 1GEQA 3W7KA 2NVCA 3T8LA 3EWBX 1JZ8A 5E6ZA 5CPSA 4CQCA 4FF7A 1X39A 4QQ3A 1VBUA 4BEQA 1M41A 3ZR4A 3S6OA 4MKVA 1HVQA 1SR9A 2H8XA 4Q6JA 4J5NA 5JBDA 2OJPA 2ZA2A 2HV5A 5D09A 5JVLA 1QK0A 2OMAA 4LANA 4QCFA 1RLDA 4MG4A 1VBGA 4TIMA