1C91A

Endo-beta-n-acetylglucosaminidase h, e132d
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDDYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c91A00
4XZWA 2JE8A 5I24A 1DWFM 2EQDA 4CD5A 1JGIA 2GFTA 4KMQA 3WQ5A 1BG4A 1RH9A 3SURA 3N13A 3T09A 3OB8A 1U2YA 1UHVA 1XC6A 1ESWA 3RMEA 1CXIA 1GOIA 5JBDA 2G3IA 1V3IA 3ARTA 4J28A 3AJ7A 4TVCA 1GOOA 4OUEA 5A6BD 1E71M 3EDJA 1H5VA 2E4TA 2ZICA 2EPNA 5AYBA 2BHZA 3UEQA 1SYTA 1HJUA 2UY2A 2X05A 1M03A 3RDKA 3EYPA 3BAWA 1IV8A 3WUGA 1V0NA 4D1JA 1AVAA 3VX1A 1MWOA 1E56A 4XX6A 3CZLA 4MNJA 4MNMA 1O7AA 1RP8A 2QMJA 4Z2GA 4MTVA 2W62A 2UY4A 3FAXA 3RM4A 3TTYA 2FH6A 2DT0A 4MAVA 4LXFA 4ML4A 1PPIA 3WH9A 2WCAA 2VTFA 4KRTA 3AIRA 2PBGA 4PSRA 2C0HA 2WMIB 3T2OA 5A69A 1B0IA 3WDIA 2WW5A 4AD1A 1XSKA 1V0LA 4ZE5A 1ISWA 3N17A 1AMYA 3VM7A 1YHTA 1KXTA 4JKLA 4AW7A 1RD6A 3NSNA 1EDQA 3PZGA 4P7LA 1FH8A 1V03A 5CGMA 3VKKA 3I3DA 1ZBKA 4PTVA 2X2YA 5D9OA 3PZMA 4D6CA 5TD4A 3VGBA 5JUVA 2V3FA 3ZSTA 3W6LA 1DWIM 1EHAA 2J7EA 1BPLB 1QI2A 4CD4A 2GUYA 3DECA 2D23A 2WHLA 2YA1A 2ZXAA 5A2BA 2J74A 1UD2A 1XGZA 4FMVA 3SCQA 2UWFA 5EB8A 1VRXA 3SCWA 1GHRA 3ARUA 3ARQA 4PMXA 1UWIA 3AIUA 6TAAA 3KL0A 4OZOA 1VJZA 1VENA 2XJ7A 5ABFA 4RL3A 2G3MA 3VIOA 1PEZA 1E73M 4FK9A 1E72M 4HZ8A 1EOMA 2MANA 3WQVA 2FGZA 3W38A 4B9YA 4WSKA 4M8UA 1ZL1A 3AICA 4QLLA 4URIA 4V27A 3N12A 2CBVA 3LPFA 2JF6A 2OLHA 4PMZA 2VOTA 4FLOA 7TAAA 4D6JA 3K46A 1WO2A 2EPOA 3NIYA 1W1VA 2WVUA 3OGRA 4AWEA 1JAEA 3SCNA 2FH8A 4QLKA 3AMKA 3VDBA 1NWTA 1GOQA 1XSIA 5A2AA 3UR7A 5I3DA 4AZ7A 3QGVA 4QCFA 2J7HA 1J12A 1HJWA 1LG1A 4DUWA 5ABEA 3AS0A 5A6BA 1QNSA 4P8VA 2ZXBA 1B2YA 2XIIA 2XVKA 1XYFA 3PZIA 5CG0A 1ZS2A 1EOKA 2W92A 4J3VA 4MB3A 1KCKA 3WMCA 4Z2IA 3KEHA 2X0YA 3K8KA 8CGTA 4FF5A 1M53A 3II1A 4UCFA 1DTUA 1E0XA 3GXIA 5CXPA 3QOMA 1P6WA 5HPOA 5D9NA 4M80A 6A3HA 3L2LA 2X09A 1W3LA 9CGTA 3W4RA 1B30A 3SCVA 3VDAA 1GUVA 3A3HA 1GQIA 1OWQA 5A8OA 4AIEA 2WKGA 3SUUA 3WH6A 3KWXA 2J7DA 4CGTA 4TVDA 1B3ZA 3GNRA 3VD4A 2A3EA 1CXHA 1J0JA 2XSBA 3UG3A 3AS1A 1UOKA 2XVNA 4P8UA 3VM5A 3L4WA 5E70A 2DSVA 1J11A 1QBAA 1NARA 2VZSA 1JXKA 4BA0A 4AD0A 4MNLA 1JL8A 3SCRA 2VRKA 2J7CA 4V28A 1JZ6A 4IUGA 2WLZA 1JDDA 5I23A 2C8NA 1FFRA 1JNEA 1ISZA 1LWHA 3BSHA 1SR0A 2BV9A 3W26A 5AC5A 3F5JA 3WY1A 1V02E 5FKYA 2ZIDA 1GOKA 2WNWA 4FLRA 1QNOA 4NI3A 1BQCA 2C7FA 2Y8KA 3SCPA 1KGWA 1J0HA 3W53A 4AC1X 3VIGA 1R7AA 2WMHA 2VQTA 1UG6A 2VC9A 2E8ZA 2CPUA 2O9TA 3GTNA 2HVMA 2XFRA 3AXIA 1WE5A 4UQBA 3AMDA 3GH7A 4DWSC 1VFMA 4CVWA 1TVPA 4OBRA 3ARPA 5D9PA 1ODZA 1V3HA 2FDMA 3VIKA 1HIZA 1M01A 1TA3B 1LJYA 2ZUTA 1UR2A 1QHPA 4M24A 4W84A 3AISA 1IZJA 2VRQA 2WPGA 1JZ4A 4GI6A 4YHEA 4F8XA 1CWYA 3UESA 3VMPA 1WAWA 1E5NA 4Q7NA 2CHOA 3AIEA 3GXFA 3G6LA 2CYGA 4XUYA 3WUBA 3HMCA 1NWSA 1UWUA 3WF3A 3N9KA 2OSWA 3UETA 1VIWA 4A4AA 1JDCA 1GCYA 1E40A 1UD8A 3KZSA 4H8HA 4JAWA 1HJQA 3T0DA 1H41A 3AQUA 3FNDA 2E9MA 5FL1A 1QW8A 3MUZ1 3N18A 3AXHA 3D3AA 3VIMA 3CBWA 1UKSA 2O9PA 2VRJA 2XFFA 2GDUA 4MJ2A 2UY5A 4LQ1A 2YL8A 1W2PA 5AY7A 1QNQA 5HPCA 3RILA 5E09A 3GXMA 1MXDA 3K8LA 4IPNB 1W9VA 3KL3A 1ISXA 1I1WA 3OLEA 5CPTA 2W5FA 2J47A 3CLWA 5DF0A 5I78A 4TTGA 4J7RA 4H04A 2A3BA 2WMJA 1GQKA 2XVGA 2PB1A 1E3XA 4MDOA 4R27A 1B3YA 3PZQA 4EANA 1HXJA 2PF0A 5IFPA 5M03A 5EBAA 1EQPA 1HJVA 4HU0A 1GOWA 4BQ4A 3U7VA 5CQ1A 5A8MA 2DT3A 1V0MA 1PZ2A 1GORA 4UZUA 1AQ0A 1D7FA 3JUGA 3AS2A 3THDA 2PWEA 2WZEA 2F2HA 4X9YA 3K1DA 4HPGA 3CO4A 4JKMA 3F4VA 5AYIA 1WZLA 5D8ZA 2OSYA 4AZCA 2B31A 3SUWA 4W87A 3ZT6A 1KGXA 2VNCA 4W88A 4WJXA 2BHUA 4MPKA 1NM9A 1UD4A 2VX7A 3ZJ6A 1WNOA 4L4PA 3AYRA 2OWCA 3N04A 1BG9A 2ZUSA 1H0IA 4MNKA 4PTXA 1QOXA 2J75A 3U57A 4CD8A 1VFUA 4JIEA 1B9ZA 1BSIA 1KQYA 3NDYA 4TUFA 2GVYA 1JZ2A 3CZ8A 1PX3A 1QNRA 2WB5A 4WSJA 5LA2A 4P7RA 4MAZA 1UUQA 5BXPA 2ZUNA 3T08A 1XH1A 3AHZA 3DYOA 1KB3A 2Y8VA 3CUIA 3CPUA 2E0PA 3FHAA 3ZJKA 3MMDA 4UQEA 3NJ3A 4QCEA 2XM1A 3AXXA 3T2PA 5LYRA 1PAMA 1CGTA 3W37A 4W7UA 4HA4A 4PRWA 3AIBA 1E55A 2BFGA 4H2CA 4AEEA 3IAQA 3QR3A 4S3KA 3VIJA 2ZX5A 1QHOA 4D6IA 2WC7A 5E0CA 2A3HA 1EIBA 4Q22A 1RPKA 4UFMA 1MQPA 1SFSA 2WLYA 3K4AA 4PMVA 4UOJA 4X0NA 2PI6A 1JFHA 3UERA 3DYMA 4UOQA 1WDPA 2E3ZA 2VZOA 1MW1A 3EDDA 1CTNA 1E4MM 5DFAA 2QLYA 3W28A 1FA2A 4UQCA 4J3XA 2Q8XA 4DWSD 2ZWYA 2J7GA 3B9AA 3VGHA 3WNNA 1UQZA 4JHZA 1B3VA 4GI9A 5DEZA 2Z1KA 2J79A 3QHMA 4P7QA 1C91A 1DHKA 1TMQA 1BVNP 2V3GA 3VIIA 4GINA 1G1YA 5A6AA 1QBBA 1MQRA 2W67A 3A6OA 1GVIA 3DYPA 2RGMA 4IISA 1K9FA 4CCDA 4W5ZA 2GK1A 2ZX9A 4JKKA 3WDJA 2Y4SA 1OGGA 1Y7VA 1GOMA 4BQ2A 1VEMA 2BXYA 1FP8A 5I79A 2BVDA 2XYLA 3THCA 1E4IA 3VMNA 1GNXA 1LL6A 2BVTA 4CU7A 1WP6A 2ZX8A 4C7FA 2CIPA 4QP0A 4W85A 4LYPA 2VX4A 4PEEA 4HMEA 1GZJA 3WNOA 4TX8A 2DEPA 4GO9A 4NZCA 3VOCA 3DHUA 2EO7A 4AYSA 4WK9A 1JG9A 4JL1A 3D5HA 1BYAA 3HU7A 1JZ5A 3CMGA 2CKRA 4HP5A 1HNYA 1HKIA 4BF7A 4RE4A 2QF8A 2DH3A 3ZJ7A 3CMJA 1CGUA 1E43A 2CBIA 4OOUA 3TOPA 4F79A 3BXWA 2JEPA 1V3JA 4P8XA 1QHZA 3A4AA 1BGAA 3CZJA 4AD5A 1B3XA 5A8NA 1J0IA 3ZT5A 1BYCA 1OGSA 4ZXOA 3OZPA 5E6YA 4CVUA 1E3ZA 3CZKA 5CPQA 1QPKA 2WK2A 1GJUA 2W4XA 1CEOA 2ZXDA 2XPKA 3BGAA 3WF4A 1W3JA 2DPEA 4GPNA 4WKAA 2WWCA 1J9YA 2XFYA 4NRRA 1KXQA 4P7OA 1W1PA 1ECEA 2G3NA 1DEDA 2GJPA 3WD4A 1WDQA 3L2MA 4H8UA 1JAKA 2J4GA 2VI0A 3F5KA 4MB5A 1PIFA 4AD3A 2Z1SA 3ZJ8A 1CENA 3OZOA 2BY0A 3NDZA 1JF6A 5BRQA 3WBAA 3U5YA 1AQHA 3BLPX 1LF1A 3BSGA 1OCQA 1PIGA 1QI0A 3N11A 1C92A 1KR1A 1XCXA 1B1YA 2JFEX 2EPMX 5HXMA 3OA5A 1V0KA 2YA0A 2Y24A 3MV11 1HT6A 4PMOA 1VAHA 5GNYA 4AD2A 1W2VA 4DUVA 2V5CA 1BVZA 4TTUA 4PCSA 3SUSA 5BXSA 4BS0A 1B31A 3WBEA 3OGSA 4NF7A 3BC9A 3B9EA 5GPRA 1U33A 2PWFA 4W7WA 2CKSA 1A3HA 3ALFA 2WVSA 5JIPA 2A3AA 1XH0A 6CGTA 4FLQA 3WSUA 3O6AA 2CEQA 1N82A 5CJ5A 3G6MA 2ZE0A 3W81A 3CUFA 4MJ4A 2YKKA 1C8QA 1NWRA 1L8NA 3AZTA 5HOSA 2BY2A 4QLJA 2O92A 4PMYA 1YQ2A 4W5UA 2WC3A 1FP9A 3QHNA 1HVQA 3L4XA 3T2QA 4ATLA 1WZKA 3WFLA 5A6LA 1C90A 4PN2A 1J10A 2VUYA 5DO8A 3MV01 3U7BA 4M82A 1R86A 1X6NA 2FGLA 3VUPA 1WDSA 3WF2A 2EXOA 3RM9A 5CPSA 3TONA 1CNVA 5FIPA 1CGVA 1FH7A 1LG2A 4GO8A 4W93A 3ZT7A 4D6DA 1JZ8A 3TA9A 1HJXA 4PMQA 1KWGA 2X1IA 2BNJA 3A4XA 4JL2A 2D3LA 4E2OA 4DM1A 4OIFA 4QDMA 3UG4A 1QNPA 2FHCA 3L4VA 1ITCA 2WSPA 3N1AA 2VZTA 1KR0A 1Q6GA 4CN6A 1HKJA 4W86A 1OIMA 1F4AA 1NOFA 1W1TA 5BROA 1EH9A 2RGLA 2F61A 4JFWA 2YOCA 4GI8A 1NH6A 3WD1A 4XZBA 1BTCA 1KBBA 1NOWA 2GDVA 3PZTA 3EMCA 4PTMA 1CGWA 4GZIA 5E0FA 3K8MA 3VU2A 4K68A 4JCMA 3N15A 5I77A 3MUY1 3WD3A 1E4LA 5D4YA 1VBUA 4B9ZA 3AMLA 4AEFA 2V3EA 5JIWA 3VMOA 3VD7A 5ABFB 3NSXA 3OG2A 5A95A 1OT1A 3WD0A 2D0HA 1HN1A 1KWKA 1NWUA 1XD0A 3WD2A 2WVVA 3OBAA 2XUCA 2YL9A 2JIWA 4PTWA 1UH3A 4C7GA 3DHPA 2ZWZA 3WN6A 3F5LA 3MSGA 2V3DA 3IJ9A 1EA9C 1ZB5A 4A3HA 4F9JA 4S3JA 5CSUA 4CU6A 4R5EA 4DM2A 1XV8A 1CXLA 3WIJA 4YPJA 1G01A 4CCCA 2CNCA 3VDCA 2DT2A 1GPFA 1E6NA 1HP5A 1TE1A 2VVNA 3RPMA 2OWXA 1D2KA 3VD9A 2WKLA 4B15A 3VTRA 1W9XA 1E70M 3VGGA 2O9OA 3RM8A 1E6XM 3UCQA 1I1XA 5LA0A 4ATDA 3OIHA 2JF7A 4FLSA 2YJQA 3AHTA 3BCDA 3ZR5A 1MFUA 2BVYA 3WFZA 4JHOA 4ZE4A 1ZBWA 4D6GA 1UZ1A 1E0VA 1KBKA 2G8ZA 3AIVA 1V08A 1JFXA 4CN1A 5IXEA 2VURA 2BY1A 3FHQA 3VX0A 1MVYA 5A1AA 3ZR6A 2AMGA 4W8BA 5FCZA 1K6AA 1HKKA 4Y7EA 3BMWA 2HISA 1DP0A 2CESA 1ZU8A 1R85A 3ARWA 1Z32X 4XB3A 1MFVA 4JZ5A 3SEPA 1MQQA 1CDGA 4PBGA 1Q6EA 2VX5A 1RP9A 3POCA 1HL8A 3EDFA 4U5IA 2WMGA 1VJSA 1CGXA 5C70A 2DSZA 1JNDA 4EE9A 4J3WA 1VB9A 3BCFA 4PMNA 2NSXA 1X6LA 3ZOAA 2BS9A 2XWDA 3WNMA 4ZENA 4P8WA 1OD8A 5IHRA 1JXJA 2V5DA 4J3UA 3NCOA 3CZEA 4QAWA 5ABHA 5FOOA 4B3KA 3CUHA 1UKPA 2XGIA 4UFIA 2WVTA 3VGDA 1QI4A 1R87A 1GHSA 4KWUA 3GNPA 4EK7A 1H09A 3MO4A 2ZUMA 1GJWA 1JD9A 1JDAA 1E1EA 2GJRA 5EFFA 4D1IA 4AIOA 3LPOA 4PYSA 3EDKA 5M5DA 1O6IA 1CIUA 2GK1B 4CCEA 3W24A 4UTFA 2XIBA 3BLKA 3IAPA 2YDSA 1BF2A 5JBEA 4HOWA 2VMFA 3ZQ9A 3FAWA 3VPLA 3FY1A 3W6MA 1DWGM 1GQJA 1C93A 1GW1A 1LL7A 2WSKA 4X0VA 1OT2A 2W61A 3MMWA 3MMUA 1B3WA 2G41A 3VGFA 3POHA 4UFJA 3MSDA 2UY3A 3WF1A 3PBGA 3EBVA 1JF5A 1BFNA 1S46A 2VCBA 2VO5A 1L0PA 2DSWA 4H7VA 1XH2A 3K4DA 4AISA 3RIKA 2CETA 3CHDA 3FN9A 1J0KA 4WIWA 3W29A 3VIFA 3WEOA 2CCRA 1VFFA 2Y2WA 3CH9A 2EEXA 3WUEA 1E0WA 3PTMA 3QHOA 2D2OA 1UD6A 3BMVA 3VIHA 5IHSA 3B9DA 4LPCA 2Y5EA 4GZEA 3OGVA 2YL5A 1Q6DA 3SCSA 4ACYA 2JALA 1G5AA 1W3KA 1U30A 1PBGA 1KGUA 2J7BA 4GQRA 4JFUA 3U5UA 1JZ7A 2YLLA 3SCOA 2J7FA 2YA2A 2OWWA 2WANA 5A6JA 2J8GA 1AQMA 4U2YA 1EO5A 1HVXA 3BAJA 2VZUA 3CTTA 3PTKA 4W8AA 5C8BB 2QPUA 2DSKA 5A6KA 5ABGA 3ZIZA 1J18A 3O2LA 2X8RA 3EMQA 2DQXA 1WDRA 1ITXA 1V6VA 2O9RA 5HBFA 1FHLA 5I5RA 1PJ9A 4OOZA 1TG7A 3WEZA 1JZ3A 3RJXA 2WYSA 5KZ6A 3PZVA 3W0KA 1C8XA 3VNYA 4KRUA 3ZO9A 3BAIA 3L4TA 2ZXQA 3PTQA 2VQUA 4KH2A 4AZGA 2YDQA 1E6RA 2YBUA 4D71A 1SMDA 5BRPA 3WMBA 4U2ZA 4D6HA 3OLDA 4NSBA 3ZM8A 1Q6FA 1K9TA 4LX4A 1QVBA 1HP4A 4N42A 3WKZA 3O9NA 1TCMA 1CPUA 3SCUA 3TTOA 1UWSA 2TAAA 2G4FA 2CBJA 2WXDM 1XCWA 3WQ6A 3GDBA 5FL0A 3WNPA 5F7UA 5CSYA 1KCLA 1HL9A 4F9DA 1QI5A 3GXDA 4UQ9A 1WZAA 1XSJA 4CN4A 1NQ6A 1V3LA 1DWAM 2VX6A 2WAGA 1ZJBA 3OLGA 1XD1A 1MW0A 1E5JA 2D22A 1K9DA 3W27A 3M07A 1HJSA 1WPCA 1W1YA 2ZUUA 3SUTA 4PUEA 4GXPA 3WDHA 4ZEPA 1CLXA 4B16A 3CUJA 4IM4A 1E9LA 1Q4NX 2WM0A 1E1FA 1NOUA 3AHYA 3PZ9A 4M56A 3AHXA 3WH5A 4AIUA 4OJYA 4BZYA 2AAAA 4GQQA 1E6ZA 3VIPA 1X1NA 4WLCA 1UH4A 4D72A 1CLVA 3IJ7A 2QMKA 4LYRA 4D6EA 1W3HA 2E9BA 2ZX6A 3UG5A 1TR1A 1IZKA 3WNKA 3GBDA 4UQAA 3LPGA 1C8YA 2J62A 4UFKA 1F4HA 4WKHA 3PHAA 4XV0A 1H49A 1KXVA 4TVUA 3WQWA 3OLIA 1JI2A 4CUCA 1CGYA 4HZ7A 3ZSSA 4AZBA 5A8PA 4CU8A 3PZOA 2OYKA 2NW0A 2ZUWA 3M6DA 4UOZA 4H8VA 2WVVB 1VEPA 5LA1A 4M29A 1JYNA 5I0DA 2V38A 1Q6CA 2EPLX 4GIAA 1ZJAA 2VCAA 4CD7A 3AZSA 1TA3A 4HPHA 4JFSA 2D0GA 1EO7A 1MYRA 1G9HA 4EAMA 1OM0A 4AZ6A 2WHMA 4AZIA 5CLTA 2NT0A 1CXEA 3ARRA 3W82A 5D8WA 4PCTA 1QW9A 4JCLA 1V6WA 2WC4A 5JBFA 3A47A 3CHEA 4EKJA 7A3HA 2VL4A 4AZ5A 2GJXA 1C7SA 5D9MA 1LWJA 3VVGA 1UZ4A 3AOFA 3FXYA 3T0BA 1UA7A 1V6XA 2YLAA 1G0CA 2DGAA 4BQ5A 3ARVA 2VVSA 1WKYA 4W89A 3WDPP 4ACZA 3MKKA 1VF8A 1V3MA 2JIEA 4ACZB 4J27A 4HOZA 3ALGA 3TTSA 3AMGA 1EGZA 4Z2KA 3MS8A 3CIVA 3VD5A 4UNIA 5DT7A 3PZNA 1MW2A 4V2XA 1OBAA 2YDRA 4RE2A 4YN5A 1NP2A 5KEZA 4AY1A 2D24A 1FFQA 1H0GA 5A8QA 2OYLA 2XVLA 5GQBA 3MUAA 1FOBA 3VINA 3HN3A 3AHVA 3WH7A 4QFUA 2DDXA 1E6PA 1C7TA 5CGTA 2D0FA 2PBOA 2WHJA 2XWEA 1WZMA 4MB4A 2DSUA 3KL5A 3VO0A 4MDPA 2BHYA 4WF7A 5CLWA 1JYWA 1V3KA 2W66A 4U31A 5I6SA 4E8DA 3TTQA 4U3AA 2FHFA 1H1NA 4NRSA 4UR9A 5BXRA 4PUDA 4GKLA 4GZJA 3WENA 2WZIA 4C7DA 3SCTA 3E1F1 1UQYA 4E4PA 2J78A 1OGBA 4DWSA 4CD6A 4DWSB 1W9DM 1CECA 4W7VA 1JD7A 1UWRA 3EMZA 4PMRA 1KXHA 4HOXA 1ZBCA 2F8QA 1R8LA 1UWQA 1J01A 3MUIA 2WHKA 1W9UA 5A6SA 1UR0A 3AIWA 1UD3A 3CGTA 3ARXA 1LL4A 1FH9A 2JEQA 2VZVA 1EQCA 1H3GA 3AYSA 2CXGA 2IXUA 2EBNA 3I3EA 3RJYA 1H4PA 2PWGA 2WZHA 1KFWA 2VCCA 1KQZA 4TX6A 3VNZA 3WDQA 3QOKA 2IUZA 1UYQA 2XM2A 2WMFA 4OKDA 2J25A 3WMSA 3WL0A 4D6FA 4AMCA 4HZ6A 5A6MA 3VDHA 3VILA 1LQ0A 1C3FA 4J3TA 4UFLA 1IT0A 5IDIA 3UR8A 3WUFA 3GM8A 2VR4A 1OD0A 4F66A 4H41A 1JYVA 5A94A 2OSXA 4BCEA 1W91A 4M1RA 1PZ3A 2WMIA 1E15A 1WCGA 1V02A 3PZUA 5E9AA 3GNOA 3NUKA 3M46A 1UKQA 4ATWA 2J8FA 4L4OA 1OIFA 3WELA 1K9EA 3EDEA 1A47A 2WCSA 1UD5A 3WF0A 2W63A 2G3JA 3ARSA 2D20A 4J3SA 4WKFA 1E4NA 2E40A 3WQ4A 1FHDA 3VD3A 2WMKA 3BAYA 4YHGA 1V6UA 3CZGA 2FHBA 2EJ1A 1PX8A 2A3CA 4U3CA 3L4ZA 1GONA 4AZCB 2BXZA 5A2CA 2CERA 1R7OA 1J0ZA 1MXGA 2WCGA 5GNZA 4HTYA 2J77A 2QV4A 3HJEA 2D1ZA 2YIHA 5CZKA 4RE3A 2BY3A 2VJXA 4OBSA 4E8CA 3GH4A 1EDGA 3IANA 2VR5A 3IK2A 5BWFA 5DMYA 2E8YA 2NT1A 3WQ8A 1ODUA 2DH2A 1WB0A 3APGA 4Z2LA 2CITA 1I75A 4AD4A 1W9BM 3L4UA 4JFVA 2IXVA 5E6ZA 4PMDA 1ZBVA 1BHGA 1B90A 1VEOA 2DIEA 3BAKA 1GVYA 4LGXA 5A3HA 1UR9A 3B8SA 4KGLA 1BAGA 2E9LA 1ISVA 1OINA 1LLOA 4HU8A 2YBTA 3ARZA 1NP0A 3SIMA 2WBKA 3A4WA 3IJ8A 4UQDA 4HMCA 1CYGA 1W9PA 1CXFA 3DC0A 2CHNA 1E6QM 1OB0A 3CUGA 1EXPA 2WWDA 2CBUA 3AFBA 4Z2HA 4Z2JA 2W91A 3MANA 1BGGA 2XVPA 3AROA 1UR4A 3WDRA 1BYBA 5GNXA 1GQLA 1BYDA 1M7XA 2EPKX 3AMCA 2GSJA 2AOSA 4TOQA 4ZFMA 4U5KA 1TZ7A 1W32A 2XHYA 1G94A 3S2CA 1JIBA 1US2A 1J0YA 3FW6A 4U33A 1TFVA 3GYCA 3M7SA 3WH8A 1UR8A 3CHFA 5HDRA 1M04A 2QPSA 1EDTA 8A3HA 1XYZA 5M17A 5IFTA 4KGJA 1XHGA 2GJXB 1TVNA 3AS3A 1BLIA 5EFDA 2PC8A 3PN8A 2XTKA 4JFTA 1TUXA 4BQ3A 3LPPA 3NSMA 1UH2A 5EMYA 3AZRA 5M3WA 1UKTA 3WEMA 3RCNA 2QHAA 4A3YA 1XRVA 5FD0A 1UWTA 3GBEA 1H11A 1UA3A 4N0RA 3W25A 3GZAA 1PX4A 2ESCA 5BXTA 3LMYA 1UR1A 5I2UA 1V6YA 1HKMA 4MB1A 4UFHA 2X0HA 5AC4A 3I3BA 3TP4A 4DUXA 4UZSA 3ARYA 7CGTA 2OYMA 1US3A 2D3NA 4B3LA 1JYXA 3RO8A 3NYDA 3BAXA 5BYWA 1E6SM 2DIJA 1VFOA 3WNLA 3CHCA 3KE0A 4TXEA 2XG9A 1CZ1A 1SMAA 1CBGA 1JI1A 5DT5A 3S6TA 4AXNA 5BCAA 3BH4A 1HF6A 2YL6A 4PSPA 2ZOXA 1MW3A 4CKQA 1DWHM 3AIQA 3AI0A 1VBRA 4HMDA 1QI3A 2VT0A 1EHNA 3SUVA 3J7HA 4IPLA 2DT1A 2WBGA 1UKOA 4MADA 4M81A 1CXKA 3L4YA 4P7NA 3VGEA 2ZX7A 5HNNA 4HA3A 4ZXLA 1ISYA 4HA1A 2ZUVA 3WL1A 1HX0A 2PWHA 5ECUA 3T0AA 4AZHA 2XSAA 3MU7A 2XGBA 2PWDA 4LYQA 5C71A 3ZMRA 3GH5A 4W8LA 1H2JA 1DWJM 1D3CA 1OSEA 3ECQA 4PMUA
chains in the Genus database with same CATH superfamily
3WQOA 4O12A 4ZSTA 4QEEA 4GYKA 1JGIA 1FKXA 1XYBA 4X22A 4KMQA 2F38A 3HF3A 1RH9A 3BJFA 5DLCA 1SJAA 3OB8A 3PWGA 5EMKA 2V63A 1U2YA 4PB5A 4AVFA 5DXYA 3H70A 2QUVA 1G6CA 4HHPA 2GSEA 4TVCA 5A6BD 1JDEA 2H9AB 4ORMA 1H5VA 4WR3A 3W7GA 5AYBA 3NGFA 3TJIA 2GWNA 3AYTA 3DFQA 4DAIA 3UY7A 2X1UA 1R3SA 3WUGA 4IQDA 3SSZA 4ZR8A 3CZLA 4MNJA 4YVPA 1GKQA 1F73A 3FAXA 2NQ5A 4GY7A 4N6EA 4UR8A 3DI1A 2NQJA 4OE7A 2FH6A 4O8AA 2GZXA 2X16A 1PPIA 4ADUA 1YNYA 4DB7A 3WH9A 1SU5A 4H9VA 3HPZA 2VTFA 5I3FA 5LNWA 3AIRA 2ABBA 1B0IA 3B0VC 2WW5A 2Z29A 3HGOA 1V0LA 3UYIA 3NQVA 2X30A 3N17A 3W74A 2R1LA 4BF5A 1QMLA 4R9XA 1K7FA 1QUMA 1V03A 1GEHA 3TCEA 2AQVA 3E12A 4PTVA 1F76A 3PZMA 2YSWA 3URQA 4D6CA 5JUVA 3S9YA 2F9RA 2GUYA 3HQNA 3OYZA 2WNZA 3EKGA 2YA1A 5A2BA 2NWRA 4FMVA 3K5XA 1AMKA 3L67A 4GC4A 4QR6A 4XZLX 1EWDA 2IQTA 1W5OA 3I6RA 2EF9A 3ARQA 4P61A 4GGHA 4E2VA 3FCPA 6TAAA 1TX0A 3NYZA 3HV9A 1FQ0A 3G5EA 5ABFA 1PEZA 3A4JA 1E73M 5F2MA 4L65A 2PDYA 4HZ8A 1LT8A 1A50A 1EOMA 3EWBX 2FGZA 2DORA 1IWBA 3DAQA 5CSRA 4WSKA 1ZL1A 2O7SA 1L6WA 2CBVA 4JTAA 2UZ9A 1FDJA 4ES4A 2P3ZA 4PMZA 4GX8A 2Y1HA 4D6JA 1WO2A 2EPOA 3P2VA 1XDLA 4AWEA 1JAEA 4PCPA 1F6KA 1LCOA 1RBAA 2A1YA 4PH6A 1BEUA 1W54A 1NWTA 1GOQA 5A2AA 2PDWA 3QV7A 5I3DA 4ZQRA 3QGVA 3KTXA 3L23A 3AS0A 5A6BA 1UB3A 2PTZA 3E2RA 4O1CA 1VLWA 1W3IA 3UJEA 4WY0B 1B2YA 2XIIA 3HJZA 5CG7A 1XYFA 5CG0A 1R2TA 3H6OA 1PO9A 3PANA 1TZZA 2HXUA 3II1A 2HE5A 3G1RA 3R1ZA 4H7ZA 4ZOEA 4ZTYA 4M80A 2G5WA 3M5VA 1W3LA 3P3BA 3W4RA 1B30A 4NILA 5DANA 3B9NA 1OWQA 1RVGA 1XP3A 2CXEA 4QM1A 4IXXA 3WH6A 1GW9A 4I90A 2ABAA 3IIXA 1LLWA 4TVDA 1B3ZA 3QGAC 4GY0A 5BOEA 1J0JA 4S3FA 3VM5A 3L4WA 5E70A 2DSVA 4AWSA 3HQPA 5HULA 3SCRA 2J7CA 4V28A 3E5BA 5C9UA 3M5ZA 3KAOA 2WQPA 3G3MA 2ZZ5A 3P82A 2HTMA 1J5SA 1LWHA 1KCXA 3O07A 3F2DA 4L56A 1M68A 1ADOA 1V02E 1F5ZA 3UVAA 1KGWA 1J0HA 4IQJA 3VIGA 1R7AA 3VNIA 1TV4A 2E8ZA 2HWGA 4X2RA 4PA8A 2TYSA 4FR6A 4S3CA 2YYUA 4DWSC 1Q45A 3H24A 1A4MA 4L9YA 1ODZA 2J13A 4IIFA 5D2VA 1V3HA 5LIUX 4LJ3A 2FDMA 4Z17A 3I10A 1M01A 4HT3A 1UPPA 1MSSA 1UR2A 4J2PA 2ZYFA 4QX4A 4W84A 5HJLA 2H8ZA 1IZJA 3TFCA 1A5AA 3LNPA 3VOGA 1JRCA 1FDZA 2DP3A 2FQIA 3THQA 4FAMA 1K7EA 4Y9OA 4F8XA 2NXGA 5K9CA 1ADSA 1M3UA 4PRTA 1G4SA 3N6HA 2O7QA 3HMCA 1IYXA 3WQGA 3EWZA 5KITA 4G1KA 1GOXA 1NF0A 1QWKA 3O05A 1FX6A 1ALDA 3TR9A 1IE7C 3T0DA 3CHVA 4IFRA 3AQUA 3CQHA 1QW8A 1LLZA 3MUZ1 3AXHA 5AYYA 4GOAA 2OZ3A 4MJ2A 2GDUA 4LQ1A 3FEQA 3P61A 3TSMA 5AY7A 4BI6A 1CLKA 5HPCA 4J4KA 3RILA 5E09A 3LUTA 4IMEA 3K8LA 1P0BA 2WSRA 2A7PA 4EAYA 4AVOA 5H8UA 4ZBCA 4TX9A 3C2YA 2PEVA 4TTGA 3T42A 4NNAA 1EZWA 4C6KA 1H5YA 1E3XA 4RJEA 2PODA 1KM4A 1DYSA 1RK6A 3U7VA 5A8MA 4JDYA 3GXPA 4B5VA 1OYAA 4MKNA 4WDTA 1MMFA 3JUGA 3KDNA 5D2XA 2QZRA 3OPSA 4X9YA 4HPGA 1PDYA 3F4WA 5D8ZA 2OSYA 4AZCA 2CLEA 2BDQA 4W88A 3AUOA 3R25A 3LCWA 1UD4A 2I7GA 1Q8JA 3P7YA 1H0IA 4CD8A 1QOXA 1LQAA 3GYEA 2YXOA 1KD0A 4X60A 1AA1B 5F4XA 3OG3A 3R0DA 5FAGA 1AH4A 1Q85A 5CC3A 2Y8VA 1B5TA 2E0PA 4JIIX 3MA8A 4UQEA 3GSMA 2ACSA 2ZTKA 5LYRA 1CGTA 3ITLA 4W7UA 1K7XA 3TXZA 4F0SA 4PRWA 3AIBA 3GHUA 2VUNA 4H2CA 3KWSA 4X2PA 1JVNA 3IAQA 4S3KA 4BWLC 3VIJA 3SFWA 2X42A 2WC7A 2JKEA 4Q22A 1QASA 1XINA 4F0KA 4R7OA 2WLYA 4DPQA 4QROA 4DJFC 2PI6A 1O66A 4ZA0A 3SN0A 4M7TA 1KBJA 2QJMA 4JTEA 1AQFA 3B4YA 1E4MM 3MCNA 3GVGA 1FA2A 4UQCA 2FVLA 4GXWA 4XG1A 2Q09A 4XTIA 3LN3A 4Q8TA 4G8TA 1XRFA 3C3UA 5B7ZA 2Z1KA 3QHMA 4P7QA 1C91A 1X7FA 4WY0F 5K2ZA 3GTFA 4KS0A 3RX4A 4NJIA 4GINA 1G1YA 1X38A 3WK3A 2OGJA 4JN8A 1GVIA 3DYPA 4DPPA 4Q33A 1Y7VA 4BQ2A 2NVAA 1GG1A 2DZPA 4MM1A 3IK4A 3WBYA 3PJTA 1LL6A 2BVTA 3S5YA 4TV6A 2CIPA 2PDJA 2QNEA 4QP0A 4LYPA 4IMFA 4R9OA 2VX4A 1T99A 3WYZA 5MF5A 2XH4A 1KCZA 4GO9A 1YXDA 4AYSA 3W7IA 1OHLA 3HU7A 2C1HA 2YZRA 2E77A 4ZO6A 2AQOA 2ZZ2A 3KUMA 3TN4A 3L66A 3D46A 1XPGA 4RE4A 1QTWA 3G1SA 1R9XA 3ZJ7A 4IWWA 1CGUA 4B90A 4HJWA 3N2MA 3V5OA 3VE9A 3TOPA 4DBUA 2VGFA 1P0DA 4MFDA 4AWTA 4DJDD 2JEPA 1B9BA 2V67A 1QHZA 4AD5A 5A8NA 4LUYA 3ZT5A 1BYCA 4UTWA 2OKTA 4LCRA 3OZPA 4CVUA 5G4EA 4GKTA 1PTGA 2DUZA 1EJVC 3AALA 1CEOA 2ZXDA 5D2TA 3WF4A 1W3JA 4QSHA 4DJEC 2V69A 3UPBA 2QJNA 5ABTA 4WKAA 3LV6A 2E5CA 4E2BA 3LQGA 1TTPA 4NRRA 1H7NA 2HZGA 2Z1WA 1WDQA 3C8NA 3U2CA 3LI1A 4H8UA 2J4GA 2R8WA 5T91A 3LHUA 4Y90A 4AD3A 3ZJ8A 3NDZA 3WBAA 4BR1A 3LRKA 5DY3A 3CPGA 4S2BA 3BLPX 1PIGA 3UYCA 1B1YA 2EPMX 1RUSA 3FEMA 5HXMA 3OA5A 1V0KA 3MV11 2Y24A 3F4DA 4PMOA 1LTDA 4HHLA 4AD2A 3PUOA 1GPWA 4DUVA 2V5CA 5HNTA 3IUIA 4GVFA 4PCSA 3SUSA 5BXSA 2RH9A 2DW6A 1ENUA 3WBEA 1Z7AA 5GPRA 1B54A 3LBMA 3YPIA 1DE6A 5H8PA 4ICMA 5H8MA 1TTIA 5CJ5A 3W81A 4B5UA 1XG3A 1NWRA 2OZ0A 1L8NA 2Z27A 3W1PA 5MKGB 3NZ1A 4Y9MA 3MSRA 3BW4A 1TZ9A 6XIMA 2I16A 3QHNA 1HVQA 3T2QA 1M7JA 1WZKA 2NV9A 1EJRC 3IJQA 4PN2A 1J10A 4JIQA 2VUYA 1TIMA 5J5DA 4HNCA 3W00A 1GTEA 3U7BA 2Q3RA 3NQ6A 4FXSA 3DXIA 2FGLA 1KC7A 1WDSA 3WF2A 5E0KA 3PAJA 4KWWA 2IMRA 5AFDA 3R11A 4JTDA 1EBHA 3LXBA 3GG0A 1CGVA 4LT9A 4W93A 4AX6A 1HJXA 1XIBA 4JL2A 2D3LA 3VNMA 2GLKA 3L0NA 4I9AA 4OIFA 1QNPA 1EWEA 3EOLA 3N1AA 2VDHA 3BO9A 1WV2A 3PPHA 5CZJA 4GABA 4RZ6A 5EMMA 2RGLA 2F61A 4H9MA 2G0WA 1FCVA 5HMSA 1D3HA 3IUDA 3WD1A 1KBBA 1NOWA 1VYRA 3EMCA 2GGEA 1XLHA 4PTMA 2PDFA 2FPVA 3K8MA 1F3TA 1E4LA 3DFSA 1PCWA 5CH9A 3L5AA 2V3EA 4J40A 5KZMA 4WJEA 1R47A 3VD7A 3R10A 1P7TB 1OT1A 3W1RA 4JTGA 1XD0A 3WD2A 3OBAA 4EWJA 2QJJA 2ZWZA 3WN6A 3F5LA 2PDNA 3IJ9A 4A3HA 3V0UA 4CU6A 4DM2A 3WLLA 3H2AA 1XV8A 1CXLA 3N2OA 3ABXA 3EXTA 3N4EA 1OEPA 3V4BA 3TR2A 1I60A 3N29A 1VD6A 3TQKA 5DBUA 1TE1A 4LUSA 5FF0A 3NGJA 3TYAA 3VD9A 3VK5A 3UBPC 4GRSA 3VTRA 3L9CA 3VGGA 2O9OA 4MPQA 4A35A 1ZHAA 1F8IA 5LA0A 2JF7A 4FLSA 4I9JA 3ZR5A 3BCDA 4LU0A 1XIMA 3LG3A 4H9UA 3WLMA 3WFZA 3M44A 1GWJA 1KRAC 2VGIA 4XVEA 3W7JA 4D6GA 4K39A 1KBKA 2G8ZA 1LUCA 1TR9A 4KPLA 1JFXA 4CN1A 5IXEA 1F9CA 2Z2UA 3QPZA 3CAKA 3S46A 3PF3A 3HQ1A 1RV8A 5M2FX 2V0TA 5FCZA 4UTIA 4RNHA 1K6AA 4Y7EA 3CUZA 2QCMA 3BMWA 2CESA 1VPQA 5EBUA 1KM5A 3TKFA 5HUOA 2QAFA 1HZYA 4HHMA 1WKFA 4YLWA 1MQQA 4CLMA 1PYFA 2BOFX 4EXQA 1XLCA 2DSZA 1YW1A 2QCNA 3CT2A 2E1DA 4J3WA 4GLEA 3BCFA 4UTLA 3TIMA 3WNMA 5G2HA 3R8HA 2DIKA 3RX2A 4J3UA 1NFGA 4JGDA 2VWTA 4RDZA 2WVTA 5KETA 3UVIA 3VGDA 1QI4A 1QWGA 3S5SA 1R87A 1GHSA 3BANA 3INPA 4EK7A 5FF2A 3HOJA 1ZPTA 1J6OA 3NNTA 3BLOA 1TCDA 1VGAA 1E1EA 1F07A 4ZOCA 3S0CA 3LPOA 4PYSA 1THFD 5BU9A 3W7CA 4I6KA 2PU0A 4NJGA 1XG4A 3BQ6A 3QYQA 5RUBA 3CB8A 2CZFA 4DNHA 3GE7A 1BF2A 4IL2A 5JBEA 3B03A 2P3EA 1PKNA 5AHNA 2FFCA 3FY1A 1EX5A 4NKCA 3GG8A 3ICJA 3WBWA 2HQAA 3KBJA 4UWMA 4XO7A 2W61A 2QCGA 3MMWA 3R8GA 1X1ZA 1S2TA 2FB3A 2DVXA 1WUFA 1S46A 3CNYA 2VO5A 4LVGA 1IHIA 2VDIA 3RIKA 3I7QA 2CETA 3VCCA 1XM3A 4S39A 1JEZA 5KSWA 3B0PA 3CH9A 1E0WA 3DG3A 3C61A 1L8PA 5LNSA 1Q6DA 3SCSA 2JALA 4LAUA 1G5AA 2A7NA 1R46A 3G1XA 1U30A 3DZ1A 1KGUA 2J7BA 5FI8A 1ZLPA 3SQSA 1I2NA 4IIEA 1EF2A 5HQEA 2E6DA 3PFRA 2J7FA 2OZTA 1AQMA 1EO5A 2VZUA 3P84A 4RW5A 5C54A 2AGTA 4WZHA 1J18A 2FVMA 3GB6A 4GVGA 3QZ6A 3QFEA 2O9RA 1Q66A 5HBFA 3T40A 3WEZA 1JZ3A 4GZ7A 2WYSA 3PZVA 1NU5A 4KRUA 1TRIA 3ZO9A 1SO5A 3BUVA 2VQUA 1E6RA 2BP1A 1Z69A 4GVHA 2OO6A 4QXIA 1P7TA 4M51A 4N42A 3H7VA 3H2CA 3VNLA 4LWWA 2PTWA 1TPB1 5GJNA 4ZB0A 3TTOA 4ZQNA 3RG6A 1V7YA 2HBVA 1VFHA 1TV3A 1NDWA 4NNCA 2DVTA 5F7UA 3MZNA 5CSYA 4F0HA 4F9DA 3BG3A 4Q4QA 4DHGA 2PLMA 4BI5A 1V3LA 1DWAM 2OEMA 1XD1A 1MW0A 2X0SA 1IIGA 4LOCA 1K9DA 3KS6A 3W27A 5E5CA 3M07A 2GDQA 4Z42C 1HJSA 1W1YA 4FHAA 4PUEA 3N2CA 4K1WA 4M6QA 4ZEPA 1Q63A 4B16A 3MP5A 4IM4A 1E1FA 1NOUA 3ZVIA 1IQ8A 2ACQA 2V5BA 2XN0A 4U10A 4LRTA 4IGSA 4A8NA 3HG3A 3WH5A 4OJYA 1OYCA 1EGVA 4GQQA 3VIPA 4DJDA 4WLCA 3ES7A 3APYA 1K1DA 4GUFA 4LYRA 3OYXA 4D9PA 1KFLA 4WDUA 3UGVA 1OCBA 2ZX6A 3UG5A 2QS8A 4A22A 1RSCA 3WNKA 3GBDA 4Q8NA 2C18A 1C8YA 3IPWA 3N4AA 2Y7FA 1HGYA 1UIOA 3PHAA 1H49A 3M7WA 4EPKA 1KXVA 4FX8A 3OLIA 5IOBA 3TH6A 1YPFA 1HW6A 2FKPA 2P53A 3S3GA 3STCA 3PZOA 4H9XA 2VFIA 3M6DA 4UOZA 4H8VA 2NLIA 3ITGA 1Q7ZA 5LA1A 2CHRA 2V8ZA 4Z1CA 4MOZA 3S8HA 2VFHA 4JNYA 2EPLX 1ICQA 1ZJAA 2HPMA 4TMCA 4JFSA 4ROPA 1DJHA 1Z44A 3UWVA 4RNFA 1EO7A 3M0XA 3SSJA 4G7FA 4UC5A 2NT0A 1CXEA 4HCLA 5HAOA 3FXGA 1QW9A 2QVNA 4JCLA 1V6WA 5JBFA 4LCQA 3A47A 4Q8OA 3CLMA 3ES8A 2NVDA 4LANA 2GJXA 2I9EA 1I8JA 3W1MA 2AKZA 2PC4A 1LWJA 1UZ4A 1V6XA 1WXZA 4NX0A 2DGAA 2VVSA 1WKYA 4W89A 3W83A 3G1AA 1TV7A 3SGZA 1E9IA 3MKKA 1VF8A 2JIEA 4HOZA 3WLIA 2PDLA 3SO7A 3MS8A 1RVKA 2ISSA 3VD5A 4GC3A 3AYVA 3HO8A 2D2GA 3PZNA 2ZFAA 1OBAA 1P48A 4GQ0A 1NP2A 4RE2A 5KEZA 4Y96A 3L2IA 1FFQA 4PR4A 5A8QA 4O16A 2OYLA 1PE1A 2DZUA 1FOBA 3FSUA 4Q7BA 2QDHA 3GRIA 2DDXA 3N2XA 5CGTA 3GY1A 4LTSA 1OK4A 4NNBA 4MDPA 2OCZA 3PNUA 1LBMA 2HVOA 5B7YA 1NY1A 1V3KA 5AVNA 5I6SA 3BQ5A 1F6YA 5CPMA 2V68A 2I14A 1VLIA 4M3PA 5A5WA 3CPRA 2PCQA 4UR9A 4JTTA 3MP3A 4G5DA 3ANYA 1EYWA 2V6AA 1GKRA 1UQYA 1XDMA 4I9TA 2J78A 2PRMA 3WLOA 4K1GA 2CZEA 4QNWA 1IT8A 2PWVA 3W76A 1UWRA 4PMRA 1XLJA 1LBFA 5J8LA 1R8LA 5FJJA 1J01A 3AJXA 1W9UA 1UR0A 3AIWA 3GC5A 1FH9A 2JEQA 4O57A 4LY4A 4PUWA 2IXUA 2EBNA 1TPFA 2WZHA 5FAJA 3QOKA 2XIJA 3K30A 2IUZA 1UYQA 2XM2A 4C6IA 4H6RA 4AMCA 4HZ6A 4XISA 3ZLFA 3VILA 4H8NA 1LQ0A 1PSCA 4J3TA 1IT0A 2O56A 4IFOA 1OD0A 4GIYA 2OB3A 4F66A 1O5KA 3GR8A 4DYEA 1JYVA 5A94A 4NP7A 3UU0A 3GHSA 1PZ3A 1V02A 3BGGA 3M46A 2VC6A 1EPXA 2PRHA 1G67A 2VFGA 1K9EA 3LGEA 3WELA 3HV8A 2WCSA 1Y5XA 4FNQA 5G1TA 3NQEA 4C6CA 2W63A 3PK7A 1E4NA 1BQGA 2ZC1A 3UR2A 3LTYA 3BAYA 4YHGA 5AVHA 2ISFA 3R0KA 3JR2A 4U3CA 3Q45A 4EP8C 1R2SA 5A2CA 3OQ8A 3UJSA 1JULA 1I9CB 1R7OA 3CWOX 4FS9A 1MXGA 2GGHA 3E3HA 3EGJA 1PKMA 4HTYA 2J77A 2QV4A 1NQKA 1P4CA 2D1ZA 3MHUA 3HPAA 1O5RA 3LU2A 3EWDA 1ZAHA 2FLIA 3NG3A 3QSRA 4GX9A 3ATYA 3NOEA 5DMYA 2DUXA 1S5TA 4M19A 4DF2A 1ODUA 1ME9A 1U5HA 4Z2LA 1A0EA 2CITA 3U3HA 2NUXA 4RDWA 2IXVA 2PTXA 1AJ2A 3MCOA 2ZDSA 1XLEA 2DIEA 1TE6A 1UPMB 5AYXA 3O6CA 4GACA 1JCJA 3DH7A 1OINA 3SIMA 1W1B1 2WBKA 3E0FA 4UQDA 4HMCA 1W9PA 3CM4A 2IW0A 4O4WA 2YCJA 1K70A 3WK2A 2WWDA 2REQB 4LS0A 3AROA 1OF8A 3BW2A 3QQ0A 5GNXA 1BYDA 3TU9A 3AMCA 4JY8A 1E1CA 2AOSA 4ZFMA 3CAWA 3LCIA 3NZGA 3S2CA 1JIBA 3DN5A 1ZAIA 1EKOA 2P76A 3FW6A 3M7SA 1XIGA 1XLFA 3WH8A 3C8FA 3D0CA 2WV8A 5HDRA 5EMLA 1EDTA 3CIXA 8A3HA 1XYZA 3UJRA 4GMEA 5CJNA 4ILSA 3UCCA 1LQ2A 4IMCA 2FTYA 1S2VA 1BXNA 3EWUA 3ORWA 3KW3A 4HCDA 2DQWA 3LPPA 4G6CA 3VCNA 3NSMA 3ANVA 3E2VA 1FWNA 3AZRA 4E0CA 3STPA 1AW1A 4A3YA 4E6MA 4R34A 2DZVA 5CZSA 4N0RA 3P0WA 1UR1A 5I2UA 4YU1A 1ADDA 1EJSC 1JJKA 4UFHA 1O1ZA 4IGNA 2VGGA 4UZSA 3CAQA 4M5PA 3ARYA 5KINA 1US3A 2D3NA 2W6RA 4B3LA 5I00A 4AY8A 1S2AA 1Q8AA 2A3LA 3NYDA 4C6FA 3BAXA 3WLTA 4WXZA 5BYWA 1E6SM 2DIJA 3S9ZA 4US5D 2VEPA 1JI1A 1DIOA 4C5YA 1OYBA 3S6TA 1MW3A 5FACA 4CKQA 3L5MA 2XN1A 3KVJA 1VBRA 1TUFA 3EX4A 2D2JA 2VT0A 1EHNA 4TQTA 3UY8A 2DT1A 3B0YA 4HA0A 4LUTB 4DRSA 2HDJA 4LAKA 3QFWA 4M81A 3FYPA 3VGEA 3NQMA 4HA3A 1O1HA 4ZXLA 3B8WA 4HA1A 3WL1A 1I2OA 2PWHA 5ECUA 1FRBA 2GOUA 5JU6A 2NQLA 4ZZ9A 4LYQA 5C71A 3ZMRA 3LI0A 4W8LA 4C1LA 1D3CA 4ROQA 5FESA 4IG2A 3ECQA 1ITUA 4PMUA 3G0XA 4XZWA 5I24A 1A4LA 1DWFM 1K8CA 4CD5A 1TKKA 3S4TA 1C9DA 4WDXA 3SURA 2G50A 4FNPA 4GNJA 1QOQA 3OVQA 4ZODA 1KV5A 1R9YA 3RMEA 2CW6A 2WNQA 5JBDA 2ZA2A 1V3IA 5E1QA 1BVWA 1GOOA 4OUEA 1E71M 1ICSA 1XQLA 2E4TA 2BHZA 1IEVA 5DN1A 3E96A 2UY2A 4GHRA 1M03A 2ZVRA 2I5GA 1LP6A 1IV8A 2VFFA 2WO5A 1KFEA 4JTCA 4D1JA 1AVAA 1MWOA 1PZ1A 4XX6A 4KRZA 2X1SA 1O7AA 2PDIA 2BASA 2UY4A 3TTYA 4X61A 4MAVA 2OLSA 4ML4A 2QVHA 3IIZA 3E0VA 2YXXA 3HG5A 4KRTA 4TIMA 4PSRA 1PTDA 2PSNA 4ZE5A 2XFWA 1ISWA 3QW3A 3RMJA 3IJLA 2B81A 3LRLA 1G4EA 1YHTA 1CI1A 1KXTA 4JKLA 3DFYA 4O0ZA 3SJNA 4AW7A 1RD6A 4BY3A 1GJPA 2P88A 3A3WA 1A5CA 3HGSA 4P7LA 2Y89A 3NA8A 4A8IA 2PDBA 3GIQA 3E0WA 5IM51 1N7KA 2IPGA 4HGXA 3I3DA 3VNJA 4L9ZA 2Y7EA 4LBRA 4O53A 3VGBA 3W6LA 1DWIM 2J7EA 1QI2A 2V81A 3DECA 1GTHA 1A5OC 1RQBA 1RZMA 5I3HA 2J74A 1UD2A 3HQOA 1VZWA 4O8RA 4O17A 4K7VA 1A5NC 5FEPA 1A5KC 2HROA 3FX4A 1VRXA 1YTDA 4FZIA 3UPMA 2WOQA 4OZOA 2FGBA 4YYCA 4WSHA 4JTSA 4FK9A 4PCNA 3WO8A 4AYGA 1B3OA 1PKLA 1HO1A 3A64A 3WQVA 2J27A 3M0IA 3UZ5A 1VFLA 4NYUA 4URIA 3R0UA 4CNUA 3GC4A 3LXAA 3N12A 5IBXC 1TJRA 3G22A 1W8GA 2NLYA 2VOTA 7TAAA 3K46A 4JIRA 5KMYA 2XGZA 3OGRA 3SCNA 4GFSA 2FH8A 2AL2B 2QULA 4XD3A 3WQCA 4JNZA 5FJUA 1R6WA 1X8FA 4UB9A 5FSEC 1J12A 4DUWA 5ABEA 4DIAA 2Y62A 1W37A 1QNSA 2V9DA 2ISWA 3GNXA 4GGBA 1XLAA 1FWGC 4MJMA 4Z2IA 4ICNA 3KEHA 4ZQPA 4FF5A 4IMAA 3UWUA 4PTNA 3PSWA 3R12A 1XF0A 1XLKA 2J9YA 4HNUA 1P6WA 5HPOA 1KTCA 5D9NA 2X09A 5DELA 4YTSA 4E2DA 1RAKA 3SCVA 3VDAA 1XRSA 3RRAA 1MZRA 4AIEA 2FJKA 1KV8A 1VS1A 5AHIA 3ERPA 3IWPA 4CGTA 1DQWA 3M6YA 1MUCA 3GNRA 4E4FA 3UT0A 2GJNA 1Q6LA 2XSBA 3AS1A 4P8UA 2PZ0A 1QBAA 2Z6JA 3B8TA 4FF7A 4MNLA 2J9XA 2QDGA 1DIEA 1JZ6A 1UIPA 2J24A 2WLZA 3TWAA 3U2ZA 1XI3A 5AZ1A 1FFRA 1JNEA 1H60A 3BPWA 1RJQA 3N6QA 1GKPA 1AZ1A 1ISZA 1NIUA 4A29A 4IX2A 3ABSA 3MKVA 5DMNA 4QQUA 3AXKA 2WNWA 2ZIDA 3W53A 4AC1X 2QCDA 2WMHA 1ML1A 2VC9A 4Q8PA 4Q4RA 4IJBA 2O9TA 4CNOA 5CPOA 1QR7A 1IGWA 3URBA 4UQBA 1VFMA 2P8CA 4CVWA 2PPGA 6PTDA 5HQLA 1TPVA 4S2CA 1PIIA 2VOMA 3VAVA 3LRMA 2WJFA 1YKWA 1YTEA 3VIKA 1LJYA 1FCQA 4DNMA 3SB0A 2RJGA 3AISA 3HM7A 3MI2A 1WXYA 5G5IA 2WPGA 1R3RA 1XIHA 4YHEA 1YE4A 3UESA 1E5NA 4QS5A 2OU4A 3AIEA 2CYGA 4XUYA 3WUBA 1VBHA 3WF3A 3N9KA 1XYAA 4N7QA 3RCMA 3C56A 2CLIA 3P62A 1JDCA 3LD5A 1GCYA 4ZMGA 4DBSA 2I5IA 4UTTA 1TPWA 3W7PA 4JAWA 2C3ZA 3NEHA 2R82A 1H41A 2E9MA 4IGMA 2XISA 1JRBA 2ON3A 4H2HA 1VPYA 3QMTA 3VIMA 3LHWA 1UKSA 2OEJA 1UOZA 2VRJA 2XFFA 3VOIA 2UY5A 1LORA 1J93A 1W2PA 3IGSA 1YDVA 1RPXA 2VM8A 4WRHA 4JYEA 4Q8MA 4AHQA 2CLPA 5C55A 2EG7A 4A8LA 5CPTA 2CC0A 3P5ZA 3NQAA 4LALA 2A3BA 2WMJA 1PS9A 1Z3NA 2XVGA 1B3YA 3PZQA 4EANA 1HXJA 2DV0A 3SADA 2PF0A 5IFPA 5M03A 1A80A 5EBAA 1F3XA 1GOWA 1RLDA 1PTAA 3CQJA 4BQ4A 4OGZA 4KEUA 2E7FA 3RF9A 4S3AA 1MEIA 3AS2A 3THDA 1EP2A 1XLLA 2PWEA 2VD9A 1XPYA 3CO4A 5D32A 1SO6A 1WZLA 1A0CA 2B31A 3ZT6A 3BK0A 2VNCA 1DPMA 4MPKA 3NQBA 4C60A 3W2LA 3ZJ6A 3GLCA 2OWCA 3N04A 3MY9A 2ZUSA 3U57A 4MNKA 1AL8A 4WD0A 4J2MA 1KQYA 2HVNA 5HMFA 1PX3A 1QNRA 3ELFA 1EC7A 2WSYA 4P7RA 3T08A 2HSAA 4NAEB 2FZDA 1KB3A 2VXNA 5G4WA 1I6NA 3RCYA 1OY0A 1VQTA 1VRDA 3MMDA 2J6XA 4LC6A 2QR6A 3TWBA 3AXXA 4KETA 2V5JA 3T2PA 1OK6A 5PTDA 3GHRA 5U4NA 4DZHA 2I5QA 1F05A 1E55A 4KEMA 4AEEA 3LLFA 3M0HA 2ZX5A 3IIVA 2A3HA 3FLUA 4AF0A 3RNDA 2F6KA 3W01A 2PP3A 4LAMA 4PMVA 3LCGA 1Z48A 4XIMA 1DJWA 3UERA 4UCGA 2FTPA 3V18A 4QE4A 1EJXC 3AU6A 1ONXA 4CQ9A 5TF0A 4NJHA 4F2TA 1CTNA 4CCZA 4UMAA 2QUUA 4AFYA 4GISA 3NO3A 3W28A 3W72A 2Z00A 4DWSD 3TEVA 3VGHA 4INFA 1UQZA 1B3VA 4GI9A 3H2NA 1HG3A 1TMQA 3B40A 2OR2A 1X8CA 1MRAA 2BXVA 4RK8A 3WJZA 3A6OA 2YPIA 3DU0A 4IISA 3DHDA 1K9FA 4BWLA 4JKKA 4G2DA 1OGGA 3GTXA 3L68A 2I9UA 3BLFA 3PFMA 3H22A 5I79A 4EXBA 3G77A 4QG9A 2W27A 2XYLA 3LENA 3ZVHA 3TC6A 4CU7A 2ZX8A 3IJ6A 4W85A 1VBJA 1MZHA 2HMCA 4S3EA 3UD6A 3UG8A 3C6CA 4NZCA 3VOCA 3DHUA 3GU9A 3SGGA 3G3DA 4WK9A 4JL1A 2Y85A 4BF7A 9RUBA 1S2CA 2QT3A 3KOFA 1LOLA 2DH3A 4KT2A 5EMJA 3CMJA 5BMXA 1UZDA 3NM1A 2CBIA 4F79A 1UUMA 3H2MA 3BXWA 5G1MA 4P8XA 1BGAA 1B3XA 4KCWA 3L0KA 3L7RA 3JRKA 5CZ0A 1MO0A 3EB3A 1DJNA 4ZXOA 3ZXWA 1QPKA 1GJUA 2W4XA 5G2IA 3QKZA 3BGAA 2NX9A 4XZHA 4G56A 4GPNA 1AUSL 1WBHA 1J9YA 3UQNA 3C0SA 2H8XA 4P7OA 3FJLA 3JW7A 1AW2A 1ECEA 2G3NA 5BNKA 3OEXA 3L2MA 3IIOA 4DJEA 2VI0A 4MB5A 4H4IA 1P1XA 3S5ZA 2Z1SA 2JGQA 1TPEA 1JF6A 3U5YA 1AQHA 1M7PA 2PDCA 3T7VA 2Z2BA 1QI0A 3LBOA 3N11A 4JYFA 2JFEX 5JVLA 2NVCA 4V1YA 4YIWA 3GZ3A 4IIGA 4HNVA 1VHCA 3UZXA 1BVZA 4JIHA 4Y8EA 1TTJA 1WX0A 1AH3A 6ALDA 4MSSA 3HPXA 3B9EA 3MWAA 1QXLA 1U33A 3RK8A 3W87A 1OJXA 3XISA 4XUGA 3VNDA 6CGTA 4IF2A 3WSUA 3O6AA 3O3RA 1KBIA 1N82A 4I5XA 5CEWA 3G6MA 2ZE0A 2OT1A 1VH7A 2YCEA 2EGZA 5XIMA 3AZTA 5HOSA 4W5UA 2XN2A 3ME3A 1Z9AA 1R30A 4J1OA 3EOSA 1AD4A 3BLEA 1D3GA 3L4XA 4ATLA 1V5XA 4X63A 1P6BA 4HVXA 3GO2A 3GG1A 4Q6JA 1VYPX 2DJXA 2PCEA 5BRBA 2NV1A 2ZZ1A 3TYCA 4JQ2A 3S83A 4M82A 1R86A 1X6NA 2E68A 4WHBA 3C3NA 4EIVA 4A3UA 1RQHA 4GYPC 5AB3A 1X39A 5FIPA 4XQ6A 4R7WA 4GO8A 1LG2A 2ZRUA 3TA9A 1KWGA 3HGRA 3H4XA 2VR2A 3STGA 3SW6A 4DM1A 5ECVA 2FHCA 3L4VA 3IACA 3C2RA 5DRCA 1Q6GA 1HKJA 3CWHA 4W86A 2HNEA 1RA0A 2PF8A 3W7DA 1T8QA 3W2NA 3KHJA 2Q6ZA 5EA9A 2YOCA 1NFBA 4GI8A 2VC7A 4XZBA 2YCIX 1XGDA 2VFDA 1XBZA 1H1ZA 1M7OA 3LS9A 4C6PA 3EX3A 1UP2A 3MUY1 3WD3A 1E0TA 1NAL1 4EPDC 2EAWA 5ENLA 2XIOA 4L7ZA 1VBUA 1XXXA 1C9WA 4Z0JA 5JIWA 3VMOA 4K7YA 1AFSA 3FA4A 4DUOA 3EOEA 3OG2A 5A95A 4DX3A 1HN1A 1NWUA 1DV7A 2WVVA 2ZVIA 3F4CA 3C0QA 4C65A 4DZAA 4PTWA 3BDKA 3DHPA 3FDGA 3KBVA 6REQA 3S1VA 3MSGA 2V3DA 5AHEA 1G01A 3W7RA 1OG6A 1IGSA 4MY1A 7ENLA 4JS3A 5DRIA 2PDQA 2DT2A 3ZLHA 3I6TA 2VVNA 3WLQA 2IKHA 5C9RA 1D2KA 2E1WA 1QU4A 3PG9A 1O95A 5LIXX 4NG3A 4N6FA 4DJED 5KZDA 1XDJA 1U5JA 4G9PA 4RUBA 3UCQA 5EKYA 1OG0A 2YJQA 2YCLB 2BVYA 3QYSA 4H6EA 4KEVA 4L6OA 1QAPA 4JHOA 2ATMA 3A22A 4FX7A 3BV7A 1UZ1A 1E0VA 3H23A 5EL1A 1OX6A 4Q8WA 2P0IA 4W8BA 2IPJA 3S2JA 3FKKA 2HISA 1DP0A 5MHBA 3TUUA 1J4EA 4XAGA 3NPWA 1ZU8A 1Z32X 3BL3A 3WJWA 2QCHA 3LB0A 3SEPA 1Q6EA 2VEKA 4MWAC 3TN3A 1RP9A 3POCA 1HL8A 1P6CA 4HZMA 1CGXA 4K2SA 5C70A 4IL0A 3MMTA 2HPIA 2NSXA 1X6LA 3ZOAA 5SWUA 3FV9A 1OD8A 5IHRA 1Y8BA 4ONVA 1PUDA 4YTTA 1RR2A 3CZEA 5ABHA 3LERA 3W7OA 4EXAA 2J6VA 3OBKA 3CUHA 1EGMA 4KWUA 3GNPA 1SR9A 3S1WA 3LGGA 3DGBA 2ZUMA 2OQLA 1GJWA 4Q4OA 2WSQA 4D1IA 4MZ1A 1PYMA 2H9AA 4O1FA 3MJMA 3ZR4A 2Z2AA 1YXCA 2PD9A 1CIUA 4K8HA 1CB2A 1VHNA 4CCEA 4O18A 3W24A 1QW7A 4NYYA 4JTKA 4QTGA 3IAPA 3QW4B 5I3IA 1KM6A 3ZQ9A 1F7BA 5AECA 1F6PA 3MYOA 4MWAE 5F2IA 1GQJA 3DFPA 3EWYA 2WSKA 3NQ7A 3QMSA 2ZZ7A 3MMUA 2BMBA 1B3WA 3L5LA 4Y2WA 3POHA 3BG9A 4UFJA 3K4WA 4DF0A 3MSDA 1A0DA 2UY3A 1JCYA 3PBGA 3WF1A 1FWHC 3RN6A 2ZRXA 4C6DA 3CV6A 3M0KA 1L0PA 2G95A 5I3KA 4EPBC 3G1DA 3FN9A 5I03A 1J0KA 4ZFCA 4WIWA 3UXAA 1FXPA 3W29A 1ZJHA 3WEOA 1O12A 1IT7A 3E9AA 3H7RA 2TSYA 4TMBA 1XIDA 3PPFA 3PTMA 1CX9A 1XFBA 3BMVA 1AJZA 5IHSA 3B9DA 4LPCA 3P60A 3PR2A 3LX9A 1HUVA 4HYVA 1SO3A 2E28A 4DZ5A 1KTNA 4CQ8A 1IXQA 4LBUA 2PLJA 3MW7A 1W17A 4LUTA 3GS6A 3BV4A 2C14A 4WX2A 2Y5JA 3NTYA 3CTTA 4O19A 1ZZMA 3B04A 2QPUA 1O5QA 2DSKA 1FWCC 5ABGA 3ZIZA 3O2LA 3IV3A 2X8RA 3EMQA 2DQXA 4HYRA 3RR4A 3W88A 3G1FA 4AIBA 3EB2A 2JQXA 4MG4A 1PJ9A 4FXJA 1TV2A 4GI4A 4JD4A 3UA4A 1TWZA 2QJHA 1C8XA 3GFXA 3VNYA 2JBMA 3BAIA 3S6DA 3PTQA 3NZQA 1JCNA 4AZGA 2ASHA 4FSAA 4O50A 3WMBA 4U2ZA 4KKXA 4D6HA 5DQPA 3OLDA 2REQA 4F3HA 1ECQA 4NSBA 3MJYA 1Q6FA 1ONRA 2VGBA 1K9TA 4N9DA 1QVBA 1HP4A 3I4KA 5T9CE 1ZSXA 3UNDA 3A12A 3R43A 3IARA 1ME7A 4MLJA 2QCFA 3U48A 4JTQA 3EWWA 2CLHA 3SCUA 6REQB 1MEHA 3NAVA 2JKAA 3Q67A 2CBJA 3FDKA 2A21A 2WXDM 4PUMA 5B80A 3W07A 4LS1A 4ZGYA 1QI5A 2BLEA 3R79A 1WZAA 1SJCA 4NT0A 1SFTA 1KM3A 2SFPA 3S5NA 1XR2A 4Y9PA 1WPCA 3SUTA 4JY9A 3WDHA 1CLXA 3IGUA 1R5YA 4NIRA 1QATA 1YEYA 3PZ9A 3AHXA 2YCLA 3A3XA 3BOLA 4GUJA 2RJHA 4GYFA 1CLVA 4JQ4A 3OVRA 3HBLA 2QMKA 3WQEA 1EIXA 5CJMA 4NASA 5FJOA 4E4UA 3LPGA 3TFXA 3IGHX 4AX7A 5I3GA 2J62A 4UFKA 1F4HA 2HV5A 4WKHA 1OADA 3GTIA 4XV0A 1WA3A 3WQWA 1GZ1A 4YVXA 4CUCA 1CGYA 4HZ7A 5I3JA 4WQ6A 1J2BA 3H53A 4DO7A 4CU8A 3T0CA 1B4EA 1PDZA 1VEPA 9XIMA 5I0DA 2V38A 5LIWX 4GIAA 2VCAA 2FZ8A 3CK5A 1MYRA 1G9HA 1OM0A 1TJ0A 4AZ6A 3HB9A 2FTWA 1UWAA 3KZPA 4EKJA 5LHEA 4RV3A 2VL4A 4AZ5A 1EYEA 1HL2A 2OEKA 3H55A 3WQDA 5D9MA 3PJUA 3NVDA 3PP7A 3AOFA 2YLAA 3ARVA 2IQDA 4GJ1A 1V3MA 2A4AA 3PPGA 3ALGA 3LK6A 1F3EA 1EGZA 4MUPA 2I17A 2E6FA 2XIQA 4V2XA 2YDRA 2JKPA 1M1BA 4UMCA 3GK0A 1H0GA 2Y88A 1J8VA 5GQBA 3MUAA 3VINA 3AHVA 2C1GA 2D0FA 2PBOA 4KFPA 2XWEA 3UJ2A 3VO0A 3GDMA 2Q02A 1M9HA 5I02A 2C16A 1I2PA 4U31A 3WK1A 5LXXA 4I7VA 3TTQA 1IF2A 4PULA 4A3QA 2FHFA 1FWEC 1KFBA 1H1NA 3EOUA 1V79A 4GK8A 1JUEA 4GKLA 4KFNA 4IPPA 2VP8A 3WENA 1DXEA 2WZIA 4DJFD 4C7DA 3SCTA 3C2FA 4KBXA 2A7RA 3KRBA 3T1GA 1HTIA 2YW4A 1X7IA 4ZQOA 1TB3A 3HPSA 4JEQA 3NQDA 4RE0A 1JD7A 1JCTA 3EMZA 3VC6A 1KXHA 1W1A1 3A13A 4HOXA 2F8QA 5F4WA 3MUIA 2WHKA 4HJFA 2C91A 4HU4A 1UD3A 3CGTA 3ARXA 2VZVA 1H3GA 3PJXA 2Y63A 3MTWA 2PWGA 2YX0A 3VCRA 4O1BA 1K8XA 3WDQA 1GYMA 1FCUA 2AKMA 4IPIA 2WMFA 4F48A 2J25A 3WMSA 5DY2A 4XAYA 3LLXA 5A6MA 3VDHA 1WOBA 1A5SA 3AAMA 4L5ZA 3PG8A 4DQWA 4BCEA 3T0TA 1W91A 3LQLA 2WMIA 1G7UA 3Q65A 1XLIA 3O7UA 1YDNA 3SRHA 3W73A 2J8FA 1OIFA 1AW5A 3Q37A 3ITVA 3EDEA 3GDRA 1A47A 4PFMA 2P8BA 4DO4A 1ITQA 3WF0A 4GQBA 2D20A 4J3SA 3ITCA 4FEZA 1FHDA 5CC5A 3S1GA 3FOKA 2WMKA 2P10A 5HWNA 2FHBA 1TMHA 1SSGA 1OFAA 2A3CA 3L4ZA 4QDPA 4WXYA 3WLJA 1GONA 3W1NA 2HS6A 3CQIA 3KRSA 5T8GA 2CERA 3ABRA 3EEZA 3NURA 2Z26A 3W7LA 5GNZA 4B3ZA 1A53A 3PS7A 4QRNA 1RCQA 3HJEA 3VKCA 5EPDA 3FVMA 1YTKA 4C1NA 2IKIA 2VJXA 3LV5A 2A5HA 4C1NB 1EDGA 3OBEA 1TX2A 1VFTA 3I6EA 3IK2A 2FYMA 5BWFA 1EA0A 2E8YA 3HTWA 4UTMA 3T78A 2NT1A 1YRRA 4JEJA 2XDFA 3M4HA 4Z08A 3W75A 1KKOA 3HPFA 3NPXA 3L4UA 5E6ZA 4F2BA 3U0HA 3KFTA 4PMDA 1TWWA 6XIAA 1TRDA 1BHGA 4LAOA 1VEOA 4CQAA 3TA6A 1ME8A 1VCGA 5A3HA 2E9LA 3V36A 4C6JA 5HUPA 3TW6A 2NX1A 3MKCA 4GCXA 1QCWA 3KOZA 4CQCA 4IIHA 3UGRA 4ERAA 2WPBA 3QPEA 2CHNA 4NJKA 3CUGA 2CBUA 3AFBA 1M65A 4DVOA 2W91A 3UWZA 3OODA 1BGGA 3CQKA 3DERA 3EA1A 2P5NA 4BKNA 2Z7GA 3COTA 1H1YA 3VKDA 1S5VA 1M7XA 3OZMA 1U83A 4TOQA 1TZ7A 1W32A 2GQ3A 1G94A 2FZNA 3R13A 2D73A 2V2HA 1U5VA 2G37A 2R94A 4U33A 1TFVA 3GVVA 4AH7A 2LLEA 5EMUA 1UR8A 2VYOA 4ALDA 3LSCA 2Z1XA 4AF0B 2QPSA 5M17A 4KGJA 4DXXA 5EFDA 2PC8A 3PN8A 3GVRA 3N2BA 2PS2A 3TDFA 1GZGA 4AY7A 3NDOA 3OHMB 3RCNA 4BFAA 3KCOA 3PSVA 1S39A 4KW2A 4A2SA 3W25A 3EOOA 3OTRA 5BXTA 1MDLA 3TK7A 4PBFA 5DBTA 2CLLA 5GJMA 4NAFB 1HKMA 4MB1A 1Y65A 4MY9A 3KX6A 1KRCC 3TP4A 4DUXA 4REQB 1FHUA 7CGTA 4C1KA 3TCSA 4PODA 5AN7A 3VKJA 3KE0A 4ZOAA 3Q4DA 3N3MA 4J35A 3FSTA 1LDCA 1OFQA 5DT5A 5LGZA 1VFSA 3QR1A 1OX4B 2KAUC 5BCAA 1HF6A 1SZNA 1HQTA 3WJSA 1XC4A 4HMDA 5JH2A 2FVKA 1ZAJA 3J7HA 3BG5A 3GG7A 4KF1A 2WQDA 1UKOA 4MADA 4FXRA 3CV1A 3KOWA 3B0UX 5HNNA 3CTLA 2A2IA 3TTEA 4HN8A 2ZUVA 3B8IA 4Q8VA 1E51A 4O1EA 2BSLA 1CCWB 3MU7A 4QQ3A 1XYMA 2XGBA 2PWDA 4ZQCA 1H2JA 3W2MA 6ENLA 3UP8A 1Q6OA 4IGHA 3O1NA 1H62A 2JE8A 3F03K 1UP3A 4DEFA 1DJZA 3WZ0E 1P0KA 1BG4A 5E9XA 3N13A 3T09A 4ASTA 1UHVA 1XC6A 4QG8A 1T7LA 5CC7A 1CXIA 3UW6A 3NQCA 4Q4KA 4DI9A 1GOIA 2G3IA 2I56A 4HK6A 2PURA 4PGLA 2GVGA 4MZYA 2CFFA 3I4EA 1XCFA 2OO0A 2EPNA 4NAEA 5DCEA 3UEQA 4OQVA 3O15A 2QCLA 1XBYA 1SYTA 2X05A 1BRLB 3BAWA 1BRLA 1V0NA 4FA3A 3QKEA 1MXSA 3QV8A 3QQ1A 3ANUA 3O16A 1RP8A 2QMJA 1TWIA 1Z42A 4Z2GA 4MTVA 2W62A 1VIZA 3RM4A 4RLIA 2CZVA 3DBNA 1S2UA 4HHHA 3BMXA 4V1XA 2Z0IA 3A23A 1RJPA 1IWAA 4TO8A 1EC9A 2PBGA 1BKSA 3T2OA 2QF7A 1BWLA 3VFLA 1XSKA 4WGXA 3KP1A 1UR3M 3VM7A 3IS4A 3KOXA 3NSNA 2B0MA 4EF8A 3P0XA 4Z0SA 4IQLA 3CL6A 5CGMA 3W85A 4NZJA 1UUOA 3SY5A 3VKKA 4WCJA 1I0DA 5D9OA 2WM1A 2PDGA 3QRHA 5TD4A 4LS2A 1DE5A 4PB3A 1EHAA 4CD4A 2DZAA 1RBLA 2WHLA 2ZXAA 3KBWA 4GH1A 2C13A 4TU1A 3BICA 1GHRA 3ARUA 1PL9A 1VJZA 3ONCA 1VENA 4RL3A 3VIOA 2QUNA 4MIMA 4X9SA 3BVJA 3W6YA 3D6NA 4DO6A 2MANA 3BURA 1YLVA 3RITA 4GNVA 2VEIA 4B9YA 1GK8A 1NTHA 4QLLA 3AICA 4O52A 3AU2A 3DHFA 4IQEA 4JQAA 2BGQA 3W23A 2HE8A 3LPFA 2JF6A 2RUSA 2HEJA 3G2GA 2HBXA 1A3XA 4FLOA 3NIYA 3L21A 2PGFA 4KIRA 1V7AA 2ICSA 3W9ZA 2HNHA 3QV6A 1L9WA 3VDBA 3UR7A 4AZ7A 2J7HA 1HJWA 5AC6A 5KTLA 1Q65A 3UXKA 4FI4A 1IEIA 3O6DA 5F2GA 2XVKA 4E3VA 4OBTA 1ZS2A 4WY0A 2PDXA 1WKEA 1JUBA 2QKFA 2X0YA 3K8KA 8CGTA 4QITA 1WYIA 3RFAA 1R3VA 3GQYA 1TSIA 3UXDA 3GXIA 5CXPA 4S3BA 3L2LA 3MP4A 6A3HA 4FX6M 9CGTA 1ZCOA 1GUVA 4TV5A 4YL2A 3A3HA 4DBEA 5A6TC 2GQAA 5A8OA 4JXCA 4JR5A 2J7DA 3GDLA 2GGJA 3VD4A 4JQ1A 1SW3A 4F0LA 1POKA 3HG2A 1MEWA 1OVDA 2XINA 1J11A 3LXCA 3VOJA 1JXKA 4AD0A 1T0OA 1JL8A 4WOQA 3TJ4A 1OFOA 1RXOB 2PP0A 2VRKA 4O14A 1IXNA 3ZWSA 1JDDA 5I23A 3LZ5A 2C8NA 1EUAA 1PHQA 1R38A 1ZJIA 1H63A 3BSHA 1SR0A 4MKVA 2BV9A 5AC5A 2E6YA 4A05A 1ICPA 5FKYA 4I5RA 2Y8KA 1QNOA 2C7FA 3TN6A 3UPWA 2Z25A 1T96A 4B4HA 4DI8A 1Q3NA 5HWMA 1UG6A 1S1RA 6TIMA 3N2TA 3IVTA 3GTNA 3NO1A 1W8SA 2AL2A 3SQMA 4QG6A 1FWRA 4UIOA 1WDDA 3GR7A 3WG6A 1TVPA 1R9ZA 3DUGA 4OBRA 4A2RA 3W1UA 5H2ZA 3APTA 1HIZA 2Z1VA 1PB0A 1SFJA 5I7GA 1QHPA 4M24A 3KRZA 4F40A 2QCCA 3H2OA 2OXNA 1JZ4A 4O10A 1XISA 3PUGA 4O15A 1Q6QA 1WAWA 3W86A 3THUA 4R85A 4ZB2A 5BU6A 1TV5A 3G6LA 3P74A 1NWSA 1WKDA 1UWUA 4CQDA 2OSWA 1GG0A 4RDYA 3UETA 1KTBA 3RXZA 1FWSA 1T5AA 4N9CA 1E40A 1UD8A 4PBEA 3GNNA 2FMNA 4H8HA 4D8LA 4JX4A 4LCSA 4JYDA 5LSMA 3FNDA 1NJJA 2QGYA 3TSDA 1FCBA 1BF6A 3CBWA 2Y61A 2O9PA 3GTHA 1NSJA 1QNQA 3NO5A 4A21A 2Z24A 1KA9F 3N19B 3E74A 4M1BA 1ISXA 3OLEA 1FWIC 2XZ9A 1XJBA 3CLWA 5I78A 4H04A 4MFEA 1LRQA 4MDOA 4RZ4A 1PCKA 4Y6GA 4YMZA 4R27A 1YYAA 1NDZA 3V1HA 4AEOA 3I68A 5C0QA 1XLGA 2DT3A 1L6YA 1V0MA 1PZ2A 4BHYA 1AQ0A 3LBCA 4GYJA 2E25A 1YNPA 3K1DA 2NX3A 3MVIA 1RALA 4M6UA 1J5TA 5EU9A 3HZ3A 2QYGA 4W87A 3SAZA 5DXXA 1H7WA 3B9OA 2BHUA 4WJXA 5CKSA 4KCTA 1JPMA 3TZFA 2VX7A 1WNOA 3AYRA 2Z1BA 3UWEA 4CNTA 3VC5A 3DKJA 3LYEA 3LY0A 4DYJA 3MDWA 1B9ZA 1BSIA 4JIEA 3W7KA 3K1GA 3S42A 2WB5A 2Z28A 3GXTA 1L2UA 3MT1A 2ZUNA 4IP5A 1YMYA 3O06A 3LM3A 3AHZA 4C90A 4ZB5A 3CUIA 5D04C 5L9FA 1HKVA 4QJ4B 3ZJKA 1H61A 3NJ3A 3SECA 3QBUA 2XM1A 4QCEA 1PAMA 4YS1A 4DJDC 3T81A 2IPFA 2DZBA 4ZTXA 1QHOA 5E0CA 3KP0A 4KEZA 1EIBA 3TOYA 1RPKA 1MQPA 4NX5A 1SFSA 3QN3A 3CV7A 1DJIA 4RCXA 4H9TA 4UOJA 1JFHA 1SUXA 5BMWA 3DYMA 1WDPA 3EWCA 4WDWA 3U8GA 2E3ZA 5HINA 1MW1A 3EDDA 2PTDA 5T9BG 5DFAA 4L64A 3GXNA 4LUIA 3V5CA 2QLYA 4N9BA 1LRNA 1Q4WA 1A5MC 4XAZA 2YZ5A 3KBMA 3N4FA 1R3QA 3B9AA 3WNNA 1JCXA 5DEZA 4GUGA 7REQA 3IVSA 2V3GA 1DHKA 3SFKA 5A6AA 2VENA 2RDWA 1MQRA 3OP2A 3MDUA 1TTQA 3UZJA 4W5ZA 4AXKA 2Y4SA 4CNPA 1GOMA 1T41A 3AO0A 5REQA 3MB9A 3PPCA 4XBSA 4EWND 3HA1A 3THCA 1E4IA 3VMNA 3KS5A 1WP6A 4C7FA 4YXGA 1LOSA 4PEEA 4HMEA 4PUKA 3WNOA 3KVLA 2EO7A 5CPLA 1JG9A 1QPRA 3D5HA 1JCMP 1S5MA 3F2BA 1JZ5A 3CMGA 5FJRA 2CKRA 4HNLA 4EVZA 3LSBA 3L0GA 3PTDA 4HP5A 1HKIA 2ACRA 3PBMA 2QF8A 4XWUA 2X1RA 3CQ0A 4HPXA 2BX7A 1E43A 4OOUA 1GYLA 1V3JA 3CZJA 3A4AA 1G4TA 3CIWA 3NL3A 4CNSA 2GOKA 2FMOA 2CZDA 1OGSA 4QJ5B 1J96A 1MI3A 2AMXA 1E3ZA 5CPQA 3V35A 3QJAA 2WK2A 4DLFA 1RK5A 2F2KA 2YCKX 4LEQA 4PC8A 8TIMA 2XIMA 2DPEA 3BOFA 4L61A 1TPUA 1YPIA 3EZ4A 1W1PA 2X2GA 1REQA 1AK5A 1PWLA 3WD4A 2PDMA 2CWNA 5TBOA 2R24A 3OZOA 1D8WA 2ZZ3A 4FALA 4X3ZA 1LF1A 1OCQA 3GW0A 3JVAA 5K3VA 1IXOA 1FHVA 4HSNA 4L80A 3KM8A 2YA0A 4OT7A 4LRSA 1VAHA 5GNYA 1W2VA 4HQVA 3VZYA 2X7VA 1R2RA 1TV8A 3AUJA 3BWWA 1VBGA 4R53A 2VFEA 1S3HA 4BS0A 3H21A 1JCLA 4ZSUA 3OGSA 4NF7A 1CT5A 3KOYA 3BC9A 4RX0A 1KRMA 3W2KA 2CKSA 4WJ8A 4QHRA 3VOHA 1XH0A 5HJXA 3SRKA 3TQPA 2QPXA 4FLQA 3HURA 3QH2A 3T6CA 5CBJA 3WQFA 2INFA 1C8QA 2BY2A 4QLJA 1ELSA 2O92A 1VJIA 1FP9A 4ADSA 1XBXA 2V2CA 3IJDA 1P0EA 4KESA 2PFHA 4S38A 3SGUA 3WFLA 5TNVA 1GQNA 2ISDA 5LIKX 5A6LA 1C90A 2QV5A 2FIQA 2PZNA 2DU2A 2XZ7A 3VUPA 3VI2A 3EA3A 4ZCWA 4Q3MA 2RAGA 3BARA 3TONA 3RX3A 1CNVA 3S5OA 3R8RA 4LW7A 1GVRA 2X1IA 2BNJA 3A4XA 4AAJA 4L6HA 4E2OA 4QJ3B 2YXGA 2DZTA 1ITCA 2VZTA 1KR0A 4CN6A 5LHFA 2C1IA 3OZYA 3BOXA 1OIMA 4O11A 1W1TA 2YDAA 1EH9A 5BROA 2C19A 4JFWA 4OFCA 4QE1A 1TJ1A 3N34A 2GDVA 4XD5A 3PZTA 4GZIA 3VU2A 4AC7C 1YADA 4K68A 3RO6A 3T44A 4YYFA 3N15A 5I77A 4C6MA 5M1TA 5GVJA 3VDGA 4B9ZA 1RY0A 1UJQA 3B06A 4NQ1A 3BJTA 2TRSA 4XAFA 3WCZA 4N4PA 3FA3A 3GUGA 4O54A 3GIPA 4WEVX 2YL9A 5C2CA 4C7GA 3VE7A 3N25A 4PUJA 4R5EA 1ZFJA 2Y6ZA 2OT0A 4YTUA 3RU6A 4CCCA 1NFPA 3WLHA 2PP1A 2Y70A 3AC0A 2ONEA 3FJNA 2EG8A 1DQUA 1EP3A 4MY8A 4RXGA 1X96A 3H4GA 2OWXA 3VOFA 2PLCA 4I8YA 1OFPA 3W1AA 4B15A 4LSBA 3M0MA 1YBQA 4L1GA 3RUBL 1DIDA 2O4QA 3RM8A 1E6XM 1O4UA 1OZMA 2BOEX 1I1XA 4ATDA 2RHGA 3LLDA 3PULA 3AHTA 2FZMA 1MFUA 5EY5A 3TC3A 1QRQA 4AHPA 4HNTA 3P6LA 3R89A 3DOPA 1XUZA 3AIVA 2PLKA 1LT7A 3G8EA 2BY1A 1MVYA 5A1AA 2AMGA 3EXRA 2VD8A 3F7JA 5F4SA 3XINA 4C6LA 4XBJA 5K4XA 1XFCA 4FNUA 2NUYA 2V30A 1MFVA 3EX1A 3MPGA 4JZ5A 1E0UA 4XO6A 4YCPA 2R14A 1CDGA 4PBGA 2E6AA 3CV2A 2VX5A 7TIMA 3EDFA 3FGCA 2EKGA 2CLFA 4OHQA 1LYXA 5FJIA 2PUZA 1DJXA 3UXLA 2DJLA 3W7HA 5HA7A 4PMNA 2BS9A 2XWDA 4LUJA 3S6OA 4ZENA 4P8WA 2PGEA 1JXJA 4DXKA 4H00A 2V5DA 3NCOA 3M0VA 4QAWA 4QGCA 4GBDA 5FOOA 3IGXA 1XIIA