1C91A

Endo-beta-n-acetylglucosaminidase h, e132d
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDDYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c91A00
1XYFA 1JFXA 2J8FA 1GOWA 2J74A 2WZEA 1GOKA 2O9RA 3L2MA 1W9PA 1F4HA 2CHOA 1CENA 3VDBA 1GPFA 1KCKA 2GJXA 3BC9A 3ZJ7A 4FLOA 1IV8A 4DM1A 3AXHA 2HVMA 4HMDA 3VIOA 1EDTA 4X0NA 1UH3A 1ZBWA 2PBOA 4KMQA 3DYOA 3VD9A 2VQUA 1MW1A 3WNKA 3NSNA 3T0DA 1JFHA 2PI6A 1MQPA 3WQ8A 3QHMA 4B9ZA 4ZFMA 3L4TA 3MKKA 3AHXA 4LX4A 2C0HA 2BY2A 3N11A 3D5HA 1D7FA 4TXEA 3U5YA 1E5NA 3LMYA 1MXGA 4GI9A 1GZJA 5A8NA 3VGBA 5HBFA 1UD6A 3AIQA 1FH7A 1J0KA 1Q6FA 2XVLA 1TUXA 1UUQA 2PWFA 3AHVA 3PZ9A 1E15A 4W89A 3VGHA 3KL0A 4NRRA 4CD6A 1X6NA 2WB5A 5DFAA 1QBBA 3T2QA 5LA2A 1SMDA 2ZXAA 4M56A 2F2HA 2W92A 4GI8A 1V3MA 3L4ZA 4TVDA 1UKOA 5M17A 1WO2A 4U2ZA 7TAAA 1E5JA 2CERA 3IK2A 4J3VA 4JCMA 3NYDA 4CCEA 4JHZA 4E2OA 1G5AA 1UD8A 1KGUA 3ZIZA 4AD3A 1B3YA 2CPUA 3PZIA 5IFPA 5A3HA 1E1EA 3WNMA 5ABEA 1DWHM 2NSXA 4M80A 1AVAA 5CJ5A 2Q8XA 7A3HA 4J3UA 2DSUA 1V0MA 4DM2A 5IHSA 3ARTA 4AIEA 3DC0A 2DIJA 2WANA 3UR8A 1KBBA 4YHGA 5DT7A 2FH6A 2ZE0A 3NDYA 3ZM8A 1DEDA 3FNDA 4Z2JA 1NARA 2X0HA 2ZIDA 1TE1A 2ZX8A 5HXMA 1NP2A 3B8SA 2QPSA 3GBDA 4F8XA 4Z2HA 4JFVA 5M5DA 2X8RA 1E6QM 2QMKA 4WIWA 3PZNA 1CWYA 3KEHA 1W3HA 2WWDA 2FGLA 1H0IA 4HZ7A 2EPKX 4PSRA 4BZYA 2VO5A 3AHTA 2XHYA 4HU0A 4D6CA 2XVNA 1W9BM 3SUSA 2CNCA 3AIRA 1BYAA 3MUY1 5A2AA 4H2CA 1B90A 2GDUA 4GO9A 4D6FA 4PEEA 1TVNA 1QNPA 1ZBCA 4GQQA 3VMOA 4ZE5A 5D8WA 2ZXQA 1PBGA 3PZGA 4MB3A 2G4FA 3SCRA 4OBRA 1JXKA 1J0IA 4HTYA 3ZJ6A 1PEZA 2VT0A 1DP0A 2VZOA 2J7CA 2V3GA 4UOQA 3ARRA 1OGGA 3UETA 2VURA 1JAEA 2IXVA 4BQ5A 1L8NA 4FLRA 1VFFA 2BNJA 1J01A 3BAXA 3WQ5A 3EDEA 1TR1A 3FW6A 4DUXA 3CGTA 3RM8A 2CBJA 2WMFA 3GBEA 5D9OA 3VIKA 3ARYA 4PN2A 3MV01 3NUKA 2CXGA 1UQZA 3B9EA 3WKZA 4CKQA 3SURA 4W86A 1FHDA 3BMVA 2J7FA 1XD1A 3KWXA 1UQYA 1E0XA 1UKSA 4IM4A 1W1TA 4AZCA 2D24A 1HP5A 4MDPA 4RE2A 1DTUA 1WP6A 3WDIA 2J25A 4PMXA 1DWAM 1TG7A 3A3HA 3PZVA 1MXDA 2PBGA 1KFWA 2CETA 3CUHA 2GDVA 4MNMA 3OB8A 4AD5A 1EO7A 2W61A 3CZEA 5BXSA 1CPUA 4PUDA 3CLWA 1KGXA 4FF5A 3N9KA 1H3GA 1TCMA 4TX6A 1K9DA 4W84A 1MW2A 2DH3A 3EDDA 4GO8A 1C8YA 4GPNA 4GZIA 2X09A 3U7BA 4CUCA 2G8ZA 2WSPA 1DWJM 1VBRA 1V3IA 4C7GA 1WE5A 2G3NA 4AISA 2GJXB 3GXDA 3KL5A 1NH6A 3CHDA 4AIUA 3VX1A 2WMGA 4UFJA 3HN3A 1EO5A 2Y8VA 1JZ3A 3MSGA 5FOOA 4UZSA 2GK1B 2J7BA 3BMWA 1E6XM 5IXEA 2EPNA 4PTMA 1W91A 2BVYA 3K46A 5A6BD 4PMVA 1KXQA 4MJ4A 3EMQA 1D2KA 3OA5A 1J11A 3A4AA 3RILA 3AI0A 4UQEA 1J12A 4MDOA 4ATDA 4QAWA 5A6LA 2VRJA 3RMEA 3AZSA 1UD2A 1NOFA 3RDKA 4JFTA 1MYRA 4JKMA 1J0ZA 3WDPP 3RJXA 1ZS2A 4E8DA 1V6YA 5KEZA 1KXHA 1US3A 1EQPA 1UR0A 2HISA 5BXTA 1JD7A 3VDAA 1PX4A 1E4LA 4HPGA 5CSUA 1O6IA 1QPKA 4K68A 1XH2A 3PHAA 4U2YA 3OLGA 1W2PA 3BAWA 2XG9A 3VD3A 3VOCA 3M46A 1PZ2A 1XSJA 1ZBVA 1UOKA 3N15A 1FFRA 2OSYA 4TX8A 1UYQA 1B3XA 4LYRA 4MAZA 5LA1A 1RP9A 1JDCA 2VL4A 4TTGA 3F5JA 2VOTA 3QHNA 3NSXA 1S46A 1BHGA 5TD4A 3VNZA 4LGXA 2GJRA 2DQXA 4D6HA 4CD4A 1UA7A 1V02E 1HKKA 4P7LA 2VX6A 5I24A 1CLVA 3T0BA 1JF5A 4UFKA 3M7SA 3SCNA 3SCOA 1QI5A 3PN8A 3I3BA 3N18A 3UESA 1ZBKA 2VX7A 1H09A 1OWQA 2BFGA 3OBAA 3GH4A 5HPCA 1BAGA 2E9MA 2QF8A 5HNNA 2ZICA 5AC4A 4AXNA 4U5IA 4UQ9A 1UR9A 3OGVA 4HOXA 4UFIA 2FGZA 1JF6A 2G41A 5DEZA 1B3WA 3HMCA 4F79A 1KB3A 1R7AA 1HIZA 1GVIA 3BAYA 2EO7A 1W1YA 2Y5EA 2JE8A 2NW0A 3ZR6A 2VX5A 3NCOA 1E70M 2YLLA 1AMYA 1LG2A 3CHCA 1GONA 4OUEA 2E9BA 2QHAA 2XM1A 4LYQA 4AZHA 5A2BA 3MV11 3VGDA 4QLLA 4WSJA 1RP8A 2EPMX 3WBEA 1HJWA 2V3EA 1TA3A 4LPCA 2DT1A 1CGXA 1J10A 4OOUA 1BQCA 4PTXA 4W8BA 1BVZA 3WDRA 1NWTA 3WD0A 2VMFA 3BGAA 1US2A 4IPLA 2IUZA 1Q6GA 4X9YA 1VAHA 2D20A 1J18A 5D9MA 4D6JA 2O9OA 2ZUNA 1JZ8A 1LWHA 5HOSA 1JI2A 3M6DA 1HJUA 3N1AA 1XRVA 8A3HA 2WMIB 1V3JA 2VZTA 4AD2A 2A3AA 3VIJA 4B3LA 3BCFA 1E72M 2W91A 2X1IA 1BGGA 1M04A 3T2OA 3WNLA 3LPFA 2YA0A 3TP4A 2C8NA 3FY1A 3MMDA 2XTKA 4KRUA 1EHAA 4W8LA 3VMPA 1IZKA 4QLKA 3VM5A 2XFRA 5GQBA 2BVTA 2CBIA 4Q7NA 1EIBA 2Y2WA 5CXPA 2XJ7A 3AJ7A 1HJQA 2Y24A 2WZHA 4IISA 2PWHA 2YL5A 1GW1A 3ZMRA 4JCLA 1CGTA 3AFBA 4J3XA 2E0PA 2CKRA 2XYLA 2J4GA 4NSBA 4KH2A 4IUGA 2ZUMA 1KR0A 1WAWA 3BCDA 5CPTA 1KCLA 1R7OA 2XUCA 2QMJA 4GXPA 4F66A 5E09A 5I0DA 3AICA 2ZUSA 4Z2GA 1EXPA 4LYPA 2QPUA 3FXYA 1H4PA 3CZJA 3LPOA 3EDFA 1QW9A 4JL2A 4M1RA 1VFOA 2J7GA 3GXFA 1UKPA 4R5EA 5A8MA 4P7NA 1VEOA 1QNOA 2GJPA 4UQDA 3AMGA 3WFLA 1H11A 5A69A 2AOSA 1QW8A 4HZ8A 5A8OA 1H49A 1X6LA 2VZVA 3NIYA 1F4AA 1JYVA 5FD0A 1B0IA 1UWSA 3L2LA 3CO4A 1GCYA 4W87A 3WUEA 2XGBA 3MANA 1E6PA 4ZE4A 5A6AA 2EXOA 3EYPA 4W5UA 5E9AA 3WIJA 1HJVA 2JEPA 5BXPA 3WH5A 1J9YA 2DEPA 2DSKA 1GJWA 3WQWA 1CXHA 3JUGA 3TTOA 5I2UA 2Y4SA 3AIBA 1C7TA 3IJ7A 2XPKA 1C93A 1E9LA 2JF6A 2EBNA 1UD4A 1UR2A 2WPGA 1Z32X 4A3YA 3ARWA 5I79A 4PSPA 4P8WA 3ECQA 2UY5A 1IT0A 1CEOA 2G3JA 1CLXA 2E8ZA 4BQ2A 3BSHA 3K4DA 1VIWA 4JZ5A 5ABHA 3BAIA 3MMUA 3L4XA 4D71A 2WHKA 3GYCA 3ZSTA 4HPHA 2VCCA 3QGVA 4HZ6A 1B2YA 2XIBA 4U33A 1QVBA 2BXZA 3AIUA 5FCZA 1I75A 3RIKA 3GH5A 1FP8A 1JI1A 4PCSA 2OYMA 5CZKA 4Z2LA 2D3NA 2J7HA 1J0HA 1P6WA 2XSBA 3CHFA 3SUTA 5AC5A 2JF7A 1UWRA 3L4VA 2ZXDA 1EHNA 2D0GA 5M3WA 2Z1KA 4WKFA 3WY1A 2WBKA 3WMCA 4CGTA 3SUVA 2GUYA 1B9ZA 1V0KA 3AS3A 5BCAA 1RD6A 4D6DA 1MVYA 3ZT5A 1ZJBA 4OOZA 3HJEA 3ZO9A 3ZT6A 1U33A 3B9AA 4RE3A 9CGTA 4UOJA 5GNYA 5I78A 4AYSA 2IXUA 4AW7A 1CNVA 1E6SM 1W3LA 3W0KA 4QDMA 3WFZA 4AZBA 4CU7A 2CKSA 3WD3A 1C92A 1HKIA 1VF8A 5C70A 1J0JA 4S3JA 4AEEA 3AMKA 1R86A 2VTFA 2V5CA 1W9VA 3L4YA 1ISVA 3SCQA 1QNSA 2V5DA 3VIMA 1HX0A 1Q6DA 2JFEX 1H5VA 2PB1A 3GDBA 4PCTA 3VGEA 3DYPA 4E8CA 1BYCA 1AQMA 1XCXA 5I77A 2WBGA 3CUFA 1LJYA 4JKKA 1CXEA 3RM9A 3D3AA 2X0YA 3VM7A 2J47A 4H8VA 5CPQA 5FIPA 4PMYA 3UG3A 3K8LA 1QHOA 1R8LA 3THCA 1CGUA 3VPLA 2OYKA 4CCDA 4JFUA 2E4TA 1YQ2A 4C7FA 1FP9A 3WSUA 1UH2A 4PRWA 3IAQA 2BY1A 4MNJA 5ECUA 3ZSSA 2UY4A 2DSZA 1W32A 3O9NA 4JFWA 4B9YA 4LXFA 3WD1A 1DWIM 2PWDA 4WJXA 1E0VA 3VDHA 2WSKA 1Q6CA 4N0RA 5I3DA 4JKLA 1VBUA 4PTWA 5BRQA 5A6MA 1FH8A 3SCTA 3EBVA 4CN4A 2GFTA 1WCGA 3AXXA 3AOFA 2CHNA 3KE0A 3RM4A 1GOOA 1RPKA 4L4PA 1KWKA 6CGTA 3WMBA 1E3ZA 1KBKA 5E70A 2J77A 3WDQA 1KR1A 1QHZA 2E3ZA 2VCAA 3EMZA 2XWDA 1BYDA 4ATWA 1JL8A 1HKMA 4MADA 4BF7A 1XYZA 3AS1A 4OKDA 4UQCA 5JUVA 3CZGA 2XFYA 1GQLA 1OD8A 5E6YA 3VMNA 3A4XA 4JIEA 4AZCB 4GI6A 1GHSA 1CECA 1BTCA 4PMZA 3WH8A 1BYBA 1CGVA 1RH9A 3OIHA 1G0CA 2EPLX 3N04A 2VNCA 5IHRA 1LF1A 1SFSA 4JFSA 1OM0A 5BXRA 2DGAA 3ARXA 2BS9A 3CTTA 3EDJA 3ZJKA 1N82A 1GHRA 1UR8A 1CTNA 2W66A 2FHBA 3T0AA 4PMDA 4DWSA 4N42A 5AYBA 1UD3A 3AZRA 3L4WA 1E4NA 3UERA 3IJ8A 5LYRA 2FH8A 1ZL1A 1ITXA 1E55A 1K9FA 2Y8KA 3W24A 2XVPA 2O92A 1E4MM 4QLJA 3W29A 3W37A 3A4WA 3RJYA 1EH9A 2VZSA 3MU7A 4UFHA 1MQQA 2WC4A 4J27A 3POHA 2TAAA 1PX8A 1QI2A 3AIVA 3VIGA 3BLKA 3SCUA 4TUFA 3HU7A 2DT2A 5LA0A 5IFTA 1V6WA 2VZUA 4PBGA 5BROA 1FH9A 5E0FA 3L4UA 3WEOA 3VNYA 1LL7A 1PAMA 4J28A 3FHQA 4H8HA 3MS8A 4WKAA 4QFUA 5EMYA 1M7XA 2W4XA 3GNPA 3MSDA 2E40A 2WMHA 3CBWA 1CBGA 1HJXA 4HA4A 2CITA 1MW3A 5CG0A 4FK9A 3AROA 4PMRA 5M03A 1E71M 2UY2A 1ODUA 5C8BB 3NJ3A 1W2VA 4URIA 4CD8A 3O6AA 1E4IA 1BLIA 1QHPA 3J7HA 3VGFA 3VX0A 1C3FA 4JAWA 1LG1A 4OIFA 5BYWA 2BHYA 1JYNA 3FAWA 5DO8A 3CZKA 2X05A 3GNRA 1VRXA 1OGSA 1XC6A 2OWWA 2RGMA 3U57A 4Z2IA 5DT5A 3UG5A 5A95A 2BV9A 1CXIA 4HMEA 4TTUA 4JL1A 4MNLA 2WMIA 4P8UA 2XWEA 2W67A 2ZWZA 3TA9A 2D2OA 4XX6A 3EDKA 1HXJA 1TZ7A 3WELA 1HT6A 4AD4A 3NSMA 2J7DA 3DYMA 1NWUA 4J3TA 2NT1A 6TAAA 1E56A 3ARZA 3OLIA 3VU2A 2ESCA 2G3MA 4H04A 1L0PA 1LWJA 2WHJA 1W9XA 1OINA 2ZX7A 5D9PA 2OSWA 5FL0A 4P7QA 3B9DA 4W85A 3OZOA 3FAXA 3ZQ9A 4B16A 2VX4A 3AISA 4M29A 1LQ0A 3WH6A 3WUBA 2CBVA 5EB8A 5CPSA 2J7EA 2WNWA 3CMGA 3N17A 3SUWA 1YHTA 3WF4A 3PBGA 1AQHA 2A3HA 2NT0A 4NI3A 1SMAA 4AIOA 1K9EA 2WK2A 4XZWA 2BY0A 5I6SA 2DPEA 1XGZA 4UQAA 2DSWA 4P8XA 2YA2A 3GNOA 3VIIA 2WKLA 4DWSC 1NWRA 3SCSA 3WDHA 4CD5A 1OIMA 2DIEA 2CYGA 4UZUA 2D3LA 1C91A 1VEMA 1E0WA 3VD4A 4UTFA 4EANA 4UR9A 1QNRA 4ZXOA 3A47A 1UKQA 5AYIA 1OT1A 3WD4A 4PTVA 4BA0A 1D3CA 4UFMA 1EGZA 4A4AA 1OCQA 2F8QA 1QOXA 2BHUA 3GXMA 1H0GA 4W7VA 3WMSA 4CU8A 2WC3A 4PMUA 1BF2A 1W3JA 3WDJA 8CGTA 3F4VA 5BRPA 1V0LA 2GVYA 3QR3A 1PZ3A 2PF0A 2JEQA 3I3EA 3WNOA 1A3HA 1O7AA 1TVPA 3MUZ1 4J7RA 1GOQA 3TTSA 1OD0A 1BVNP 4ZEPA 1ISYA 2JIWA 3WQ6A 3TTQA 3WENA 3ARVA 3BH4A 3CHEA 4HP5A 4KRTA 2WVSA 2F61A 1B30A 1BSIA 3TTYA 2V3FA 4UQBA 3AMCA 2WLYA 2ZWYA 1ZJAA 4XUYA 1QI3A 2WCGA 1V6VA 1DHKA 2WMKA 1XV8A 3UG4A 3WQ4A 1KGWA 1ISZA 2O9PA 3ZT7A 4DWSB 1ITCA 4DUWA 1GORA 3GM8A 1I1XA 1WZAA 2CESA 1ESWA 2J8GA 4GZJA 5FKYA 3WUFA 1ZB5A 3VD5A 1JDDA 4KGLA 2VVNA 1V3HA 2J78A 1E6RA 1K6AA 1JZ2A 1WDSA 5D8ZA 5CQ1A 2CIPA 4V2XA 1HVQA 3CIVA 2PWEA 3CUGA 1JZ7A 1NOUA 3WF0A 3CZ8A 5DF0A 1MQRA 3K1DA 3WH7A 3AS2A 2EPOA 4H41A 1UR1A 3KL3A 4ACYA 3OLEA 3LPGA 4OBSA 1W9DM 1E43A 1I1WA 3N12A 3DECA 1JZ4A 2GK1A 2DDXA 4M24A 3T2PA 3UEQA 1UWUA 1A47A 2DSVA 1KWGA 2DT3A 4TVCA 1CXFA 1VB9A 4D6GA 5D4YA 2AMGA 2YL8A 4ZXLA 2YKKA 3CUIA 1V6XA 3GZAA 2VRQA 2W5FA 1X1NA 3PZTA 1HL9A 1HF6A 1C7SA 1OGBA 2X2YA 1XH0A 2WZIA 2PWGA 3AMDA 1V02A 4XV0A 2V38A 1G94A 1EOMA 1E1FA 1C90A 3VILA 4AZIA 2VR4A 2Z1SA 1WZKA 1C8QA 1V08A 4CN1A 3GH7A 5GNZA 4IPNB 2D0HA 2D22A 1VJZA 1JZ5A 1VEPA 3I3DA 2CEQA 2OWXA 1DWFM 4P7RA 5CLWA 4AD1A 5HPOA 2ZUUA 1W1PA 3SUUA 4OZOA 4FLQA 3VKKA 1UWQA 1LL6A 1R85A 1JZ6A 2A3CA 1FFQA 1JXJA 4UFLA 5EBAA 3MUIA 4J3WA 3VTRA 1W3KA 4AZ6A 5EFFA 2OSXA 4D1IA 3TOPA 1BPLB 4UNIA 2FHFA 2V3DA 3RCNA 5JIPA 3ALFA 1JGIA 3CH9A 1J0YA 1V03A 4Q22A 1CGWA 1NOWA 3F5LA 4TOQA 3OG2A 1GVYA 1VFMA 4C7DA 1HKJA 5I5RA 4HMCA 3WEMA 3PZUA 2XGIA 3PZOA 4DUVA 1JG9A 1E73M 3WN6A 1XSKA 5CGMA 5C71A 4HOZA 3AYSA 4ATLA 4W88A 2W62A 1GJUA 1H2JA 3W28A 4ZENA 4AD0A 2MANA 1M03A 1V3KA 2RGLA 4R27A 2YIHA 3IANA 4ACZB 1PIFA 6A3HA 1UHVA 1VFUA 3VD7A 3THDA 1ISWA 5A8QA 5I23A 4ML4A 1WDQA 3W82A 3PZQA 2WMJA 4WLCA 1ZU8A 2WHLA 3NDZA 1JYXA 4DWSD 3EMCA 4WF7A 4W5ZA 4GQRA 1LL4A 1OB0A 1G1YA 2D1ZA 3AMLA 5JBEA 4UOZA 5GNXA 4NF7A 1CGYA 4CVUA 1E6ZA 2BY3A 5IDIA 4HA3A 3QHOA 2YL6A 4M8UA 4PMQA 2YDQA 4PUEA 1JIBA 1PPIA 4FMVA 4AWEA 4AMCA 3WNPA 5A2CA 2YA1A 4AZ5A 3DHPA 4AZGA 3RO8A 3BSGA 3VO0A 1E3XA 3APGA 1PIGA 1CDGA 3CZLA 1HJSA 3MO4A 1V6UA 5EFDA 1E6NA 1BGAA 3W81A 2UY3A 2WVVA 4QCEA 3BXWA 3VVGA 3T09A 1MWOA 2OWCA 5GPRA 4NZCA 1FA2A 3ARSA 4HOWA 4EKJA 2YLAA 4KWUA 4D1JA 7CGTA 3IJ9A 4EE9A 5CSYA 4W93A 4AY1A 1HVXA 3WD2A 2YOCA 1W1VA 4W8AA 3SIMA 2VCBA 1JYWA 4QCFA 3BAJA 3ZJ8A 2VRKA 3VGGA 1Y7VA 5F7UA 1GQKA 4E4PA 2FHCA 2WM0A 2XFFA 3PTMA 1WPCA 2J75A 3BLPX 2WVTA 5FL1A 2WAGA 4X0VA 2WWCA 1B3VA 1R87A 4MB5A 4V27A 2DT0A 1H41A 4MJ2A 2VUYA 1W9UA 4CVWA 5ABFA 1EOKA 3WEZA 4XB3A 2YBTA 3FHAA 3K4AA 1G01A 1KQYA 2WVVB 4HA1A 4B15A 4P7OA 2ZX6A 5JBFA 1PX3A 3GTNA 3W27A 2C7FA 3W38A 1UWIA 1UG6A 2ZOXA 4FLSA 4J3SA 4MPKA 4H8UA 3VUPA 3WNNA 1HNYA 2YL9A 3DHUA 4GINA 1WB0A 1H1NA 2WW5A 4AC1X 2YDSA 1NP0A 1GQIA 1EA9C 3O2LA 2CBUA 2EEXA 2VC9A 1NM9A 3CUJA 4PMOA 2ZUTA 3PZMA 3WL1A 4LQ1A 4M81A 1MFVA 4D6EA 1B31A 1JD9A 1VENA 1WDPA 3VIPA 1UR4A 1EDQA 1QNQA 3U7VA 1Q4NX 3VIHA 4AZ7A 3S2CA 1WDRA 4MB4A 4RE4A 4M82A 4W7WA 1U30A 4OJYA 3UCQA 1FHLA 4WSKA 4YPJA 2BHZA 3ARUA 3ZR5A 4D72A 2J79A 2BXYA 1UD5A 1GOMA 4W7UA 4WK9A 3SEPA 4KGJA 3T08A 3W6LA 4P8VA 1TMQA 2XVGA 3ZOAA 1JDAA 2E9LA 1VJSA 4GIAA 2WKGA 5A94A 3WQVA 1BG9A 3AYRA 2VJXA 5A8PA 1LLOA 3W6MA 5A6KA 1BFNA 1OSEA 3UR7A 1QI0A 2WC7A 2G3IA 2ZUVA 2JALA 1CXKA 3PTKA 2PC8A 4MNKA 1U2YA 4YN5A 2YDRA 1Q6EA 1PJ9A 3BAKA 1NWSA 5ABFB 2QLYA 1WZMA 2A3BA 4JHOA 5JBDA 1GQJA 5ABGA 3AHZA 4S3KA 3CMJA 1SYTA 3PTQA 5DMYA 1XSIA 3II1A 1FOBA 1TA3B 2BVDA 2DH2A 4PMNA 2FDMA 3AIWA 1GUVA 1UA3A 4BS0A 4U3AA 1XHGA 4UCFA 3RPMA 5CGTA 1CZ1A 1UH4A 1EQCA 1ECEA 3VDCA 2OLHA 4WKHA 3OZPA 2XM2A 4V28A 2XSAA 2WXDM 1KXTA 4Y7EA 4U5KA 5A6SA 2XVKA 3ARPA 2AAAA 3AS0A 1G9HA 4BQ3A 3OGRA 1CXLA 2E8YA 3AHYA 3SCVA 4MAVA 1QBAA 2ZUWA 5KZ6A 2ZX9A 3WL0A 2WYSA 4EAMA 2YBUA 4CU6A 5CLTA 1JNDA 4EK7A 1M01A 2A3EA 1MFUA 3E1F1 2VVSA 1UZ4A 3N13A 1GOIA 2VI0A 1ODZA 4GZEA 3F5KA 3MMWA 4PYSA 4BQ4A 3K8KA 3SCWA 2VR5A 1WKYA 2J62A 1QI4A 1HL8A 3AIEA 4F9JA 3TONA 4F9DA 5A1AA 5BWFA 4L4OA 1OIFA 2UWFA 3VIFA 3FN9A 2WCSA 5D9NA 3W53A 1K9TA 2ZXBA 3WF1A 5HDRA 1TFVA 2EJ1A 3WBAA 3AZTA 1M53A 1V3LA 4D6IA 3QOMA 3A6OA 1XCWA 2D0FA 1EDGA 2JIEA 1JAKA 1WZLA 1KQZA 1BG4A 4BCEA 1B1YA 3AXIA 1AQ0A 4CN6A 2WCAA 4ACZA 1UZ1A 2VQTA 3ALGA 1HN1A 1C8XA 2WVUA 3WUGA 1CYGA 2CCRA 4HU8A 1XH1A 3G6LA 3WH9A 2WHMA 2GSJA 4YHEA 4CCCA 5JIWA 1IZJA 5E6ZA 3AQUA 1UKTA 4NRSA 5AY7A 1OT2A 4MTVA 1CIUA 5A6BA 2B31A 4QP0A 4CD7A 3W25A 3U5UA 3GXIA 4RL3A 1XD0A 1HP4A 1KXVA 2D23A 4A3HA 1V0NA 1DWGM 4TVUA 3KZSA 4AEFA 1JNEA 3M07A 1ISXA 4U3CA 1UWTA 4Z2KA 3OLDA 1NQ6A 2QV4A 2XIIA 3ARQA 3W26A 4B3KA 1OBAA 2O9TA 3WF2A 4U31A 2ZX5A 3VINA 1SR0A 4GKLA 3OGSA 5E0CA 3W4RA 1WNOA 4H7VA 3CPUA 4MB1A 2OYLA 2W63A 1MW0A 3LPPA 3POCA 3WF3A 5A6JA 3QOKA 2WLZA 1GNXA 2EQDA 3MUAA 1B3ZA 3K8MA 4XZBA 3S6TA 3G6MA 2YJQA 3IAPA 3SCPA 1E40A
chains in the Genus database with same CATH superfamily
4JEQA 1XYFA 1VCFA 4N6FA 3VNIA 2J74A 3N6JA 4NJHA 1W9PA 2OOGA 3RAOA 4Q4QA 3VDBA 1GPFA 1KCKA 2BB0A 1TMLA 3V1PA 4LCSA 1C29A 2DZUA 4HMDA 3OZMA 3BGJA 3AU6A 1RJQA 4OV9A 2VQUA 3W1MA 1JFHA 1T0OA 2BOGX 1FCBA 3EZ4A 2QVHA 2GGGA 4MKVA 3SRFA 2O7QA 2DZSA 1UZDA 3GWQA 5C6MA 1XDMA 3RCMA 3SRDA 1MXGA 4KWSA 1QR7A 4WY0B 2B0MA 4L6HA 1UD6A 3DFSA 5HMFA 4L6OA 2V0TA 2XVLA 4REQB 3N3MA 4IGNA 2ISFA 3E0IA 3W7JA 4GNVA 1E15A 4O1EA 4C6QA 4E2DA 3VGHA 5GJNA 3D6NA 5FEWA 1ZFJA 2WB5A 3H4WA 3NQ6A 3T2QA 3IUDA 2ZXAA 2W92A 3W3OA 4DLFA 3UJSA 4GI8A 2ISWA 1YNQA 4MFEA 3L4ZA 4TVDA 7TAAA 4CEUC 5CPLA 1E5JA 2PDHA 3IK2A 4XZNX 4A35A 4CCEA 3DN5A 1M1BA 5EPDA 4LS0A 1KGUA 3BG9A 3IVUA 4AD3A 2CPUA 4D8LA 1G67A 3VZYA 5IFPA 3WNMA 2VFDA 1DWHM 1WXJA 3D47A 2NSXA 3WLHA 3GFZA 4J3UA 2QULA 4Q8OA 1V0MA 4X2RA 4DM2A 2WKJA 2PDCA 4CQDA 1L6GA 1KBIA 2DJXA 4TV6A 4LNCA 5AYXA 2DIJA 4OHQA 2CLEA 3KFTA 3M0HA 1KBBA 4LS2A 1EP3A 3ZM8A 6XIAA 4EPKA 3QTPA 1SUXA 3D46A 1G6CA 1HUVA 4MUZA 3MJMA 5HXMA 3I65A 5AN7A 4Q4MA 5M5DA 1V6TA 3PZNA 1CWYA 3VA8A 2FGLA 4DO4A 3MZ2A 3M64A 1K7FA 1IGWA 4IPPA 5D02A 3ZLGA 3W2LA 2XVNA 1VHCA 1W9BM 3V5CA 3DFYA 3PBWA 1QK0A 3MUY1 4CQBA 4QR6A 1B90A 2NX9A 4H9XA 1NIUA 4ZE5A 1PBGA 3O7UA 2G4FA 3ATYA 3VFLA 3W72A 4OBRA 1JXKA 1IEXA 1J0IA 2VT0A 1SZGA 2V3GA 4UOQA 2WJDA 4DJDD 3BLEA 3TYAA 2WO5A 1HTIA 1TTIA 3C0QA 4FLRA 2D2HA 2CZFA 1K8ZA 3MBDA 5FAJA 4RPQA 3MSYA 3FW6A 3WQPA 3TDFA 3CGTA 1PDZA 2OZ0A 2E6YA 4G56A 4GVIA 3VIKA 4PN2A 3TZFA 2DORA 5DMNA 4Q8NA 2E5CA 1X7FA 3STEA 3MCNA 4CKQA 2C1GA 3H21A 3IWPA 1UQYA 5CKSA 1HL2A 2GOKA 4DJEC 2D24A 1PZ0A 1L2UA 1DTUA 3UJEA 1O5RA 4JN8A 5EMKA 4DI9A 3DENA 5LNWA 1TG7A 3A3HA 3PZVA 3W07A 1OC7A 3H22A 1PVNA 1EO7A 5AC6A 3CZEA 3ITYA 3N9KA 1H3GA 4FF5A 4TX6A 4W84A 4ZB0A 1C8YA 4GPNA 1BRLA 1W3NA 2E77A 1NY1A 2PDPA 1N55A 2WSPA 4TO8A 2GJXB 3DHDA 4LC6A 3GXDA 1X8FA 3WBWA 4HCLA 1DJHA 3RR1A 2G96A 2J6XA 1RY0A 3MSGA 3BMWA 3F2CA 3K13A 5IXEA 1V8EA 2EPNA 2VDIA 1AG1O 4LUTB 2L5HA 3OA5A 1J11A 3I68A 5C5YA 3BARA 3ZZ1A 2X30A 3WLPA 3RMEA 4QS5A 3E0WA 2CU0A 4PB4A 5JQ9A 1ZHAA 1B4KA 4JFTA 1J0ZA 4DJED 1V6YA 2ZTKA 5KEZA 4DF2A 4IP5A 1S39A 2ZYFA 3Q4DA 1AA1B 4NJGA 3BGGA 1H7XA 4QXIA 4K68A 4LU0A 4GUHA 1JCMP 3NTYA 2XG9A 1XLKA 5I03A 1ZBVA 1LRNA 1UOKA 1T7LA 2OSYA 4BFAA 1UYQA 3UD6A 5DBTA 3CU2A 3MB9A 4ZVJA 3W7OA 1MZHA 4OUIA 1JUEA 2CLOA 3QHNA 4AYGA 5I7GA 2ZZ2A 1JJKA 1S46A 4ERGA 5TD4A 1UJPA 2DQXA 4KQNA 4P7LA 2VX6A 5CZTA 1O66A 3BW4A 1JCLA 4UFKA 3NYZA 4IP4A 4ASTA 1QI5A 3LERA 1JCYA 3I3BA 3HIJA 3NQ8A 3OBAA 3B0VC 3MWAA 1K8CA 2ATMA 3A12A 4NUWA 2ZICA 4BEQA 4U5IA 3S42A 3A13A 2PDQA 4HOXA 3ZVHA 1EEPA 4GY0A 1CCWB 3EOOA 4F79A 1R7AA 1ME9A 4PB3A 2Q02A 2VFEA 3UJRA 3RN6A 3NCOA 3CL8A 1G4SA 4O57A 5FEZA 1AMYA 2C13A 4B5SA 4EACA 2FJUB 2NUXA 4AX6A 4QLLA 4WSJA 4ADSA 3WBEA 2EAWA 1XQKA 1OX5A 1TA3A 2DT1A 1CGXA 4OOUA 3WDRA 3VDGA 3WD0A 4DJFC 4W9TA 1J8VA 4NNAA 4IPLA 4H9MA 4X9YA 1YDNA 4XZ9A 1DJZA 1J18A 1M41A 2RDWA 5HQLA 2V30A 5D9MA 5D2XA 1TYGA 4D6JA 2YCJA 1JZ8A 4WJEA 2J6VA 5EL1A 3EWDA 1JI2A 3LXBA 3WQOA 1XRVA 3KBWA 8A3HA 3GU9A 4EXBA 4AD2A 3VIJA 4B3LA 2QUVA 1BGGA 4GUIA 3T2OA 3BE7A 3QF0A 3TP4A 2XTKA 2REQA 4KRUA 4X9SA 1GKRA 2Z27A 4Y90A 5TIMA 2XFRA 5GQBA 3UGVA 4Q7NA 1Q6OA 2Y2WA 3ZS4A 3UWYA 3NOEA 1HJQA 1NSJA 2PWHA 3RHGA 3M7WA 3AFBA 2E0PA 2CKRA 2PDMA 1O5KA 2ZUMA 1WAWA 3OVGA 5HQMA 2XUCA 3WLNA 5E09A 5HULA 5I0DA 4Z2GA 4S38A 2P10A 1P1MA 4PR4A 3FXYA 5IRPA 1K02A 3CZJA 3LPOA 3EDFA 4JL2A 3RU6A 2HCVA 2YW4A 3ANYA 2X41A 4C6DA 4L64A 1QNOA 4UQDA 1H11A 5A69A 2QKFA 3KTSA 1QW8A 4QG8A 1SGJA 3GAYA 5A8OA 1H49A 1X6LA 3GFXA 4TQTA 2A6LA 1GCYA 4O0ZA 2XGBA 1WBJA 4M6VA 2D73A 4ZTYA 4W5UA 3LY0A 3WIJA 3EPMA 4GX9A 1J9YA 4DXKA 3A24A 2Y4SA 3WJYA 1E9LA 2GOUA 1XC4A 3CHVA 3QV7A 1SZNA 4P8WA 3A5FA 4QAIA 4XD4A 1CEOA 1HO4A 3G3MA 3MI6A 2FKPA 4FX8A 1IEQA 4EAYA 1XS2A 1P4CA 4DZ5A 1VIWA 3G1HA 3BAIA 3LRMA 3MMUA 5B7YA 2Z26A 2OO6A 5FF0A 4J9JA 3I4EA 3TMQA 2XZ7A 2XIBA 2BXZA 2V63A 4AC7C 3RIKA 1W1B1 1TIWA 4FXFA 1DJXA 1FP8A 1G4TA 1S38A 2R1MA 2C3ZA 2WJFA 2OYMA 2J13A 1EYWA 1RQHA 3NQ7A 4GVGA 2A21A 1AJZA 4PBEA 2NUYA 3WLIA 1ML1A 2FPYA 3TLLA 2JF7A 4C5YA 2ZXDA 1EHNA 3UZJA 1X39A 4Q8TA 1UUMA 1XICA 4LEFA 2WBKA 4JTRA 3UGRA 4WR3A 1ZP4A 2XDFA 3GS6A 4XTDA 4HSOA 4E3VA 3TTEA 3CNYA 3LX9A 4S3BA 1AD4A 1RD6A 1MVYA 4JTTA 4IOTA 3ZT5A 3B0XA 4GLEA 1U33A 3B9AA 4RE3A 2C0AA 3JR2A 4ZQPA 3GVGA 1GVSA 5LHEA 5F2LA 5I78A 5HNUA 2IXUA 4AW7A 1TV8A 4PA8A 4HHHA 2HBXA 1M3UA 1KM6A 4GCXA 3R0DA 1J0JA 1OX4B 3G22A 1XLMA 1J5TA 3CUXA 3L4YA 1ISVA 2PPGA 3SCQA 3T6CA 1HX0A 3AYTA 3LN3A 1H5VA 4O17A 5BRBA 4EXAA 1AQMA 3G1DA 1K3UA 2HQAA 3V36A 3R0KA 5G1YA 3D3AA 5KZMA 5FIPA 4IJBA 3K8LA 2OVLA 5AOUA 3VPLA 4CCDA 5HA7A 2C79A 5CGQA 5LHFA 1YQ2A 2I5GA 2CHRA 3L7RA 2RHGA 3LHYA 3EWZA 2UY4A 2DSZA 2E6FA 4QX4A 2QUNA 1VLIA 3O9NA 3TYCA 4ZO6A 4UMBA 1E0VA 4XK2A 2XN2A 3PR2A 3G18A 4PTWA 5BRQA 3CB3A 1Z7AA 2GFTA 3VOHA 2CHNA 7XIMA 1GOOA 1WXZA 1E3ZA 1DBTA 4LY8A 1KR1A 5A6TC 4G8TA 1FWFC 1BYDA 6TIMA 4ATWA 3NZPA 1XYZA 4X22A 3QH2A 3RK8A 3WLLA 3H2MA 4K7YA 4ZCWA 1FBAA 4L9XA 3WH8A 4C1NA 1BYBA 3GFYA 2Z6IA 3OIHA 1G0CA 2PRHA 3U8GA 1F3XA 3TC3A 3W7PA 5M1TA 5AYZA 1QTWA 2QCCA 4JFSA 1O60A 4X2PA 4BI7A 1XBXA 2O4QA 3ZJKA 5HJLA 4DPPA 5T9BG 3T0AA 3PPGA 1N2VA 3M5VA 3HM7A 4Q8VA 3FDGA 4U10A 1S2UA 1K70A 3AZRA 1RY8A 2V9DA 3WBXA 4ZGYA 4NZ3A 3IIOA 4DUOA 5TQLA 5LNVA 2Y8KA 1E4MM 3VC5A 5EU9A 3A4WA 1EGMA 1DJIA 3RJYA 1TJ2A 3RLHA 4H7ZA 3BZJA 1XKJA 3UYCA 2TAAA 1EJXC 4JTKA 1QI2A 3MYPA 3BLKA 5G2WA 3IIVA 1J2BA 4BJHA 2DT2A 5LA0A 3PWGA 3P7YA 1XP3A 3VNKA 1AW5A 5IFTA 4IZGA 1X6UA 1ONXA 2QJIA 5E0FA 3L4UA 4J28A 1TIMA 3Q94A 4H9ZA 3GIQA 3S6DA 4WKAA 4QFUA 3TQ0A 1W1IE 1MUCA 1IIHA 3GNPA 4DZIA 1WAUA 1CBGA 1HJXA 2IW0A 3DESA 1AW1A 2Z24A 3ELFA 5CG0A 2I16A 4FK9A 3TN3A 3PBVA 3AROA 3VCCA 4PMRA 3STGA 1P48A 1EJTC 1E71M 5C8BB 1TPB1 3DIPA 4CD8A 4KCUA 4JAWA 1LG1A 3CASA 5FJJA 2BHYA 3MI2A 2X05A 2X1TA 1XC6A 3LNMA 2OWWA 5F4WA 3W1QA 1F3WA 3S9YA 1JDEA 3C52A 4A3UA 3WK1A 3MP3A 2FZMA 3FSTA 2VENA 4XSMA 5I3FA 2BV9A 4DF1A 2W67A 2ZWZA 1LYXA 3UA3A 1SZRA 4RNJA 4RXFA 5ABTA 3WELA 2J7DA 3DYMA 4J3TA 3GKFA 1MO0A 3ARZA 3KZPA 5DCEA 2V5LA 3PBYA 2WNZA 1L0PA 1IWPA 2WHJA 5D37A 4P7QA 3B9DA 4W85A 3OZOA 3ZQ9A 3E38A 2PWVA 2VX4A 3AISA 3E2SA 1JUKA 3F03K 5EB8A 4C6NA 2J7EA 2WNWA 4O0QA 1YHTA 3WF4A 2IS7A 1AQHA 1SMAA 2NSOA 2Y7DA 3V16A 4Y9OA 4I9MA 2DSWA 3M16A 4MKSA 4QBXA 3E9AA 3SCSA 3AYVA 2DIEA 2CYGA 4UZUA 1E0WA 3OU8A 4UTMA 4ZB5A 3F4CA 3KOWA 4UTFA 4EANA 4NZ1A 3W75A 1Q7ZA 1UKQA 3ZWTA 4PTVA 4GGHA 4YLWA 4UFMA 4A4AA 1OCQA 2F8QA 2V5KA 2WC3A 4XIMA 1XR2A 4AEOA 4I7VA 1E9YB 2H3DA 4YTSA 2Q3OA 4YJ5A 2YXXA 4L4MA 3QPYA 5AVHA 5FAGA 2E1DA 3FYYA 3PNUA 1EP1A 3H70A 2PDKA 4ZEPA 1ISYA 2E68A 2JIWA 2Z1XA 1GW9A 4CLMA 4DHGA 1I0DA 1K7EA 1B30A 3ITTA 1R38A 1BSIA 1ZJIA 3UZZA 1R6WA 2V3FA 4IGMA 3EEGA 2WLYA 3H7VA 2DQWA 2BGSA 2VGFA 3B8DA 4XUYA 2AKZA 1V6VA 4MYXA 1DHKA 2GJLA 4US5A 5C7HA 3R43A 4H9YA 1KGWA 5K9XA 3BG3A 4LAUA 1HKWA 1GORA 4R9OA 3WQDA 3UFYA 3MJYA 1XRFA 3E12A 4JDYA 1WZAA 2CESA 1ESWA 1V4YA 3NGFA 5FKYA 3WUFA 4ADUA 3B06A 3VD5A 1JDDA 4KGLA 5H6HA 2ZZ6A 1EJUC 1P1XA 3DHFA 3C6CA 3HFYA 3E0FA 3ATZA 1JZ2A 3ZWSA 4HN4A 4EP8C 3LCWA 3HPFA 5SWUA 3QN3A 3TR9A 4F2BA 3CZ8A 5DF0A 3T9PA 1XLFA 3GDRA 3TYDA 1WKEA 4H41A 2NQZA 1T8XA 1IXNA 2AL1A 1UR1A 4ACYA 2P1FA 3OLEA 4Q4SA 3PUOA 1TPH1 3A64A 2JKAA 3N2OA 1OABA 1Y5XA 2DDXA 2GK1A 1YKWA 4QISA 4XAPA 4M24A 3KVJA 1A47A 1OZMA 1PHQA 4TVCA 1CXFA 1VB9A 4ZFCA 5D32A 3CUIA 3EWXA 5D33A 3GZAA 2WJEA 2OGYA 1X1NA 1Q5MA 4JNZA 1HF6A 1TPUA 4ALDA 2X2YA 1XH0A 2PWGA 3LCGA 4C1KA 1EOMA 3FYPA 3I7SA 2NQJA 1KRAC 4PUJA 1C8QA 4CN1A 2WM1A 2QYGA 2D22A 4M7SA 1VJZA 1MRQA 1VEPA 1KV5A 1QOPA 2OWXA 3W7LA 4H9UA 4O19A 4QSHA 3OYXA 2BMBA 4FZIA 5TBOA 3WQFA 3LNPA 3SUUA 3ZXWA 5C9XA 4O14A 5H91A 5CBBA 3V0TA 1W3KA 4J3ZA 2Y62A 1OX4A 4D1IA 4C6CA 3BTNA 3IJ6A 1PL9A 3ALFA 2E09A 1EF2A 4O4VA 1V03A 3V1HA 2X1UA 3UWUA 4Q33A 1A0DA 4YTUA 3TMLA 3F5LA 4TOQA 2AGTA 3SZ8A 1RJRA 3WEMA 3PZUA 1ONEA 2ONEA 4PUUA 4US5D 5LGZA 3W28A 1XG4A 4AD0A 3NXFA 1GVQA 1FHVA 3QC0A 2YIHA 1LTDA 1EBGA 3S47A 4LRSA 4ML4A 3LHVA 1LDCA 3A3XA 3N14A 3KBNA 3L5LA 4FOUA 3LM7A 5G2HA 1QOQA 3HO8A 2GQ8A 1PKLA 3NDZA 4A29A 4JNMA 4IMCA 4JQ4A 2GDQA 4WF7A 3QYQA 3HMJG 1PDYA 1BXNA 4N6EA 4FX7A 3AMLA 5JBEA 4UOZA 5GNXA 2BY3A 5IDIA 4HA3A 2VDHA 4PMQA 3RU8X 1MEIA 4AMCA 3RX4A 3GQYA 4JTDA 1LOQA 1KFLA 3WLTA 3RCYA 1VFTA 4AZ5A 3TH6A 3DHPA 3GR8A 4AZGA 3T0CA 4V15A 4LY4A 2ZVRA 2VEGA 1PIGA 1CDGA 1HJSA 3MO4A 3W7RA 5EFDA 5AFDA 1BGAA 3BXWA 5FF4A 3VVGA 4HOWA 4EKJA 2YLAA 3R8RA 1JPMA 3IACA 1Z69A 3IJ9A 2HE8A 4L65A 4EE9A 5IM51 1W1VA 3WLKX 4W8AA 4ZO7A 4HN8A 2PLJA 4PGLA 3S4TA 3ZJ8A 1JCXA 1I2RA 5F7UA 5CEWA 1SO3A 3KOZA 2J75A 3BLPX 3JS3A 4NXSA 4GK8A 3RLGA 2WAGA 4X0VA 3QMRA 4Q32A 1TMHA 5K9CA 4V27A 4JOMA 2ABAA 2VGBA 1H41A 5HWJA 2I56A 2VGIA 4MWAA 3HOJA 4CVWA 1AH0A 1I6NA 2YBTA 1SJAA 3UF9A 3EX6A 4HA1A 1TR9A 4B15A 1LORA 1TUFA 2FVLA 4Q8WA 1PX3A 5K3VA 1JCJA 2FZ9A 5AC7A 4DX3A 3RFAA 4XAFA 1DIOA 4GH1A 3VUPA 4GD0A 4NJJA 1F6YA 4GINA 2WW5A 1VIZA 3NQDA 4O11A 1GQIA 2PGEA 4B5VA 2O7SA 3CB8A 2CBUA 4JTHA 2ZDRA 1G4EA 2INEA 5DY2A 1SW0A 3FVDA 4I8DA 2YW3A 4HU4A 3ID7A 3WL1A 4ZB2A 3HJZA 3CPGA 1VYPX 2V67A 3R25A 4I5XA 1B31A 4K39A 1UR4A 3ITXA 1KRBC 3UPWA 3VIHA 4AZ7A 2QCDA 1S5TA 4M82A 1U30A 2PCEA 4QE1A 3KP1A 2VEPA 3EWBX 4W7UA 3PAOA 6ENLA 1XI3A 1S1RA 4P8VA 1TMQA 2XVGA 3ZOAA 3W7IA 3WK0A 2E9LA 4CNUA 4GIAA 3KDNA 1T96A 4PCPA 4DO5A 4KF1A 1FXPA 1BG9A 1SM9A 1CI1A 4S3EA 3MVIA 5A8PA 3C2YA 3W6MA 5A6KA 1BFNA 1DE5A 3B3DA 1W3TA 1OSEA 9XIMA 2HE5A 4GHRA 4MNKA 1EEXA 4YN5A 3NPUA 3FJNA 3B8IA 4GRSA 1LQ2A 1R46A 2Y70A 1Q85A 2NQHA 5JBDA 1BWKA 5ABGA 3AHZA 3QPZA 5DMYA 2BBFA 3M0IA 3KW3A 4FS9A 3TEVA 3DX5A 1TA3B 4PMNA 3O07A 4JTIA 4NNCA 4I90A 4UCFA 3RPMA 3W1TA 3UCDA 2R1LA 1EP2A 1ECEA 5AZ1A 2CFFA 3D3FA 4DF0A 2XM2A 4DQWA 4V28A 1KXTA 4HQVA 3WQEA 1YDVA 1A3XA 3ARPA 4MIMA 3I6EA 4NNBA 3MSRA 4BQ3A 4XD6A 2E8YA 3SCVA 1Q8JA 2I5IA 2ZX9A 3E3HA 4ONVA 4CU6A 3TZNA 3QTGA 1JNDA 3OOQA 4RZ6A 2QCLA 4L1XA 2A3EA 3LSCA 4LFYA 3YPIA 5AHEA 4HD5A 1FHUA 1M7JA 2VI0A 2F38A 1UASA 1AODA 1LRTA 4FOKA 1WKDA 4KCVA 4LOCA 1X97A 4JBRA 1MEWA 2Y89A 1DL3A 3HFTA 2Q6ZA 4B90A 4F9DA 5A1AA 4L4OA 3VIFA 3M0JA 1KLZA 2VFGA 3W53A 3CTLA 1K9TA 4FA3A 2ZXBA 3WF1A 2Y7FA 1TFVA 1W5NA 1RHCA 3H2FA 4D6IA 5FF2A 4ZMGA 2QNEA 1R3QA 1EDGA 1KQZA 2WSQA 1VBHA 3PPHA 1V7YA 1UZ1A 4ACZA 2VQTA 2NXHA 4QEEA 1UWAA 5GVJA 3WLQA 2NQ9A 3DI0A 2WVUA 1OVDA 1TV7A 2PDGA 3N4EA 4NRSA 1EX1A 1CIUA 2P76A 4K36A 4QP0A 4M6PA 3W25A 4JPGA 5M2FX 4RL3A 1K8YA 4K7VA 1PZ1A 3THQA 4YTTA 4AEFA 1FQ0A 1QWKA 3A22A 3LU2A 1SW7A 4Z2KA 2XIIA 8TIMA 4PEKA 2QQ6A 1PB0A 3CPRA 4IXHA 3LCXA 3XINA 2QCGA 4AWUA 1AMKA 4U31A 1SR0A 3HPSA 4AVOA 4PCFA 3OGSA 3W4RA 5EMUA 3O0FA 1P0BA 1XYMA 1XLCA 3LI0A 3S1WA 1A5AA 4MB1A 4RJEA 2OYLA 2W63A 1MW0A 3WF3A 2PODA 5A6JA 4PUKA 1B3ZA 3G6MA 3CV1A 2H6RA 3MY9A 4YMZA 2F9RA 3BG5A 3NO3A 4A22A 3O0KA 4PODA 4E8GA 5D2TA 5DY3A 1OK6A 4PULA 2O9RA 3FKRA 3L2MA 1LUCA 3F2BA 2Z28A 3LCHA 3KDOA 2ACSA 1OADA 2PZNA 1UH3A 2BVWA 2VGGA 4FOJA 4KMQA 3DYOA 3VD9A 2BXVA 2PI6A 1MQPA 3QHMA 4B9ZA 3M0MA 3L4TA 3ITVA 5F4XA 3PFRA 4LX4A 1F61A 1T99A 2BY2A 3K5XA 1D7FA 3HPZA 3LMYA 4WUIA 5A8NA 2P0OA 5K2ZA 3B0UX 4FXSA 1Q6FA 2VC6A 4LJ3A 4PE8A 2ZKMX 1QPQA 3KL0A 4CD6A 1A5BA 2QF7A 2PF8A 5LA2A 2ZDSA 3UVIA 2F2HA 4LUIA 2X7WA 3QV8A 3Q45A 1UKOA 5M17A 3QV6A 4FR1A 3OHIA 3WLJA 4JHZA 1A5UA 1MMFA 2PDIA 1UD8A 2NUWA 2PD5A 3P67A 4NAEA 3IGXA 4G6CA 3VYLA 2CLKA 1J5SA 1LP6A 5KETA 4M80A 2W0UA 4L7ZA 3H23A 5CJ5A 4QDWA 1W8GA 2R24A 1FWIC 2DSUA 5IHSA 3ARTA 4AIEA 2IKIA 2PP3A 3H4GA 4I6KA 1VKFA 4CQ8A 2BTMA 2KZHA 4XAGA 5DT7A 3WQGA 3IJIA 3BOXA 1EBHA 1DEDA 3FNDA 1NARA 4KETA 2X0HA 2ZX8A 1AK5A 1LCOA 1H51A 1A5NC 2QPSA 5HATA 1NAL1 1C9WA 3AUJA 5HR6A 1E6QM 3KEHA 4MSSA 1W3HA 2GVEA 4XUGA 1H0IA 3ABRA 3L0GA 3B8TA 2EPKX 4PSRA 4BZYA 3NL2A 4EIVA 1EWEA 4A21A 1E1CA 3CAWA 1AL8A 3UNDA 3OJGA 1BYAA 3NAVA 4O54A 3EAUA 3N6HA 4D6FA 4LVGA 1QNPA 1ZBCA 4CNNA 4GQQA 1UZHA 3TKFA 3VMOA 2ZXQA 3TN6A 2VOMA 4MB3A 3BV4A 4Q8QA 3SCRA 3EGJA 3UZXA 1OGGA 1G7UA 1K6WA 2PEVA 3HGRA 1NF0A 2PTWA 1L8NA 3LBCA 3SQMA 3ABQA 1VFFA 2BNJA 5F1UA 1A4MA 1SJCA 5XIMA 1MSSA 3HPXA 3RRXA 3WQ5A 1REQB 4DUXA 2HXUA 2A1YA 2Y1HA 4IMAA 4MWAE 2R82A 3GBEA 5HNRA 3T42A 3T05A 3ME3A 3PJTA 3WKZA 3SURA 4W86A 1BWLA 3WO8A 6REQB 1FHDA 2J7FA 3KWXA 1E0XA 1UKSA 2G4JA 3URNA 1DV7A 3KCJA 1Y65A 3WDIA 4FXRA 1GG0A 4FP1A 3A21A 3Q2DA 3DGRA 3H12A 3V5FA 3MW7A 2AMXA 3U6WA 1DWAM 4KEUA 1MXDA 2PBGA 2YX0A 2DZBA 3GVVA 4MNMA 4HCHA 4AD5A 4Q7BA 5BXSA 5C54A 2OG9A 1TCMA 3L0NA 4AH7A 2X09A 4XVDA 3EWWA 1V3IA 4BF9A 2G3NA 2Z7KA 3KL5A 1NH6A 3UBPC 3EB3A 5MF5A 4UFJA 1LUCB 4IHCA 5DRCA 1ZSXA 5XINA 3GR7A 2HTMA 1EO5A 2ZC8A 4RV3A 3S5OA 1VLWA 1OCJA 3WQCA 1A0CA 3KOFA 4PTMA 4JTJA 1W91A 2BVYA 5A6BD 2TMDA 4YCOA 4PMVA 3C0JA 3LS9A 1KXQA 4MJ4A 1D2KA 3TE9A 4L9YA 2J88A 1O5XA 5C7VA 4UQEA 3ORWA 1R9ZA 4ATDA 4GYKA 1UD2A 3RDKA 4Q8MA 1LBMA 4JTEA 4JHMA 1MYRA 4JKMA 2DUXA 3LEPA 1REQA 1ZS2A 4JDBA 4ROQA 4XISA 5G4HC 4PL1A 2VR2A 1KXHA 4GOAA 1X1ZA 1TWDA 1EJSC 1VFSA 1US3A 1VGAA 1EQPA 2HISA 1JD7A 4H1ZA 2PMQA 3KHDA 1IGSA 5I3KA 1IE7C 3ZVIA 2CLFA 3IS4A 5C2XA 4WVXA 4WOQA 4JQ3A 2GQ9A 5KITA 4F0RA 5H8UA 5L6UA 3ZLFA 3LCIA 2QS8A 2C6QA 3KVLA 3M46A 2A0NA 4L6DA 1FFRA 1FY6A 3TJLA 1YEYA 4MAZA 3GU2A 1RP9A 4FNQA 1JDCA 2VL4A 3VAVA 1GVFA 1W8SA 2PGWA 1ZUAX 5KTLA 2XFWA 1BHGA 3OG3A 2GJRA 1UA7A 3H53A 1QRQA 4GNJA 5I24A 1CLVA 1JF5A 3NQMA 1P0EA 3SCNA 1ZALA 5AECA 4HVXA 1TRDA 1ZBKA 2VX7A 1H09A 3GH4A 3P61A 3LQGA 2F84A 1PKMA 3EWUA 1DXFA 4AXNA 4NJIA 3JZEA 3H7RA 4UQ9A 4GBDA 1UR9A 2VELA 1IIGA 2G41A 1OCBA 5DEZA 3HMCA 3MHUA 3P60A 3WX7A 1XIBA 2O56A 2JE8A 2Y8UA 1G69A 1E70M 2YLLA 1LG2A 4J2PA 3UWEA 3N2XA 1JVNA 3MCMA 2QHAA 4LYQA 5A2BA 3VI2A 3MV11 3VGDA 1VRDA 3JRKA 1RP8A 1NF7A 4MPQA 3NURA 4XAZA 2EG8A 1BVWA 4PTXA 3LLDA 3GVQA 3R1ZA 2GLKA 3TJXA 3BGAA 4EPBC 3H24A 3S6OA 1V79A 3MWCA 4BK9A 2IUZA 3TXVA 3REQA 2D20A 4C91A 1JCNA 2NVDA 4IMFA 4YNGA 4KCTA 2ZUNA 2B81A 3EPNA 3E5PA 4FI4A 1GJPA 3TYEA 3S3GA 3M6DA 4K8HA 4QNEA 2WMIB 1V3JA 2OKTA 2VZTA 4CEXC 1FWJC 3WNLA 1YBQB 3H2OA 3NGJA 1NFBA 3GAKA 2XSXA 1JPDX 4QQUA 2NLIA 4PC8A 4RNIA 3GVWA 2BDQA 3GHTA 3T0TA 2CBIA 3WLMA 1EIBA 5CXPA 2D69A 3GDTA 2DW6A 2OEJA 3TW9A 2NWRA 2YL5A 4O53A 3GR4A 4JCLA 1CGTA 4J3XA 2XYLA 2AQWA 4IJRA 3V5OA 2QJNA 1TCDA 3IIXA 1KR0A 2E25A 2I7GA 4HK6A 3DERA 3S2JA 3M0LA 1EXPA 4LYPA 1I2PA 4ZOAA 3UR5A 4M1RA 5FJUA 3O8AA 2J7GA 3GXFA 4P7NA 3DH7A 3INPA 1XISA 4TIMA 2AOSA 4CNPA 3G1FA 2HS6A 1RLDA 2OJPA 3IK4A 2VZVA 1P5BA 2QAPA 1F4AA 2C15A 2ZQ0A 1TWIA 5DXYA 3MANA 4QGCA 4MOZA 1E6PA 2FVMA 2EXOA 3TYUA 3NR0A 3TIMA 3B03A 4DO6A 2DEPA 2DSKA 2ACRA 3WQWA 2QVNA 5F2GA 5I2UA 1JCTA 1C7TA 3IJ7A 2EBNA 1J6OA 1WKFA 5DANA 1R2RA 2WPGA 1Z32X 5I79A 4PSPA 3OEXA 4ZTXA 3QKZA 2UV8G 1IT0A 3R13A 4PTDA 4PL2A 2O55A 2OPJA 1DIEA 2E8ZA 2EKCA 3GC4A 4HYVA 1U1JA 3K4DA 5ABHA 1ZAIA 4RPPA 3L4XA 5JVLA 1OYCA 2X0SA 4UTLA 4D71A 2A79A 4KEMA 3QRHA 1XIMA 2HSAA 3QGVA 2ICSA 3WJXA 1B2YA 5J8LA 3P81A 4BF5A 4UTIA 3S5YA 3LD5A 3LM3A 4INFA 2QDDA 2X40A 3UVAA 2XSBA 3CHFA 1UB3A 3SUTA 5AC5A 2WQDA 4PFMA 3L4VA 3UNTA 1TPVA 1F5ZA 3B8VA 2Z1KA 1DJQA 4WKFA 3S2MA 3WY1A 5I02A 1TZZA 2QEZA 3H8AA 3LI1A 4LF1A 2GUYA 4ERAA 2ALDA 4WDTA 2YZ5A 3UU0A 1N8IA 3AS3A 5BCAA 4GFIA 4M5PA 3HJEA 2D2JA 1YBQA 4UOJA 4O8RA 2XIJA 5GJPA 3LMZA 1E6SM 2IPWA 1W3LA 5HWMA 4UTKA 6PTDA 1VF8A 1HKIA 1VPYA 5C70A 1KKOA 4S3JA 3SB0A 1IWBA 3APYA 3R6IA 1I9CB 3W74A 3HV9A 3WBYA 3LHZA 4JIRA 3VIMA 2JFEX 2PTDA 4H19A 5CZJA 1U83A 3GDBA 3DYPA 3BLFA 2FFIA 3P62A 5AKQA 5I77A 1WX0A 1LJYA 1C9DA 3QGKC 3RM9A 4RDWA 3QR1A 1TREA 4ZOEA 3GRIA 3FSUA 4H8VA 4PMYA 3UG3A 1HO1A 2X1SA 4Y9PA 1QHOA 3NZQA 3THCA 1CGUA 1AUSL 3NQBA 4H4IA 5HUPA 3TJIA 4NAFB 1FP9A 3WSUA 3GNDA 4PRWA 3IAQA 1TQJA 4OVXA 5ECUA 4IX2A 1W32A 1FWEC 4GQGA 1GTHA 4LXFA 5F2IA 3WD1A 1DWIM 2PWDA 4WD0A 3VDHA 2WSKA 3UT0A 5LNRA 3SCTA 3EBVA 1DKWA 2JGQA 2YYUA 4CN4A 2YXOA 3B9OA 2H9AB 3A23A 1RK5A 1WCGA 4HJFA 4C6KA 2CZEA 1A50A 2NX3A 3RM4A 1KWKA 4AU0A 6CGTA 1ZRQA 5E70A 3GSMA 2ATSA 3WDQA 2OLAA 4XTIA 5HUOA 1FWNA 2E3ZA 1TJRA 3W1XA 1HKMA 4GNKB 4MADA 4RX0A 3T8QA 4BF7A 3AS1A 3WLOA 3SN1A 4OKDA 4UQCA 5LNSA 2DP3A 3CZGA 3SM0A 3MYOA 1GQLA 1OD8A 2QJGA 3MKVA 3VMNA 4DLMA 3CWHA 4AZCB 4GI6A 3MPGA 1BKSA 1LT7A 2F6UA 1F8IA 1W17A 2ASHA 4GG9A 3OVRA 5DXXA 4IUOA 2E5DA 2ZZ4A 3FJLA 3RGTA 4MJMA 3N04A 1XFCA 1UP2A 4WX2A 4G7EA 1JPIA 1LF1A 1SFSA 1SQ7A 1FUYA 2DGAA 2ZRVA 3BICA 1ZAJA 2BS9A 3EDJA 3SO7A 4G7FA 1N82A 4MZ1A 1GHRA 1UR8A 2W66A 2VFIA 2FHBA 3L0KA 3FV9A 5AYBA 2P8CA 1E4NA 3UERA 2ACQA 3IJ8A 3FX4A 1WUFA 2Q3RA 5DBUA 4CQCA 1WQ5A 3BDKA 2A7PA 5J04A 3PPFA 3S8HA 3HG3A 1LLZA 1KBJA 4LEQA 4IF2A 4O4WA 3V7PA 2Y0FA 1L6YA 4AFYA 2WC4A 1S5VA 2PTZA 2Q8ZA 4JD4A 5LSMA 5REQB 4DO7A 3T78A 3VKDA 3OA3A 2E67A 2OXNA 5BROA 3NFUA 3A9BA 4IQEA 3WEOA 3TU9A 1TPWA 3MS8A 4RZBA 2W4XA 1B3OA 3M9YA 4Y9MA 3RG6A 3UYIA 2CLIA 2J9XA 4HA4A 4LB4A 2OODA 3LK6A 3V75A 1MNZA 2DZXA 5M03A 4WZHA 4YYCA 3HGJA 1E4IA 4LT9A 1Z8AA 3VOFA 1C3FA 3GE7A 5CPOA 4OIFA 5FEXA 3SRHA 5DO8A 3CZKA 3R89A 3GNRA 1OGSA 3JZUA 3W86A 3ONBA 3NA8A 2H90A 1ONWA 1WA3A 1Z42A 4AWSA 5DT5A 4M7TA 4XG1A 3UG5A 5A95A 3PB2A 3SGGA 2RJGA 1XPGA 1PV8A 1EUAA 5JH2A 4MNLA 1TSIA 4RV8A 4P2VA 3HB9A 1HXJA 1FDJA 1HT6A 4AD4A 4Z1YA 4OE7A 1HFBA 1FWTA 1OINA 5D9PA 4IG2A 5FL0A 5C9UA 4B16A 1M7OA 2EJAA 4Z42C 5BZAA 1XX1A 4M6UA 3CMGA 3SUWA 2V81A 3PBGA 2QUTA 2I17A 3CM4A 4NG3A 4AIOA 1DJNA 3KCOA 3BURA 2WK2A 4JIQA 4IIFA 5I6SA 1XGZA 4UQAA 4P8XA 2YA2A 1NWRA 1WDWA 1OIMA 4FR6A 2D3LA 1OEPA 2PDNA 3EOLA 3V18A 2P0IA 3VD4A 4LTSA 1ADSA 4IICA 4OWGA 3A47A 1K1DA 2RDXA 2H3BA 4DZHA 2BZNA 1RLCL 4E6MA 1QOXA 4JTSA 4GQ0A 2BHUA 3GXMA 1H0GA 1ZNNA 4CU8A 1BF2A 3ABXA 4HU3A 4G1NA 8CGTA 3F4VA 1VC4A 4XKYA 2VEFA 4R85A 5PTDA 1DIKA 3GW0A 3S83A 1H62A 1XFBA 5CC6A 2R1KA 3S9IA 2GSEA 3WNOA 1A3HA 4F0KA 2TRSA 1MI3A 2CWNA 1TVPA 3MUZ1 2HK1A 3TTSA 1OD0A 1BVNP 3BQ6A 3NZ1A 2W3ZA 4GACA 4LNYA 7ENLA 3VC6A 1BD0A 3SADA 1U1UA 4HPJA 3AUOA 4KRTA 2WVSA 1YW1A 4ORMA 4YTRA 3L12A 3TTYA 4FPSA 3JVAA 1UMYA 3W76A 3P0WA 2G5WA 1QI3A 4L9ZA 1LRQA 3LTPA 3GG1A 3W02A 1QT1A 3DG7A 3EKLA 4LS1A 3UG4A 4TR9A 1TQXA 3WQ4A 1ISZA 2ZE3A 3GM8A 1S3HA 4J1OA 1AL7A 3R94A 1RCXB 2J8GA 2FMNA 4GZJA 3LHUA 4U4MA 3UXIA 4HNCA 1V3HA 1E6RA 3IV8A 2CIPA 1CB7B 3DFNA 4V2XA 1HVQA 3CUGA 1JZ7A 1Y8BA 5I00A 4MMWA 2CXEA 3K1DA 3W9ZA 3WH7A 3AS2A 1RCQA 2EPOA 3KL3A 1POJA 2YZRA 3LPGA 3VE9A 3FIGA 3B8UA 2Y88A 1JZ4A 4UR7A 4EWND 4GXMA 2PP1A 3C56A 3S1VA 3UEQA 4FIRA 3W88A 4DELA 4K8EA 1KWGA 2PFHA 2PP0A 3CL6A 4MJZA 1V6XA 3DFTA 2HJPA 3NQEA 4HPNA 4KERA 3LQLA 3SSJA 2VRQA 2PWUA 3BJSA 3PZTA 3R5EA 1C7SA 2WZIA 3U0HA 3I6TA 1V02A 4XV0A 3O6CA 1VFHA 1C90A 3IGUA 3QZAA 5D30A 4AZIA 2VR4A 1QPNA 2R9RA 3LG3A 5I3HA 1XYAA 2A6NA 4GI4A 1KCXA 3KTXA 4PMJA 4LUSA 2OKOA 2YCLB 3SQLA 1J4EA 1DWFM 5CLWA 4KW2A 2OQLA 3QW3A 1F3TA 1B57A 3ZLHA 3DU0A 3LLXA 5FESA 4OZOA 3G1SA 3LHTA 4FLQA 1BXBA 3EWCA 1UWQA 2POZA 2A3CA 2A5HA 2RDTA 1FFQA 2QV5A 3MCOA 4UFLA 5EBAA 3MUIA 4J3WA 4D2JA 4E4FA 2DW7A 3TOPA 1BPLB 3RCNA 2V3DA 5JIPA 1Q8AA 1JGIA 1J0YA 4MGGA 3BW3A 4NQ1A 3WMLA 4C7DA 3UY7A 3MDWA 1HKJA 3G8RA 4QJ1A 1Z6KA 1S2AA 2XGIA 2C19A 3BQ5A 3WN6A 5AB3A 5BNKA 5C71A 1H60A 1YE4A 4LCQA 4W88A 2W62A 1H2JA 1BSLA 2DJLA 3QBUA 1V3KA 4Z17A 4I5UA 4R27A 3UP8A 4F0HA 4UTTC 4A3RA 4ACZB 3LBOA 3VUSA 1VD6A 1K7XA 2DY3A 4UC5A 2B7QA 1WDQA 5CSSA 3PANA 3EOEA 4AQLA 2WMJA 1K8XA 3UXAA 4NIRA 2WHLA 3CMFA 4DWSD 4GC4A 1A80A 1OB0A 2YGYA 3S1UA 5G4EA 3SY1A 2UZ9A 1XLDA 1WV2A 1TRIA 4NF7A 4CVUA 2YDAA 1E6ZA 2YL6A 4RCXA 4PUEA 1PXGA 1JIBA 4FMVA 1JQXA 4AWEA 3WNPA 2C1HA 3KS5A 4TV5A 5A2CA 2ZZ7A 1TPEA 3PWAA 1FWGC 1TV5A 4KIEA 4KIRA 3P5ZA 3S1XA 3SY5A 4N7QA 2WSYA 3W7NA 3VKAA 3ZFHA 2I5QA 1E6NA 1XLJA 2XN1A 2WVVA 4QCEA 3BCJA 5FJRA 1N8WA 4NZCA 3W7EA 2DZVA 7CGTA 1XQLA 3C8FA 5CSYA 1HVXA 4X60A 3TCSA 3W01A 1FWAC 1WOBA 3BAJA 2C71A 4N02A 7REQB 3VGGA 4RDZA 2XFFA 3E0VA 3PTMA 4FNTA 1WPCA 2WVTA 2WWCA 1B3VA 2YFOA 4B5NA 2DT0A 5AVNA 3HBLA 3EB4A 3HQNA 4MJ2A 4GE8A 1W5OA 2NLYA 1DJGA 3P3BA 3WEZA 4XB3A 4K3ZA 3EA3A 3K4AA 1F7BA 1YXDA 2YPIA 1G01A 4WGXA 1KQYA 2BGQA 3KRUA 4P7OA 2ZX6A 5JBFA 3GTNA 3W27A 2C7FA 1A3WA 4Z1DA 3IGSA 5FF3A 1UWIA 1V93A 4PUWA 3CV2A 4J3SA 4MPKA 4US6A 2PTYA 1TV4A 4GUJA 3CAQA 4N9DA 3DHUA 4Y9AA 1H1NA 4AC1X 1RSCA 2YDSA 1NP0A 4HTBA 4YWSA 3O2LA 4H00A 4DXXA 3CUJA 1XLBA 5EA9A 5BMWA 2W9MA 3PZMA 4LQ1A 3IIPA 1JD9A 3DFOA 4X61A 1VENA 1WDPA 1QNQA 2IPGA 5MKGB 4MWAC 3ABZA 3TC6A 3NXLA 3S2CA 3W83A 4OJYA 3UCQA 1FHLA 3ARUA 1VS1A 3ZR5A 3OYZA 4UNKA 1OFQA 1S5MA 1E9ZB 4RW3A 1X96A 4ORIA 1EL3A 3SEPA 1DXIA 3TSDA 3DFQA 2OQHA 1SSGA 3W6LA 4ZQNA 3WJSA 1JEZA 4FHAA 1U5JA 1OFOA 2WKGA 3TNBA 3OQEA 3AYRA 1GEHA 1VPQA 4QJ4B 2VJXA 1AD1A 5CG7A 3BLLA 5AHLA 4GKTA 2VM8A 1RVKA 3UR7A 1QI0A 1EB3A 2WC7A 2Z6JA 2ZUVA 1CXKA 1U2YA 3T4CA 3PG9A 2YDRA 4WEVX 2QLYA 1PCWA 3IGHX 3QQ0A 2WJZA 4HGXA 1SYTA 1GK8A 4DJFA 1JR1A 3GO2A 1UC5A 1FOBA 2FYMA 1XG3A 2BVDA 2V5JA 4AHQA 3KOXA 2FDMA 4A05A 3AIWA 1GUVA 1UA3A 1TPC1 4GJ1A 3FYOA 4BS0A 1XHGA 5CGTA 3N3TA 1UH4A 3QEZA 2B7NA 3JU2A 3GTIA 2Z4GA 3DKJA 3VDCA 4L1GA 2XSAA 2WXDM 3W2KA 4ZZ9A 4OFCA 3EOUA 1OK4A 4UBPC 5D2WA 4GUGA 3OGRA 4UNLA 1QBAA 2ZUWA 5KZ6A 2OU4A 3WL0A 2YBUA 5CLTA 3KUMA 4EK7A 4PRTA 4IXXA 2GPTA 3M47A 5E1QA 5FACA 4GYPA 3R79A 1MFUA 2GJNA 3WLSA 2P3ZA 3ZVHB 5T9CE 2W27A 1GOIA 4KRZA 3MMWA 3W84A 5LXEA 1WKYA 1QI4A 4F9JA 3TONA 1OIFA 2ZZ5A 3FN9A 1TE6A 1PUDA 1Q6QA 1OF6A 4IQLA 2EJ1A 5LIKX 3GG7A 3WBAA 2EF9A 1M53A 1ADDA 4QG9A 2JIEA 2F6XA 4V1XA 1IEVA 4HYWA 1AQ0A 4WRHA 4GIRA 1J96A 3W7MA 5U4NA 3QM3A 1HN1A 1C8XA 3WUGA 4L1WA 4ES4A 2OQYA 5KSWA 3LV5A 5DELA 1J2WA 3WH9A 2XU2A 3N73A 2GZXA 4GVHA 1RVGA 4I7WA 5CC7A 1UKTA 1RD5A 4KPLA 3IARA 3U5UA 4LUYA 2PSNA 4K6AA 1XD0A 1HP4A 2V82A 1V0NA 1DWGM 3KZSA 5DN1A 3PJXA 1JNEA 3M07A 4LAOA 4U3CA 3DKLA 1UPMB 3G8EA 1NQ6A 1XXXA 4ML9A 1W37A 3EKGA 3PUDA 5HJXA 1OBAA 2O9TA 3MP5A 1F9CA 4JTUA 2PLMA 1YMYA 4HSNA 4XBKA 3TR2A 4LWWA 2VFHA 3L66A 4D8ZA 3POCA 3LPPA 4LUTA 4ZOCA 3M43A 4HJWA 3LZ5A 2WLZA 4M6QA 3ISIX 1GNXA 2EQDA 3B0YA 4XZBA 3S6TA 1ADOA 3B40A 3IAPA 1A49A 4AF0A 2CLPA 3WCZA 1SU5A 1JFXA 3O06A 3UR2A 1GOWA 1R2SA 1DHPA 1LZOA 1GOKA 3M0YA 1F4HA 1IT7A 4KFNA 1P43A 2KX9A 1JDFA 2IPJA 3O1NA 1GYLA 5FSDC 2GJXA 5MKGA 4XQ6A 1FTXA 4FLOA 4DM1A 3AXHA 3PBUA 4DBEA 5HWNA 1Q7MA 1EDTA 3PP7A 3VOIA 5AZ0A 3NSNA 4B4FA 3TJ4A 3WQ8A 1IEIA 3G0SA 1IXQA 3MKKA 3RYSA 4JY9A 3AHXA 4WCJA 5AHIA 4FAMA 2FDSA 4JTAA 2C0HA 3N11A 3D5HA 2NXIA 4GXWA 4TXEA 1VR6A 3U5YA 5E0KA 1PTGA 1HW6A 4GI9A 2PDLA 3W1PA 1FH7A 1SZFA 1RA0A 1J0KA 3T8LA 3QLLA 3SN0A 2ZRWA 4BHYA 1UUQA 2PWFA 3AHVA 5I3IA 1KV8A 3V3WA 1NDWA 1JULA 1E9IA 3FJ4A 4MZ8A 3QMTA 5L9FA 4N4QA 4RXGA 5DFAA 1QBBA 4PTNA 2A85A 1SMDA 4RE0A 1PKNA 2BOEX 3KS6A 4Q8UA 4I9JA 1TJ0A 1V3MA 3K30A 1WO2A 2GGEA 1PWMA 2OO0A 4JCMA 4GWEA 4EVZA 5IBXA 4E2OA 1G5AA 4O28A 1B3YA 1KFJA 3C61A 3GKAA 1DVJA 3I4KA 5A3HA 5ABEA 1GYNA 4PBFA 1AVAA 1A5LC 2Q8XA 4Z1CA 4NASA 1P0KA 4MLJA 1XJBA 3FOKA 1AJ2A 3UR8A 2VD9A 4M19A 4YHGA 3AWOA 2FH6A 2OELA 2ZE0A 4OBTA 1Z44A 3LCFA 4IWWA 4IT1A 4Z2JA 4R7OA 3QJAA 2DVUA 1TE1A 1SO5A 4C6OA 1YADA 1NP2A 4Z2HA 4UUIA 4JFVA 2X8RA 1D8CA 2QJMA 4QHRA 2QMKA 3G2GA 4B5UA 2WWDA 3PWIA 1DYSA 4S3CA 4ZBCA 2XHYA 3C3UA 1ZENA 3G77A 1PIIA 4LVBA 1KTBA 4H8NA 5G5IA 4JIPA 2CNCA 3TUUA 5A2AA 2FPTA 2GDUA 1GT8A 1TVNA 3UWVA 1YTDA 1UUOA 5D8WA 4CNTA 4A8RA 3B05A 4FALA 5C2CA 3WFAA 3TX9A 2A3LA 3N4AA 4Y8FA 2RAGA 4HTYA 2VZOA 4GH3A 3D0CA 3ARRA 3H6OA 4JX4A 1EKOA 4XD5A 1S3TC 4DYJA 2E6DA 3W1AA 4BQ5A 3H2NA 4FX6M 3PM6A 4E2BA 3BAXA 4H6RA 3NL6A 1O95A 2Y5JA 2CBJA 3ARYA 3I10A 4NKCA 2CXGA 5LIXX 4Z1AA 4O1FA 2V8ZA 3NG3A 3BMVA 3R58A 1XD1A 2X2GA 3CV6A 4F0SA 1W1TA 4Q8PA 2YB4A 1HP5A 4MDPA 4RE2A 1WP6A 1OFAA 1JRCA 1DORA 5H1WA 4IFKA 3BLOA 4JGDA 4WY0A 4CNSA 3HZ3A 4FNSA 3HPAA 4ZOBA 2QJHA 2PGFA 3NVDA 1EYEA 3SFKA 2QCMA 2W61A 3T44A 3OTRA 5AC8A 2AQOA 3U2EA 3W1RA 4PUDA 3WZ0E 3CLWA 3OBEA 2OLSA 1K9DA 1MW2A 1QUMA 3GXNA 4QSFA 4F0MA 4GZIA 3U7BA 1BRLB 2G8ZA 4B5WA 3FA5A 1WE5A 1NTHA 3C5QA 1NDYA 4AIUA 4UIOA 3VX1A 3C0SA 2XH4A 1ONRA 1OZQA 2PDBA 5CBJA 1YDOA 2Y8VA 1EC7A 3A9IA 4HMNA 3GHUA 2GGHA 3MVTA 1V7AA 4YYFA 3FEMA 3TA6A 3DAQA 5D38A 2PC4A 3KP0A 1RA5A 4S23A 1EUNA 3A4AA 3NQ2A 3AI0A 4RW5A 3UPMA 1WBHA 3CYVA 1QK2A 4AIBA 4LB3A 1TTPA 2VRJA 4IFOA 1UBPC 1NOFA 2H8ZA 2W79A 4D8AA 3RJXA 4E8DA 3FXGA 2O4MA 4F2TA 2YCIX 3W85A 2BASA 2QAFA 1TPFA 3ITGA 3VDAA 3V4BA 3U9IA 1O6IA 3W7CA 5IOBA 3S1GA 1XH2A 3ABOA 3PHAA 4JQAA 2YR1A 4U2YA 3G1AA 1W2PA 3OLGA 3BAWA 3ANUA 3TAOA 3IJDA 1K03A 2VP8A 4O15A 4TX8A 1QPRA 3QQ1A 3E49A 1B3XA 4LYRA 3CH0A 4DAIA 1OFPA 3FDKA 5FJIA 4TTGA 3UZ5A 2YFNA 2VOTA 2G97A 2P3EA 4AY8A 3KHJA 3EB2A 3VNZA 4DXVA 3IRSA 1V02E 3PBMA 1HKKA 3QGAC 4J35A 8RUCA 3GUWA 3T0BA 1RBOB 2YB1A 3M7SA 3PG8A 3JW7A 3SCOA 2Z00A 3PN8A 1TX2A 2CLMA 3N18A 1T40A 2VEKA 1OWQA 2BFGA 3SQSA 5HPCA 2E9MA 3PPCA 1GVOA 4I5RA 5AC4A 4HSHA 1O4UA 3OGVA 2QDHA 4UFIA 4O52A 3L9CA 2FGZA 1JF6A 1B3WA 1HIZA 1GVIA 3BAYA 2HVNA 2NVCA 3ZR6A 3USBA 3P93A 3VCRA 4DB7A 4F0LA 1FDYA 2FJKA 1ZAHA 2Z2AA 1A5MC 2C16A 4OUEA 3C2OA 5LGXA 4HA0A 3K1GA 4C1LA 1KM5A 2WNQA 1XLGA 3MUXA 5F1VA 3NZGA 2BOFX 2V3EA 3CXOA 3ONCA 1J10A 1BQCA 4QNWA 1MNSA 4BI5A 1NWTA 3N2TA 4JR5A 3N29A 2VMFA 1CLKA 3KBJA 1US2A 1LLWA 3L2IA 1J6PA 3M5ZA 3Q67A 3W2NA 3EX1A 4HKPA 4DBUA 1XIEA 2RUSA 2DZPA 1DTNA 1DXEA 2VUNA 3GIPA 4AVNA 4Q7IA 5T26A 1HJUA 3B4YA 1SW3A 4CNOA 1L6SA 3BCFA 1M04A 2FVKA 2OZ8A 2ZRZA 2G50A 1IZCA 4WXZA 3LPFA 2YA0A 4AMAA 5B7ZA 3FY1A 3MMDA 3CQJA 1IQ8A 1FWBC 2OZ3A 3VMPA 2FTYA 4B5TA 1IZKA 4QLKA 3VM5A 2BVTA 2X16A 4NY2A 3GNXA 2XJ7A 3AJ7A 3EXSA 2HEJA 2V2HA 3AXKA 3W7DA 3M0VA 5LIUX 1GW1A 2Z2BA 3ZMRA 4JX5A 4M3PA 2J4GA 4NSBA 4KH2A 3G1RA 2I14A 4GYJA 2R8WA 3USZA 2GGIA 3P5YA 5CPTA 3K2GA 1R7OA 4GXPA 2HPMA 1QDSA 2PURA 2E6AA 3OPSA 2ZUSA 3DCPA 4R88A 1PSCA 3GTFA 1QW9A 3SJ3A 1VFOA 4BEUA 4YS1A 1UKPA 2IQ0A 4R5EA 1VEOA 2GJPA 3M1ZA 3M0ZA 5C9WA 4QM1A 2NQLA 2BSLA 1P0NA 4HPXA 4HNUA 3NIYA 3QQWA 1JYVA 5FD0A 1B0IA 1UWSA 2HWGA 3CO4A 4RDVA 4W87A 1UPPA 4NZ4A 5BMXA 4PB5A 4F2UA 4ZE4A 5A6AA 4PRRA 1SJBA 1HJVA 2JEPA 5BXPA 4RR4A 2ZC1A 2FGBA 1GJWA 4ZQOA 3JUGA 1MXSA 2OZTA 4HZMA 5D2VA 1W3IA 2WZMA 3QY7A 3RXZA 4O1BA 2PDUA 5C0QA 2WV8A 7ODCA 3QMSA 2UY5A 2OFJA 2ZRUA 3FEQA 4GQBA 3KX6A 2G3JA 4GJJA 1QXLA 4BQ2A 3BSHA 3TYBA 3TN4A 4HB7A 5KZEA 1DE6A 3W2UA 1WYIA 1NU5A 4IIGA 5K9DA 2FZNA 3GYCA 4HPHA 1R5YA 3H55A 3LGGA 5CC5A 1XLLA 1RCOB 2CC0A 4HZ6A 4O0KA 4IMDA 4LAMA 1W5QA 1OG6A 1JRBA 4U33A 4XBJA 1QVBA 1DQXA 3LCLA 3W2MA 5FCZA 5J5DA 1GVEA 4RLIA 3QKEA 4PCSA 3QW4B 3TYZA 5CZKA 4Z2LA 1EC8A 1Q13A 3UJFA 4TX9A 3AAMA 4JNYA 2HROA 3OVQA 3M44A 5DLCA 2D0GA 5M3WA 4DBDA 2YCEA 1XINA 2QJJA 1U1HA 4R7WA 4XIAA 1V0KA 4XD3A 2REQB 4KBXA 4D6DA 4YVPA 4OOZA 1TV2A 2ADAA 3UG8A 4LVAA 3XISA 2BWGA 3P8JA 3ZO9A 3B9NA 3ZT6A 4M0XA 1LWIA 5GNYA 1HGWA 1MEHA 3E0LA 3NL5A 4AYSA 2I57A 4A8NA 5E93A 4QDMA 3STFA 4KFPA 4CU7A 3BO9A 2CKSA 3KXQA 3WD3A 1C92A 4AEEA 2G0WA 3CS2A 3AWNA 1W9VA 1CB2A 1EPVA 3SW6A 1QNSA 1Q6DA 2WOQA 1FCUA 3KVKA 1YPIA 1R30A 4ADTA 2WNNA 2PB1A 3VGEA 4E8CA 1XCXA 3ABSA 3RPDA 2WBGA 3CUFA 3MDUA 4JKKA 1PYFA 2QUUA 2X0YA 4XAYA 1YIXA 2J47A 5CPQA 2PU1A 2Z2UA 1Z41A 1R8LA 1YE6A 4JFUA 2E4TA 1E0TA 4HNOA 3RRAA 1ZTVA 2BY1A 4KKXA 3EOSA 3ZSSA 1KBLA 3WLRA 2GQAA 1W1ZA 4B9YA 3H2EA 2E5BA 4WJXA 1Q6CA 4N0RA 1YDYA 5I3DA 4KT2A 4RNHA 3LGDA 1R3TA 3BMXA 2NXGA 2G37A 3PUEA 5D09A 3F4WA 3AC0A 3AOFA 3ICJA 3PNZA 1X98A 2Q71A 4L4PA 1YRRA 4Z0JA 3WMBA 4UTTA 3NEHA 2FZDA 3EMZA 2XWDA 1JL8A 1OC6A 2PDFA 2YCKX 3EA1A 4IFKB 1EC9A 4MKNA 1EZWA 1YYAA 2XFYA 1HGYA 3AXMA 1H7WA 1N8FA 2VEIA 4EF8A 2XH2A 4GFSA 1KFBA 1KM1A 1F6PA 1O5QA 4TU1A 1GHSA 3CQHA 4DJFD 1CECA 4NX5A 1BTCA 4PMZA 2V2DA 3NWRA 1M68A 1CGVA 1RH9A 1UBSA 3OW1A 1KKRA 5ECVA 5HANA 5IHRA 3NL3A 3FLUA 1GKQA 4F40A 2XH7A 3GHSA 3GB6A 3CTTA 4NYYA 3TV8A 4PMDA 4DWSA 4JS3A 2BG5A 4N42A 2DIKA 3N4FA 3L4WA 3LSBA 2DVXA 5LNUA 1GTEA 1ZL1A 3DBPA 1ITXA 4JTFA 2OGJA 4ZQCA 1K9FA 4LRTA 2O92A 4QLJA 3W29A 3W37A 5I3GA 5LXXA 4K8GA 4KS0A 3MU7A 4J27A 3DFPA 3POHA 2NZLA 5D04C 3H26A 3PAJA 4TUFA 5D03A 3HU7A 1SPQA