1C9JA

Bacillus lentus subtilisin k27r/n87s/v104y/n123s/t274a variant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVRVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSYSSIAQGLEWAGNNGMHVASLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE
publication title Engineered Bacillus lentus subtilisins having altered flexibility.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1c9jA00
3SICE 5FFNA 1SBIA 3CNQS 2SNIE 1SUCA 4NE9A 1LW6E 2DQKA 4DWWA 3AJ9A 3Q5GA 1SUBA 3DDZX 3WHIA 4ZOQI 4HVLA 2QTWB 2SICE 1AQNA 2ST1A 2Z2YA 1YJBA 1GNVA 1Y3DE 3LXUX 3DE0X 3LPAA 1AH2A 2E1PA 1KDVA 3WIVA 3F7MA 3P5BA 3BPSA 3DW1X 4K8RB 1IAVA 1P7VA 4DJ5X 1KE1A 4B5LA 2IXTA 2PYZA 3I37X 3BGOS 2X8JA 2X8JB 1C3LA 1SH7A 5JMOA 2ID8A 3EIFA 3GCWA 2B6NA 5AQEA 1UBNA 3H42B 1GTG1 4H6WA 4M1ZA 4GI3A 5B1DA 3CO0S 2G4VA 1GNSA 3TI9A 1THMA 1DBIA 1BFKA 2Z58A 5FBZA 3D43A 1R64A 1CSEE 2XTJA 1SUAA 3VV2A 1BJRE 3DE3X 1Y9ZA 2HD4A 2PMWB 1TM1E 1R0RE 3DE1X 2Z57A 1V6CA 1CNMA 1Y3FE 4H6XA 1BE8A 1TO2E 2XRMA 3TI7A 1SBCA 3DE6X 2ID4A 5FAXA 1SCNE 1SUEA 3SQOA 3OSZA 3Q40A 3LPDA 3BX1A 1AF4A 3DE7X 1T1EA 3VV3A 1TO1E 1KDZA 1TM4E 1PEKE 5ARDA 1C9MA 3DYBA 3F7OA 4BWGA 3DE2X 5B1EA 3D9QX 2IY9A 3ZXYA 3DW3X 1AU9A 4CG0A 1Y3BE 1VSBA 1ZVKA 1NDQA 1SBTA 2WUVA 4I0WB 1OT5A 3QFHA 1WMEA 2TECE 3WQBA 4KPGA 3QMPA 1MEEA 1Y1KE 2SECE 3VTAA 4C3VA 3T41A 1PTKA 2Z30A 1SBNE 1OYVA 1DUIA 4Z2AA 1GCIA 3GT4A 5JXIA 2P4EA 1EGQA 3HJRA 1KE2A 1SIOA 2WV7A 1KDYA 4WOBA 1GTL1 3DVQX 2PWAA 2SBTA 2W2NA 3GT3A 1SBHA 4AKTA 1BFUA 4C3UA 4DZTA 1Q5PA 5ARCA 4LVOA 1SPBS 5SICE 1PFGA 1TM5E 2W2QA 1WVMA 1PJ8A 1S01A 2PKCA 2DUJA 1SCDA 3L1KA 1R6VA 2ZWOA 2W2MA 5CW1A 1GT91 3EE6A 5ARBA 3VYVA 1BH6A 2WWTA 4OMCA 3DWEX 1P8JA 1SN7A 1GA4A 3PRKE 2PQ2A 1Y33E 3TECE 1YJCA 1P7WA 3I34X 2GKOA 2W2OA 1WMFA 4OMDA 1YJAA 5K7SA 1NDUA 4KB5A 3DVSX 1TMGE 2PWBA 4HX2A 2W2PA 3UNXA 1S02A 2PRKA 1TM7E 1T1IA 1WSDA 3AFGA 3EDYA 1TM3E 3GCXA 2WUWE 1SUDA 1Y48E 3F49S 3A3OA 2HPZA 1Y3CE 1C9NA 3PTLA 3A3PA 3DE4X 1SVNA 1C9JA 1AK9A 2DP4E 4ZARA 3DVRX 5JXGA 4KG7A 1AVTA 5AVJA 1GA1A 4CFYA 4NMXB 1GA6A 1NLUA 4JP8A 1WMDA 1TECE 1T1GA 5JXHA 3VSBA 1SCBA 1TK2A 1SELA 1OYOA 1AV7A 4LVNA 1ZVJA 1S2NA 1MPTA 4AKSA 1SIUA 1HT3A 1XF1A 1V5IA 1YU6A 2V8BA 1EA7A 4YN3A 5AVKA 3QTLA 3VHQA 1JEAA 1SIBE 1IC6A 2ZWPA 4CFZA 2Z2XA 3ZXXA 4H6VA 4OV6B 1Y4DE 5AMXA 4WOCA 3WIUA 1Y34E 3DE5X 2ZRQA 5JXJA 2Z2ZA 2Z56A 3I2YX 3AJ8A 4MZDA 1SCJA 4J94A 1SCAA 1A2QA 1ST3A 3LPCA 1BE6A 4NE7A 4FONA 1GTJ1 5I9SA 4RYDA 3I30X 1ST2A 1Y4AE 1SUPA 3A3NA
chains in the Genus database with same CATH superfamily
2G80A 1DTWA 4DQUA 1T91A 3GA0A 2I34A 3AX6A 3WRWA 3SICE 1RKVA 1X80A 2XMDA 4GS5A 4J4BA 2DEUA 4CZ2A 1Z12A 3BOSA 4FOLA 1IJFA 4CTJA 4HAIA 1FFEA 2FW0A 4Q9NA 1JHZA 2WFZA 4XSVA 4C89A 4OI2A 4RH1A 2HA2A 1L5OA 3D64A 3MCAA 3ZUPA 1E3WB 1OXUA 1M2VA 1YOVA 1DC5A 1RE1A 2EX1A 5IYZF 2WTUA 1JEQB 3BRWD 3R6GA 4MI6A 4BWVA 3HWX1 1NJ8A 2B34A 1T4CA 4G41A 1EXNA 5I8PA 1FTNA 1Q7TA 3QTBA 1TQ6A 4ZOLB 3O92A 1Y5RA 1JPVA 3CR3C 3PWKA 2HU8A 3ZHRA 4JQYA 4V1CA 4HDNB 1JHRA 4TMWA 4BB0A 1N36B 4MTLA 2BVNA 3NIWA 2NLOA 5A04A 3PXBA 1E62A 1GUDA 2BMAA 2NM0A 2V54A 3DZ8A 2BFEB 1J8YF 1HDRA 4LOJA 3LHKA 2P6NA 1QP0A 2ZULA 4CW7A 5HKKD 2YN2A 2NU9B 1XZEA 4PNHA 2X4LA 4C6SA 1IEVA 4RVDA 5KYVA 4RL6A 2NTYC 5I9NA 3V8BA 4IDDA 3DAGA 4NXMB 1PR9A 3CWCA 1SCUA 3LFTA 4UCFA 2RH9B 1DIOB 2M9MA 3AR2A 5EUBA 2ZYRA 3L8DA 1NQWA 1TJNA 1PK7A 1O94A 2J85A 1YVRA 4CTOA 2Z5FA 4Q4AA 5JD4A 1OXKB 1Z5OA 4CM4A 5KQLA 2GPYA 1G18A 4PNZA 1TZMA 2JCVA 4I3HA 3OSUA 3BQ9A 3I6ZA 4RK1A 1US8B 421PA 1P7PA 4TTSA 4WN3A 4AZVA 2H07A 2R0QC 4YV7A 4Y3UA 2FWPA 3DXFA 3MTAA 4OAQA 5EMJA 5JAOA 2X23A 3EIOA 3I92A 4ZRMA 3E9QA 1IM2A 1BGVA 1E58A 4OHVA 1O97C 2R87A 2QU8A 2OHXA 3FLAA 5JCOA 3DKVA 2AFVA 3GRVA 3HYTA 2E37A 3BIJA 1EFAA 2TMKA 4MS4A 2GEBA 4MR7B 1PLKA 2BR4A 2Z6AA 2RGGA 1RQLA 3RW9A 1JR3A 1E2FA 3K9NA 4X41A 3RANA 4UAGA 1W36C 1D5CA 3JYOA 4FOOA 6REQB 3X1MA 1GNLA 1PEYA 3UT5A 3L1HA 2I2AA 4F86A 1YI0A 2CSUA 3OZRA 2ZETA 2UU9B 4MWOA 4XGIA 4HNGA 2XWJI 1T29A 4IEIA 4AECA 3H6GA 3LPLA 1TQHA 4Q7QA 5JVDA 1FNNA 3SKYA 4RXUA 3WAJA 4W5RA 2J48A 1ID1A 1ND5A 1BQEA 2IE8A 1HETA 4JUCA 1YIAA 4DHWA 3TFWA 1DRUA 5IHPA 2XUDA 5J2TA 1J39A 1HMPA 2W2TA 5ITVA 5HCNA 5K6AC 1KJQA 4G26A 4JEUA 4MPTA 3D6VA 2O9JA 4O8ZA 1B6SA 3TTUA 5IDQA 1LJUA 3Q8MA 3JASA 4Y1RB 1DVRA 1I2MA 2ZI3A 2L17A 3H1FA 2GM4A 1C3EA 2XD9A 5IH7A 1Z8DA 3IVGA 1YUBA 3MD0A 1IBKB 3PFGA 3CH5A 3B1YA 4J6EA 5KEIA 2A4MA 2VHTA 3BMOB 4U7JA 4YIHA 1ZLYA 3PUHA 4MV3A 2P9QA 1PG5A 1BROA 1IFXA 1PHPA 1UJ2A 3DTNA 1OGIA 4K6HA 4KAXA 5AK5A 1LWOA 2R6DA 1VL6A 2WF8A 2IEGA 2ZYSA 2IHZA 4RQBA 4WOPA 1E94E 1RABA 2CJFA 2Y92A 4ZAYA 4P92A 3E5HA 1JSCA 3WK6A 1L0BA 2BF7A 4TTIA 2MWMA 2AI3A 2UDPA 1GTMA 2B2NA 1QWSA 3TBFA 4BQPA 4UUMA 3UKJA 2NVOA 3LFHA 4JVNA 4PSAA 3THOA 2XQVA 2ZTUA 5HUHA 2E9SA 3FNFA 3OJEA 3CPEA 3ZW8A 1XL1A 2J0UB 2QQ0A 1A3CA 1TXGA 3NNDA 3QBTA 2I2CA 2QRHA 4MKGA 4LYJA 5F35A 1WZCA 3RUEA 5K0SA 3M5PA 3SOPA 4EATA 1S2LA 2W11A 4P83A 4UAUA 5HBRA 2HCTA 3B70A 2KMLA 2QRQA 4KE9A 1NV9A 3W2HA 5IX8A 5G0SA 2VPWA 5DU2A 4M83A 1R7RA 2FDXA 3FGZA 1KS2A 2G77B 3M6MD 1YR1A 1PEKE 1NJ6A 4GKKB 5K8CA 1N7IA 3BFKA 3ANMA 5I5GA 1DKQA 3TKYA 4DA8A 5LD2C 4JI0B 1SPXA 1J9ZA 3R5XA 4PONA 2BGWA 5HJEA 5CM2Z 3BK1A 1YSCA 1RI5A 1ZMXA 3OD1A 3OOHA 1EXVA 3JWPA 4RKRA 2GCOB 1FJHA 5HZMA 3UN1A 2JCYA 3A25A 2FMKA 1C4KA 1Q1QA 1PZXA 3DW3X 1HMYA 3CBGA 3VR5A 1UBLS 1Z5NA 2JAQA 1M1YA 1WB6A 4N6OA 1ZU4A 1J2TA 3HCPA 4URVR 4ARCA 1GFSA 1GKIA 3D8UA 1OREA 1CDOA 4I9HA 5E9QA 1ZD5A 3UT6A 4NU8X 3S27A 3ZGYA 1CZNA 4AL4A 2E6KA 3HYLA 1LX7A 2AG0A 1IDOA 1NW4A 5U9CA 2C2GA 4HUQB 1VLHA 2PCJA 3CVWA 3RAFC 1T3TA 3ICOA 1I4EB 2ZS8A 4L78A 5B53A 2G0NA 3RE1A 1UZAA 4NV0A 1NW5A 5CURA 3UG7A 1P2FA 3BERA 3GOQA 3IOCA 1KEEA 2WJWA 2JIOA 4D99A 1VC2A 1H0SA 1V5EA 1OT5A 1M6VB 4JI8B 3OTHA 4DJTA 1JDNA 2N42A 1U7WA 2PVSA 4FGJA 3TOVA 2WDPA 3CUEF 3NR2A 2PMBA 5FJJA 2VTVA 3WQBA 3NALA 2JEYA 4NE2A 2GT1A 3RIMA 1VDMA 1FFXB 2P0AA 3LVQE 3E53A 4G5FA 4CMEC 1ZR4A 1PTKA 2QAGC 1I0LA 3BXHA 1OXSC 1IZ0A 1QE3A 1GAWA 5BUSA 4Y9UA 5AK0A 4MUKA 4GZ3A 1TIPA 4JL8A 5E6RB 5JYDA 3BJZA 3IGFA 2XMSA 2WJGA 1LY1A 3L06A 1GL3A 3ILYA 3LBYA 4ECAA 3W5HA 1O89A 4JL6A 4ZVVA 1K3UB 2NUTA 3LRXA 1XVAA 2W6MA 1C0KA 3M1IA 3E4DA 5JXIA 3GLIA 1BHJA 3A3NA 3R3WA 4J29A 5AW9A 4ZYLA 1Y1RA 4Q7LA 5JRJA 3PENA 4WD3A 3B1JA 4DT1A 4FI3C 2PVCA 4IX1A 2HHAA 5FTKA 2B8NA 1FDUA 1L7PA 1JFLA 1OWPA 2VAWA 4DCJA 2AFHB 1FQJA 1VI5A 1R0CA 4DA9A 2XQJA 4C2BA 4YRIA 2J0VA 2IUTA 2GDZA 1RBMA 3NP7A 1QHNA 2JH9A 4RV9A 1KE2A 1W1UA 5JFGA 5BQOA 1QPGA 4PRZA 2EBUA 5KWVA 2XXAA 2YJ4A 1JR2A 1VE3A 3EPHA 3OJ0A 1JFTA 4NBLA 2YY5A 2VSXA 3ZLVA 1H2XA 1UBUS 1ZK1A 3RVOA 4IEFB 1NMYA 1FJGB 4I3GA 4BUJA 2OT3B 1YUMA 4IFBA 1HTTA 2QG6A 3TNLA 3AHDA 2HMVA 4BO6A 3QVJA 3KJXA 3L6UA 2HIMA 3I6YA 1HEIA 3Q12A 4D44A 3QVWA 4HNAB 3WP1B 5EJ6A 4KC0A 4UEKA 4XLZA 4GD3Q 1W4BA 5ICFA 2FHSA 1ACMA 3JY6A 3QFRA 1YHNA 4JFRA 3LXXA 5CCEA 2C7VA 3L5OA 2VXYA 1LQUA 2QA5A 3PP8A 4LRSB 5HE8A 3UJ9A 5GJWC 1V8PA 1T26A 5BWMA 4MQEA 4BQQA 4MKRA 3TEJA 2EX0A 5FR1A 1AHHA 1PFUA 1ZOSA 3L6OO 4LXQA 3LTNC 2YTZA 1B2LA 2O59A 3R0IA 4OYHA 4TMVA 2ROQA 4GX5A 3TNJA 1R16A 4OY3A 4C4RA 4RWZA 3VUEA 4P84A 4HLUA 1W0JD 3ABRB 3EVFA 1L9KA 1X74A 3JWIA 1FMLA 5KOIA 1AMOA 4L85A 3VU3A 2PR2A 1JQ3A 4YRNA 3DMGA 2I8LA 5GINE 2H4YA 2CVOA 3OPYA 1ATZA 1TCAA 3QEJA 1DKLA 3ECAA 5ALRA 2W2XA 3HB7A 4FYYA 5FD8A 4AJEA 1OKKA 3SIPA 1YDMA 2E4XA 3LE8A 1QYWA 1XRPA 1MO2A 1XC7A 5CW1A 1KQGA 1GT91 1OZHA 2HRZA 2KX7A 2QTGA 2CDAA 3C3DA 3DR3A 3H9EO 1EMDA 4KFRA 3BMNB 3UXYA 4BP9A 2XDQA 4MUEA 2H08A 3EQ8A 1W5EA 5DSZA 4BX8A 4EYOA 4K46A 2K6GA 3TZKA 5LLTA 3DOOA 5AM0A 4DYDA 3V4RA 4LHSA 9ABPA 4WV3A 2QVZX 3BD8A 4ND8A 3ADOA 1E64A 2IYSA 1Y8RA 2ZSBA 1FDIA 4P4LA 5JAQA 3WB9A 4BEJA 1G0NA 3EODA 4L5CA 2N75A 4JLSA 2P1RA 3NVDA 3P7MA 1SXIA 4IKPA 1EXWA 1JIKA 1UBRS 5TV2A 1FFHA 1FMFA 1TKRA 2LUOA 4OFWA 2W6CX 3P9QA 4JJ6A 3TZBA 1DT3A 2Q3CA 5K45A 3WZLA 4XUDA 3V8EA 4DV0B 2WHEA 3I34X 2B82A 1U63A 2FHPA 4KX5A 1PJAA 2HMWA 2VYNA 1D0VA 6YASA 1UKZA 1WMFA 4JODA 5K7SA 1JU9A 5KOYA 2CEKA 3R77A 2P2DA 2V4UA 2C8JA 4OMUA 4QQNA 4OA8A 4JT4A 1KOLA 4TZ6A 4EUNA 1FA9A 5CDUA 2YHIB 3U44A 4M0UA 4XUCA 3G2QA 3HCWA 1WCYA 3A0UA 4M1OA 1B42A 3QF4A 1BX1A 1G8FA 4W63A 4Z4HA 1XDBA 1R00A 3OOEA 3ZDXB 3VNAA 3ZHBA 4BEWA 2W58A 2I1LA 3N2IA 4YRRA 2ZPTX 2J59A 2ORWA 3E7DA 2WMNB 2VRCD 2BFPA 3QUBA 1N5DA 4DV1B 2QVLA 2DPYA 4MR9B 2K4MA 5JSQA 2HPVA 3C6MA 3OP4A 1KBQA 4X6XA 3SJUA 3ZNPA 2KSQA 2YJTD 3EDYA 4MO9A 3LM8A 3RK4A 1QFJA 3BFJA 4PZPA 3TXXA 1EIWA 3A9CA 4S1WA 2ZT6A 3PUYA 1P33A 3UOWA 4X44A 4IKOA 4YLYA 1FW6A 2ZCJA 1RJ9A 3QMVA 4YCLA 3KYDB 1NPDA 3H04A 2C0CA 4F4FA 3FBWA 3BMCA 2QI9F 1LV8A 3PNVA 1Z4LA 4NDZA 1Q0UA 3CO5A 4M2LA 4O4IB 3KL2A 4KACA 1UP4A 4JZKA 2IXFA 4NATA 4ZIRA 4EO4A 2JG3A 2HAEA 1EVZA 3KQKA 1AK9A 5T4EA 3VZCA 4PYNA 2M6LA 1S9DA 3QLUC 3BCHA 2WTXA 4GRDA 4N5DA 3D8NA 4ESVA 4W6QA 3OIDA 2CFRA 3EGDB 2F9LA 3ITKA 4OCZA 1X1DA 3C24A 1U9YA 1DBRA 4KVAA 3WNVA 1KVSA 1SGWA 1CRPA 3G13A 1KAGA 2C9YA 2JIBA 1NLUA 2Y4OA 1ISFA 2IY8A 1JUDA 4UJ5A 1NJ5A 2C0PA 4GWKA 4DCSA 4LV5B 4HYYA 1V5FA 1L5GB 3ICEA 2PD6A 4C6RA 4F5ZA 4G0MA 5CT6A 3RNLA 4DTCA 3MTBA 4MP8A 2QENA 3DAOA 2WU0A 3IP9A 3PFWO 2VAPA 4I50B 2Q8QA 4CV2A 5F2OA 2XB6A 3ORYA 4N5IX 2QAIA 4ON9A 2WPNA 3P9CA 5INTA 2YUTA 3SXPA 3KQNA 3BKWA 4G9EA 1A4UA 4C4AA 2Y1LA 3F3SA 1ONNA 3DV0B 2EJUA 5ALUA 2PS9A 4ZOEA 1L7AA 1JWLA 3JPYA 3G7NA 2R86A 3NNSA 4TKLA 3TJRA 2ZWMA 4BFSA 3OT4A 3RSGA 1EAYA 4ISCA 3GGCA 1BVYF 1TYDE 2IXEA 1G4AE 3S8MA 5GIPE 2G0TA 5FNVA 1RPJA 3E5MA 3W05A 4B7XA 3ZVKA 4L02A 3W1EA 2ZJ0A 2C97A 4X7PA 4A8JA 3MCZA 3RK0A 3F90A 3NX4A 4MK4A 1R88A 4CFZA 4XWKA 4RXMA 3RGGA 3H3XA 5D8DA 4D4GA 4IKEA 1TYCA 2ZBFA 3MTQA 4R40A 5AVTA 3K0SA 1YR2A 1OLSB 1TO6A 1PJZA 1XTQA 2OCAA 3IAFA 2NU8B 4JNKA 2Q3BA 3UOAB 2XSZA 1FLVA 3K4HA 3M3HA 4GMFA 1HF3A 4AWBA 2HMYB 1QHHA 1XMIA 3NWJA 4CF3A 5A9SA 4MEAA 1VFNA 1L7DA 3M70A 2MR5A 3EGXA 1Z82A 3NDIA 4YAJA 1GQRA 4N0QA 3GNQA 1WV0A 4JBYA 3HBNA 3A4NA 2Y77A 4IDHA 5C18A 2VUHB 3N0WA 4Y9SA 4CLHA 5H4HA 3GY0A 3W7VA 5IYZA 2ZRKA 3KOOA 1PNOA 2DKFA 1ST3A 1RFLA 3VFDA 4DVGA 1R3UA 3BHMA 4LZNA 5KTKA 3VYWA 4BVFA 2QMUA 2JI8A 4POOA 2GWHA 2NT4A 2XA1A 3MGAA 3WLAA 3I30X 3S2YA 1VIVA 5ALDA 1ZK4A 2ZRAA 3CZ4A 4RELA 4KNVA 3CKLA 5CH8A 2M32A 1F38A 3V2GA 2E4ZA 4HWOA 2ZREA 1RAEA 4XARA 3FSEA 5BO5A 2AKEA 2FN8A 2O2SA 3MJVA 4JJZA 2WFLA 4ZQFA 4RUKA 1V3TA 1EJ2A 5FBWB 3LOUA 3SQDA 3BTSA 3UGQA 3ZHOA 2Q7XA 2D4AA 4YAUA 1LJLA 3RC3A 5ADWA 2H2WA 4P9NA 1NGSA 4A6XA 3GF4A 2D1FA 1A95A 1DTSA 1IB6A 3DKKA 3GN1A 4FOSA 4W9NC 1U0JA 3SQLA 4E07A 1M1NB 3N6XA 4GT1A 4M9RA 2XBMA 1SUBA 1E79A 2FP4B 5F1OA 4U6SA 4JLMA 2SICE 1RAIA 1S3IA 1Z33A 2V97A 2X9QA 1PGPA 2EF0A 3K15A 4MQUA 4PQFA 3S1SA 2RGEA 3BL5A 3V4PB 3MIIA 2X42A 1G63A 4JR1A 1NLFA 4M9QA 1Q7RA 1BS1A 2Q1TA 4FYVA 4BXOA 5AI9A 2JLCA 1ORRA 3DGFC 1VHWA 1AXGA 2B4QA 2BY4A 1O03A 1MFPA 2XA2A 3KHTA 5K3CA 3CZ9A 3F3KA 2YXPX 3GQBB 3F9RA 3MYRA 3DOCA 4RJLA 5DNYB 2GEJA 1U1CA 3INRA 4D9NA 4TM7A 4LYDA 3UMBA 4BMCA 2W8BA 3KCNA 2GGSA 3PZBA 1P7VA 2COUA 3N6RA 5BY2A 4RDXA 5K0BA 1PV4A 3GVCA 2BD0A 1D6JA 2ZZKA 3G0CA 3T54A 1UT6A 4XWYA 3E03A 3LKBA 1B0UA 1GQQA 5FL7A 3RF6A 4U02A 5CVVA 1YBVA 3NFRA 4KNWA 1XF9A 1T3LA 2GTPA 1JHMA 2R68A 4Y98A 3THXB 5CH3A 3R7WB 3ZWXA 1ZH0A 1ZZGA 1TEXA 2NSJA 1VMKA 3GJ5A 4YASA 4AS2A 1VGVA 3KS9A 4JI5B 4ZZ1A 2O8CB 5AKGA 4B31A 2RJ3A 5KTMA 1NKSA 1R15A 4XSGA 4R8MA 5FF9A 1OTYA 3I37X 2AD5A 2Z3WA 2WWFA 1HK7A 4NBSA 3KUKA 3A1SA 4O4LF 3RC2A 3HA3A 2WWXA 4YH1A 5JS1A 3FCUB 4F2WA 4B4VA 4M46A 4PYKA 1K3TA 5FEMA 6GPBA 3C6ZA 1XU4A 2Z1MA 3HEMA 1E3DA 1ZN9A 1PG2A 1IXRC 3I4LA 1W35A 1AUQA 1U3DA 3TAXA 1PT5A 3GFTA 1AN9A 3OOSA 2PMKA 3GMIA 3CCCA 3R6TA 1PGOA 2NZVG 4UM7A 5E6SA 4YCNA 4IDFA 1K75A 3NWEA 2FEAA 3ZYCA 2D5LA 2NU6A 2VQ6A 1DC3A 1MDFA 3MQ4A 4G63A 4H60A 3CN7A 4AS3A 4ZU6X 1GPH1 3KWLA 4YAKA 2QLLA 1IWOA 1P2UA 4XRRA 4FPXA 1H5UA 2EKQA 1ORHA 4AKEA 2ILTA 3BICA 1RJGA 2Z9CA 1E5VA 4QQKA 1R0YA 4PO9A 4EI9A 1EX9A 2AOWA 5CFPA 2XT6A 4TXNA 4F11A 3LD9A 3Q2KA 3OZBA 2V6IA 4INOA 2KS6A 5THKA 4DR7B 2JLWA 5CLFA 2G83A 3ZW7A 5DT2A 2F3SA 1G1AA 4AKGA 4Z4EA 2ZIEA 1KFBB 4BBAA 3AHJA 3N2GB 1F60A 4IGFA 2CW5A 3FAZA 3QOWA 3Q7RA 1KAOA 2GXSA 1WXGA 4TTVA 4UTZA 3IHKA 3TW8A 4BQNA 5BT8A 2JJQA 3VZSA 3RS4A 5J2UF 3RS2A 3N2NA 5IJWA 1Y9ZA 4KCGA 3OAAD 1YMQA 1JHXA 4QQ8A 3FPGA 4LGVA 1F8FA 5CT5A 1I3NA 4JLVA 1U0HC 1X7WB 4Z7OB 1IN5A 3TW0A 3VNQA 5HZKA 2O54A 1JILA 1FYVA 1NKTA 2Y1XA 4RTJA 1SXJB 3OD5A 3HFJA 4LYFA 1OI4A 5EE1A 4DRZA 2XMQA 4UARA 2IIPA 5SZJA 3V3TA 2W71A 4P3KA 1FFYA 3TWOA 5FO0A 1MO4A 2AV6A 1CJCA 1ZGJA 2IODA 4MUFA 4Z9AA 4GLLA 1M8PA 2V5AA 1NOIA 5JDIC 1ML4A 4GYKA 2JHCA 2BI8A 4E5PA 3IP6A 4IDAA 3NVAA 3HDGA 2O2DA 4ARZA 5IG2A 1ZVVA 4E2YA 4F3CA 1D7AA 3ET4A 3LUGA 5I48A 2XZOA 3IUBA 3NHUA 3CY6A 5JWRA 3U31A 4R2IA 3D0OA 4L16A 4C0WA 3M1LA 1NBHA 3QUCA 1BXGB 2H4HA 3GNTA 4NNPA 2R66A 5JZBA 4PR3A 1CQIA 1EFTA 1NBAA 1QX4A 1FF9A 1KEUA 1UQUA 2W98A 3KTOA 3Q40A 3QVVA 2CNNA 3E1GA 2IITA 3UWOA 3VR3D 4OM7A 4QFDA 4L9WA 4R8SA 3BFPA 1P1KA 4FUQA 2D0PB 1XKQA 1YC2A 1AKYA 1GT6A 1ZY2A 2SKCA 3R3XA 4H4CA 4EI2A 4WZAE 4IQ8A 1H2RS 1TO1E 2OQRA 2C5EA 3N9IA 3SZUA 1GNRA 3DBLB 1Z3IX 1T3GA 1WDMA 3DONA 1FTSA 3PUKA 4P2BA 1PS0A 1LF5A 2FYTA 1CZKA 2ORIA 3CMMA 1U8TA 2BKLA 2YVQA 1E0JA 1BEEA 3CZAA 4RPJA 1T5HX 2YZGA 4AJJA 5FHQA 3H1EA 3DE2X 1QO0D 3ZE6A 5P8WA 1BDJA 4E5NA 3X2SA 4Y18A 1VHTA 4JX8A 4PLZA 3T5MA 4D41A 2QMZA 1DQSA 1YRLA 5LBUA 3RS5A 4YMGA 4FGKA 1YZ3A 3K6SA 1FXSA 5ULLA 1Q11A 1Y8AA 3ZVNA 3FCAA 5EIWA 1QIGA 2PIAA 4P8RA 3N87A 3FSGD 5AUOB 3UC5A 2QLJA 3I52A 4YMHA 2QX9A 1LPBB 1XTUA 4PO8A 5CDHA 5CIYA 1Z5WA 1DO0A 4RPLA 2DU8A 1CYDA 1YR7A 5JISA 2JFGA 1HE1C 3H4IA 3FMOB 2CZCA 1TKAA 3OC6A 3TPCA 2VTBA 1GTSA 1HNNA 4MI3A 1Z34A 3IDAA 1C1DB 1TJ4A 4F97A 2X19A 3VO1A 2E21A 5GGXA 4XD2A 3CEHA 4CQMB 1MEEA 3F67A 3K9BA 2VNIA 3A2LA 4J6FA 1Y1KE 3ZR4B 2F8LA 2BI7A 1RXVA 3LT0A 4C3VA 1BNCA 3GZNB 1Z29A 5EIFA 2Q1XA 4Q4LA 2P62A 3GLRA 4C43A 2HRCA 1PTJA 3PRJA 3ICQB 4MDHA 1XK6A 4UDNA 4EHAA 1LPNA 1E2PA 1G19A 2WABA 3QPDA 4MWDA 2NQ2C 4DCTA 5CJ2A 5KJFA 2OXEA 3KB8A 3TGLA 3PEWA 3JARB 2J1LA 1OT3A 2JCGA 2H1WA 2XOXA 4F46A 1KJYA 3FYUA 3OPXA 4EW2A 3H05A 5JNUA 3FZYA 1N6LA 3DZJA 1YASA 4I66A 5HQJA 3FVRA 5K0GA 3OCYA 2NZXA 4N54A 4HLNA 4WGGA 2RGUA 3NJ8A 1GQFA 2GO7A 4MRMA 1UWKA 3D0RA 4CKBB 1PZGA 2X0EA 2FDRA 1I6KA 1A9ZA 3K1ZA 3MS7A 3V9AA 1I3KA 4P7GA 1LPSA 2GD6A 2EJTA 3DYIA 2WV7A 2QL6A 4XJSA 3GH3A 4R1LA 1R0XA 3LDHA 2IEYA 3VU9A 4MICA 5DTRA 4JMLA 5HCUA 1I94B 2IP4A 3HUEA 1PT6A 2HYDA 2CLMB 2RB5A 1DELA 1Q1NA 3LMKA 5FYDA 2FWAA 4JCCA 1PGQA 1KI9A 2FN7A 1BWPA 2NZ2A 3CRRA 4PLVA 2W2NA 1V35A 4BO0A 3B60A 2RAPA 3I6QA 1ESCA 3GT3A 4PXAA 4RWEA 3BFVA 3WNBA 4BU1A 2CLFB 2BFDB 2PXAA 2GPWA 3U7JA 5A4AA 1XPRA 1BOOA 4ID9A 4YO8A 2E4WA 3O8LA 3UHPA 3ETNA 4R2HA 5L51A 5AESA 4UNQA 1KHHA 4Q7EA 3ANSA 4V0QA 3UATA 5C81A 1C1XB 3IAAA 4UHBA 2H6EA 2IHTA 5KDDA 5EXDA 2EVWX 3VKWA 5J4VA 2RGDA 4D25A 1UC4B 1NHGA 4EA7A 4A36A 2ZYWX 3SJ7A 1PJ8A 5JLAA 1O5IA 3K9LA 1TZKA 2DHQA 4IBOA 4K9KA 1QE0A 3C97A 1QHYA 3MF4A 2J3IA 4NBRA 4Q34A 5EQTA 4C29A 1O0CA 4LF5B 2Q5IA 3U37A 5B30A 2FB9A 2XI4A 3QWBA 2I2WA 1GDDA 1HSOA 4IWXA 4UOQA 5ALFA 3WMXA 4RTNA 3G8BA 2HN9A 4O02B 4QGHA 3FHCB 2DPLA 1D1PA 4UHDA 3JQ9A 3EE6A 4BCBA 2D59A 3M9LA 4OUDA 4PLTA 3RJ9A 2X1LA 1Z38A 1PZHA 2ZJ5A 1NIPA 1DBPA 1HT0A 3D0KA 1SQFA 3DTVD 3FKJA 3OIYA 3FOEC 3PT9A 3KIPA 1JXMA 1MQAA 2H54A 4GKAA 4PTYA 3T5TA 3NC1C 4B85A 3HCAA 4K6CA 1E9EA 1E1MA 4JQOA 1KJNA 2XXBA 3A1VA 1P77A 1LVUA 1O2DA 2CWDA 2NUAA 3BF7A 1P8JA 3M8KA 4QTZA 1Z5GA 1ISPA 1KAQA 1V11A 5DHQA 3WDMA 2VZLA 2HYIC 3BIWA 3D31A 1SHTX 4FBGA 4Y6QA 3QLUA 3G68A 1WABA 2M6KA 4AJIA 2ZTVA 1DIRA 3VR0A 4CLOA 121PA 3KJHA 4L5YA 5FP0A 2HA6A 3VOSA 2XUJA 2ZIXA 3BDIA 3AB7A 3HKEB 1L8QA 1YBHA 1G20E 5LA6F 2J46A 2XCSB 1Y1SA 2DECA 1YZFA 4ZVSA 3OQJA 2OORA 1PNTA 3GNLA 4NLLA 5IPFA 2YUIA 3JAWA 4J2TA 4J1NA 2O14A 3WLIA 5HNKA 2ERCA 1BXZA 4BVLA 4BGUA 5JATA 4DC1A 3ZV5A 5LBTA 3C3JA 1WW2A 4IIUA 2BFCA 3TQOA 2PX0A 3L0CA 3U4IA 4LN1A 4RULA 3G17A 1XU9A 4ZC8A 5JASA 1R3DA 1PN3A 2WB4A 1TMGE 4QPPA 3SR4A 3VOBA 4QFCA 2UZ0A 4YYZA 4YCBA 2QSUA 4G1MB 1HDXA 2FWMX 4OP2A 2FEMA 5IBQA 1ID8A 3PWZA 4L9RA 4RSHA 3GRKA 4CKYA 5C5EA 2YS7A 4QYTA 2HI0A 2PUEA 4DNQA 4A0GA 3O4FA 1I2ZA 3PI6A 1X1QA 1HO3A 4FCTA 4MAMA 5EQJB 4ETWA 3A4LA 5AKZA 4AO6A 1IU9A 1SHUX 3TAHA 3RS8A 3O3MB 2QK4A 5AJZA 3NBMA 4W6ZA 4R0MA 3AYZB 1SUWA 4E11A 2C1XA 3EYWA 4U8GA 4I1OA 1BW9A 3ZX4A 5K51A 2ONZA 1W0JA 3KTDA 5IZCA 1OBHA 4B3GA 1VL5A 2V7PA 4D9FA 4G85A 4KUHA 5EEGA 5AHXA 5FI0B 1RVDA 4A2QA 2A67A 5IUNC 4B3JA 1KVTA 1Z4PX 2XCLA 2JZOA 2NQTA 5BMVA 5C52B 5C51B 2QXYA 3AB3A 3GLVA 1GXSB 2LTAA 3H5WA 2PNJA 2O8BA 3TRIA 2JATA 1E60A 3CN9A 5L53A 4FYMA 1Y42X 3A58B 4EKYA 3P4XA 1ETUA 1J8QA 2ANCA 2O23A 2PTHA 3FCXA 2Q29A 4Y2SA 4MVJP 3FCCA 3GFQA 4NU0A 5EWMB 5A71A 5KNBH 1XTIA 2O06A 3WYBA 5FV4A 4NYMQ 1ZGGA 5DGIA 4D3ZA 3OTIA 3WJ1A 4FWTA 3AL2A 2OBFA 4BNNA 2VSYA 4K6KA 4K3UA 3FPSA 5AJXA 2XMZA 4PLGA 3CTMA 3KKMA 4URHA 1ODLA 1XUOA 2X0IA 5FPPA 3BWEA 3TINA 3GIDA 3TVDA 3A6ZA 4AZTA 1SCBA 2NSDA 1E8MA 5H82A 2Q2VA 4BP1A 4ECEA 3T99A 2P7HA 3KSBC 2D7CA 2YC2C 2PUWA 1FFCA 2BE7A 1FPMA 2A9PA 2QL5A 3AEYA 3PGVA 3JU3A 4B8YA 4E30A 3RSFA 3TSAA 4GWGA 1XRLA 5IC4A 3Q7EA 5LP6C 4DDHA 1UK7A 4RMNA 1I7QB 4N0EA 3PU6A 3EIQA 4PN7A 1IM5A 2RAUA 3IERA 3KAKA 3CEPB 2GZ2A 1EKXA 5KYXB 1ZEJA 4RKYA 1DBQA 1MKYA 2H3EA 1XCMA 4Q21A 4G23A 4WLVA 5DLYA 2R47A 1OW3B 1A8QA 3BZUA 4OH7A 3MJTA 2A9FA 3Q9LA 4MW0A 3UK0A 3WNCA 4A8PA 3BMQB 2X9LA 4M3NA 1Y4UA 1EWYA 1CEQA 2NXEA 2ZRQA 3QI7A 4YRDA 3ZCPA 1JHAA 4RGBA 3CJRA 3D4PA 4XIGS 3RD5A 5EIAA 4CIDA 2NG1A 4YAIA 4EF4A 3Q4GA 1H2WA 2VS1A 3PQCA 1RQGA 2C2WA 1GKYA 3IJRA 3KP1A 1K63A 1WCV1 2J7PA 4QU8A 1VYTA 5FWYB 1D7OA 1IBMB 4D3YA 4DNFA 3CUUA 1XKLA 1BRMA 3P8ZA 2XT0A 3IEUA 4AC9A 1RI2A 3E6AA 1C7JA 1FYWA 2NYVA 3ND8A 4Q1CA 1KZYC 2C7BA 3NS7A 4JUAA 2G5GX 3ITNA 4BTLA 1TU4A 2FLVA 3KTAA 4K0RA 4YPOA 1PKEA 1DDGA 2P2LA 4B7UA 2OAQ1 1GTJ1 2GUWA 4K8OA 4TL6A 5I9SA 1QC5B 2YL2A 3L0IB 4KR9A 4CDGA 3RYCA 4HWKA 3WLSA 4D4IA 1FYXA 4O63O 1LRLA 2R1TB 2BKEA 4QGGA 4EFMA 5EIXA 2B3DA 1FDWA 2DOKA 5CIWA 1KSGA 1XA3A 3L5KA 1UZMA 2YZNA 4OB7A 3T7CA 4HQFA 3TZHA 4HYTA 3W4KA 4D9CA 4GBGA 5GY7A 5JUWA 2XNKA 1DTWB 5MFPA 1I3LA 3OA0A 3GPIA 4UQPA 4DIOA 1BMTA 1XJQA 1T5OA 1RTKA 4NOMA 4D9HA 1V6SA 2ZBUA 3AW8A 3MCTA 1X80B 2CCKA 4UKDA 4BKRA 1XLWA 2PX3A 3L0SA 1SUCA 4MVCA 3DL7A 4Q24A 3NTQA 3CB4A 3ISJA 4TZ0A 1U2TA 1JW9B 4HNUA 4A92A 4UVHA 3R6DA 3H11A 1ACLA 3TSZA 1M2VB 4J9VA 4L4UA 5FOXA 3NGXA 3TSOA 3IP8A 2JFVA 3UYLA 3GGSA 5C4GB 1T4CB 3DTTA 1D09A 3OH8A 4WI1A 3X1YA 4UBMA 3UB3A 5JC1A 1PFVA 2E18A 3ZK9A 3DFKA 4O4LA 1YZNA 4WY2A 2INGX 3NVMB 2GPAA 4HDKB 4AJHA 2BELA 2PBFA 3A6DA 4XIFA 4R41A 3OIFA 1RLUA 4D80A 2YJ6A 5KNDH 4K9RA 5BYJA 1KDVA 3WFIA 2BSQA 1ZI6A 4RPCA 3W6PA 2ZWVA 3WQQA 2P41A 3Q9SA 4D8XA 1PL6A 3FAKA 3CCBA 2ZYAA 3W9UA 1BA2A 1CIVA 4KZPA 3HEAA 4PSKA 4AY6A 5D1HA 2HJGA 1SCUB 1YS2X 2IXTA 3D4OA 5EL0A 3X1KA 1RP7A 4NBUA 5FOQA 2PA3A 3GRAA 2KBEA 4TZTA 5T4BA 1L6RA 1WUIS 4KMOA 5G2OA 2XZDA 1E7RA 1YD7A 2PYZA 2AE2A 3KXPA 1MZVA 1IDN1 2HA3A 3OCZA 4RF2A 3VZDA 4RX1A 2OENG 3OI7A 4CM4B 2I78A 2VF7A 4NHOA 2B7LA 3I09A 4XWAA 1LDEA 3M6IA 3F2VA 1EJ6A 3INNA 2GILA 2VATA 3OFJA 3KT3A 2KQUA 3QSGA 5B57C 1L5QA 2MINA 3EEYA 1E1DA 3RADC 1L5VA 1X8LA 2AXEA 2ZUUA 2RGNA 4HAOA 1C8KA 3TMYA 5J2UA 3PE4A 4WLFA 4FZ3A 2ZJ4A 5EXSA 3SBXA 2PLRA 9LDBA 1JVNA 1B14A 1PJSA 4UEQA 1GILA 3WNDA 1HURA 3OC0A 2CHQA 2FFJA 3LK7A 4MS4B 4G5HA 1CCWA 2B6NA 3ZTWA 5ADUS 5JJ5A 1F12A 3IQXA 1SY7A 5GAJA 2OZKA 1EU1A 2GRJA 2FZ4A 3K7EA 5D7BA 4DV5B 1XQ6A 3FWHA 4KQ2A 3ML1A 3UT5B 4U9IS 1DKPA 2EBFX 3AHEA 4K28A 4RGYA 3VHLB 4YV2A 3CA8A 3FNEA 2ZJ6A 3DEIA 3BB3A 2Q1UA 1N8KA 2A5YB 4Q9DA 4W8HA 5AJVB 5DTQA 1HFKA 3TCKA 2BRUA 1ZL2A 2JIPA 5JVDB 1GNSA 4MRNA 5DBEX 4C21A 2VUIB 3Q7SA 3H9QA 5DLPA 2ZE6A 2L69A 4AP6A 2G72A 3RU2A 3D4BA 5DLDA 7REQA 2C7RA 2OBMA 1RLJA 3HKDA 2VG8A 1ZITA 3FNRA 7YASA 5J2TB 4O2BF 2ZDHA 3CGWA 1P5FA 1P2SA 4P4TA 1FOEB 3BGSA 1RADA 3SAJA 3AM1A 2PH1A 1R0ZA 2YOGA 4FGUA 3SMQA 1TEZA 3NYIA 3KEMA 3P0RA 4LY0A 4BFTA 4K3VA 5TQ0A 3VV2A 4NJOA 3HEBA 2J30A 4ZT2A 1KRXA 3WZMA 1AKUA 4QRHA 3UJAA 3H1AA 1E77A 3AF4A 5HDQA 2ECQA 2HO4A 2JAOA 3QXHA 4LDRA 3NBAA 4A0FA 1VL8A 2HFKA 1U8YA 2PLNA 2H00A 3FMFA 3I5MA 5DEOA 1FP1D 1SR8A 2Z8YM 3OKFA 4HN4B 4JOCA 1JNYA 1R6AA 3A6HA 4II3A 4REMA 3WRYC 2OGWA 2XOEA 1WQ3A 1DRJA 4IJ6A 2PZ8A 3PQ7A 3V3KA 1QP4A 1K5GA 1N4DA 1X9IA 3FWYA 5DM1A 3VI3B 2XE8A 4RTLA 5TS2A 2J6IA 4P53A 1Q77A 3P0EA 3I1YA 4HFJA 3ENNA 2VUTA 2RHOA 3L8YA 3RVKA 3U5TA 5E4JA 1CT9A 2DHEA 3IAUA 1CS0B 3KZ1E 4V02A 3PX3A 4CMCA 1ZJYA 3C7TA 1PDWA 1IZZA 2A3NA 2G9UA 3EEIA 1Q95A 4RY8A 5EYPA 3MCUA 3SQOA 2ZJ7A 4DCNA 3P9RA 3INTA 4DSNA 2ZBPA 1HC7A 2CNLA 3JRNA 1OC4A 4BVEA 3VZQA 1ZX1A 4TXMA 2BM9A 1G8SA 1XXHB 1ZJ6A 4ZVKA 3ONVA 4QUHA 1XN4A 4YAGA 1ONSA 3OUTA 3VJRA 2VC2B 1P9NA 1G8GA 3DMYA 1RHUA 2RSLA 4PO3X 4Q3AA 5HRUA 1UXOA 1QQTA 3AC0A 3K53A 5CB0A 4BY9E 2Y99A 4B79A 1N1DA 4BFUA 2QSJA 3RFVA 1DAFA 1AKVA 2VPQA 3FHJA 3C8DA 4EKDA 5IJ9A 4BAUA 4KN5A 4NULA 4PQYA 3WJ7A 2CSXA 3V32A 2G06A 3UMRA 2VZ0A 5L7WA 3BFXA 4Q3LA 4DBLC 5AOVA 1EX7A 3CXUA 3NJRA 1H93A 3QXCA 2FPIB 3D2BA 2VN8A 3AFNA 2WMYA 3MJFA 3O83A 2WT8A 5B58C 3ENQA 1OX6A 1M2KA 4CPDA 4QQFA 4KREA 2FMIA 2CBXA 1Y3BE 2BUBA 4KO4S 4DGQA 1R6UA 1SKUA 4H6PA 4J3JA 4LX8A 2VF5X 1HZZC 4CGYA 4E51A 1Y0BA 4ENPA 1CU1A 1TRHA 4F4UA 1KEEB 2CJWA 2I6FA 3B5JA 1SK8A 4IINA 5CNIA 4IOKA 4LJKA 2COKA 4KSBA 5AHWA 4LTNA 2IGBA 5BV2P 2MYUA 2DT8A 1CW2B 3A9RA 4JH0A 2PRYA 3OAAA 4MVWA 4ZI2A 1PWEA 4RHFA 3V2IA 1OFIA 2V7GA 1K0UA 5EG5A 3HMKA 1U7UA 1R37A 3L3BA 1JEOA 4ILKA 3RVBA 2FN9A 1CQXA 2QD3A 3WBJA 2HU7A 2YVAA 1A9QA 3L8GA 4L3OA 4PBTA 2QTHA 4JOQA 4TXHA 4I1SA 1RLOA 3CNNA 4LIPD 5M34A 1LZKA 3SEFA 2G9RA 3EHDA 2WHYA 4MH0R 2LIVA 1Z56C 2ZROA 4CKWB 2Y6UA 1OWOA 1JQAA 1Q0RA 1MX5A 4P22A 4RVGA 5B3AA 4ZTUB 4PM4A 2Q5JA 1K8ZB 3KNZA 1A4IA 1NVXQ 1J2EA 4B9AA 5DOZA 3B3FA 4BVAA 2QQEA 5FI5A 2FSGA 4DT1B 4IR7A 1ZNQO 1VSTA 1AUPA 5KJ6A 3HJRA 3PT5A 2TMYA 1FMJA 2PH5A 4X92A 1YB2A 2X8WA 2VBGA 4MGHA 3TLXA 1IEQA 3WLFA 2YJGA 1A7JA 3D5QA 3H0EA 1TTHA 4IG9A 4BNIA 3KO8A 1E9DA 4CV0A 4JP2A 2O8DB 5JCXA 4B76A 2BEVA 3TD2A 3FFWA 2GUGA 3I04M 3K20A 4B0OA 1CIPA 3QWHA 3MPUA 3WMWA 2P2SA 4RTPA 1GRRA 1I33A 4EG5A 1F7VA 1XDUA 3I8OA 3H18A 3FYDA 1E5QA 2ZP1A 4MHSA 3IB6A 1XSEA 1JPJA 2P6PA 4NFSA 3HXKA 1BU5A 5I8ZA 3RB8A 5DHTA 4UE2A 5ILOA 5D6NA 5EJ5A 3VA7A 3PRYA 4MCJA 2NYRA 2VYVD 1QO0A 4YBZA 5A3QA 2GLTA 2PGNA 2J5QA 2PUCA 3GIWA 4EB8A 3ZWOA 1TCCA 1F8YA 1QG4A 1POWA 4HL6A 4MQEB 4WZ6A 5AIAA 3ZE8A 3WNQA 1PFGA 2G09A 1SUSA 3JQBC 4JELA 4Q5IA 2CVPA 2CLCX 4RJIA 5KS2A 3FSGA 4Q3DA 3ZK8A 3T6KA 2MYNA 3EIUA 1V7QA 2F3TA 4QARA 4EI7A 4PRLA 2IEZA 3KEGA 2Q0XA 1JXQA 2IZ5A 1HG0A 1KO5A 3G9ZA 4IJ5A 4IL5A 3VH4A 4AJ9A 5JAZA 1TW2A 5IDXA 5JROA 1BDMA 1N1MA 1OOEA 3B7WA 3OPYB 4KVGA 2XWBF 1R6VA 3NNNA 2PJUA 5T6MA 3FI0A 3OTQA 5IBRA 5C4MA 3DZFA 2GJ4A 2Q4OA 4BHTA 4U2FA 1KK3A 4MPPA 1BYIA 5ILQA 2R6FA 4QUDA 4GYJA 2OV8A 5THXA 2PQMA 3KD2A 4DLVA 4W7SA 2FSSA 1BH6A 1I24A 1LLCA 1NUTA 1Q74A 2XDQB 3KR0A 3LH5A 4FSXA 4M38A 1QH8A 4JB8A 4LZJA 5D00A 3UM9A 4EBFA 5EJMA 4EGQA 1G4HA 1SD1A 2QVGA 2XV1A 4OQDA 1XMSA 4WZAA 4C0XA 1TTQB 2YINC 4BC1A 5CLGA 4BNLA 4DAEA 1NJGA 1H4QA 4DMHA 3HR4A 4KFSA 1DMSA 4D81A 3FE2A 3G0GA 1JG6A 1W19A 2H29A 1AKMA 2WM8A 2IIBA 3BB1A 2F55A 2BEUB 2P6UA 2HDOA 3DOFA 3MINA 3URMA 1NBOA 1W2WB 2L82A 1GPJA 3PUZA 2G82A 1N78A 3ELYA 2ATCA 3EZ6A 3W8FA 4PNEA 1K6XA 1E1LA 2QX6A 2WJ6A 2Z3VA 3CQ9A 4TYPA 3JQAD 3AVQA 2OILA 1XEAA 3SR0A 2H5IA 5T3YA 4ZODA 1AA9A 2W2OA 3KKOA 4LXXA 3ER8A 3IE0A 2CLDX 2ISQA 2KJQA 4HI0E 4YQEA 1T24A 5F4BA 3A9TA 4J76A 2OUIA 2ZUBA 5IASA 4PSCA 4N5MA 3PNYA 5DNVA 3G02A 3G2KA 1ZINA 2F6RA 3CPSA 4DY4A 3ET5A 4QUGA 3GR6A 3TQTA 2AH5A 3BTVA 1MF7A 2Z08A 1K89A 4XJXA 2V0GA 3L6DA 4RORA 3FOWA 2NO4A 2AG8A 3OE4A 3QVMA 4IMRA 4BRZA 4YV1A 1B8PA 4EEXA 5A2QA 3EUFA 3FDZA 3H4TA 4FMDB 1O7JA 4KYUA 2XUPA 4NEGA 4EELA 4WK2B 5DM0A 1SVSA 2Z4TA 1T5LA 3IVAA 1OAOC 5LR6A 6ABPA 1GUFA 4BQFA 4X0EA 2OSVA 1AG9A 2Q5CA 4YP9A 1FDTA 1WXFA 2IYVA 4Z99A 4AF6A 4BBJA 2VK2A 4CF4A 1OH7A 1DFHA 1JDJA 1M54A 3KLMX 3HI6A 1C9KA 2B98A 4MKHA 2I2XB 3JSXA 4R51A 3SFVA 2W9XA 1RM0A 3IYLW 4M1WA 4XQ9A 3V1LA 3K6JA 4RMHA 3K9QO 4KVFA 1T3HA 4MWSA 2IZOA 3OIWA 3ICCA 1K8XB 1R6BX 1A9OA 1RJ9B 4PAQA 1QK4A 3IURA 3M4JA 1MJNA 5CXQA 1S1CA 3HHEA 3ESBA 3J81A 1HRKA 3HO8A 4QHSA 2NWQA 2JARA 3BMCB 2DSNA 4YJ3F 1JA9A 3EGEA 5JBNA 4ZIRB 3G2OA 5KKNB 1OBFO 1TKBA 5FIUA 4ZARA 2ODEA 2B9EA 1CPYA 3KX2A 2PBLA 2I0FA 3FTNA 3M1AA 4BGEA 3NWPA 1MJ5A 4MWGA 4YDSA 2N0SA 4XCVA 4AYXA 4M7PA 4NMXB 4AUKA 2VBIA 4OL0A 2PXCA 3U6KA 2JGNA 4Z4IA 1MDBA 3DTVA 5GZ3A 1NF9A 1NJ2A 2HJWA 3WGTA 4RJ2A 5CB6A 3JQDA 4LHEA 2GASA 5B5SA 3WLOA 1DC6A 1TLTA 3OQNA 3ZWPA 2YMMA 3DCYA 1G3RA 1JAIA 2IXBA 1Z83A 2ECOA 4IO1A 4W7IA 5F2EA 4YXFA 5A4DA 1QRSA 2O07A 3QYJA 3VSDA 4Z54A 3F4BA 4MGZR 1TF2A 3BN3A 3Q9UA 2PUTA 1TK2A 1ZOPA 3ZGXA 1AGXA 4I1PA 3A37A 1KFCB 2YV2A 1T2DA 1VG9B 4NY1A 5L3ZA 3H1PA 2IC5A 2ZB4A 1NBEA 2P3SA 2BKUA 2FI1A 3FOAA 3LT5A 3Q10A 1O8BA 1QDUA 3B3QA 4HWSA 4IQFA 2AG1A 2IX3A 5L4LA 3SYRA 3V7WA 4FXPA 5KSYA 1YS4A 3AP2A 3IR5A 5LMNB 4NAHA 1JEAA 2B78A 4EY4A 5DLEA 1SHZA 1L7OA 1RP1A 2AR9A 1QGZA 3PUVA 1PS8A 3QU9A 4A8JB 2WSSD 2DJIA 3KYBA 2YYYA 3HLKA 1NQ5A 3M34A 1EDBA 5ALQA 3VH3A 4BYGA 3EVGA 4RAQA 1Z73A 1EQ2A 5KX5B 2AG6A 1YGYA 2QVXX 4S1NA 4BJ6A 1R0BA 1DE0A 5TJHA 3HBJA 3AVTA 2AMLA 3W06A 2IIVA 2ZIFA 4J0CA 2Z56A 4NQRA 2C4TA 2XMGA 3SE7A 5CEFA 3E2MA 1N9ZA 1Y5MA 2P11A 2XA9A 1HG1A 5BVGA 4HDSA 4ZQGA 2OWEA 3D1LA 3FIJA 3OEHD 3H5NA 4H0FA 4HLDA 4RZ2A 4EJFA 4PHHA 4PC6A 5IYZB 3HV2A 3A6LA 4FFOA 1MHPA 3QEAZ 2R7MA 5GM1A 2YXEA 1SVKA 3RTAA 3ETDA 5D2CA 2GZDA 4WK4B 3S5JA 3EIXA 4NOKA 1TL7C 4CKXA 3WMFA 2WA1A 4QDJA 5KCZA 1LBTA 1QKJA 3EZGA 3C5HA 4KQEA 3PFBA 3W8EA 5AHKA 1N2XA 3UAXA 3WL3A 4GR9A 3G0OA 3UJDA 4EX7A 1L4BA 3QU4A 3VX4A 2FX5A 1EX1A 3W4IA 2WFLB 4WMLA 1G20A 2D8MA 2PSSA 1QRTA 1JEEA 5IMSA 1R12A 4C6HA 2AK3A 2HX1A 2JKYA 5ALKA 3H5AA 5KVQA 5CJJA 3KZCA 1YKSA 3EDQA 4PAWA 4AM8A 2DQKA 3P19A 3S28A 1GZHB 2GD2A 3AR3A 2VQDA 4P33A 3ZWNA 3M6VA 2ISCA 1T8RA 3H5OA 4HVLA 5J4YA 3ZU5A 3E9YA 1AQNA 5ABPA 2X13A 5LUAA 3MJEA 1XLUA 4C5CA 2GLXA 3EK2A 3IUQA 2GEKA 4O8CA 2XADA 2DBYA 4GU5A 1U0EA 1HM5A 1KDRA 5E2BA 3SYNA 4ND5A 2WDZA 4DLSA 3U7QA 1S8NA 2YQ5A 2JHAA 3I2HA 5F1KA 4YCCA 3SSNA 1OPRA 5TGDA 5GMOA 1JYFA 4EHHA 1KEPA 2BEJA 4PC1A 1JQJC 4IYRA 1DQYA 3CH7A 1G38A 4RSGA 1KJWA 2HU5A 5LU8A 1RS0A 2OPBA 5BMOA 4TYWA 4K8RB 4NHEA 4OQ4A 3A1FA 5KHOC 1DIHA 1Z0JA 3QWAA 1YVDA 3HUTA 3W9SA 5IVHA 2O3QA 3KTFA 4DZZA 2OVBA 2VJKA 3BREA 4M88A 4O1MA 3O1IC 4Q37A 4B44A 3RUIA 4BV3A 4D9MA 2O7VA 3I5XA 1QTNA 3PJDA 4DLWA 1NVWQ 3MT8A 3O75A 1AGRA 5H3CA 1SNYA 2CGEA 2AW5A 3VOAA 3PIIA 4OYRA 4AYTA 2UUAB 3I1IA 4FBLA 3L04A 5G4KA 5LYJF 2GZ3A 5AFSA 2O4CA 4ZI7F 2AR7A 2GH1A 1X2EA 3HDHA 1J0CA 4O2BA 1UXJA 2L42A 1ZWKA 4CG2A 3CM0A 1OH8A 3K8ZA 1KEVA 1PZMA 3GMTA 3LUDA 5E3IA 1NMQA 4RK6A 2I2DA 4ZREA 3GRZA 5GJCA 5DXFA 5K99A 4XAQA 2BZ0A 3FMPB 4OPMA 4TLMB 2UKDA 1IOVA 4R9UC 4AP9A 2RI0A 3HWWA 1TAQA 5CA1F 1NZJA 3EIFA 1A8HA 1O4WA 2FVYA 2ZCVA 4IJQA 4UM9B 1P5HA 3HCRA 1YK0A 1VSUA 4MQ5A 4DUPA 3ZV7A 4AICA 2NU6B 1IK4A 1LBIA 3LWZA 5FFMA 1MQ9A 4CLDA 3RRBA 1PS9A 3G49A 2PV0A 5FKJA 4ZICA 4KIJA 1N1GA 3PKIA 2IS1A 1SG6A 1E0KA 5IT5A 1AC5A 1T34A 3BIXA 1ZONA 2M1ZA 1T2NA 1HE2A 1PD1A 2I6SA 5KOJB 4EECA 1FB5A 2KM1A 1VE5A 3WK7A 2FG6C 3P52A 2XYHA 2OKCA 1MA0A 1IBSA 1BE1A 1TW3A 1K06A 3GP8A 2B1QA 1AQYA 2ZEJA 1D9XA 2XTJA 3HYRA 3I2FA 3RPEA 4DSAA 4Z5XA 2E1RA 2HOQA 3TW8B 1Y8ZA 5A9TA 4AU1A 3D7NA 3M3PA 1KGDA 3HG7A 2FRDC 4LF7B 4CLRB 1KY3A 1KKUA 2GEDA 3DE1X 1A7AA 821PA 5BN5A 4OA5A 3BA1A 2F2TA 2NVBA 3K0FB 3MBKA 1M8FA 3OCJA 1FFAA 4URWR 3C39A 3H4VA 5C8VA 2V3WA 1WUHS 3E3LA 3F8SA 4HC4A 3RJTA 1EFPB 2Q8PA 4R7TA 3DJYA 2EJWA 4NICA 1X7DA 3U4MA 1EDDA 1JB9A 2XMBA 3JQ8A 2JFUA 2UVDA 5BNFA 1N2JA 3OTOB 1AZLA 2J31A 3A7DA 4G1EB 4N6NA 2RBEA 1X1SA 2P5YA 3IPRA 5FV7A 4CQLB 3TLZA 3ZLTA 2BZGA 4GI2A 4L57A 3MMPA 5L4NA 2V6JA 2C8KA 4BNXA 2FETA 2HK6A 1HDCA 3COWA 4LHXA 4BMOB 4Z4QA 3DQZA 2SKDA 2MSEB 4I2NA 5K3FA 3FLBA 3IO5A 1DEXA 4OHPA 2XXJA 3L46A 2XHEA 3BX1A 3DDNA 4BO1A 1MC5A 1I7SB 1YZLA 2P65A 1P4GA 1T1EA 2QN2A 3IRVA 5CITA 4OHXA 4MJXA 4R9RA 1TM4E 3F47A 1Z4JA 4CCWA 2VRBA 1NMEA 3HZOA 1I5EA 2WWVD 4W9MC 3W78A 3RJZA 3KU1A 4XFKA 5I6DA 3PJRA 2X1HA 4BWGA 1RQRA 5LVAA 4TL7A 1QGED 2VHUA 5D6OA 1HT2E 1G3UA 4LGYA 1KI3A 4ZV4A 1XZIA 3LLCA 1GLNA 3H1TA 2QN7A 3EQZA 5HG0A 3DZDA 3IA7A 4Z51A 3K6SB 4PC3A 4G5RA 4EH1A 3ZBPA 1P3Y1 2GVDC 4G81A 4YUVA 6Q21A 3CWZA 4Y2VA 4S2UA 1T1JA 3L05A 4CG0A 2G4LA 4D82A 3DV9A 3O4JA 3USES 1T8YA 4REQB 4FLEA 3FLEA 4XWTA 2DMRA 2J9GA 4HVTA 4R01A 5LC1A 5BQFA 1J23A 4CEJA 4X1KB 5JMPA 5EZ6B 1XDSA 2AE1A 3SHFA 1COZA 3KQYA 1ZKMA 4ZJYA 2H5JA 5BQXA 2VTBB 5CTJA 1LS1A 1T10A 4GPEA 3X44A 1F6BA 1NNLA 4RSMA 5HR5A 3PHIA 2ODNA 1OY1A 3RRMA 2PQ6A 1RWOA 4DCVA 4J7AA 1ZH6A 3C7CB 1XEXA 1SZDA 3TLYA 3UAOA 2QRVA 2X2PA 4LYAA 2VPXA 4DG9A 4YPVA 1RWPA 3FGNA 4IUDS 4KI0A 3I9V6 1M33A 1Z7EA 3BQMB 2I03A 4MS3A 4MWTA 1RI1A 4X6UA 5IVIA 1RRCA 3Q3HA 2RBKA 2AQ8A 4KQIA 5D5QA 2W37A 4JBIA 3WLRA 4BB5A 1YL6A 5COBA 4H1TA 5JWHA 1MJFA 1SRQA 1N2HA 1P1CA 5B2FA 3DZGA 3H5VA 4LF6B 2H4ZA 3AETA 1YC5A 4Q47A 5JH7F 2EIHA 1CIJA 4KXYA 2WILA 1Z9BA 3ROEA 1L5SA 4KMSA 5FL3A 1SOVA 4RMIA 4QBGB 3ROTA 3FYUB 2EFYA 2P4EA 3STHA 4BWYA 2ATVA 1NP6A 1ZMBA 2A58A 3DVAB 2H1SA 3NAGA 4N3BA 3WSWA 4OK6A 1TAGA 4ZZIA 1BSVA 1WO8A 4UZFA 4LY6A 1IK6A 2A1UA 2ZSFA 3PDUA 1Z0IA 4MRMB 3T7DA 2QRJA 4C5BA 1LBHA 4B4OA 2DBVO 4QXMA 5KWIA 2AMJA 4LE1A 3NLLA 1WQ4A 2RHMA 2OWDA 4TWZA 4A10A 1FPQA 1T9DA 1MX1A 1DFGA 4OOEA 3OT5A 1DJNA 4QBHA 4QPZA 1XP8A 2WMOB 5GWXA 4E3WA 4E5VA 3NFYA 2IRWA 2DB3A 3ED5A 2ZSDA 3TQCA 3L7NA 2ASVA 4JITA 4MRRA 3VU9B 4F2PA 1KO7A 3MGKA 3SLGA 2ZRDA 5IANA 2Q4BA 1W29A 2RGWA 1KZ4A 4F1WA 4TTJA 3QU7A 2PWAA 1U80A 2PKWA 1XYVA 3LWNA 4TLAA 5ITZA 2CXHA 3KPVA 3CX6A 4L3VA 4BZPA 2CV1A 4CKEB 3R4VA 4EB6A 2JLQA 4QOJA 3RKRA 3V4OA 3AF1A 3IBSA 2HADA 3AH8A 3HUFA 3QBDA 1I2AA 2JFXA 2GPTA 3GBSA 4QSHA 2FZWA 4KFTA 1NVKA 4J7XA 2FOIA 2OV6A 2PX5A 4H18A 2QGZA 4BMNA 3LNTA 4HYEA 2XUGA 4EJ2A 5JO0A 2DBRA 4F3KA 3MUOA 2W4MA 2NP7A 1M1XB 3QVKA 3SSAA 1YA4A 1XNRB 2X8BA 1E9SA 2D13A 3UANA 3PXAA 1TM2A 4M53A 1OAOA 4NCJA 1FVHA 3U7GA 1IBRA 2WT9A 4DR3B 4K9OA 4B5KA 2W6ID 5I7SA 2PZLA 3G23A 1TFUA 4WNIA 3Q3CA 3V1TC 3VR4A 4IJMA 1DFIA 3DBRA 4U6QA 4ZV7A 4BMSA 4BKOA 3TJZA 3C4QA 1K4YA 3U7EB 2AF4C 1T9GS 2OAGA 2XWQA 1D07A 3G79A 3NQ41 3OEED 2UZ1B 3DLTA 1LQ2A 2QMOA 1N7JA 2R2GA 3EZNA 2R6R1 4XFJA 1R6TA 4OUDB 3OU7A 1QM5A 3FOCA 2V4MA 2WJPA 3Q8XB 4G97A 4W7HA 2ZJ3A 4DSOA 4H7JA 5AKHA 2CE2X 4FDMA 2BL4A 3VPXA 3S0JA 5D3QA 1SJ9A 2C3OA 3L41A 5JTTA 2IUSA 3CJQA 4NYJR 2Q3MA 3FOFC 1IATA 2G4CA 2CKDA 2NUAB 1P72A 4KBFA 3ZG6A 5AVXA 4GMXA 1V11B 2W00A 3GAMA 2R1UA 3DLBA 2IF2A 4R6XA 1XU7A 4AZWA 4X7MA 2C84A 3TIFA 1UQTA 5BNZA 1U5BA 3TOCA 4BMDA 2Q1YA 4CLOB 1G291 1HQKA 4HP8A 2HLNA 5HFNA 4U2KA 4WRRA 3TR0A 2WWGA 2Y2VA 3LAWA 3OE7D 3QUQA 1BQ4A 4QGBA 5J4HA 3FYSA 3KUUA 4UUOA 2ZIXB 2LD4A 4XI9A 1YB6A 1N2GA 1CY4A 5E3HA 3GMSA 2UUBB 1FNDA 5DGCA 1DOZA 1YJAA 5AR1A 1F5SA 1P9RA 3QEMA 2YC4C 1E2JA 1ISMA 2LCIA 1G8PA 2YXLA 3KYCA 1JG4A 1QCCA 5IHXA 4K7JA 5KWEA 3OQOA 3EQ7A 1JKJA 5JEDA 4YJ3A 1WMBA 4PHCA 4CL3A 5DI3A 1PZEA 2WWWA 1EP2B 5JSYA 1ZJ5A 1JIVA 1TCUA 3VYSB 1BHSA 1CC1S 2PUVA 1FDRA 1ND6A 1NUUA 1J24A 3EPLA 4YY3B 4ZHQA 5BW5A 3CRNA 4JA0A 2YFKA 3IV9A 4RACA 3NGMA 4R2JA 1OR8A 2IUUA 5K4HA 1V7CA 4BQIA 1NR5A 2H2GA 4UOZA 2VYVA 2PSDA 1PG0A 3COZA 3M82A 1NC1A 3K71B 2JGKA 3JQFA 4RHTA 4FKMA 5C1PA 1FRNA 2FW1A 3ZWKA 3QK7A 4R8VA 3DEJA 4RDHA 2O2YA 3WRXA 5AVSA 1P1IA 5KHLB 4IY1A 4WKOA 5E1BA 3INGA 2CK3D 4BN0A 3L8MA 1RD4A 1CQZA 4OD0A 4TKMA 4X7BA 4B4DA 4U9UA 1X7XA 4IQGA 4K6OA 2X4GA 3VC3A 3D3QA 3S40A 1RLTA 2R96A 4DCPA 4F1JA 1Y9DA 4PZAA 2NVUA 2KPOA 1SC9A 3SIWA 3SM9A 3VNRA 1RM5A 3DOJA 3PNPA 3ZDEA 1XRSB 3ZIUA 4Z9FA 4P5PA 2J8ZA 1N5KA 2B21A 2H16A 3FF1A 4FEGA 3WGJA 3WL7A 4XQ0A 1P6UA 3A05A 4WFIA 4XE5A 4N01A 4LUCA 2AN4A 4YFVA 4IMIB 2NYUA 1A88A 3C0KA 2A7QA 3FNIA 2VTKA 3IBTA 1CB7A 1CF2O 3T52A 2JLSA 2IPXA 2XJ9A 3SX4A 2C2YA 1KBOA 3OQ1A 3ZCQA 1GCAA 1NVDA 1V1MB 4L5AA 3WOHA 1QAMA 1TEVA 3FX2A 1SOAA 3IQIX 4NAUA 2VXBA 4RMJA 2GN0A 4KXLA 5HKLA 2XGSA 4JXZA 1O6GA 3BWYA 2ZIWB 2BMWA 1UIMA 4GLOA 5AI0A 2BW0A 2UZ3A 4RS4A 4EG1A 4OYYA 4UM8B 2WD8A 5EHNA 3ZCVA 4CNQA 2A57A 3CIOA 2FW7A 1G9XA 4L95C 3RBVA 4E0BA 3VJLA 2PZMA 4L4RA 3D4IA 3LY8A 1POXA 1Q91A 2A8YA 2AFHE 1CR0A 2VFAA 4M0EA 1QLWA 3RTGA 5BPHA 4JSYA 4Q93A 2R1ZA 1XZGA 2FR8C 3UTDA 3U0VA 1DQNA 3EXG2 4BJ5A 2W7TA 3JQAA 3OPNA 4U2DA 3NTOA 2QNBA 3M4ZA 4EJSA 3KQPA 3IKTA 3DOIA 3JVVA 4C2UA 5K2OA 3F73A 4EHIA 4YN3A 3T1QA 1EGMB 1P0CA 1MO6A 2P6MA 2CJXA 2CUNA 4D02A 1RRVA 4ZVNA 4IRUB 2GRUA 4KDRA 2B61A 4PHTA 3K92A 3QE4A 1JAHA 4G36A 3FTPA 1U5CA 3GDGA 1EFCA 4ZD6A 3VR1A 2I1WA 4EMSA 1Y3IA 3RV4A 1YJ5A 1A50B 3B9QA 2X40A 521PA 1N6IA 4X94A 4YALA 5I7HA 4JUDX 2P4UA 1KPGA 4RY2A 1G2PA 2JASA 4UE6A 3ANNA 2C82A 5BSUA 2OCLA 3KVVA 1I6LA 1ZBQA 2FZEA 3IUSA 4IS2A 4LRXA 4MVJM 5B1IA 4C0QC 4EMUA 4IHJF 1RRMA 3N1UA 4O3FA 2FKNA 1GCUA 1N0WA 1TA4A 2NO1A 4BIMA 2XKAA 3E27A 4DDTA 5JXWA 3UJ3X 1GZ3A 4DL9A 2QLFA 2R5NA 3RFUA 2IZ0A 3KTAB 2Q3HA 1K7FB 1TGVA 1TIKA 1XEFA 8ATCA 1J0BA 1VM6A 4YCDA 1UMKA 4M1YA 3RYCB 5HK9A 1Y4AE 4U2CA 5K8LA 5A1TA 2I99A 4TROA 4F9GA 3VO2A 3NC0C 3UJ8A 3QENA 4RQTA 3H1BA 2IVFA 5C7LO 4UTVA 1RC1A 3PC2A 4BFLA 3OLCX 4UTPA 4RVCA 1NSYA 4B6RA 4KJXA 3G85A 3HFSA 3QEKA 5AW2A 4LC0A 1C8BA 1Z0KA 2CHGA 5AXCA 4BN5A 4RY9A 3B36A 5FAKA 1LW6E 3G5UA 4YRQA 1AS2A 1OH6A 4CETA 3ZI0A 3AJ9A 1QP7A 3DEAA 1DQRA 1U3CA 2OLJA 1XIVA 3BT7A 1WBDA 2QTWB 3S2IA 3KHSA 1SWWA 4Q03A 1GSIA 4BNKA 1QU3A 1VBMA 1CG6A 4JXKA 1SBYA 4LCEA 5LYJA 2J0QA 1I32A 3LLUA 5M2QA 4HGYA 4PRYA 4ZI7A 3UT0A 1CDEA 1V25A 4MPDA 3VYUB 3H4MA 1QFYA 3OZSA 9ATCA 4MV6A 2VYCA 4O4LB 3R8XA 2RBGA 3GI1A 5FUYA 4YJ2A 3R76A 1BKSB 2J08A 2NQ8A 2VAXA 3LOPA 4RD6A 5A3SA 2JHGA 4XWWA 1D2EA 3JWHA 4UNSA 3DL4A 3KLOA 4N5HX 4QO8A 3ROMA 2RFLA 3BHJA 3KELA 3PCRB 3IE2A 1TB4A 4EFNA 4KR7A 5CA1A 1NLYA 4Q9IA 2B30A 2QT9A 3FNQA 3A9VA 1F0PA 1M2NA 3RTEA 4ENWA 3DHVA 3F4KA 1YOBA 3O3OB 2X5NA 3U3OA 1R9GA 3VPGA 5A03A 1FUKA 3KXDA 4CG3A 3BE5A 2YMQA 5JEEA 4KH0A 4U7GA 1DWUA 3HU2A 4TMFA 2EFEB 3AOGA 1LK5A 3Q98A 2P9JA 4M9ZA 1R10A 3MTGA 5GVRA 1FX0B 1PV2A 2HJ9A 3RI3A 3T1NA 3WL5A 5BV1A 5M04A 4IUCS 5JI2E 4ZCQA 2NZ8A 3MA0A 1LNQA 5BR8B 1ZUNA 2W6JD 4I4CA 4PIVA 4RD1A 4JEHA 5EC8A 3JRXA 1XP5A 2GNOA 2DFPA 1UT8A 2WIKA 3OM9A 3V1YA 1KK2A 1F2DA 2BR3A 2OK8A 3BZBA 4UDXX 5I7AA 5FO1A 1OA0A 2VNJA 1YV9A 1C3LA 1MORA 1NATA 2OM6A 1TF5A 1ZO8A 2C4KA 3ILVA 3OEHA 4MQFA 1QG0A 1Y6JA 3OPQA 3DPUA 4OFZA 5J2UB 4PYJA 5LFAA 2I3DA 1AV6A 4J0HA 1U8AA 1UP7A 3DPIA 4B84A 1R66A 2QG4A 3NYWA 3L07A 1VG8A 4Z1MA 2QW1A 3SR3A 1UC5B 3Q6MA 4YLGA 5B7QA 5DM4A 3C14C 1KH2A 3LJKA 1GZDA 1KP2A 3O2SB 1UMBA 2CNOA 1Z68A 1U2RA 4GEKA 4GOJA 4RVUA 3WLKX 3PQ6A 4C05A 2ZRHA 1GN8A 4L28A 2VHCA 3R7NA 1Y80A 1C2TA 1JI0A 1OCEA 2XEDA 2XMCA 3C5VA 3CE6A 3CZQA 3LUPA 4ZT6A 3Q1LA 4NYIQ 2ZZMA 2O6HA 2HPAA 3KC2A 2IHKA 5E7MA 1ORTA 3LHSA 2ZUDA 1BAPA 1EE1A 2YCBA 4W4TA 2ZTSA 2JDID 1CE8B 1L8LA 2D2IA 2PKQP 2ZAOA 5EE5B 1UBFA 5FFFA 1UOOA 1AKNA 1T15A 2FW9A 3CLSD 7REQB 3OLZA 3HKDB 4LV8B 4B1FA 2HB6A 3DAYA 3DHEA 2EQ5A 5TLSA 2RD2A 4IZIA 4J4HA 1IVNA 3GUZA 2WFAA 3DNFA 3I9V1 4JVSB 1U8EA 4XKJA 5TQ0B 3JVDA 3X1WA 1KRHA 4HG2A 4KIWA 4Y2QA 1CZLA 1ZJWA 1J9EA 5EGNA 2KW5A 2QTCA 2ZTHA 3SSMA 1AF7A 4KV9A 3RHZA 1I4TD 1NUPA 5HE9A 2OGSA 3KKZA 4GX0A 2J3KA 2IV3A 2IHVA 2O8EA 1BKDR 4CIAA 5DO9A 3V7NA 1YFLA 4LV6A 5WRFA 1L1FA 3DDUA 2CVQA 3CHYA 4Q16A 5CU7A 3HB5X 3STXA 2ZM5A 1PI3A 3R3HA 1I10A 4YRTA 2UUOA 1SBCA 4JA2A 1WZEA 1XL0A 4PS0A 1JDPA 1G5IA 1QO9A 3FUUA 5CIQA 1CUHA 5M3BA 2G63A 3EPJA 3TOSA 4JJ7A 2P90A 1XTBA 2NNLD 5HF9A 4ES6A 2XF8A 5A7HA 5CMLA 3DDSA 3ZJTA 4J0FA 2SCUA 2H1VA 4PCUA 5AW4A 3DAPA 3I32A 1PR2A 1YR3A 3ICWA 3L2OB 4GUAA 2CL5A 1ODIA 1V39A 3BKXA 3TFQA 5FEUA 1DQZA 1UT5A 4U0KA 2JZCA 1K97A 1Q1AA 1GO2A 3CYFA 5FOTA 3LUJA 4QTXA 1PR4A 1JJVA 2OCYC 1XZQA 2QX7A 3BGDA 4FYXA 2YMPA 2P2YA 4LXHA 4NENA 4U2BA 1F4PA 3OZFA 1AQLA 4FMCF 4QNRA 1TA9A 4G07A 4S1TA 3DO6A 2JIRA 2HDNB 4RTQA 3QPAA 1SCIA 2AJCA 2UZAA 1G55A 2F4NA 1TT7A 1PDVA 1S9HA 4IH9A 1E9VA 3G9UA 5A4IS 2I4LA 3R09A 2HZBA 4L08A 1U1EA 3VXKA 3EPKA 2Q21A 1S2DA 2GHQA 2WJIA 2IE0A 5H4GA 1C3VA 1W47A 3Q6NA 3L4BA 4LSMA 4E88A 5IJ9B 1JZSA 3OQHA 1DLIA 3PQ4A 4LHZA 2HREA 2D0OB 3HCDA 4LW8A 2D3TA 4Y2YA 1E1QD 1KIAA 2RG7A 5AM5A 2Q9BA 1M6NA 3WR5A 1V95A 3H84A 4Y6OA 1FLNA 4JYZA 1UF9A 3ETCA 1PFWA 3IQWA 3JZFA 2V8OA 2OMEA 5BSVA 1M6HA 2TS1A 3I39X 3RTBA 4FC6A 5E6UA 1B8UA 2F48A 2DX7A 3CU5A 4OQNA 5DNWA 3ZTTA 4WKGA 2B9VA 1D1TA 3E3MA 4QODA 1U6KA 5MFZA 2MOKA 3LK6A 1Q15A 2CJWB 2JD0A 5LZ9A 3GD7A 1FBNA 1XQ9A 1P19A 2RHJA 4D56A 2JGIA 2PQ0A 1OX4A 2GBLA 5BN3A 4DA6A 5HKBA 2B4YA 3QHQA 1ODKA 1G4UR 2CNKA 3EMVA 2XGGA 1VKOA 1OBVA 3K4PA 4QATA 1JR4A 4OHZA 1JPNA 4A16A 2ZPUA 4EY5A 3CTPA 3VPAA 5HGJA 1PJ4A 1NXQA 3NAQA 4G2TA 4XLTA 5J23A 4R2WA 1ZHOA 1GVNB 2ZS9A 3BEOA 3OPVA 2PFKA 5IAGA 3WICA 4DPKA 5ADVA 2Y2UA 4C4YA 2F7SA 2GXUA 5HS6A 1V1RA 3ZCXA 1O95D 1B41A 1RBQA 3FTDA 5U4XA 4A15A 4G0OA 3ANYB 3KJGA 2F9FA 3O82A 3R5KA 3CUSA 4NZZA 3ITDA 4HDRA 4J43A 4NNJA 5FTNA 3MUEA 5EFZA 4WUVA 1GAEO 5BYBA 1RZVA 2P1DA 2QSZA 4FHCA 5ANRB 3LF2A 1B6GA 2P3LA 1HFEL 2DTXA 4V0MA 1U0RA 5F4ZA 2HHCA 3V4SA 3GWGA 4NU5A 5A5GA 5JD5A 1A27A 2B35A 4UNNA 4BZXA 4KNYA 2VP2A 3DR5A 3M6XA 2WR8A 4KRYA 1SC4A 4D4JA 5DSXA 1RW4A 3MHPA 2BH2A 4AZ0A 5T57A 2GK3A 2IH5A 3GAFA 1XTSA 2MR6A 3WKCA 1LXCA 2BEVB 1XKTA 3MS2A 4Q1BA 1G6KA 3H3JA 3KT6A 5ECYA 2C3YA 1UBKS 2P5UA 3EWSA 3GU3A 4MUMA 4I8XA 4WACA 4FFDA 3FOZA 1XA4A 4TUYA 4FILA 3K8QA 4WT7A 2WWYA 4AQYB 3SWWA 2JK1A 4K9PA 4YRMA 2AXQA 2HQ1A 2Y76A 2A5JA 2ZPAA 1I7PA 1JJBA 4RAOA 5CVTA 3QXJA 1IMOA 1DHRA 2LKDA 4LISA 4M1SA 2L19A 1KC3A 1RTTA 1YS7A 4PYIA 2FPWA 3RIGA 4MUJA 1QR2A 4XB2A 1I9GA 3RC7A 1NBMD 3IAS6 1F48A 3ABSB 4J3NA 4G5YA 2HXYA 4HMQA 4I4NA 5E4YA 3U4CA 1BOFA 2AI2A 4RPGA 5D3KA 2B69A 2ZJZA 2VK8A 4ZK2A 4PZCA 2I3GA 2ONCA 3D6HA 4DXDA 3ITEA 1RT9A 5SICE 4CMKA 5KQPA 2BR5A 3UXMA 4RVNA 1MH1A 1VMIA 3MOSA 1RQ2A 2GB4A 1A72A 3GAAA 2GF9A 3O0DA 4HAVA 4HY3A 5DW0A 2V7EA 3R4CA 4BO8A 3FDXA 3PD1A 1N6NA 4RJKA 1RM3A 1VCHA 3DBVO 2ZOSA 2Q9UA 3HCEA 4XWGA 4KOEC 4F2HA 5C37A 5LXTF 4H59A 1Z2OX 2FAXA 5CFMA 2A1TS 2A5LA 3KPJA 3LT4A 4Z9YA 3DD5A 5E7JA 2P8JA 1G5HA 5LA6B 1T3SA 3EDOA 1KDPA 4GG1A 5K4AA 1SXJE 2I22A 2IPAB 4YJFA 5JZ9A 4BIIA 5REQA 3F3MA 1Y6RA 3MTEA 1E2UA 2M6SA 4LYHA 5EQFA 3T35A 3LY9A 2GFHA 2RG1A 4L4XA 3MJHA 3RC9A 5BORA 2Z8ZA 4WCVA 2W42A 1VJ5A 4GUDA 4OGKA 3P4YA 3R9WA 1ODCA 2FPOA 3RR2A 4B47A 1QH8B 5GTDA 4YACA 1WCIA 3Q7IA 2RHDA 5D1NA 2QW8A 2J9ZB 1HKUA 5K9ZA 3VISA 4WZAB 3W5CA 4W5QA 4GHWA 3FTEA 4KRGA 3SQXA 2ILVA 4LYYA 4HNHA 4MB0A 3UFXA 1UDWA 4E12A 3U6BA 3TNFA 3LDAA 5B3KA 1TVKA 3LHIA 3MINB 4NZYA 2PL1A 3FKQA 2J5RA 2Q4DA 1M73E 1GPKA 4PU0A 3SJCA 4UUNA 3D4NA 3GMDA 3UENA 4A6DA 4E14A 1YJCA 1EWRA 1D8TA 1FUIA 4OXXA 5FUBA 2ZXFA 2PX8A 4R7ZA 5HEKA 5LZ7A 2DPGA 1GARA 3ESZA 3FCEA 5L3SB 4GLFA 3KDAA 1RJEA 3S2EA 4LXGA 4QQRA 3WWZA 4B73A 3STVA 1B26A 2XTMA 4G1BA 4YC7A 3UHFA 4BUCA 4CMIA 1M0SA 4ODIA 4CHTA 1E3WA 1T2UA 4E6EA 2V1UA 3DVSX 4BNGA 5I8WA 3FYHA 4GMDA 4IUYA 1GPYA 4AY4A 2VQ3A 4MJ7A 1EFVA 2Q4EA 2XB2A 2C3UA 4DA4A 1Z4QA 1F8XA 2Y0DA 3QPVA 1QH9A 4TKUA 1RHMA 5ECDA 4TV8F 4CR7A 4MW4A 2BFEA 3N0RA 2D06A 4JYCA 3WFZA 4BRSA 4ZJZA 1G7TA 1ZMRA 2OHVA 2AZMA 3B52X 1G3IA 4N9QA 4NCIA 1E5DA 2HF9A 3PHBE 5C5CA 2JBAA 1NRXA 4S1PA 3GLGB 1N3BA 4RLFA 1VJGA 4JYBA 4NMHA 4BB6A 3CNLA 1E6WA 2PBZA 5AVWA 3HQ4O 3TW4A 3C74A 4ARSA 1J9GA 1DG3A 5KKCA 5UKDA 1AN0A 4XUGB 5JSFA 4Q4HA 2QL7A 1Q6YA 4TLBA 1AZWA 1KZGB 2HL6A 2C7GA 1WJGA 3FR7A 4Z4GA 2YDXA 1SVNA 4N1AA 1XRMA 4LI0A 4OHBA 3D3EA 2MSDB 4JU9A 3JQRA 5C46F 2VWHA 3OZIA 4KG7A 1Q0ZA 1QYRA 3E9ZA 3MTIA 2YJ5A 5JRDS 4CFSA 2PD4A 4S05A 2C0QA 5IVDA 3OEEA 2VQEB 2JH3A 5K0EA 1N8SA 1QBGA 3PICA 4K03A 3L7DA 1QAQA 2DWQA 1OTHA 2WJYA 5G4LA 1FMTA 2OLKA 3DTVB 4UBLA 4CF5A 3HO1A 3DBIA 3FVTA 3COPA 4WPGA 3HXQA 2F90A 1LPPA 3WGZA 3TN7A 5AWFC 4EKIA 3PR3A 1MX3A 4MR7A 6PFKA 1CUXA 1TA0A 1J70A 3W6ZA 2X4IA 4Q48A 2FJUA 2VJPA 4NECA 4TLLB 1H9BA 1CUZA 2EFCB 4Q3EA 2PAAA 3FPBA 4F72A 1HR0B 4IHJA 1DS6A 3ICVA 4WBNF 4REOA 4JIMA 1RJDA 1QU2A 2J09A 3LBIA 3OE7A 1YU6A 1RYYA 3ZN2A 1ZXLA 2V8BA 4AXBA 2HT1A 3UGTA 1VSQA 3WY9A 4B2LA 4JWTA 1TI7A 3ZZUA 1G8JA 3MGGA 2C9MA 1XNGA 3DCJA 1KVRA 3F6SA 3GFFA 1M9NA 2C1ZA 2PRJA 3QVLA 4IIBA 2EZUA 3SZGA 3S8YA 4KPEC 5I7FA 1BDBA 4Q3BA 3JAMA 4CE6A 4ZYVA 1RPZA 2XE6A 4Y1RA 2Z5LA 1FCJA 4Y9TA 3G2HA 5DCWA 3FDJA 5DYYA 5JAPA 2X1MA 4OXRA 1XWWA 1WRBA 4KGVA 1O0SA 4G09A 5E9WA 3AIKA 4CQMD 1HFJA 2ADFA 2FFAA 1S96A 4ABYA 1J42A 1QZUA 3NHKA 5DYWA 5IAJA 2EWMA 3QYAA 2XYGA 5TMPA 3J81k 2RGCA 4Q82A 3BMOA 1CEYA 1X86B 3N86A 1MTOA 1VHJA 2AJBA 4X5OA 3WGUA 2LP4Y 2UYGA 1VHQA 1S3FA 5BVGB 4HDSB 3E70C 1E2MA 3Q41A 1NPTO 3SFTA 4GYWA 2A7XA 4CEIA 1KYVA 3VPCA 2ODTX 3O7MA 4Z4FA 2VDMB 4PLWA 1PL0A 1UEJA 3BXXA 2D2XA 1ZJZA 1MGOA 1TZCA 3FG9A 3SN6A 2CK3A 3ZZNA 2X7HA 1NQUA 2GBPA 1A5TA 1M6EX 2A3RA 4IS3A 4QAJA 3B1KA 3ANXA 3ZXSA