1C91A

Endo-beta-n-acetylglucosaminidase h, e132d
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDDYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c91A00
1CXLA 4EE9A 2WKGA 1IZKA 2G4FA 3QHOA 1KXVA 1UKPA 1UD5A 2G3NA 2OYKA 1EH9A 3SCWA 5E6YA 2PWEA 2YKKA 5CZKA 1BYDA 2CBUA 1AQMA 1B3YA 2J78A 4M56A 1OM0A 5E70A 4PTWA 3WIJA 1E0VA 1XC6A 1BYCA 5A6JA 4JL2A 3GNOA 3AISA 4H41A 1B90A 1UA3A 2DH2A 4FF5A 2AAAA 3K1DA 3AIWA 3FAXA 4BQ2A 3ZIZA 1Q6GA 1JZ3A 2J4GA 1WO2A 3VNYA 1ZS2A 1ZBCA 1OINA 3POHA 4BF7A 1W9XA 1EGZA 2EPMX 1E6SM 4PUDA 4H04A 1GOKA 3VX1A 4KRTA 2DQXA 1QI2A 2WNWA 2OWWA 3QHNA 4U5IA 3VIHA 3MUIA 1LG1A 2VUYA 2PWHA 4A4AA 2QMKA 2ZX9A 1B1YA 1MWOA 1E9LA 1JZ4A 3A4AA 1LG2A 4HZ8A 4UQCA 2D1ZA 1LL7A 4IUGA 1HNYA 2BHYA 3CGTA 3LPFA 3WNNA 3HN3A 1JIBA 1QNSA 4PCSA 4RL3A 4HPGA 3VOCA 2QPSA 3WUBA 4PCTA 4J3UA 4XB3A 1UD6A 1J11A 2X05A 3OIHA 1GQLA 4M1RA 3W53A 2VMFA 3NDZA 3ZJ6A 2XFYA 2BY1A 1KCKA 2WW5A 4PMRA 4JFUA 3TTSA 5ABHA 3WBAA 3OB8A 3F5LA 2HISA 1DEDA 1JL8A 1DWHM 2G3JA 3GM8A 4DM2A 2J47A 3WF2A 3OG2A 4GIAA 1B30A 4AZHA 1KWKA 4P7RA 3WFZA 4WLCA 1V6VA 5A6SA 2QLYA 1C8QA 1V6YA 2GK1A 2W4XA 1NM9A 3MMWA 3S6TA 2FHFA 4BQ4A 2E8ZA 3FAWA 2DSWA 1E70M 1UR2A 2VI0A 2X8RA 2CNCA 5M03A 5FIPA 1GOWA 2VCBA 2BY0A 4MB4A 4MNMA 4TOQA 4E2OA 2VCCA 4JFWA 2B31A 1GOOA 3FY1A 3BLPX 2J7FA 1OIFA 4LPCA 4PTMA 1PX8A 3LMYA 4ACZA 2F2HA 3O9NA 1DWFM 2WHMA 4E8CA 3VGGA 3MUY1 3VD9A 4AC1X 3VIKA 1W1PA 1D7FA 3SIMA 1FA2A 4AD2A 1XGZA 2J62A 3WF1A 5CQ1A 2VCAA 4AD3A 4FLQA 3VGDA 1EOKA 3W25A 1LL6A 1X6LA 2PWDA 9CGTA 4JHZA 1CIUA 2X0YA 2ZUMA 5KZ6A 2NT0A 2G3MA 3PTMA 3ZT6A 5A8NA 3VDHA 1NWSA 2YA2A 5CPTA 2VRJA 4CD6A 4GO8A 1UG6A 1VEPA 3NDYA 4CD7A 1RP9A 1E0WA 4JFTA 4X0VA 2GJPA 1LJYA 5AC4A 2J74A 3W0KA 5I6SA 3GNPA 1ESWA 1HVXA 1RD6A 1PZ2A 3SCPA 3F5JA 2VZSA 4JHOA 3WF4A 4KGLA 2VURA 2GDUA 5A6AA 2D23A 4WF7A 4PRWA 2D20A 2J25A 3AIBA 3PZVA 5DEZA 1JI1A 2QPUA 2WAGA 1HJXA 4BQ5A 2EXOA 3SUTA 2WBGA 5LYRA 2WVSA 1QNOA 4JZ5A 1GORA 4BA0A 1UYQA 2EEXA 3SEPA 3LPPA 4KWUA 1GOQA 3MANA 4S3JA 3WEOA 4HU0A 3QR3A 2O9PA 4GKLA 1XD0A 5HOSA 4AWEA 3AFBA 2CBVA 4U3CA 1UZ1A 3K46A 1H0GA 4UZSA 2WHKA 5CGTA 3D3AA 1MW0A 1E0XA 3OLEA 1V0KA 5DF0A 1E1FA 3BLKA 4J3TA 1ISWA 3ECQA 3I3EA 1FH8A 2QV4A 2OYMA 3BCFA 1JNEA 4A3YA 3IAQA 5F7UA 4GZIA 1E55A 1E43A 3L4XA 4LXFA 4E8DA 1E5JA 3SUWA 1VB9A 2WPGA 1XYZA 3PTQA 4ZFMA 1HJSA 4W93A 4W89A 4AMCA 1H5VA 5BXRA 1E4LA 3GXIA 1WZAA 3VIGA 3PBGA 1V3IA 1EDQA 4C7DA 3L4VA 3N04A 1J01A 1VJZA 3VD7A 1MW1A 5M17A 1BTCA 1FH9A 4XZBA 1BPLB 1UA7A 2E3ZA 5BRQA 5DT5A 1HP5A 4CN4A 1MXGA 2XSAA 3MV01 3UR8A 1W9BM 1EOMA 1HL8A 3FXYA 3APGA 3UCQA 1V0LA 3EMZA 4URIA 2EPOA 1CXKA 5A6BD 3ARVA 1FH7A 4B3KA 4UR9A 1KWGA 2YL5A 3ARTA 1BG4A 3IAPA 3VDCA 4Z2JA 3CUHA 3AXIA 4HTYA 1H41A 5EFDA 3BSHA 2W63A 3CHDA 1GZJA 3IANA 3ARUA 3EDJA 1HVQA 4AD4A 1HT6A 4JKMA 5I3DA 2YJQA 4AZGA 3WNMA 2A3AA 2CEQA 4OKDA 2ZX6A 4XUYA 3AMLA 1UH3A 2E9LA 1JAKA 3W38A 4UFLA 3WQWA 2BY3A 5BXPA 5I2UA 3PZTA 1BGGA 1QNQA 3BMVA 2WXDM 4OJYA 3MV11 1J0JA 2VRKA 1QW9A 1BLIA 3WEZA 1RPKA 5I5RA 5HPOA 4PMUA 1M01A 2VOTA 2DSKA 2ZIDA 1LLOA 4IPLA 1MXDA 3EBVA 1BG9A 2VQUA 3LPOA 4W84A 3WY1A 3AROA 4MPKA 2X1IA 5DT7A 2D2OA 4CCCA 4CCEA 1UWTA 2D24A 3M07A 1DWGM 3DYOA 1XYFA 3GZAA 2WCSA 1G5AA 3UETA 4N42A 2V5CA 2WM0A 3B9DA 4OOUA 1ZU8A 2YDSA 2XYLA 4UFHA 2E0PA 3VMPA 4AISA 3W6MA 1C93A 2J8GA 3VKKA 3VUPA 1ODZA 4CU7A 3WDIA 3WD2A 4DUXA 3SCTA 2PI6A 5FCZA 2EPKX 2OWCA 3IJ7A 1K9TA 1UWIA 4D6JA 4Q22A 1BVNP 2HVMA 4DWSD 1UD8A 4WIWA 1HX0A 4K68A 1X6NA 3AIEA 5D9OA 4GI6A 5JBFA 5IFTA 1LWHA 1KXQA 1CECA 2VZVA 5BWFA 2O92A 2J77A 5E6ZA 1J0IA 3WBEA 3FW6A 3VPLA 3GH7A 2IXVA 4Q7NA 2NT1A 1HF6A 3UEQA 2TAAA 1WDSA 4J27A 2A3BA 3SCNA 1K9FA 4NRRA 3UR7A 4MNJA 1JDDA 3HU7A 1ZJAA 1FP9A 1UWSA 6A3HA 1UUQA 3A6OA 2VO5A 2ZX7A 3RDKA 4CU8A 3WH7A 1GVIA 1XSIA 2J7DA 3ZQ9A 2GFTA 1KBKA 3MUAA 4P8WA 1JXKA 2ZXQA 3NCOA 1CGTA 1CXIA 1FFRA 1RH9A 2C7FA 1AQ0A 4DM1A 2D22A 1UR9A 4PMDA 1HKKA 4GQRA 2OSWA 1JD7A 1VJSA 3L4UA 4CVUA 2DH3A 2CYGA 3N1AA 1JFXA 4P8VA 3ZMRA 1IT0A 4W5UA 5HNNA 3IK2A 4U3AA 2FHCA 5LA2A 1TUXA 1W1VA 3O2LA 4MNKA 2DSVA 2D0FA 4JAWA 1J12A 1VBUA 1CGYA 1E6NA 1PAMA 1V6WA 1G1YA 4QDMA 3AS0A 2XVKA 1AQHA 3WD4A 3LPGA 4D6EA 4TX6A 3GNRA 5A94A 1ITCA 3KZSA 3UESA 2FDMA 3CBWA 1Q6EA 4OZOA 1DWJM 3W81A 2V3DA 4AIEA 3BH4A 2WVVA 3GBEA 5D9MA 3WDPP 4D1JA 1OIMA 1PPIA 3G6LA 1KXTA 4ACZB 1JFHA 5DFAA 5FL0A 3T2QA 1W3HA 4P7NA 1E72M 2WLZA 1W3LA 3EMCA 1H3GA 1JNDA 4AD1A 3ARPA 4S3KA 5CPSA 5JUVA 3GH5A 1JAEA 3MMDA 1V3LA 2V5DA 3GXMA 3UG5A 5A2AA 5GNXA 4EANA 3KE0A 4V2XA 1B3XA 4ATDA 2W91A 4CD4A 3QOMA 2ZXBA 2RGMA 1FHLA 1V02A 2JF6A 2G8ZA 1M03A 4NSBA 1V6UA 4JCLA 4AZ5A 1Q4NX 1JYVA 2BS9A 3N13A 3SUSA 3QHMA 1E6XM 5A3HA 5BXTA 3BAXA 1ODUA 1ZBVA 4ATLA 1G9HA 1P6WA 4UOQA 1PJ9A 3WNKA 2PBOA 4AIOA 5A8PA 1E1EA 2VX6A 4PBGA 4WJXA 3VINA 3VD4A 1WKYA 1HN1A 3CUFA 3WFLA 3CPUA 1OT1A 4AZCB 1EO7A 3SCVA 3TTYA 1R8LA 5A6KA 4TUFA 2CITA 1ISZA 3B8SA 4QCEA 4U33A 3NYDA 2AMGA 5BYWA 1NWUA 3AHXA 3BAJA 1E56A 3CHFA 2JEPA 3WUEA 4DWSC 3VIPA 2A3HA 4HA1A 3VD5A 5JBEA 1H1NA 1EO5A 1TA3B 4H8VA 1QVBA 3ZSTA 1JGIA 3ZJKA 3TONA 3EMQA 4MADA 1J0KA 1V03A 2DGAA 3GDBA 4ATWA 5IXEA 1V08A 2BHZA 3TTOA 2WHJA 5D8WA 1E4MM 4AD5A 2WC3A 3CMGA 2F61A 1UH4A 3T0AA 1QI3A 1Q6DA 2C0HA 1MFUA 2PF0A 4TX8A 3E1F1 1Q6FA 1JZ7A 2YL9A 1JG9A 3W28A 1CXEA 4ZE5A 4PMVA 1ISVA 2VTFA 3RCNA 4UQEA 1J0YA 1SMDA 3BAIA 4W8BA 1CGXA 1XH0A 5A69A 4YPJA 3ZR5A 1MQRA 3PTKA 1UKTA 3N11A 4A3HA 1JZ2A 3CTTA 4M80A 2MANA 1JZ5A 2Z1KA 4UCFA 4LQ1A 5E09A 1NARA 4WKHA 3POCA 1CWYA 3CH9A 4U2ZA 3W82A 3W6LA 4UQDA 3ARYA 1W9PA 1ZB5A 3N17A 1N82A 3WMSA 2IUZA 3AS2A 1TVPA 4H7VA 1I75A 3RM9A 1KR1A 3K4DA 3I3BA 4ZENA 2W67A 4AZ7A 4D6CA 3ZO9A 3L4WA 3RM8A 3IJ8A 2O9TA 1MFVA 3WMBA 2W5FA 5A2BA 1CEOA 1K6AA 1HJQA 2VNCA 1CLXA 3AZSA 1XH2A 1OD0A 4MNLA 1W1TA 3PZOA 1KGUA 7A3HA 2WSPA 2DDXA 3KL0A 4ACYA 3SURA 4ZEPA 1MW3A 3TTQA 1DHKA 4HOXA 4AZCA 2VZOA 3AIRA 4W5ZA 4JFVA 4W7WA 1R85A 1U2YA 3KL5A 1QW8A 3OBAA 1A47A 2YDRA 2ZOXA 4B16A 1UWUA 3GYCA 2VR4A 3EDEA 1WDPA 1NH6A 1UQZA 1BYBA 1JXJA 1W9VA 2CETA 2XIBA 1NP2A 1VRXA 2IXUA 4HZ7A 2CKSA 2ZUSA 4TTGA 3VD3A 3WDRA 3TP4A 1TA3A 2VQTA 3RJYA 4FLSA 1UH2A 1BSIA 3NSMA 2EBNA 4L4OA 1X1NA 2VVSA 4UQAA 1UHVA 3OLDA 1E4NA 4JFSA 3L4TA 2ZUVA 1CLVA 1UOKA 2EJ1A 1CXHA 1V6XA 1R87A 2CKRA 3WDJA 2PC8A 2WMKA 3MSGA 1V0NA 3RIKA 1FP8A 2DIEA 4PMQA 3M6DA 3FHAA 3PZ9A 5A8QA 1WE5A 2WHLA 1TFVA 1F4AA 2WVTA 1C3FA 4P8XA 1EIBA 2ZXAA 1E6RA 3MMUA 3GH4A 1H4PA 2XWDA 1CENA 1EXPA 2GJRA 2RGLA 5CXPA 2DIJA 5A6BA 3CLWA 3BAKA 1QI5A 2UY2A 2VX7A 2X0HA 3F5KA 2J79A 1BQCA 4D72A 2VC9A 2DSZA 1UD3A 4B9YA 2G41A 2NW0A 3U7BA 1V3MA 3VU2A 4AZBA 1HKIA 1HP4A 3BCDA 5AYBA 1WDRA 3PZIA 3WL0A 5I77A 1ISYA 4W87A 4PEEA 3G6MA 1LWJA 4Z2HA 1VENA 2FH8A 1H09A 4AD0A 5GQBA 1HJUA 2BFGA 2DPEA 3WH9A 4PMOA 4QAWA 4PUEA 4CCDA 1C91A 3BXWA 3L2MA 4HA4A 3NSNA 4H8HA 4QFUA 3WF0A 1UKQA 4D6FA 1KBBA 2WVUA 2E4TA 3II1A 2E40A 2J8FA 1US2A 6CGTA 5M3WA 3VNZA 4RE3A 1BGAA 3WUGA 4OBSA 3M46A 1WPCA 5D9PA 4MAZA 3WEMA 1WCGA 3T2OA 3WQ8A 2O9RA 1CTNA 2XGBA 1VFMA 3WNLA 1GUVA 2WANA 1R86A 3WMCA 1BF2A 4MB3A 3BSGA 1GCYA 1B3VA 2E8YA 2XVGA 5ABFA 4UOJA 1RP8A 1OGBA 3AOFA 4HP5A 1QBAA 3WQ6A 1EDTA 1B0IA 1DP0A 2Y5EA 4J7RA 1H49A 3ARZA 3KEHA 4R27A 1GQIA 3VM7A 2WMIA 3U5YA 1C8YA 4ML4A 3EDFA 5FD0A 3WUFA 4BZYA 4D6DA 2D3NA 4V28A 2YOCA 2WZIA 3AS1A 3WDHA 4TVDA 1GQJA 4PSRA 1TE1A 4HOWA 1PZ3A 1ECEA 4H8UA 8A3HA 1OT2A 3CZKA 5IHSA 1XSKA 1H2JA 4KMQA 4YN5A 2WC4A 4UZUA 1IZJA 3OZOA 2WVVB 3WD3A 4CUCA 4DWSA 4F66A 2ZUTA 2QF8A 2ZWZA 1V0MA 4LX4A 5A2CA 3WELA 2D3LA 3OA5A 3UG4A 5BRPA 1UKOA 3CUJA 3MUZ1 3VGHA 1A3HA 1QHOA 1OB0A 8CGTA 2DT1A 4Z2KA 1B3ZA 1E6ZA 1GONA 2PB1A 4D6IA 5KEZA 3FNDA 1HJVA 1UR4A 4EKJA 2XIIA 5JIWA 3AMDA 1UR8A 2QHAA 1J9YA 3AIQA 3WKZA 3OLGA 1O6IA 3AQUA 1G94A 1M53A 2ZICA 1UD2A 1QHPA 3PZUA 3VILA 4PTXA 5IHRA 4FLOA 3WN6A 2OLHA 3U7VA 3EYPA 4D6GA 1HKJA 1GHRA 4HZ6A 3WNPA 4GQQA 4IISA 1J18A 4EK7A 1UR0A 2WBKA 4UFMA 4Z2LA 3DYPA 4HA3A 2WWCA 1JI2A 5HPCA 3VTRA 5CLTA 2XFFA 1V3KA 2ZE0A 1SR0A 1QI0A 1L0PA 5DMYA 4GXPA 1E15A 2YL8A 4DUWA 4D1IA 4MDPA 3W24A 1CGWA 4UNIA 3CUGA 2XWEA 1WZMA 3AMKA 2WWDA 7CGTA 3AICA 3VMNA 3NIYA 1VEMA 1S46A 5ABGA 5BXSA 4GI9A 3CZ8A 2VZUA 4AY1A 1W91A 2OYLA 4JL1A 1HL9A 4AW7A 5ECUA 4F9JA 2ZXDA 4D71A 2BVTA 1R7AA 2VRQA 2CESA 1PBGA 3WQVA 5E0CA 6TAAA 3VO0A 2JIEA 1JZ6A 4M82A 4CVWA 3ALFA 1E4IA 3RJXA 4P7QA 4HOZA 3WD0A 3BAYA 5FL1A 3N9KA 3VIFA 1MYRA 2ZUUA 4X9YA 1YQ2A 2DSUA 5I0DA 4AEFA 3VVGA 2XHYA 4PSPA 4GI8A 4CN6A 3SCUA 3THDA 2VJXA 3ARQA 4HU8A 2WLYA 2WYSA 1C7SA 1UQYA 3PHAA 1XV8A 4TTUA 3MS8A 3VGBA 1H0IA 2JFEX 1TCMA 1NWTA 1U30A 2WK2A 3PZNA 5AY7A 4MJ2A 4BQ3A 1G01A 2O9OA 3ZT5A 4J3SA 2X09A 5A6LA 3W4RA 1B9ZA 3GXDA 2WSKA 4KRUA 1SFSA 3BAWA 3ZJ8A 1J0ZA 3AIUA 2F8QA 2JALA 4NZCA 1W9UA 2A3CA 5CSYA 3L4ZA 3QGVA 1C8XA 2WZEA 1GQKA 3WH5A 2XG9A 3J7HA 3ZJ7A 3NJ3A 5A8MA 4W7VA 3K4AA 1UR1A 1HIZA 2EO7A 4GPNA 4HMCA 4QCFA 1FFQA 4E4PA 1EQCA 1EQPA 3EDKA 3SCQA 4XZWA 5I79A 5C71A 1JD9A 1HJWA 1TR1A 3RMEA 1E5NA 4U31A 1VEOA 1OGSA 1W9DM 2PWGA 1G0CA 1JYNA 1US3A 1H11A 1GVYA 4LYQA 5FKYA 1ZL1A 2V3EA 1LL4A 3VGFA 4GO9A 1WZLA 2ZUWA 3WQ4A 1GJWA 3BMWA 2W66A 5C8BB 2XJ7A 3VM5A 1D2KA 2CXGA 4P8UA 3SCOA 2XTKA 3WH6A 4B3LA 4CU6A 2XVLA 4LYRA 4UTFA 4F79A 1JDAA 5D8ZA 2VT0A 4OUEA 1CDGA 4KGJA 2GUYA 4CD8A 1UWRA 5D9NA 2J7GA 3THCA 4PYSA 1W3JA 2UY3A 1EHAA 2WCGA 2DT0A 3WD1A 1JDCA 3VIJA 1OBAA 4ZXOA 3SUUA 3TOPA 4W85A 4P7OA 5CJ5A 1YHTA 5AC5A 1DWIM 3A4XA 1VIWA 2GJXB 1OSEA 2VX4A 1CGUA 3WDQA 4J3XA 4HMDA 3KWXA 2OWXA 2ESCA 1GNXA 4R5EA 2V38A 3AYSA 1VFUA 1NQ6A 3AXXA 2VR5A 3MU7A 1V3HA 3T08A 1OD8A 4M29A 3OGSA 4PN2A 1GPFA 5HXMA 4RE4A 2J7BA 5IDIA 1QBBA 2OSYA 5CPQA 1XHGA 4MB1A 2Q8XA 2XVPA 3OGVA 3M7SA 3CIVA 1B3WA 4UOZA 4OOZA 1TG7A 2VZTA 4N0RA 4GINA 3VX0A 3EDDA 5CGMA 1XCWA 3WL1A 4W8AA 4GZJA 1GOIA 1VFFA 3IJ9A 4MB5A 1JF6A 2EQDA 4FMVA 3AJ7A 3L4YA 2BHUA 4CGTA 2J7EA 5GPRA 5DO8A 1WP6A 2E9MA 2XM2A 4JKLA 1NWRA 1C92A 4QLLA 4F8XA 1KB3A 5A8OA 3FN9A 5IFPA 1TVNA 3VGEA 3BGAA 3AHZA 4J3VA 3ZR6A 5LA0A 3RO8A 3ARSA 3W37A 1R7OA 2Y2WA 2CPUA 1XD1A 3TA9A 4GZEA 3T0BA 4W88A 3UERA 3T2PA 4LGXA 5LA1A 2GDVA 5ABFB 1GW1A 5BCAA 1W2VA 4QLJA 1E73M 3WF3A 3K8KA 3N18A 2YA0A 1BVZA 3AZTA 4L4PA 3DHUA 4PMYA 3WENA 1HXJA 1ZJBA 3AHVA 5EMYA 3CMJA 2WMIB 1KXHA 3AHYA 1QNRA 2XPKA 1UD4A 1WNOA 2XSBA 4XX6A 3ARRA 4NF7A 3CHCA 4CKQA 3OZPA 1QPKA 1B2YA 1E6PA 2OSXA 1CZ1A 2GVYA 3PZGA 4ZXLA 3FHQA 3BC9A 5ABEA 1B31A 2PWFA 3U57A 4DWSB 1JYXA 4PMZA 1TMQA 4AZIA 4M8UA 3RPMA 2UY5A 1KGWA 1FOBA 1KR0A 2XM1A 2Y8VA 4TVUA 5GNYA 2GJXA 2XVNA 1PX3A 4Z2IA 2BY2A 2XFRA 1BAGA 1OCQA 1LQ0A 1XRVA 5FOOA 1UZ4A 2XGIA 1C90A 2D0GA 2XUCA 1QHZA 4TXEA 4WK9A 2CCRA 4HPHA 5C70A 5TD4A 1XCXA 3AMGA 4NI3A 3QOKA 4B9ZA 4YHEA 1E3ZA 4WKFA 2J7CA 2BVYA 2E9BA 3HMCA 1KQZA 3GBDA 5JBDA 2FHBA 4IPNB 2WMFA 4W7UA 1BHGA 1O7AA 2VX5A 5D4YA 1E3XA 3CO4A 1NOFA 4CD5A 1AVAA 1CPUA 4NRSA 5I23A 4UQBA 4YHGA 2JF7A 3AXHA 1JF5A 3VDBA 2W61A 1E71M 3KL3A 3VIOA 4EAMA 4RE2A 4AIUA 4AZ6A 4UFJA 1ITXA 4WSKA 1OGGA 4J3WA 5HBFA 3ZT7A 2Y8KA 2Y4SA 3S2CA 4PMNA 3WH8A 2DEPA 2FGZA 3CZLA 4V27A 2G3IA 4C7GA 3D5HA 3VIMA 5CG0A 5EFFA 3B9AA 4KH2A 4MAVA 3VDAA 1XH1A 3GTNA 4MDOA 1Z32X 1K9DA 4D6HA 1SYTA 3AHTA 1QI4A 4BCEA 3B9EA 1MQQA 1SMAA 2YLAA 3JUGA 2DT3A 1WZKA 1I1XA 3VMOA 1VBRA 1E40A 4AEEA 3AMCA 2WCAA 2DT2A 4TVCA 4WKAA 4QLKA 3NUKA 2A3EA 2JIWA 2AOSA 1NOUA 2YLLA 3ALGA 3W27A 3W26A 4F9DA 3DYMA 2JEQA 2VVNA 4CN1A 4M24A 1EA9C 3WQ5A 2V3GA 4IM4A 2EPLX 3T09A 2BXYA 4FK9A 1W1YA 3CZEA 4PMXA 1MVYA 4LYPA 2BNJA 5JIPA 1J0HA 3AS3A 5GNZA 1GHSA 3CUIA 1VAHA 2Y24A 1V3JA 3PZMA 1WB0A 1ZBWA 3MKKA 1M04A 2CHNA 3ZM8A 1KQYA 4UFIA 3A3HA 3PN8A 4FLRA 2ZX5A 3WSUA 3ARWA 1BYAA 2WKLA 3CZGA 1CGVA 3A47A 3K8LA 3N15A 1JZ8A 1CYGA 4M81A 4Z2GA 3I3DA 2JE8A 4JKKA 4QP0A 3AZRA 1OWQA 1F4HA 4JCMA 2FGLA 1GOMA 2CBIA 1JYWA 1J10A 3GXFA 4PTVA 5E0FA 4W86A 5EBAA 4AXNA 5A6MA 2BXZA 2YA1A 2WB5A 1NP0A 3O6AA 1HKMA 1PEZA 2NSXA 4ZE4A 2CHOA 1Y7VA 4X0NA 4C7FA 2YBUA 2QMJA 4MJ4A 2WZHA 3RILA 2J75A 1XSJA 1W2PA 1GJUA 1I1WA 1W3KA 1C7TA 2WC7A 2CERA 3ZSSA 7TAAA 2YL6A 2D0HA 1LF1A 3VIIA 1QNPA 5HDRA 4MTVA 4OIFA 2C8NA 4U5KA 3U5UA 1NOWA 4OBRA 2GSJA 2Z1SA 3SUVA 3DC0A 4AYSA 1W32A 2W62A 5BROA 1DTUA 4B15A 1VFOA 1AMYA 4BS0A 1KCLA 1KGXA 1Q6CA 4HMEA 5CSUA 4XV0A 3RM4A 4UFKA 4DUVA 1E6QM 3K8MA 3SCSA 3W29A 1K9EA 4Y7EA 2VL4A 5M5DA 1KFWA 2ZX8A 1EDGA 5AYIA 1WAWA 3UG3A 2YIHA 2V3FA 1CXFA 1CBGA 1MW2A 1U33A 3ARXA 1V02E 3MO4A 1PX4A 2PBGA 2J7HA 2BVDA 2WMJA 2YBTA 3WNOA 1ZBKA 3T0DA 2FH6A 3L2LA 1D3CA 2BV9A 1TZ7A 2ZWYA 1IV8A 3AYRA 1L8NA 1BFNA 1EHNA 3DHPA 5EB8A 2WMGA 4U2YA 1PIFA 1ISXA 1FHDA 2W92A 2YDQA 3N12A 3F4VA 1MQPA 2X2YA 3AI0A 2UY4A 3PZQA 5CLWA 1VF8A 1DWAM 3CHEA 3MSDA 2ZUNA 2CIPA 3AIVA 4W8LA 3CZJA 4UQ9A 1PIGA 5A95A 4J28A 2GK1B 2EPNA 3DECA 4JIEA 3SCRA 2CBJA 1UWQA 3ZOAA 1UKSA 3OLIA 1CNVA 5E9AA 4P7LA 1WDQA 5I24A 2WMHA 2UWFA 5A1AA 1M7XA 3OGRA 1QOXA 3A4WA 3NSXA 4WSJA 4H2CA 3HJEA 5I78A
chains in the Genus database with same CATH superfamily
1FWJC 3OIXA 3TW9A 1VFTA 2WKGA 3O63A 3EKZA 4JTLA 4DPPA 1KXVA 1K6WA 3C0SA 3W83A 2OYKA 1PL9A 2A7PA 4ERIA 2CBUA 3VABA 1B3YA 5E70A 3PM6A 1BXNA 5A6JA 4PTDA 1R0MA 1X98A 2C1IA 1B90A 1UA3A 2F84A 3W9ZA 2PRMA 3K1DA 3FAXA 1E9ZB 1P1XA 1Q6GA 1JZ3A 2XSXA 3VNYA 1ZBCA 5LHEA 1Q63A 4WD0A 4L4LA 1E9YB 4BF7A 1POJA 3VA8A 4B5WA 3HQOA 5JH1A 4PUDA 2NWRA 3A12A 3VX1A 1H7RA 4NI8A 3CQHA 3QHNA 4HK7A 1AMKA 2OEKA 1EF3A 4GFSA 1XIEA 2PWHA 3E38A 2QMKA 2ZX9A 3C2EA 1E9LA 4MOZA 4KF1A 4Z0SA 3M47A 2RKXA 5DY3A 1XDJA 1HNYA 3LGGA 3LPFA 1TRIA 3AU6A 1JIBA 2QZRA 1QNSA 1LLWA 4PCSA 3WUBA 1B9BA 1EX5A 3QF0A 3CASA 4G9PA 1TJ1A 3OIHA 1FVPA 3MBFA 4M7SA 2BY1A 1KCKA 2HE5A 4QE4A 3QGAC 3S5NA 2WW5A 3LK6A 3HG3A 2Z7KA 4GD0A 3FJNA 3OB8A 4L61A 2ZA3A 3R89A 3V7PA 1DQUA 2GVEA 1DEDA 1HO4A 4D9PA 4DM2A 3M0LA 4GIAA 2RJHA 1TTJA 3HQPA 4OGZA 4P7RA 1X38A 3EOUA 2PLKA 3B8DA 1V6YA 4MVAA 3ID7A 3TFCA 2NQHA 3VZYA 4L65A 3VKBA 2B7PA 1M5WA 2DZVA 2VI0A 3I10A 2DVXA 2VCBA 2BY0A 5LXXA 1FY6A 1QTWA 4JFWA 5H8MA 1M6JA 3L12A 5DN1A 3A23A 5A6TC 4KBXA 1PX8A 2F2HA 2BGQA 4Q4MA 4I5XA 2ISDA 1TWZA 1LORA 3TYEA 3MBDA 1DWFM 5AC7A 2VEGA 2RH9A 2RFGA 3VGGA 4GFIA 2VM8A 1CW2A 2IMRA 2QCGA 3M7WA 3NXLA 3VIKA 3PUDA 1XBXA 3SIMA 2J9ZA 4AD2A 1XGZA 2JGQA 3ZZ1A 2FJKA 2OB3A 3WF1A 4AD3A 2PDIA 2G0WA 5LNVA 3CJPA 3DFQA 4AC7C 2X0YA 4KCVA 3W7NA 2A6LA 1XLDA 1J96A 2YA2A 4NP7A 4RR4A 1R47A 1I2PA 3VNDA 1MO0A 4IJCA 1E0WA 5D2VA 1P0EA 5I6SA 3GNPA 3SCPA 1PZ2A 2DZAA 3TMQA 2VZSA 4KGLA 4LVAA 4S3BA 3GNDA 1RUSA 2D23A 4PRWA 1D3GA 5DEZA 3PZVA 2WAGA 3BG9A 4H19A 4QG6A 4YCPA 4JY8A 2FVMA 2ATMA 1QNOA 3PSVA 1WKEA 4Z08A 2XH7A 3LPPA 2FTPA 4KWUA 3TROA 3PBYA 4AVFA 1EZ2A 4HU0A 1ML1A 3TUUA 3QR3A 2Z1XA 1IR2A 4QS6A 4U3CA 4G5DA 4KCTA 1RJPA 1SJDA 1MW0A 3VK5A 4IP7A 1K02A 3W22A 3T0TA 4J3TA 2Z1BA 3H7UA 5IBXA 1AJZA 5KITA 1JNEA 3EEZA 4HA0A 1XLAA 1ZCCA 2B0MA 2R24A 3BW4A 3HA1A 3GU2A 1EEPA 2J6XA 3SUWA 1LYXA 4IXHA 1ZQ5A 3FKKA 4W93A 5K4XA 3GXIA 3VIGA 3PBGA 1EDQA 2IKHA 1BXCA 4S3EA 1WX0A 2Q8ZA 1M9HA 4DXKA 1DIEA 1ZGDA 4GYPC 2H3DA 1VYPX 5BRQA 3XINA 1A5NC 5LIYX 1HP5A 4EXAA 2HWGA 1EOMA 4LBRA 3APGA 3UCQA 1F07A 1JPKA 3QYQA 1S5WA 2VGFA 4LYKA 1KFEA 5A6BD 3H8AA 3NQ7A 3N9SA 4KEZA 1UUOA 4G8TA 1FH7A 4QGCA 3DI1A 4PL1A 1KWGA 3LENA 1XP3A 3AXIA 3LOTA 3QSRA 4PEKA 2Z29A 1H41A 5EFDA 3CHDA 1GZJA 3Q37A 2GWNA 3ARUA 5D32A 4AD4A 1HT6A 2YJQA 2A3AA 1RLCL 2C1HA 1Q7QA 4XUYA 2NX1A 3AMLA 4C1NB 1KTCA 2E9LA 4GVIA 1X1ZA 3TN4A 2BB0A 5CH9A 4MWAD 4BR1A 5BXPA 1OVDA 1QNQA 1RHCA 5JVLA 4DIAA 4GY0A 2QDDA 1XDLA 1ZP4A 3WEZA 5I5RA 5HPOA 3STCA 4J5NA 1M01A 3WLIA 2VOTA 2DSKA 2ZIDA 1VRDA 1MXDA 4DBWA 1NEYA 3N25A 1BG9A 1TQJA 3UY7A 3WY1A 4MPKA 1U5VA 4CCCA 1V5XA 3B4UA 1UWTA 1A5OC 3BQ5A 1G5AA 3MKVA 2ONEA 4OOUA 1XLCA 4IMEA 4US5D 2HEJA 1TQXA 1UB3A 2QJIA 3PG8A 1PXGA 5CCZA 1ICQA 3GXNA 3W07A 3VKKA 2Y61A 1POKA 5DBUA 4ZCWA 3RPTA 1TTIA 4IPPA 3IJ7A 5CPNA 4YNGA 4Q22A 3NQGA 2H3BA 2FZNA 4FOKA 1S2CA 5KINA 3T6CA 1UD8A 4YS1A 2P0IA 5EPDA 3S6DA 3SN4A 4GI6A 3QTGA 5IFTA 1CECA 2ZADA 3EWCA 1YBQB 1Q66A 1S38A 5BWFA 1LT8A 3LBCA 3GLCA 3VAVA 3MWCA 5L9FA 2IXVA 2E5BA 4R7OA 4J27A 5HINA 3QQWA 3E0LA 3EPOA 2C0AA 1KCXA 1CB7B 1ZJAA 2E28A 1FP9A 1UWSA 3A6OA 2VO5A 5J5RA 1OC6A 3SGUA 2ZX7A 1X7FA 1BQGA 4FNUA 1GVIA 1UZHA 3EXSA 3BVJA 3QPZA 1CGTA 3MKCA 3BG5A 3UA3A 3KRUA 3OVGA 2C7FA 4QEHA 2NV2A 2D22A 4Q8VA 3L4UA 1OFRA 4J9JA 3NQ6A 1JFXA 3H53A 2C3ZA 2VFDA 4UB9A 4Q6JA 4W5UA 4U3AA 1F6KA 2OZ8A 2FZ8A 2D2JA 3O2LA 3M43A 1VJIA 2DSVA 4N4PA 2OOGA 2D0FA 4JAWA 1ZHAA 3OA3A 1J12A 4GQBA 4QJ5B 4N9DA 2R1LA 2VEKA 2V5JA 3S1VA 3AS0A 1Q85A 2XVKA 4AUBA 2YW3A 3IRSA 3PVFA 3GNRA 2ISFA 3ENLA 3LHTA 4HNLA 3H2FA 5AOUA 2D2GA 1DWJM 3W81A 2V3DA 3F7JA 3P84A 3PWAA 1SZFA 3M0IA 1W3NA 4ACZB 2WSRA 1JFHA 4FB7A 2Z2AA 2PLCA 1W3LA 4E4UA 4HB7A 1JNDA 4IWWA 4AD1A 1I0BA 4CQAA 4S3KA 3NPVA 3GH5A 4E3TA 1GTHA 2V5DA 4GMEA 5GNXA 3SJNA 4ZGYA 2Z1VA 4CD4A 1V02A 3FSTA 3NQCA 1U22A 4NSBA 1V6UA 3BMXA 3N13A 4KIRA 1GKRA 3GVVA 1SZGA 1LZOA 3F1QA 3P80A 5BXTA 3BAXA 1ODUA 3H7VA 1ZBVA 2VC7A 3BDKA 1G9HA 2W3ZA 2PBOA 1GEQA 4KCUA 4PBGA 2PDFA 1R2RA 2PFHA 4LVFA 2VOMA 3WCZA 2C13A 3WFLA 1OT1A 3GYEA 4UNKA 1EO7A 2F2KA 1R8LA 1GG0A 3T05A 5A6KA 1U1UA 3M4HA 4JQ2A 4JDYA 1O4UA 3E3HA 1E56A 2YCIX 3EOOA 3L5AA 3VD5A 1YDVA 2GSEA 7REQB 4BFAA 3WJXA 1O68A 3ZSTA 3A9IA 3EMQA 4EVZA 1TPH1 1V08A 2PGEA 3W7MA 1PKMA 5GVJA 4ONVA 2C0HA 4CLMA 8XIMA 4KWVA 3KWSA 4IGHA 4GBUA 3P74A 5CC6A 2PDJA 2Z28A 1HTIA 4L1GA 1WXYA 4GQ0A 4RZ4A 3NQ8A 4UQEA 3ZWSA 1U5HA 3FYPA 1GK8A 3IIOA 3BAIA 4GIRA 1OFEA 1CGXA 2DUXA 3C86A 4LNCA 5DLCA 3ELFA 3O0FA 1EP3A 3OHMB 3TZFA 3PTKA 1UKTA 1RQEA 1JUEA 3MJMA 1JZ2A 3CTTA 2PCEA 4R7WA 1X8CA 4H9ZA 3UA4A 3GHUA 1QW7A 4HNTA 1JZ5A 4FNRA 4UCFA 4WKHA 1XR2A 2RDUA 1YEYA 2B7QA 4XVDA 3CH9A 3ZWTA 3PAOA 1HUVA 3FOKA 4H9XA 1XLKA 2IUZA 4OE7A 3AS2A 1TVPA 4H7VA 4GY1A 4JTGA 5REQB 1S2AA 4XO6A 3ZO9A 1YYAA 3QMSA 3IJ8A 2W5FA 2VNCA 5FF2A 1OD0A 3PZOA 3U6WA 3T1GA 4OT7A 2DDXA 4MZYA 4WR3A 4ADTA 1EJVC 3SURA 4ZEPA 1DHKA 3WK3A 3KS5A 1AJ2A 2QJJA 3AIRA 1R85A 1XLJA 1A47A 3OBAA 1DJQA 1R9YA 3NZRA 3KBNA 3IUHA 1WDPA 1NH6A 3TNOA 3T4WA 4J40A 1JXJA 2XIBA 3INPA 2VHLA 4YU1A 3TLLA 1YPIA 1C9DA 7REQA 1X6UA 2QVNA 3DOPA 2J88A 4LNYA 4S39A 1BSIA 1D7KA 3KRBA 4UQAA 1W17A 3LCIA 4XAFA 5AHLA 3L4TA 2ZUVA 4QISA 2ZZ3A 2YCJA 2Y62A 2PC8A 3L21A 2IKIA 1QNVA 1V0NA 3RIKA 4H00A 1F2JA 2OO0A 3FHAA 1A4MA 1KBJA 2HZGA 1LDCA 1P43A 3WQGA 1F4AA 3LA4A 4GH1A 2Y5JA 3WG6A 2CWNA 3QV9A 1CENA 5FJPA 2PDYA 2RGLA 2GJRA 5CXPA 5A6BA 3KHDA 3DI0A 4D72A 1I2OA 1C8VA 1V3MA 1XFCA 4AZBA 4BI5A 4IIDA 2NXHA 3WL0A 4AYGA 1LWJA 3UWZA 3I68A 3OYZA 3DFSA 2DPEA 1F3XA 3WH9A 3MY9A 4S38A 4RNIA 2JK2A 4QAWA 2DZUA 4L7ZA 1XFBA 3W7DA 3GNNA 1C91A 3KRSA 5C2GA 4HA4A 4MWAA 3WF0A 4LY8A 1VPXA 4D6FA 1KBBA 2AGTA 5E9XA 4N9CA 3T8QA 2J8FA 2DW6A 5REQA 2XIMA 1SPQA 2V8ZA 4RE3A 2NUYA 1TPWA 3WUGA 3M46A 1WPCA 5D9PA 1ZJHA 1SVDA 2HROA 3AYTA 1JCJA 3WNLA 1GUVA 1R86A 4GA8A 1BF2A 1RK5A 3BSGA 4L64A 5ABFA 3B8VA 3WQ6A 4O8RA 4US5A 5HJLA 5D09A 3RFAA 1IWBA 4R27A 1AA1B 3U5YA 4DPQA 3TKFA 4IJBA 2H9AA 3SY8A 3GDLA 2NQZA 4LH8A 2WZIA 3AS1A 3VI2A 4DJED 2VEFA 1H7XA 4H8UA 3L66A 5IHSA 1OT2A 3CZKA 3WK1A 3W71A 1Q45A 2WC4A 3U2CA 1CI1A 1RCOB 4QSHA 3WD3A 4CUCA 4F66A 3LTYA 2JQXA 2HVOA 2V5LA 1G7VA 1V0MA 3G1AA 3QR0A 5K3VA 2AL2B 4IFRA 3UG4A 5BRPA 1UKOA 3W85A 3ZVIA 2V2HA 3CPRA 3RX3A 1X39A 3W87A 3LTSA 4C6MA 1MUCA 3CNYA 1UR4A 3ZVHB 2XIIA 4Q4QA 2G96A 4AVOA 2QHAA 3BJFA 1J9YA 3WKZA 4CQ9A 1TPEA 3CV6A 2JGYA 3N19B 5EMLA 3VILA 2VENA 3P6LA 4PTXA 2F6UA 1Z69A 4C5ZA 2YFOA 4WJEA 3OO2A 3O16A 3ABRA 2V9DA 1ME7A 4UFMA 3GG8A 2XFFA 1V3KA 2ZE0A 3WJZA 5CZJA 1THFD 3VKCA 1E15A 2Y0FA 1DL3A 2FZBA 3G77A 4MDPA 3W7IA 3CUZA 4UNIA 1ZTVA 2B7OA 2W0UA 4I8YA 3SGGA 3D0CA 3UGVA 2OZ0A 3BJSA 3WBWA 1EXBA 2WWDA 3DIPA 1KA9F 7CGTA 4BEQA 1S46A 3W7HA 1W6TA 1EPVA 4JL1A 4MZ8A 1OZQA 1HL9A 5I3GA 2PTDA 2ZXDA 3MYPA 2OXNA 2PRLA 6TAAA 5HK4A 2VEMA 4M82A 2BDQA 1SU5A 4IMFA 2VWSA 1DIDA 1KBIA 4FEZA 4ADSA 4HOZA 3LXAA 1MYRA 4KQNA 2DSUA 4AEFA 2GQ9A 4PSPA 3ARQA 4HU8A 2WLYA 1G6CA 5LIWX 1WKFA 1XV8A 4L6HA 4WUIA 3GHSA 4I8DA 3DKJA 5CAKA 1YNQA 4DXXA 4AG0A 1UC5A 3H4WA 3I4EA 3PFMA 3I6RA 4WVXA 2X09A 2AL2A 5A6LA 3W4RA 3UP8A 3BAWA 3ZJ8A 3AIUA 5B7ZA 3CIWA 1QK0A 3ZVHA 3M0MA 4XAZA 4NZCA 2A3CA 3PTDA 1NTHA 3L4ZA 3LQLA 5DX7A 4NXSA 4XQ6A 1C8XA 3EWDA 3WH5A 4X2PA 2NX3A 2W6RA 4NIRA 4V1YA 3TFXA 5TBOA 2IPJA 2P10A 4QCFA 2CWXA 3NQ2A 3BWWA 5J5DA 2GWGA 4YIWA 3KW3A 1EQPA 3HPZA 3PK7A 4XZWA 2J8TA 5T26A 1IF2A 2OCZA 1IZCA 2X2GA 3GG0A 4U31A 1VEOA 1W9DM 2PWGA 3UXKA 1US3A 1GVYA 3HGOA 4LYQA 4PR4A 1ZL1A 4PRRA 3GG1A 4QRNA 3GW0A 5FSDC 3B8WA 2ZUWA 1VHCA 3W1LA 3CH0A 3N14A 5C8BB 3G1VA 2CXGA 3SCOA 4CU6A 1JPMA 1S2TA 3M16A 4S3CA 3PBVA 4KGJA 2GUYA 2V2CA 1DE5A 3THCA 4PYSA 4J2PA 3T9PA 5LNSA 1P6CA 2EF9A 1MEHA 1XIHA 4HHLA 4C6FA 3RX2A 2A85A 4DRSA 1OSEA 4RPQA 1P1MA 4JHMA 3WQOA 4J3XA 4K8HA 1S3HA 1KRAC 3AYSA 1VFUA 3AXXA 3T08A 1OD8A 3H4XA 3N6JA 3ZLFA 3PWIA 5HXMA 4QE5A 3P14A 4RE4A 3G1YA 4EIVA 1QBBA 1ADDA 4XZIA 3WX7A 3OGVA 4XAPA 2C19A 3R58A 3LLXA 1ZRQA 2A5HA 4GUHA 3VX0A 3EDDA 2PE4A 1VQTA 4GZJA 1GOIA 3ANUA 4YCOA 3U3HA 3AJ7A 5GPRA 3V4BA 5DO8A 2E9MA 3OTRA 4JKLA 1C92A 4IMDA 3P0WA 5HMSA 2JKPA 1WQ5A 2ABAA 3RU6A 3FN9A 5IFPA 2ZVIA 3VGEA 1PYMA 5C6MA 1H7NA 4GGBA 8XIAA 4DNHA 3WLLA 4C6BA 1QPQA 4BJHA 2Z7GA 2CPUA 3IEBA 3GAKA 3TA9A 4GZEA 2CZFA 1Z6KA 1N8WA 4HD5A 1GVRA 4D2JA 2GDVA 4GI4A 1RV8A 2HMCA 5BCAA 3W88A 1LROA 3NQFA 3WF3A 1IXQA 3N18A 3EB2A 1HFBA 1BVZA 4L4PA 4PMYA 3DHUA 3UF9A 4YWSA 3H2OA 2Q71A 4E4FA 1KFJA 4L6OA 4P5UA 3KXQA 1KXHA 2W79A 3LCFA 1WNOA 3YPIA 3CHCA 3KOYA 3IIZA 1QPKA 3PZGA 2HNEA 4FOUA 4F0LA 1CLKA 5AHEA 1OEPA 5AHNA 4PZVA 1KFBA 1MRAA 3HURA 3W73A 5BZAA 1Z41A 1O94A 5FEWA 1KR0A 3MO7A 4TVUA 5G5IA 1MEWA 3BPWA 2Q8LA 4LVBA 3LX9A 2V0TA 2BY2A 1EYWA 3S5OA 1XKJA 2OZTA 3G3MA 5C70A 3AMGA 1NELA 4CNOA 3DG6A 4YHEA 3PC0A 5IDZA 4X63A 4WKFA 2J7CA 2BVYA 3GBDA 2FHBA 1BHGA 2VX5A 1Z9AA 3HPSA 3UXIA 3CQKA 1CPUA 3S5ZA 4UQBA 2C6QA 3TC6A 4YTQA 4H6EA 3UJRA 5JH2A 3UD6A 1JF5A 4N7QA 3KL3A 3NOEA 4AZ6A 3GVQA 1DJNA 4RKAA 5HBFA 3FA4A 2WZMA 1R3VA 4Y2WA 3S2CA 3URBA 4HJWA 3ICJA 1QATA 3ITYA 3CZLA 2BMBA 4C7GA 3E0WA 5CG0A 5EFFA 3B9AA 4OHQA 3WLKX 1Z48A 4MDOA 3O07A 4GK8A 2YCKX 4LT9A 1QI4A 2X1SA 3XIMA 3B9EA 1TCDA 1MQQA 3QRHA 4YTRA 2YLAA 3JUGA 4DJEA 1YPXA 1I1XA 2WCAA 4QLKA 3T0CA 2JIWA 4IP4A 2DP3A 3VE7A 1VBJA 1NOUA 5FA5A 1VBGA 4I90A 1I9CB 1DJYA 2JEQA 2P3ZA 4YLWA 2ZC1A 3GTXA 4Z1DA 2EPLX 5BOFA 4FK9A 1Q7ZA 1K8ZA 3HBLA 4RW3A 4PBEA 4PMXA 2BNJA 3UCDA 2QCCA 2NQJA 5GNZA 1WUFA 1GHSA 3W7QA 2DZPA 3TW6A 4DBDA 4Y9MA 2Y24A 1V3JA 4LCQA 2QYGA 1ZBWA 4R33A 3MKKA 5G1MA 4NNCA 1F6YA 4UFIA 4A22A 2ZX5A 3ARWA 3A47A 5HQEA 3TWAA 3MCMA 5CBBA 1OF8A 3I3DA 1ME8A 4E6MA 7PTDA 3S2JA 1OWQA 4DJDC 6REQB 1GOMA 4HIBA 4N6FA 4O15A 1JYWA 4IL2A 3IK4A 2DV0A 3AUJA 4AXNA 2BXZA 4PODA 4Q8OA 2WB5A 1HKMA 3WLRA 1Y7VA 3E0VA 4C7FA 1YNPA 4HPNA 4ZB2A 3CL6A 5EL1A 2RAGA 3LU2A 3RILA 3E6EA 3UVAA 2J75A 1W3KA 4N9BA 4YJ5A 4UTIA 2CERA 2D0HA 4LEQA 3KDNA 5HDRA 3WYZA 2C8NA 5D05A 3SUVA 1W32A 5BROA 4B15A 2GPTA 4AX6A 1VFOA 3F2BA 1FWNA 1YXYA 2CC0A 3W1TA 4HMEA 4S1FA 5CSUA 2IW0A 3RM4A 4DUVA 1H51A 2WOQA 3EOEA 4ZQPA 1TJPA 5HQMA 2VL4A 4JQ4A 3CMFA 4NYYA 5AYIA 1EDGA 3AJXA 2DW7A 3WLNA 2C79A 1J5TA 4NY2A 1CBGA 1HZYA 1OCBA 3ARXA 3EX1A 1TRDA 2PBGA 2WMJA 1ZBKA 5C9XA 1D3CA 2BV9A 1R3TA 4YVPA 5DRIA 2ZWYA 1L8NA 3EOSA 2CLHA 1FHDA 3N12A 1MQPA 1XIGA 2X2YA 4ROQA 3MSDA 4WXYA 2ZUNA 2FYMA 5FF3A 4N4QA 3O06A 3CEUA 1PIGA 1OYAA 5D37A 3DECA 4LW7A 4WXZA 3H6OA 4LUTB 4ZR8A 3UPMA 1N8IA 3OGRA 1QOXA 3OP2A 4WSJA 4H2CA 1CXLA 4EE9A 1M3UA 2G4FA 5T8GA 5CC3A 1EH9A 2ZRYA 1LOLA 2YKKA 4NXKA 5CZKA 1BYDA 4NAEA 3W1QA 2J78A 4O11A 3WIJA 1XC6A 3WJYA 1BYCA 3GNOA 2NXIA 2XU2A 4H41A 4C65A 5HWMA 4BQ2A 1XI3A 4IGNA 2X0SA 3QR1A 4HQVA 2HQAA 1EEXA 1ZS2A 1MUMA 3O0KA 3XISA 3POHA 2JKEA 1XM3A 4JR5A 4KETA 1Q7MA 1W9XA 4GVGA 1EGZA 2WJDA 4KW2A 5C7HA 4KRTA 3LM7A 4O28A 5FJIA 2VELA 3K2GA 3MDWA 3VCRA 1LG1A 2VUYA 2I1OA 5HR6A 5G4HC 3P5YA 3QM3A 1RY8A 2I9UA 1FWCC 3MA8A 1SZEA 2D1ZA 4ZQRA 2VXNA 4IUGA 2BHYA 4FS9A 4NJHA 2BVWA 3HN3A 4Z1CA 3KVMA 4HPGA 3VOCA 3L65A 3BURA 2PU0A 4DHGA 2QPSA 3R0UA 4A8RA 3S6OA 4HPXA 3GZ3A 1UD6A 4TQTA 2X05A 4I9MA 1GQLA 2QJGA 3U4FA 4Q7IA 2VMFA 4V33A 2XFYA 3HJZA 3FVMA 5AYZA 3TTSA 5ABHA 5AZ0A 4N6EA 3NR0A 4J2MA 4JEQA 1AD4A 1YTKA 1JRCA 1DWHM 4WZHA 5DCDA 3STFA 2J47A 1ZJIA 3FS2A 3URQA 1XCFA 1EX1A 3WFZA 2FB2A 1C8QA 3N2OA 3C52A 2IPWA 4EPEC 3S6TA 1BEUA 4LY4A 4BQ4A 1D8CA 1S39A 5CKSA 5TNVA 1RALA 2X8RA 4UNLA 2CNCA 2J27A 3BG3A 4MB4A 4PUWA 4C6QA 4E2OA 3U2EA 2VCCA 2XH0A 1FWGC 1UOZA 1GOOA 1E9IA 3BLPX 3PG9A 4Y6GA 1R3SA 2J7FA 4LPCA 2OGJA 4H1ZA 3FYYA 3S9YA 1A3WA 1EJ7L 4IQLA 4HNNA 5T9CE 2WHMA 2IQTA 1PTAA 1RAKA 4GRSA 3TJ4A 4XZMX 1LP6A 3MW7A 2FVKA 3PUEA 4ZVJA 5D2WA 3A22A 5HJYA 3UG8A 3B8IA 1AW5A 3W25A 2PWDA 3EA1A 4L56A 3EWUA 4JTJA 5A8NA 3VDHA 4B5XA 3BLIA 2QCHA 1F73A 3PFRA 1KKOA 3TYBA 1VEPA 3NDYA 2GJPA 4ZODA 2WNQA 3ITVA 3W0KA 3HIJA 3IIVA 3URAA 4ZOCA 2FMOA 5SWUA 5AECA 1RA5A 2R1KA 1R3QA 4WF7A 2Z00A 2D20A 2QPUA 4WJ8A 3SUTA 1P7TA 2G37A 2WVSA 1KCZA 2ACRA 1TMHA 1W0MA 4C6KA 2YYTA 3NDOA 2H8XA 5K2ZA 4RDWA 3MQTA 4S3JA 3SB0A 4DNMA 1YE4A 3R6IA 4GKLA 3UWWA 5HOSA 4AWEA 3AFBA 2QULA 2WV8A 4UZSA 2WHKA 5CGTA 4I9TA 4GGHA 1E0XA 1ZY9A 3UJSA 5DF0A 4O1DA 1R46A 2PRHA 3D3FA 2OYMA 4S2CA 4LAKA 2YXOA 1OYBA 1I60A 2QCLA 1E0TA 3UWVA 4CNSA 3KBWA 3SZ8A 1VB9A 1XYZA 3CAWA 4Z1YA 5EMJA 3DFOA 3TW7A 4I9JA 1E4LA 1YDNA 3TJLA 4GUJA 3F2CA 3TSMA 1ZCOA 3NYZA 1J01A 1VJZA 3SRHA 1FUYA 3SRFA 1PKYA 4C6DA 1FH9A 4PCPA 1EUNA 2QW5A 4KERA 3TN5A 4UTTA 2Q3RA 4NHVA 5DT5A 3G8EA 3UR8A 1W9BM 3ITLA 4FOJA 3FJLA 4G7FA 5G2HA 3C61A 4URIA 5HMFA 3IUIA 1IR1A 1CXKA 3W6YA 4B3KA 4DBUA 2FTWA 3ARTA 1H61A 3ES7A 1BG4A 3IAPA 3GTHA 4ILSA 3BSHA 1HQTA 1U5JA 3H22A 5I3DA 3DEQA 4FXSA 2CEQA 1FQ0A 4OKDA 3GC2A 4GVHA 2PMQA 1QMLA 1OX5A 4RDYA 1O5KA 1LUCB 3EA2A 1EUAA 4IFKA 3VE9A 3TZNA 3IUDA 4H6QA 5I2UA 3PZTA 1BGGA 5G4WA 3WLQA 2EHHA 3R8RA 3LCXA 1BLIA 3DBPA 3VOGA 5MKGA 2X1UA 1PS9A 1VHNA 4INFA 1KM6A 1LLOA 3TCEA 3CTLA 2PZ0A 3AROA 3UXLA 3KOFA 2D2OA 2R91A 3D6NA 3VUSA 3M07A 3QBUA 1H1YA 3UETA 2V5CA 2WM0A 3HGSA 3QC3A 1EGVA 1NY1A 1FWTA 3UNDA 2XYLA 4H7ZA 2E0PA 3W6MA 2NV9A 3EA3A 3CB3A 3VKDA 3WDIA 1JCTA 4CQDA 5LIKX 3MSRA 2OWCA 3VXGA 3LEPA 3NEHA 5I00A 1UMYA 1OG6A 4M6UA 4DWSD 5HUOA 1HX0A 1OX4B 1T40A 5EBUA 3AIEA 3W7GA 4B4FA 3EX4A 1UP3A 2D2HA 3W2KA 2O92A 4NJIA 1TPC1 1SFJA 3WBEA 3G24A 4RK8A 3FW6A 1TJ2A 3VPLA 3NFUA 2NT1A 1REQB 1VPQA 3UEQA 1F7BA 5G1TA 4LJ3A 2PDNA 3HU7A 5BU9A 1M68A 4E2BA 1TZ9A 3RR4A 5C7VA 2Z25A 2J7DA 3ZQ9A 1NSJA 1KBKA 3DKLA 3UWYA 2HK1A 3KOWA 2QCEA 2ZQ0A 4QITA 3E2SA 4XG1A 5GJPA 3S46A 1AQ0A 3ZS4A 3UZZA 1UR9A 4GQRA 2OSWA 1VJSA 4CVUA 4FR1A 2CYGA 3N1AA 4LUIA 1KFLA 1XBVA 3ABXA 3FXGA 3ZMRA 5EMKA 3NQMA 1XPYA 1V8EA 4KFOA 1L9WA 2PGFA 5ECVA 2D69A 2TSYA 4IQEA 1VBUA 3W1XA 3CWNA 4PUUA 1PAMA 4RNFA 2VDGA 3E96A 4WOZA 1I2NA 3LPGA 3PUOA 2GLKA 1ITCA 3B05A 3KZSA 1KD0A 2FDMA 4N2YA 3WK2A 3BH4A 4HN4A 2WVVA 3WDPP 2G4JA 4D1JA 2A1YA 4LV9A 4E38A 3G6LA 5LKYA 4RX0A 2G97A 3OOQA 1E72M 3GNXA 3PJXA 1F3EA 1R2TA 3GFYA 4C6OA 3HMJG 1GKPA 5JUVA 1C29A 3MMDA 2UZ9A 1V3LA 4B2DA 3MVIA 1XIJA 4PUKA 3UG5A 5A2AA 5CBJA 3KE0A 4ATDA 4RDZA 2W91A 1ECQA 1FHLA 4CCZA 3P81A 3LD5A 1R6WA 1I45A 1OX4A 1VCFA 3DUGA 1E6XM 3JRKA 2O7SA 3A4JA 5K9XA 1EGMA 1PJ9A 1E1EA 4DF2A 1XKYA 3VINA 2UV8G 3K5XA 4FP1A 4TR9A 2A79A 3UYCA 3SCVA 3S5SA 3TTYA 3UQNA 1HGWA 1XLBA 2YCEA 4ZQMA 3B8SA 1JCXA 4IX0A 4DZHA 3RYSA 4O53A 3TSDA 3E5PA 4O4VA 3KP0A 2VDIA 2PC4A 3WUEA 3R79A 3SJ3A 2A3HA 4K3ZA 1EC9A 1VR6A 5JBEA 1H1NA 1Z44A 2VFGA 1AZ2A 1EO5A 3MI6A 2ASHA 4H8VA 1E0UA 2HCVA 1I0DA 2AQOA 3TONA 3GIPA 1UR3M 3USZA 1EB3A 3G0SA 2DGAA 3AO0A 4G2DA 4LALA 2BXVA 3Q65A 3LBOA 2WHJA 5D8WA 3P7YA 2Y7FA 4O0KA 1E4MM 3CMGA 4BEUA 3IJLA 1WYIA 4AAJA 2GL5A 1ZNNA 4LFYA 3T0AA 3MZNA 1MFUA 4N02A 4TX8A 3E1F1 1ENUA 1G4PA 4RZ6A 2ZVRA 1ISVA 2R8WA 3H70A 3RCNA 1XYLA 3FV9A 5CAHA 1SMDA 4NZ5A 1GEHA 1XH0A 5A69A 1RJQA 4DUOA 4GH3A 5DXXA 3ZR5A 4AWUA 4Q8NA 4AWTA 1RBOB 2QF7A 3U2OA 3GQYA 2H8ZA 1FCUA 2CLKA 1DXIA 2YZRA 3TC3A 4XD5A 5E09A 3NXFA 1F61A 3QVQA 3FEMA 4QBXA 4U2ZA 3RO6A 3VZXA 4GG9A 2Q01A 3N17A 2ZBTA 2UBPC 1N82A 1O1HA 1I75A 3K4DA 3SAZA 2O56A 2W67A 4AZ7A 3GVRA 3KBVA 3R7MA 3L4WA 2FFIA 1MFVA 3WMBA 5F2MA 5D02A 1K6AA 2IS7A 2QUVA 1W1TA 1DIOA 3PJUA 5G2WA 4ACYA 3LBMA 3T07A 1MW3A 4HOXA 3S1UA 4C1LA 2VZOA 4W7WA 1S2WA 1QW8A 1UP0A 3M0VA 2YDRA 3DFYA 4B16A 3GYCA 2VR4A 2E77A 3EDEA 4HJFA 1WOBA 3OU8A 1UQZA 2CETA 3R25A 1NP2A 3UT0A 2IXUA 4HZ7A 2CKSA 2QDHA 2OT0A 3TP4A 1FWSA 2PDHA 3S1WA 1P4CA 2VQTA 3IJQA 1K70A 3W72A 4K36A 4LAUA 1KW1A 4FLSA 4JTQA 5F1VA 3SFKA 1UHVA 3MSYA 4O52A 4JFSA 5CZTA 1CLVA 2EJ1A 1V6XA 5E1QA 2CKRA 3EPMA 3BLDA 3MJYA 3HV8A 1UJPA 2REQB 1VKFA 3KHJA 2DIEA 3M6DA 4GKTA 4H9VA 4A8NA 2JKAA 3SSZA 1WE5A 1TFVA 2X16A 2WVTA 4Z17A 1C3FA 1EIBA 4QAIA 2ZXAA 3MMUA 4CEUC 1PWMA 4M0XA 2XWDA 1BXBA 1EXPA 4EP8C 2POTA 2X0HA 3BAKA 4BWLC 3OVPA 2VC9A 4G1KA 2A21A 2QT3A 4B9YA 3RGTA 4YXGA 3VU2A 3L23A 1HKIA 3BCDA 8TIMA 1WDRA 3PZIA 4W87A 4PEEA 4C60A 3G6MA 4FX8A 1Q3NA 2FH8A 3ZR4A 4L9ZA 1H09A 2PLMA 3C56A 4AD0A 2BFGA 3W1AA 4NT0A 4PCFA 5XINA 3RRAA 3DXIA 2YCLA 3W00A 3I65A 1FWBC 4PUEA 2Y85A 2FDSA 1SZNA 1JULA 1SSGA 3NQVA 4H8HA 3AALA 2BWGA 2WVUA 3II1A 1US2A 5M3WA 3M9YA 1BGAA 4OBSA 1AZ1A 1I2RA 3P3BA 1SJBA 4MAZA 4M3PA 4Y9AA 2O9RA 2X41A 1VFMA 3LXBA 3MC5A 1GCYA 4Q32A 3EXTA 2E8YA 3H23A 1QBAA 4QG8A 3U9IA 4WY0A 1DP0A 3O15A 5GJMA 3ARZA 2FIQA 1C8YA 4ML4A 4D8LA 4H6KA 3PP7A 3WUFA 4NAFB 3BCJA 4UXDA 4IP5A 2YOCA 4ZQCA 3NL5A 1UPMB 4LV4A 3WDHA 1H62A 2V67A 4TVDA 3PPCA 4JXCA 4H7CA 1PZ3A 8A3HA 5BNKA 1IZJA 4DZ5A 4P61A 3CIXA 4PUJA 4IOTA 2WJZA 2R14A 3IGXA 4DWSA 1NIUA 2QF8A 3UVIA 1KTNA 3O6DA 4ZSTA 3OODA 5HUPA 3R4IA 3WELA 3LZ5A 4XIMA 2PCQA 3EKGA 3VGHA 3MUZ1 3TIMA 1A3HA 1OB0A 2DT1A 4Z2KA 4B4HA 4D6IA 3IVTA 3AMDA 1UR8A 2AQWA 3AQUA 3B3DA 1M53A 4F0RA 3DENA 2ZICA 2J13A 2Z0IA 5EGRA 3CV2A 4UWMA 3H12A 4FNSA 1FDYA 4DI8A 3O3RA 1S1PA 1Q2RA 3H7RA 1H7WA 2V82A 1TTQA 3U7VA 3EYPA 1L2QA 2B81A 4HZ6A 3GDKA 1SO4A 4EK7A 1A5CA 3F4NA 3BE7A 4NKCA 1EBHA 5HPCA 1JUBA 3VTRA 1FHUA 2A3LA 5CLTA 1VBHA 3TE9A 1QI0A 2BGNE 3H54A 1L0PA 4GXPA 2YXGA 1T8QA 3M41A 4JTUA 2B7NA 4AHOA 1RVKA 5G1YA 3CUGA 1LRQA 4O8AA 3SIZA 4LAOA 3B40A 5I06A 1SW0A 4QS5A 3IIPA 4GOAA 3AMKA 3JS3A 3Q45A 3SN0A 3VMNA 3QZAA 1VEMA 1MNSA 5ABGA 1TSIA 2VZUA 4AY1A 4HMNA 1W91A 2OYLA 3NL6A 3HO8A 2QDGA 4MUZA 4F9JA 2Y70A 3ABQA 3W74A 2HSAA 1K03A 4Z1BA 2P8CA 2CESA 3WQVA 3C4UA 3CT2A 1FRBA 1V51A 1OK4A 3HG5A 2JIEA 1JZ6A 4HHHA 4CVWA 3CLMA 3ALFA 1E4IA 2FFCA 2BG5A 5FL1A 1SO5A 3BLLA 3W2JA 4JIIX 1YQ2A 5I0DA 4EWJA 3VVGA 4CN6A 3EAUA 4C6PA 2VJXA 1TWWA 2ZA1A 1C7SA 3PHAA 1SFTA 4GE8A 2NWSA 1LWIA 1H0IA 3RX4A 3TTEA 3NM3A 3TX9A 3W23A 3S5YA 4DXVA 1G01A 4LU0A 1TV3A 4MJZA 3T81A 2IQ0A 4A8LA 2QUMA 1SZRA 2QCMA 4OVXA 2IPGA 3A3XA 2JALA 3VKAA 4A2RA 3QGVA 2PD5A 3UYIA 4DJEC 2XG9A 5C9UA 1YLVA 1KFKA 3FLUA 4W7VA 4JDBA 5L6UA 3PBUA 1HIZA 1RXOB 2EO7A 4AXKA 3CPGA 4HMCA 2DUAA 1A0DA 2VD9A 5C71A 1JD9A 1GYLA 1UJQA 4XUGA 5EKYA 2QJNA 4M5PA 1F3WA 1JYNA 1H11A 3W7JA 4GO9A 3S42A 4JTIA 1A5LC 4ICCX 3W7OA 4EXBA 2BP1A 4R53A 4P8UA 2XTKA 3WH6A 4M1BA 2XVLA 4ZL1A 4UTFA 5D8ZA 1V93A 4AHQA 2VT0A 4ZFCA 1CDGA 1PUDA 4HSOA 3LRLA 3E2QA 1VFHA 4H9UA 4P2VA 3ZFHA 1W3JA 5I02A 1EHAA 4GJIA 4BI6A 1OBAA 4ZXOA 4YTUA 1YHTA 3QV6A 2VFEA 1TV8A 3BV4A 1DWIM 1S5TA 1UZDA 2R94A 1ITUA 2FLIA 1CGUA 2QQ6A 3GKAA 3R10A 4HMDA 4DBSA 4FO4A 1GNXA 4R5EA 2V38A 2FZMA 3OBKA 3VOIA 3QN3A 2VR5A 1NFGA 1ZP3A 1QAPA 5HAOA 1GPFA 1W5MA 4E8GA 4Y90A 3EX2A 4MB1A 4AVNA 4O19A 3QPEA 4G56A 1B3WA 4JNMA 3EPNA 3E74A 3NG3A 4U28A 4REQB 2PTZA 1U1JA 2VZTA 3ZLHA 1KM4A 5CGMA 1XCWA 3WL1A 4W8AA 3WQCA 4DN1A 4MB5A 4CGTA 1FCQA 4NX0A 4GYJA 2XM2A 3GFXA 1S5NA 4LF1A 3PF3A 1TX2A 2R1PA 4GUGA 1A49A 3BGAA 4JTAA 3P5ZA 2ANUA 2HRWA 2OLAA 3N2BA 3ZR6A 1AJ0A 1F9CA 3NO1A 5LA0A 1WKDA 3C3NA 3DCPA 3RO8A 3ARSA 2ALRA 5DCBA 2BX7A 1O12A 1FWHC 4HNOA 1US0A 3M64A 4BF5A 3T2PA 1TPFA 4DYJA 1UWAA 2Y7DA 4CNUA 1NU5A 5E5CA 2VEPA 4GNJA 3STGA 5M2FX 1QU4A 2V6AA 1ZJBA 2VYOA 3PY2A 1B57A 2WMIB 1QNRA 2XPKA 2XSBA 1JGMA 4XX6A 3ARRA 4ICNA 4K38A 3LTPA 1BWKA 1XG4A 1EP2A 4PB3A 4AFYA 1CZ1A 2GVYA 1AQFA 2F9RA 3BC9A 3UY8A 3KP1A 5TIMA 3A24A 3U57A 3WLOA 4F2UA 4PMZA 1VC4A 1TMQA 2NXGA 4M8UA 1KGWA 2YGYA 2HV5A 4EF8A 2Y8VA 3STEA 4QSFA 4MFDA 3KBJA 3LG3A 3GVGA 4C1KA 3DESA 3HFYA 4Z2IA 2XFRA 1BAGA 1OCQA 3VCCA 1LQ0A 1XRVA 3BGJA 3OJGA 4QR6A 1IEIA 1C90A 3TNBA 1QHZA 4WK9A 2CCRA 3V1HA 5TD4A 4ZB5A 3OBEA 4B9ZA 4ZBCA 2CLFA 3BUVA 1KQZA 4Q8TA 2WMFA 4W7UA 1GVQA 3I7RA 1SO3A 1O7AA 3TK7A 2PLJA 4JX6A 1E3XA 4Q4PA 4WY0F 1W1B1 4CD5A 3GDTA 4IG2B 1AVAA 1EWDA 2VC5A 3M44A 4NRSA 4YHGA 2FZDA 1TV7A 2JF7A 4ASTA 1EC7A 3VDBA 1GWJA 2W61A 1E71M 1KV8A 4O16A 3THAA 4E3VA 4EAMA 3MYOA 4KIEA 2Q09A 2PP1A 2WPBA 4UFJA 1ITXA 2GVGA 4J3WA 2YX0A 3ZT7A 2Y8KA 2Y4SA 2ZZ2A 4QDPA 3WH8A 1AK5A 2I57A 6ALDA 4V27A 1GYMA 1QO2A 1ONXA 3P8IA 6XIAA 1DXFA 1A5SA 3VDAA 5PTDA 2YPIA 3AHTA 5BMXA 4BCEA 4HHPA 4O14A 4DJFD 3ANVA 1A5KC 3WLHA 3VNMA 1IE7C 2OU4A 4LAZA 2CLOA 4GY7A 2V30A 2ADAA 4A35A 2PWUA 1XQLA 2WM1A 1L6YA 2BOGX 3BK0A 4WKAA 3NUKA 2A3EA 4RZ5A 4MY9A 4KESA 2P1FA 3HGJA 3K30A 2YLLA 1KM2A 1AW1A 3AU2A 3W26A 4MG4A 3K13A 2V3GA 4WRHA 1W1YA 3CZEA 2VWTA 1LT7A 1OQFA 4AIBA 3BLEA 2GQ3A 2R1MA 3CUIA 4MKNA 4Y8FA 2L5HA 2Y7EA 1Q4WA 4A21A 5AC8A 3EGJA 1XX1A 2XN0A 3PNZA 3ZM8A 1KQYA 1NQKA 4LF2A 3FDGA 3A3HA 4GJ1A 1OJXA 3GUGA 1X97A 3N4FA 1TIMA 2PPGA 2WKLA 5FF0A 4XSLA 1XW8A 4UUIA 1NDVA 3H2MA 4NJKA 3FYOA 1TPUA 3OG3A 4JCMA 4Q4OA 1MNZA 1JUKA 1VLIA 3GG7A 4A29A 1NVMA 4QJ4B 5J8LA 5EBAA 5A6MA 3AWNA 3CV1A 4DZIA 2GVJA 1XBYA 3LLDA 1B4EA 1PEZA 2E6AA 2NSXA 4ZE4A 3JW7A 1VYRA 1YXCA 4MJ4A 4K7YA 2WZHA 1Q2SA 1XSJA 4IG2A 1C7TA 1XDMA 3IARA 2WJEA 3ZSSA 4DF1A 4JD4A 4WX2A 4GX9A 3IVSA 2KZHA 4U5KA 1W5NA 3W2MA 2GSJA 2Z1SA 5BOOA 3DC0A 3WFAA 2PF8A 3M6YA 4HSHA 4LOCA 1KCLA 4A3UA 1UROA 2GVLA 3NPWA 4D8AA 4LUYA 2Z6IA 3K8MA 3W29A 4Y7EA 5HNTA 3DN5A 1KFWA 3V16A 2ZX8A 2PD9A 1WAWA 4EXQA 4UR7A 3LM3A 3DDMA 2MNRA 3PB0A 1ADOA 1U33A 1V02E 1PX4A 2J7HA 3TN3A 1FX6A 1PYFA 3T0DA 3L2LA 4LB4A 1KLZA 3AYRA 4C1NA 1BFNA 1K1DA 3D47A 1RJRA 2CXEA 4U2YA 4LBUA 5KZDA 2QIIA 2YDQA 5M1TA 3JVAA 3F4VA 4IIHA 4QDWA 4JYFA 3R8HA 3MHFA 5CLWA 1VF8A 3LNMA 2Z26A 1L6GA 2CIPA 1W31A 4UQ9A 2FPTA 5A95A 3DG7A 3KTCA 1H50A 2EPNA 2GK1B 3AUOA 1D3HA 4JIEA 1UWQA 1T96A 1CNVA 3GDRA 2I5GA 4JQAA 1WDWA 2OELA 3UCCA 1WDQA 3G5EA 1M41A 2UWFA 4OUIA 4FHAA 2POZA 1GVOA 2OODA 3HJEA 3W01A 4B5VA 1AH0A 3M5XA 1HW6A 3R13A 3NO5A 4RCXA 4AHPA 1IZKA 3T78A 1VPYA 4QM1A 1UKPA 3W7KA 2G3NA 3ORWA 1Q65A 2RJGA 5E6YA 2PWEA 1AQMA 4JYEA 4KFPA 4AX7A 1OFOA 4M56A 4E2VA 1XISA 3R5EA 1E0VA 4KS0A 2CZEA 3QFWA 1GOXA 4FF5A 3QW4B 3AIWA 1NAL1 5T91A 3VNLA 3KBMA 3ZIZA 1OCNA 2PODA 1Q8AA 3P62A 2J4GA 1E1CB 1WO2A 1G4TA 4EPKA 4PA8A 1GJPA 1NF0A 4G7EB 1YBQA 2XINA 4H04A 1GOKA 2WO5A 3MTWA 1QI2A 2WNWA 2ZRZA 4JN8A 4U5IA 5CJMA 3MUIA 2CZVA 1B1YA 2DZSA 1JZ4A 3A4AA 3JU2A 2Y6ZA 2Y8UA 2EPHA 5HWNA 1QCWA 3CGTA 3RUBL 3WNNA 4RL3A 2VFIA 1ZALA 1SSDA 5C0QA 4XB3A 3W76A 1J11A 2BOFX 3QZEA 4IIGA 4XD4A 4M1RA 3S47A 3NDZA 4ZTXA 3FSUA 1UIOA 2JBMA 2QGYA 4L9YA 3HF3A 1KRCC 1GZGA 3WBAA 3F5LA 5KETA 2Q3OA 4FNTA 3WBYA 2HISA 1SM9A 1JL8A 2G3JA 3GM8A 3W7PA 3WF2A 3UZWA 3OG2A 4EX4A 3HTWA 1B30A 4AZHA 4R34A 5ENLA 3MUCA 3W3OA 4WLCA 2FZ9A 2Z24A 1V6VA 5FSEC 5A6SA 1UIPA 3Q4DA 2GK1A 2R1NA 2WNZA 1NM9A 3MMWA 4F0MA 4LB3A 3TMLA 1J2WA 3FAWA 4XWUA 2OO6A 1GOWA 3G8RA 3O05A 3FY1A 4XD6A 5AFDA 1JPDX 1OFPA 3GS6A 1OIFA 3TJIA 1VFLA 4ACZA 4UMCA 3O9NA 1SW7A 3NAVA 3UZJA 3HB9A 4XZLX 1KM5A 4NL1A 1UASA 1P48A 3MUY1 3VD9A 3WO8A 3REQB 2GJNA 4AC1X 1G69A 3A13A 4ZOAA 1D7FA 4O1FA 4NUWA 3CK5A 3P93A 2J62A 5CQ1A 4ERAA 3VKJA 4GX8A 1VIZA 4FLQA 1XF0A 1V7AA 1EOKA 4XO7A 3S0CA 1LL6A 1X6LA 9CGTA 3D46A 4JHZA 2YB1A 3GW3A 3AXKA 5FF7A 3V5CA 5KZ6A 2G3MA 4RV3A 3TLQA 4KRZA 3ZT6A 4QROA 1NWSA 1XLEA 2VFFA 3BTNA 2OKTA 1K8XA 4QJ1A 2YB4A 4GO8A 2E6DA 2VGBA 3GDMA 1RP9A 3E2RA 1DQWA 4JFTA 1MZRA 4ERGA 1LJYA 2J74A 4DJDD 1ESWA 1HVXA 1RD6A 3F5JA 4I7VA 1R9ZA 1EFZA 5AHFA 5A6AA 3VNIA 3A3WA 2HXTA 3OYXA 1JI1A 3L0GA 1EZWA 1HJXA 3ITGA 3R8GA 2EXOA 1FTXA 1W5QA 2WBGA 5LYRA 3O1NA 2PTWA 1UPPA 4RV8A 1GORA 1IEQA 5FEXA 2EEXA 3G0XA 3SEPA 1ONWA 4MWAE 1GOQA 2ZC8A 3MANA 4XBJA 3WEOA 2ISWA 2E7FA 4NZFA 2O9PA 2VD8A 5H8PA 3W75A 2CBVA 1UZ1A 1H0GA 2YYUA 4KCWA 3KBSA 4X61A 1V0KA 4F0SA 1SJCA 4Z42C 3BLKA 1ISWA 1K7FA 1IEWA 3I3EA 5DANA 3KTXA 3HPXA 1FH8A 2QV4A 5AVNA 3BCFA 1XQKA 3CQ0A 4A3YA 3IAQA 1PIIA 4GZIA 5F7UA 3GIYA 3FGCB 1VS1A 1E43A 3L4XA 3P2VA 4JTEA 4E8DA 2J66A 2DU2A 5F4XA 1E5JA 2Y63A 2WPGA 1TUFA 3PTQA 4ZFMA 4A2SA 3WLSA 4Y9NA 1MI3A 1DXEA 4W89A 2ALDA 1H5VA 4XK2A 3KVKA 4X3ZA 5BW6A 2O4QA 4C7DA 3DFTA 2OOFA 4KWWA 3RLGA 2PZNA 5TQLA 4PE8A 2RUSA 4XZBA 1ZZMA 4DJFA 2QEZA 2GOUA 3M0HA 1A0CA 1RA0A 4QG9A 1WBHA 3S2LA 4CN4A 2CLIA 2P3EA 3MV01 3M1ZA 3FXYA 2NQLA 2TYSA 3LZ3A 3GXTA 4GYFA 2EPOA 3ARVA 5K9DA 1PCWA 2XIOA 4UR9A 2YL5A 5A5WA 4JIRA 5FACA 5LNUA 1YXDA 4ZOEA 5A8GA 4HTYA 1DJXA 4TO8A 4XIAA 1Q6OA 4BY3A 3LLFA 2V5KA 1HVQA 4B5SA 4KKXA 1JDEA 5F2IA 4AZGA 4DYEA 2ZX6A 5HR7A 1UH3A 3BZJA 1WAUA 4F4RA 2GQ8A 1JAKA 1J5SA 3OHIA 4UFLA 2QJHA 4QIUA 5D03A 2BY3A 2O4MA 2V81A 1Q6RA 2WXDM 1J0JA 1R3RA 2DZBA 3MV11 4Q33A 4JTSA 4UBPC 3C5QA 2FPVA 4AB4A 2QV5A 5GJNA 3R0DA 5IOBA 3A21A 4IPLA 1LTDA 5FF4A 3EBVA 2YFNA 4JIHA 3LPOA 4W84A 4MMWA 2X1IA 4AF0B 1QPNA 4CCEA 4DBEA 2D24A 5DBTA 3ABZA 1XYFA 2WCSA 3SBFA 3QV8A 1H7PA 4A6GA 3B9DA 3LSBA 4S23A 2YXXA 4ZO8A 4G1NA 1ZAJA 1YX1A 3N3MA 4UFHA 3BO9A 5K4ZA 3VMPA 4GACA 1C93A 4JTFA 4BK9A 1KRMA 2J8GA 1KFCA 1QPOA 4IX2A 3WD2A 1LCOA 1XXXA 4DUXA 1P0NA 1R5YA 3EWBX 3MCOA 1ZPTA 1UWIA 1W5OA 4D6JA 1CCWB 5HNRA 3CXOA 4WIWA 4K68A 3HFTA 5D9OA 1A5MC 2XZ7A 3E5BA 2E1DA 1XWYA 5C2XA 4FF7A 3QGKC 3APYA 3KOZA 4JQ3A 5HATA 4LS2A 1BRLB 3WZ0E 3GH7A 1ZFJA 4Q7NA 2CLEA 1S3TC 3FCPA 4NRRA 1KTBA 3UR7A 4MNJA 1NDZA 1JDDA 1JCLA 4LANA 1S5MA 1FDZA 4AMAA 6A3HA 3CAQA 5DCEA 4CU8A 3WH7A 1KNWA 1IEVA 4RXGA 3NCOA 3PS7A 1A5BA 3QY6A 4UCGA 1FFRA 4JEJA 3LSCA 1RH9A 3OQEA 3A9BA 3TN6A 1GVFA 4DX3A 3W7LA 1WUEA 4PMDA 1HKKA 1XINA 4M51A 4K37A 4IJRA 4A8IA 3HGRA 4XZHA 3G1DA 4LUSB 1IT0A 1VCVA 4PFMA 5HMEA 1ZAHA 2FHCA 3TXVA 1UBSA 5LSMA 1TUXA 1W1VA 4MNKA 3A64A 1UP2A 4D8ZA 1CGYA 1E6NA 1BWLA 2ICSA 4A05A 1V6WA 4QDMA 1AL7A 3APTA 4QQ3A 2QPXA 1AQHA 3U4AA 5AHMA 4AF0A 4M19A 5HNUA 1E51A 4QQUA 3GHRA 5ABTA 1EBGA 1ZAIA 3CBWA 4FA3A 4OZOA 4B3ZA 3CWHA 1EKOA 3DBNA 3GBEA 3AXMA 1SW3A 3RLHA 1KXTA 5BOEA 5TF0A 3LGEA 4I6VA 2DZTA 5FL0A 3T2QA 4L5ZA 4P7NA 1YKWA 4DF0A 1V6TA 3QQ0A 4XTDA 5D30A 5F2LA 3EMCA 3PJTA 1H3GA 2DUZA 4ENLA 2W27A 5FJOA 3MI3A 2I5IA 3GXMA 1PVNA 4V2XA 1B5TA 3QOMA 2RGMA 1PV8A 4JCLA 4AU0A 4AZ5A 1JYVA 1HGYA 3R11A 3SUSA 3IRDA 3QHMA 4PULA 5A3HA 3NGJA 4ATLA 4NZ3A 1P6WA 3WNKA 5A8PA 2VR2A 4GIEA 4WJXA 3UJFA 4HCDA 3RRXA 1XUZA 1BRLA 1MSSA 1N7KA 3TQKA 3SRKA 1WOAA 1VLWA 1D8WA 3W86A 1ISZA 3KLLA 3KCJA 1FWWA 4C6JA 5FESA 3TQVA 5BYWA 1NWUA 3NQEA 3AHXA 3BAJA 2DJLA 4DWSC 5H91A 5LNWA 3CHVA 1TA3B 3ZJKA 1OYCA 3RAOA 1J0KA 3FFSA 4OWGA 5F4WA 1L8PA 1V03A 4HTBA 3OQ8A 5IXEA 3TU9A 1QPRA 2HS6A 4IQJA 2PDXA 4LUSA 5CSRA 4LAMA 4O13A 2OEJA 3S9ZA 2WC3A 2F61A 1UH4A 2BSLA 1OFQA 1QI3A 2OPJA 3NQAA 2PF0A 5BMWA 3QH2A 2OX4A 2ZRUA 1R9XA 3W28A 2F7FA 1CXEA 4ZE5A 4PMVA 4DELA 1Q13A 3WLTA 3C2OA 3GUWA 1M1BA 1YNYA 4S3GA 3SFWA 4F40A 1J0YA 2GYIA 3WQFA 4W8BA 1QWGA 2XGZA 4YPJA 3LERA 1MQRA 3T7VA 3N11A 4Q8PA 5D2YA 3GU1A 4DAFA 3M0XA 4UC5A 4C6IA 2YBVA 3LMZA 2MANA 1XRSA 2FQIA 5C55A 3B9OA 3FX4A 3ITOA 1CWYA 3W82A 3W6LA 4DJDA 3ARYA 3PWGA 1W9PA 1ZB5A 3VOJA 3WMSA 2Z6JA 3BARA 2H6RA 4PUMA 3I3BA 1QK2A 4D6CA 4UTWC 2CLLA 2OMAA 3ZXWA 2O9TA 3S9IA 1DTNA 1CEOA 1HJQA 3R94A 4J3ZA 1KGUA 7A3HA 1PO9A 2WSPA 3L67A 3KL0A 4UTUA 3TTQA 3V5OA 5CEWA 3DZ1A 1IEXA 2QR6A 5K9CA 4W5ZA 4JFVA 2DZWA 1T6MA 1U2YA 5DMLA 3KL5A 1FKXA 4IQDA 2AKMA 4O12A 4JTRA 3ONCA 3F4WA 1BYBA 1W9VA 1MDLA 3IIXA 1VRXA 1DV7A 4R9XA 4TMBA 3WDRA 2ZDSA 4ML9A 1TA3A 4O1BA 1V79A 3UFYA 1S5VA 1DORA 1DHPA 1FWEC 1UH2A 3QMRA 2A2IA 2EBNA 2VVSA 3CEPA 3U0HA 2AL1A 3BW3A 3OLDA 1UOKA 5D2XA 3TYAA 1CXHA 2ZE3A 2WMKA 3MB9A 1OC5A 5AZ1A 1KM3A 5FEPA 4PMQA 1FXQA 1CT5A 2A0NA 1VYSX 4FSAA 2GQAA 3PZ9A 2WHLA 1QWKA 4P8XA 4MY8A 3GH4A 1H4PA 4M7TA 5B80A 3W1UA 2DIJA 3QKEA 3CLWA 1K7XA 2VX7A 1T41A 1XYCA 2ODOA 3LCWA 2PDCA 4J1OA 3SDOA 4AQLA 2VP8A 2DSZA 2NW0A 3U7BA 1GG1A 4ECLA 1JVNA 5I77A 1VENA 3LHYA 1HKWA 5JQ9A 1PDYA 4M6QA 4PMOA 1SUXA 4HYRA 4Q8QA 5BWAA 3B0VC 1W56A 4TV6A 3DGBA 4QFUA 2INZA 2W9MA 4LS0A 2E4TA 1XYBA 2E40A 2GSHA 6CGTA 3VNZA 5CC7A 5DMNA 3S4TA 3G1SA 3NO3A 2A7NA 3BOXA 3ES8A 4B5NA 4YMZA 3QEZA 2BBFA 4JIQA 5IRPA 3T2OA 1OCJA 1CTNA 4Q8UA 4O50A 1AUSL 2PGRA 3LYEA 3TVAA 4PBFA 2ZTKA 5K7JA 2C18A 4IUOA 1V7YA 1RP8A 1OGBA 4HP5A 3LRKA 3CYVA 1B0IA 4XKMA 5CSSA 3KEHA 1GQIA 5FD0A 5EA9A 4BZYA 4D6DA 2PSNA 4V28A 3C8FA 1GQJA 4HOWA 5H8UA 3IWPA 1XSKA 1RCXB 4UZUA 5MF5A 4BKNA 4S3DA 2ZUTA 2P53A 4MGGA 5I7GA 5E0KA 5D2TA 3RPDA 1CX9A 1AG1O 2A7RA 2PAJA 5FAGA 2Y89A 4OTKA 3CUJA