1C9JA

Bacillus lentus subtilisin k27r/n87s/v104y/n123s/t274a variant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVRVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSYSSIAQGLEWAGNNGMHVASLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineered Bacillus lentus subtilisins having altered flexibility.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase
molecule keywords SERINE PROTEASE
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1c9jA00
5AQEA 1SBCA 4KG7A 4YN3A 1PTKA 1GA4A 1JEAA 1TMGE 2X8JA 5AVJA 3D9QX 1AH2A 1WMFA 4Z2AA 1GA6A 1SUEA 4OMDA 3AJ8A 1SIBE 2W2PA 1TM1E 1YJAA 2Z30A 2W2OA 1CNMA 1YU6A 1AVTA 4WOCA 3VV2A 1GA1A 1TO1E 2SBTA 1Y3CE 5ARDA 4CG0A 3SQOA 3GT3A 3VYVA 1EA7A 1EGQA 1TM5E 2IY9A 2PWBA 1C9JA 3F7OA 3H42B 3LPAA 1SCDA 1SVNA 3LPCA 4J94A 2PYZA 3ZXXA 1C9NA 3I34X 1A2QA 1GCIA 1SUAA 1R64A 2W2NA 1SH7A 3A3OA 3Q40A 1AF4A 3CNQS 1PJ8A 2ID8A 3GT4A 3I37X 1PEKE 3LPDA 1AQNA 2ST1A 3EDYA 5CW1A 1GTG1 3L1KA 2ID4A 1Y4AE 2XTJA 3I30X 4M1ZA 4FONA 4H6XA 4ZOQI 1BH6A 1Y34E 2DQKA 2Z2ZA 1S2NA 1Y48E 1NDUA 1P8JA 2Z57A 4H6WA 2ZWPA 3DYBA 4AKSA 1C3LA 1OYVA 1YJCA 3UNXA 1SBHA 3PRKE 2PWAA 1Y1KE 3GCWA 1TECE 2SNIE 1S02A 1T1IA 3DE1X 2G4VA 1TM7E 1NDQA 1S01A 1SBTA 4ZARA 3HJRA 2ZWOA 4CFZA 5K7SA 1CSEE 1ST3A 2V8BA 1DUIA 3D43A 3F7MA 3EIFA 1SUCA 3DVSX 1PFGA 1V6CA 3VV3A 1SN7A 3A3NA 3VSBA 1AK9A 1OYOA 1R0RE 2WV7A 1AV7A 1ZVJA 3WQBA 2WUVA 1SUDA 2HD4A 3DVRX 3QTLA 4KPGA 1Y4DE 3GCXA 1Y3FE 1UBNA 3QFHA 4RYDA 1AU9A 1SCBA 1XF1A 2P4EA 3DE5X 1TM3E 1GNSA 1NLUA 2Z2XA 3LXUX 5I9SA 3DE3X 1BFUA 3P5BA 4OV6B 4DJ5X 1IC6A 3BGOS 1OT5A 1KDZA 5ARCA 1C9MA 1GT91 1R6VA 3SICE 2TECE 3DVQX 1KE1A 5FBZA 3BPSA 5JXJA 2WUWE 2GKOA 2E1PA 5B1DA 3WIUA 5JXHA 1Q5PA 1TO2E 3QMPA 3Q5GA 1KDVA 2SICE 3TI7A 1SCJA 1Y3BE 3DW1X 5B1EA 1P7WA 3AJ9A 1WSDA 1SIOA 5AMXA 5FFNA 2HPZA 2WWTA 1IAVA 3DE6X 2ZRQA 4C3VA 1ZVKA 4KB5A 4H6VA 4GI3A 1YJBA 2W2MA 3I2YX 4B5LA 3WHIA 4CFYA 3BX1A 5JXGA 2B6NA 1WMEA 1SELA 4K8RB 4NE9A 3F49S 1THMA 5SICE 3TI9A 2PQ2A 4WOBA 1BJRE 3EE6A 4I0WB 1SUBA 2DP4E 1Y33E 2PRKA 3VTAA 1GTJ1 2Z2YA 4DWWA 3DE4X 1MEEA 2Z56A 3PTLA 1GNVA 2SECE 1SUPA 4HVLA 3DE7X 3WIVA 2W2QA 3DWEX 1TK2A 5AVKA 1SBIA 1Y3DE 3CO0S 3DE0X 4HX2A 4NE7A 4OMCA 5JMOA 2DUJA 1GTL1 4C3UA 3OSZA 3TECE 4AKTA 1MPTA 1WVMA 2XRMA 3A3PA 3T41A 1WMDA 4NMXB 2X8JB 4JP8A 1T1GA 4DZTA 3ZXYA 1VSBA 1SCAA 1V5IA 1KE2A 1SCNE 1Y9ZA 2Z58A 1KDYA 5JXIA 4LVOA 3VHQA 1LW6E 1TM4E 3DDZX 1P7VA 1SBNE 4MZDA 2PMWB 4BWGA 1BFKA 3AFGA 2IXTA 5ARBA 1SIUA 3DE2X 2PKCA 4LVNA 1BE8A 1ST2A 1HT3A 1SPBS 5FAXA 1DBIA 2QTWB 3DW3X 1BE6A 1T1EA
chains in the Genus database with same CATH superfamily
1D8TA 1NRWA 4YMUA 1FLDA 2MTBA 2JCYA 1TU3A 1W93A 1LSSA 1RMYA 5HK9A 4FGZA 2B8JA 3F97A 1SUEA 3MT9A 3CINA 3GGCA 4C6TA 2C2MA 4LV8B 4ZYZA 1O57A 2GRUA 5E0KB 4KLNA 1USGA 3PC8A 3TAUA 2XGJA 1DWQA 3RR2A 5JAZA 2XD4A 3ZWMA 1WDLA 3PUYA 4RPHA 1NPYA 3RRXA 2K2WA 4RJKA 2JBWA 2JLAA 1XTRA 1ORIA 5LR6A 2C03A 3HB4X 3QVMA 1UC9A 2ZYHA 2FGJA 3WMGA 2X0IA 2IYVA 3IMCA 4MR9B 2WM3A 3AEUA 3R7WB 4BGUA 5D5QA 3LU1A 4D42A 2HW8A 4BNFA 2ORYA 4DQXA 4AYTA 2R8XA 3COJA 4KSCA 2JFPA 4UTZA 4IL5A 1VXRA 5AOCA 4IMRA 3V46A 3W3AH 4D9MA 5JJLA 3I64A 3NPMA 2II6A 2VHVA 4GXNA 2GKSA 2G8NA 1WF6A 1JR4A 2D59A 5B37A 1SHLA 4EBBA 3IQIX 4QRDA 2DLCX 4NESA 1KOFA 3THXA 1GQFA 5LZ2A 2QUIA 3JATB 4L9RA 2O2CA 2CDAA 3LWBA 3QWAA 1E3WA 3AF5A 1NN5A 2YN0A 3R1IA 5JDCA 1LI4A 1SUDA 2GJAA 1SWVA 1N1EA 2VT3A 3QTLA 4L07A 2ZOSA 2I2WA 3IOCA 1IU9A 1Y5LA 1WMSA 1BEEA 2Z1NA 1C1YA 5TJ9A 4DJTA 1U0SY 3Q8KA 4JT8A 4V2UA 1WF3A 2JDID 1DELA 4JDPA 1ZK0A 3BQNB 5AJZA 4JUIA 4RS4A 1I01A 3WADA 1IULA 4DSOA 1COWA 1KA9H 2APJA 2O8FB 1V9CA 1JQKA 1YZNA 3WR5A 3MJCA 1XJQA 1ZMRA 2RI0A 3OKPA 3HQ4O 3O8DA 2YMQA 3O6VA 1GRNA 3OX2A 3KHTA 4P4UA 4ZO4A 1WO8A 1V4VA 4XGKA 4MULA 4CMHA 3UAXA 2VL7A 3PHLA 3ONVA 1L5RA 2OYRA 1C7RA 3I2YX 1D6SA 2D2IA 3AV0B 3THSA 3QOFA 1QK4A 3IP8A 5EYPB 5HM8A 1HDEA 2OD7A 2YRFA 2VAVA 3DDSA 1BE0A 4JI3B 4FLEA 2YINC 2NACA 2OO5A 5TIIA 3F4KA 3MFQA 4GP9A 4U2KA 1RKUA 2AKEA 3A28A 4DEXA 3P52A 2AZ4A 4NCBA 3QNMA 3UC5A 1HE2A 5E7IA 4WV3A 4E6PA 2G25A 1YAHA 1ZRNA 2H7YA 2Q29A 4LVUA 4R40A 4GD3Q 2XF2A 3RK0A 3VJLA 4O4JB 3QBTA 3ZKAA 4DTIA 3BMQB 2YV5A 4TWZA 1L8AA 4A27A 3B3FA 1QBGA 2JJ8A 2VH1A 2OCYC 1KY2A 1EFRA 1W0JD 3PJFA 4LVOA 5JASA 3U1BA 2V96A 2BLLA 3DMRA 4DXAA 1J2RA 1QXSA 3H1AA 4Z9AA 1CPYA 2BEWA 5K0BA 1PS0A 1HT3A 1V2GA 1XKLA 2IE0A 4UREA 5IBQA 5AVWA 1MB4A 1DKNA 1G5HA 3LA6A 1KMHB 2PFKA 2GPJA 4QUIA 3BRWD 4HZUB 4DLYA 2CD9A 2J6BA 5JRZA 1TVKB 3AOEC 2ACKA 1WUTA 4B2YA 1I1QB 1OKKA 2ZRIA 4K81B 4LQLA 4M86A 5FI0B 3V42A 4C1NA 5DNEA 2QIPA 3DL2A 4EUKA 3IERA 2ACVA 4UBKA 1GAJA 1KP2A 1BA3A 3B8HA 1J33A 4BPRA 2LNDA 1PK7A 2GESA 4IWNA 3GFQA 1OXTA 3EMBA 5TMBA 3MBIA 2GCGA 4OD0A 4E15A 1YVRA 2ZVJA 3THYA 3RM3A 5BVGB 1EBUA 2O2ZA 1JTEA 5JZOA 5KOJA 1YZLA 2GUWA 5JAUA 3H2KA 4DE5A 3F0TA 2R87A 1NRXA 5F64A 3WRVA 2BHTA 1IDOA 4IIGA 1PWXA 2DFVA 2PKWA 3I4FA 1OYVA 1IQ0A 1HM5A 1KI6B 4QQ8A 4PZPA 4ZOLB 2VTBB 5D7BA 3WL5A 5J1TB 4OHFA 3GCWA 5LVAA 2Q3DA 4FYPA 4LWZA 1ATZA 2Z8XA 4RVGA 3MBOA 4HK4A 4TROA 4WFKA 3FOZA 2IODA 4HV4A 3A27A 1XNGA 1P2GA 3MM4A 2YY5A 3HEAA 1RWBA 4LXYA 4AJ4A 2VPYA 2FU5C 3AKEA 4OFZA 3EPKA 2EBWA 2C88A 2CLCX 5JCXA 4B84A 2WTEA 4QDOA 3EDMA 4RGVA 4TVSA 3HXMA 3FMIA 3LCJA 1LS6A 3AYZB 1BOFA 4EECA 4EUNA 1CRLA 2VH2A 1FZQA 1CZRA 2BKAA 2G5PA 1BFUA 2WHRA 3E7DA 4WEOA 4KO1S 5CYGA 4XDZA 3WXMA 1CJCA 1RR6A 3R7DA 1UJ4A 4J16C 5BW5A 4EPVA 2CW5A 2PVPA 2Q3MA 2AG6A 3CLKA 2YUTA 3LGSA 3QU2A 1WVGA 1B41A 4Q9NA 3WNZA 4RFSA 3I9V6 3GIWA 3QW4B 3R5HA 3PPIA 3TUIC 3ZN2A 1OAOA 2H2FA 2XNHA 2HXSA 2V7UA 2K7FA 5SYNA 1NYRA 2I1VB 1M7BA 4YMGA 5JHGB 2W4QA 4J0DA 4BAGA 5BN5B 4DMKA 2CE2X 3ROQA 1QOPB 3IVRA 3OU6A 4M1QA 1LPBB 1IY8A 4UEKA 2WWVD 4DT1A 5L9AA 1AXRA 3W2EA 3D4NA 3LBHA 1XNRB 4G5RA 2DWQA 3WGVA 1NOJA 2HJRA 4WJKB 1P2UA 1RRFA 3ME5A 1E1KA 2I6TA 1Y33E 3O1HB 2XCQA 5AHXA 3RAJA 2RD2A 2OM2A 2PGLA 3KJXA 4ID3A 1NQ5A 1N6HA 1XWFA 2HCTA 2YFQA 4UMEA 5KOIA 5F2NA 2IH5A 3GFTA 2C5AA 3EPPA 3OPYB 4HTAA 4AX8A 2O4UX 2OBNA 5K0LA 2M1XA 2XBMA 1JQJC 2ZKIA 2VP0A 2H2HA 4WFQA 3HVHA 2CZQA 1NE7A 1M5RA 2FMTA 3IV7A 5CFNA 1FFCA 3EAGA 4KXLA 2X2PA 2ZI5A 1G3IA 1BGXT 3HCOA 2W98A 1XE3A 1SULA 4OBBA 3THWA 4B3TB 1XAGA 3QP9A 1G19A 1K6JA 1MJNA 1QGED 1UEXC 2VDJA 3C5EA 3CPHA 5JNTA 3S55A 4TSFA 4CMEC 1YRYE 1P3DA 1JYFA 4V0RA 3O4GA 2E5FA 4JLMA 2FPUA 4OFXA 1I7QB 2FK7A 3D1JA 1DCFA 1YQXA 3QYPA 1WXFA 1GZHB 1JDTA 3C3JA 3ZDAA 2XXAA 1AHNA 3BTOA 4KN8A 2ZB3A 1R4ZA 3GEEA 3L18A 4RANA 3UMCA 4A6PA 1Y7HA 1Z12A 1JIIA 3IBYA 3R3HA 2JA2A 1IQPA 1ZXLA 2I3AA 2LDXA 3A7DA 3TCKA 4CKXA 1KXZA 1CTQA 2JH8A 1DX6A 1WA5A 1JX6A 3PPYA 1EA7A 3C87A 1RTTA 3L1UA 2FWIA 5SY9A 1ISJA 2Y1KA 4JX8A 4YAGA 1NXPA 3QK7A 5DHPA 1WZ2A 1PEKE 1Z7BA 1ZOLA 2A1TS 5EXDA 1W6RA 4FHGA 1QZTA 2DULA 2RAUA 3DPSA 5L3ZA 5BUZA 1ZHOA 2R751 1GHTA 2Z2ZA 3PNMA 5D85A 4Z4CA 5IAAA 4YQZA 4D2IA 1OV6A 2X3YA 3C8DA 1RI5A 4EENA 5E6RA 1DAKA 1XMVA 3K1AB 4FS8A 5HJ5A 4B35A 3EIXA 4JLPA 2YICA 1F1BA 1ZIOA 2PLRA 1SBTA 2UDPA 1VB3A 3BEDA 1SA0B 2QGFA 4DV2B 3THYB 3O8RA 3GNTA 4B3GA 1SUCA 3DC2A 2P0YA 1G20A 2IKSA 3D8UA 3NT5A 3JQ9A 3QENA 1QUEA 4OUDA 2VQ6A 3VJMA 1FSGA 5LMUB 2CF6A 4ZVQA 1AA6A 3VYUB 1N8NA 1B6RA 3STWA 1TF7A 2CT8A 3VOAA 5IP5A 1TQ6A 3WK7A 4JITA 1XF1A 1R15A 2OXCA 4DCSA 3EFOA 1YL5A 3NHBA 4FEAA 4HB2A 1TUEA 1W2WB 2RHDA 5BNZA 4ZI7A 4DCTA 4LWPA 3VVBA 3EBOA 5I4KA 4JGBA 3KAPA 1H2XA 2HQRA 3S3TA 1L7EA 2IBTA 1CRWG 4I5GA 2V5VA 3PU6A 5LBIA 4B74A 3AEQB 2VBCA 2WSLA 1RLJA 1KDVA 3R7FA 1L1RA 4YAFA 2Y0BA 1DIRA 2BFCB 1W52X 5H4HA 2EZTA 3GGPA 1X86B 3SCZA 2XE6A 5B3JC 1UC5B 3SZOA 4Z49A 1S89A 3HXKA 5MHTA 4OIFA 4C3VA 1DMRA 2JDIA 1PV4A 2RC6A 3OLZA 4HDOB 5C1IA 4PPNA 1ISHA 3H1BA 3C24A 1HG1A 1P9NA 2B7BA 3CJRA 3IUYA 1L4KA 2CDCA 3OZXA 3ITDA 5C46F 4EKNB 5LP1A 4AZTA 4CM1A 2YJNA 4MS4A 2AWNA 5WRFA 4CMKA 5BSVA 2CLKB 1MEEA 5BYBA 3RJ9A 4EG6A 4MCHA 3U61B 1MG0A 3CRNA 3ZTYA 13PKA 1P2VA 5AIBA 2P5SA 3DULA 4IIDA 1LZKA 4KU4A 2NUAA 4Y6GB 4BVBA 1Z0DA 2EKDA 2GPSA 2PX8A 4BAUA 2EJBA 2WFLA 3FOFC 1HYEA 1E98A 2DT5A 3DMGA 2FI1A 1V9SA 5IDXA 2JH9A 5BUSA 3SKVA 3D31A 5C5EA 1PT6A 3LUAA 4I5EA 2FPKA 1L1FA 2RH9B 4N6OA 2VNSA 1UBGA 2HCBA 1DOZA 5BWOA 4ITRC 1C1XA 1FC0A 2D7CA 3HB5X 1HXHA 1UMCB 2ZQ5A 4PBRA 2QTHA 3OIVA 1TX4B 2CVQA 2JGDB 3JU3A 1ESCA 5B3AA 1P9WA 1HL3A 3EDCA 1ZK3A 3TZHA 2XW6A 1NF8A 3L8ZA 1ZH0A 3E0XA 1FP1D 2RG1A 4DR5B 4GGPA 1D8AA 1ZA2A 4Q66C 4BFWA 4EA6A 3MOSA 4B3FX 4EHIA 3M2PA 3ZC3A 1SK9A 4LZAA 3TMKA 2JFHA 4XJSA 4ZYXA 2ATVA 1SXJC 4E33A 2D1FA 2CJXA 2YVLA 5LQDA 5KU1A 1P9RA 1Q16A 3MAAC 3CEJA 5KX5A 1KYQA 1CWUA 5LDDC 4BBAA 1RJGA 2HKIA 4H7DA 3KD2A 4J7XA 4JEUA 2XVXA 3IP6A 5AICA 5KNLA 1EK0A 3PQCA 4G5OA 3RB8A 1LA2A 3WNQA 3MUNA 3LQ2A 2Q6LA 1LDYA 3H19A 4HY3A 1J8FA 1KYVA 1ORDA 2AW3A 2ID4A 2P7HA 4L1KA 1YB4A 4P5EA 5IDYA 4JKIA 3L07A 4HX9A 4F1WA 3IIJA 3TSAA 4JUCA 3MUEA 1D1QA 1GDTA 4IF6A 3ZQJA 4TGLA 3EJ6A 2JAQA 3R8XA 1F2TA 1DAOA 4HFRA 5A3VA 3OQ1A 4DLLA 3K94A 2D54A 2W8ZA 4DAEA 4B3HA 2HDOA 4K9MA 5EE1A 2O57A 2X3UA 3Q11A 5DVZA 4JI2B 4PC1A 4ER7A 2O54A 1RYHA 2HBYA 2Q07A 4CXMA 2OQVA 4Y3UA 1P0PA 1AV7A 3GGGA 1Z0SA 2WDZA 3G49A 4PX2A 5JSUA 1AOXA 1X7DA 2XVMA 1XU9A 3D0RA 3B1XA 3GHYA 1TM3E 2ZR7A 2VSYA 5F33A 1CW2B 4B8YA 4WIAA 4LJAA 3S1AB 3E61A 3VA7A 3W5SA 4BMPB 4MIOA 2JFYA 3OLYA 4XYLA 3I1YA 3TXAA 3IJPA 3SQMA 2XMSA 3SBXA 2WKPA 1Z7GA 3GRYA 3KS9A 1I24A 2GA8A 2Y71A 3QG1A 3V97A 1AO3A 2IA5A 3DKVA 3RSCA 1WPRA 3DLTA 2AKYA 4UDXX 1W8DA 3OUZA 4OYRA 1R10A 3QLTA 2OP1A 2R6ZA 2IY7A 2WJIA 3PQ8A 5I45A 1A8QA 3IJEB 1Q17A 2FFRA 4O4JF 5E3IA 2WMDA 3VO2A 3ISJA 3JYPA 2ZRAA 5AVYA 2IH4A 4I8DA 2RK4A 3G9ZA 4X20A 4J4BA 3OMLA 2IELA 5IDQA 3DDCA 1JIUA 2NW6A 3FTEA 1N2IA 1G8SA 1Y63A 2P3SA 1QZUA 1ENPA 1KMCA 2IVZA 4JVLA 1QIMA 4PZUA 3R7LA 4E5KA 3AVOA 1BKSB 1G2IA 1WKCA 2Z56A 1JYEA 3ZHXA 4GZ3A 4YMTA 3E35A 2PY6A 2LR0A 4M0CA 3DE0X 1U99A 2R86A 1RRKA 2X4IA 3H4IA 1MAWA 4TMVA 1OCEA 2P4HX 3HZZA 5P21A 1PL8A 4BMOB 5I5EA 4KFRA 5E1BA 5JS8A 1Q7GA 3BJIC 3BVPA 3GQBB 4AT1A 4N5LA 1PP4A 3M34A 4B3XA 2B37A 1DKMA 4YTEA 1L5ZA 2W4IA 3HL0A 2WSSD 4BB6A 4MRMB 5FUWA 4CLDA 4RSRA 4OHMA 4RS3A 3NKVA 2J9YB 1V8OA 2J4DA 3H9EO 2BDEA 2AN5A 4YA6A 2WU3A 2OXEA 3TIXB 4ARUA 1HV8A 3H16A 3WKBA 2B92A 2QYHA 4K9PA 2O8EA 3E53A 3E70C 4HUTA 3AKDA 3T9DA 1XL1A 2F3UA 1X80B 5DHTA 4FP9A 4B31A 3Q10A 4MRRA 3OCVA 3HUEA 4PR3A 5JDIA 4K5QA 1O94C 4P3XA 1TQ2A 4B3CA 3CUYA 2FGKA 3ZCPA 1RIIA 1BQ4A 1U11A 4KDFA 1KQNA 1H5QA 4KTVE 1OFVA 1KSJA 4JLUA 2XZLA 3CNQS 3ASVA 2IYOA 3C6YA 2PVCA 3UHOA 2BKXA 1PNQA 1CXZA 1KR2A 1FLVA 2QZSA 1XDUA 3DAPA 3OAAA 4EUEA 4FCCA 3M6AA 1NHGA 2FUKA 1EYZA 4I55B 5I7SA 2HEIA 2I2XB 4FJ1A 3SGLA 2AXQA 4DKJA 5JVDB 5AESA 2AUMA 2A9FA 2HHLA 4RD6A 2QW1A 5KJCA 5ALOA 1FSPA 2GCOB 2OGTA 3V4ZA 5CG2A 5FDFA 3KIPA 3FA2A 1LBSA 1PJAA 1IMJA 3FCXA 5GIOE 1BAPA 2BMWA 3WGJA 3BMOA 4YDHB 3TXXA 5LKAA 2J30A 1V6CA 3BE8A 1L7DA 1P1BA 3TBHA 4JJIA 1QG0A 1COWD 1DRUA 1W2HA 5L8VA 3ELDA 1YCHA 1UBEA 3VAYA 3EXFA 4ASUD 2W00A 3MD9A 1F0NA 1KJWA 1LNSA 1X14A 3BIXA 3M6UA 4ECAA 4AFNA 1KYXA 2OZEA 3AP1A 4G07A 3IHKA 1O6FA 5ARCA 3TSYA 2VTBA 4HUQA 5DBOA 1GEEA 3NIFB 3C4JA 2YJ5A 4LOJA 3AM1A 2LCIA 3CUTA 3ACBA 3H9CA 4PTLA 3STXA 1G8MA 3HM2A 3IXLA 2FZLA 5IN4A 5FFNA 3FFBA 2R1UA 5MN6A 3ZXUB 4J0KA 5H0IA 4F6LA 2JAHA 1MT3A 3GLGE 4Q15A 1YUMA 4YAJA 4CDNA 3DHYA 3K1TA 1D2GA 1WCV1 3K9QO 1RQLA 2A3NA 2HF8A 5AM0A 2PGXA 4KPFC 1M66A 4JLWA 4G4SP 3AR4A 2PRKA 5CB4F 1XLTA 2BP7A 3F3MA 1B93A 4D57A 2Q4EA 4RD4A 3BAZA 1J1IA 3PD0A 3ND8A 1J8MF 1JV2B 2FQQA 3PDHA 4EZBA 3Q9SA 4MZXA 4UD6A 4XD7D 3ED1A 4GO1A 1QZZA 3IAAA 5EIFA 1GG9A 3UMMA 2V7QA 3O95A 5AYVA 2FXVA 2ZZKA 3Q12A 3QVWA 4DSTA 1WMDA 2MMCA 1YI1A 4I4CA 4NEHB 4AP9A 1JALA 3R6DA 1RXWA 2Q2WA 4GGMX 5FX2A 3E1SA 3AOGA 2Y05A 3KKPA 3O3NB 4TT8A 1U9CA 2BFCA 3RK4A 5JXIA 3BFKA 3HCCA 2CKDA 4JLNA 3WYNA 2G6BA 5IT9A 2BUAA 3RYHA 3T1HB 1GL3A 2FWPA 3KQQA 1JFRA 2GCPA 2JJMA 4MUBA 1GLVA 2O8VA 1N5MA 4E2WA 1ISPA 1DBIA 1JHXA 1NYTA 2C9MA 2NTNA 2QTWB 4HG2A 4MEJA 3ZBQA 3V8EA 4CW7A 5A4AA 3HJUA 2Q0QA 3O8CA 4RNCA 1CF2O 4JBIA 2VT7A 1BXGA 1OXBB 3OLVA 3BD8A 1M54A 5JG7A 1T91A 2FNAA 5AOVA 2QBYB 3NETA 4BEVA 4D1YA 3DL7A 4LX8A 4LECA 4AB1A 1VSVA 2X2OA 2EV9A 3Q8XB 2CCKA 4KAAA 4MQUA 2CB9A 5CUQA 4B3DA 4EI9A 1APBA 4RTRA 1XC7A 2RI1A 4LPKA 2D13A 5BQOA 1V11A 4TWBA 2BTQA 4G8BA 3H42B 2UYQA 4LDJA 5HIIA 3GLFA 1I6WA 3GCDA 2WFLB 3KTDA 4F21A 3T7TA 3D3WA 1NXQA 3O2JA 4BX0A 4WK4B 5CHYA 4X85A 3T7SA 4EDHA 2BZGA 1OZAA 1E9BA 1JFFB 3RTGA 2VHUA 1MIOA 1OFGA 4ATNA 1Q12A 3EVEA 3FFXA 3IH5A 4KO4S 1YE5A 1H4SA 5A0TA 1L5MA 5EJ9A 4F3RA 2Q9BA 3V8PA 5TGZA 5AVTA 2AFIE 4GRIA 1X8JA 1MZVA 1ZH4A 4LJLA 1YQTA 1I4OA 2ZIAA 4FYVA 2OBXA 1QVAA 1MT0A 1CR1A 3K0BA 3VI4B 2QN2A 4D8UA 1SCQA 3L0PA 5JNWA 2DPHA 2XGSA 2FDRA 3CRMA 5DOZA 3SF8B 4NU0A 3IXMA 1FS5A 3P5SA 4MHOA 3WB9A 1IY1A 3MVEA 3K9FC 4X9XA 3K5WA 1H5NA 5C7LO 4KBGA 4A36A 4HAIA 3JAWA 3KVRA 4N0PA 3D7KA 5CJ2A 4UM5A 5D1NA 1EQ2A 2WICA 2XDWA 3KZCA 4E30A 4WXMA 1KMMA 1Z08A 1NF9A 2F9LA 5CLIA 4WNAB 4CM4A 5COAA 1L7MA 3G13A 4FT4A 4HH0A 4WZBA 2WWIA 4OQZA 5BR7A 4EJSA 1KFEB 2H17A 2Y0PA 2QE7A 2QRVA 3ISVA 4AMYA 4PNEA 4TYNA 3ZBPA 4F9EA 2Z9CA 4GIBA 4QSMA 4XR9A 4DCUA 3KJQA 2C8VA 4P34A 4JR1A 2P9ZA 5KSYA 4FYHA 1SNYA 1GUAA 4UAJA 4AJNA 3ZVMA 4DM7A 1IK4A 1O95C 3AFNA 2O1SA 3SNKA 3TGPA 5EJEA 4N65A 1ZD2P 2FVYA 2Q2OA 2VPQA 5HS4A 1NOKA 3PC8C 4D80A 4OI0A 1JBQA 4GMKA 1B3RA 4R31A 4RD0A 3WMRA 3KVYA 3T7IA 4BVKA 1XQ6A 1Z6PA 3IODA 1W19A 4N5IX 4KQXA 2FOIA 4Q4LA 4HX2A 3ROFA 4D9GA 4BNYA 3HN6A 3GUUA 4FFSA 2EP8A 2IYZA 3IUJA 2Q46A 3IMKA 4OSOA 1NMEA 5G40A 3PIIA 3OCZA 1KZ1A 4CV1A 1E7QA 5IK2A 5LOVB 3O8NA 3RYIB 1C3OB 1KDOA 1R3UA 3SKXA 3R7NA 3WLIA 3RVNA 3BHIA 5FXMA 1RQPA 1P7YA 3RFFA 4B3BA 2BP7B 3BWEA 5ERXA 2AVDA 2PL9A 2VNIA 4MGZR 4MUHA 1LRJA 3DKRA 4OP1A 4OXRA 4EF5A 1NVUQ 3STHA 5HWSA 3FR7A 3L3BA 3HP4A 4N0QA 4Z9XA 1EX1A 3QLVC 4AM8A 3U7QA 2E2WA 1VJRA 2GHRA 4OJYA 4NVRA 2DWUA 3BWBA 3A1TA 2QM0A 3CF6R 3F78A 4YCJA 5J2UA 3O4IA 2C4UA 1FB5A 3VSCA 4QGHA 1PW5A 4Y67A 1G3UA 2CXNA 2IEZA 2ZG6A 5AVJA 5AM4A 1F0YA 5DH9A 3UJ3X 3MUOA 1RI4A 1TCAA 4AXXA 5JHHB 4C7BA 3UIEA 2KB0A 3GVXA 4B5KA 4MR8B 5GGYA 2ZDHA 3GT3A 4Y9TA 5D51S 1K08A 3IPLA 1JSCA 1NXSA 3AR9A 3T99A 1BU5A 2DR0A 4ZU3A 3FPKA 2P6NA 3K1YA 5LMCA 1A2QA 1KZ6A 2QJWA 2XSZD 3F7NA 3W9UA 2XWQA 1NBHA 1QNFA 1PK9A 3LWDA 2V5AA 4GOXA 3SFTA 1AKVA 1JDBB 3K2IA 1FNMA 4PIPA 4QG7A 4UTVA 2GXAA 1G9SA 3LC2O 3LUGA 4FMBB 1A8IA 4XUDA 1G38A 3BS4A 5F98A 1DWPA 1FFSA 1T9BA 2OD2A 1WWKA 5FTKA 2Q3LA 3N7UA 4ZGGA 5AHWA 3IOEA 3ITNA 4ZJUA 1MD9A 2G4VA 2ZR0A 4J91A 3BXOA 4C0KA 5GONA 2NXCA 3KCNA 2XF8A 1JFFA 1YVPA 1OX4B 2OO5C 3G2QA 2Y67A 4C0JA 4COOA 4LFBB 1D7OA 5DYYA 3UHFA 4RTLA 1E99A 4LCEA 4YPOA 1WQ3A 2HD4A 2TYSB 3B2QA 2BFFB 1G1MA 2BFEA 3QU5A 4I8XA 4KDRA 4QTXA 2AX4A 2VNJA 4EA7A 3NZEA 3E3LA 3BYZA 4ESHA 5CNKA 4I5DA 4IG9A 4ZT3A 2C5FA 5BSFA 3RC8A 1RP1A 4G85A 3KQUA 2QTBA 3DVQX 3IMEA 4JJ4A 3C3KA 5TC4A 3HRIA 2OV6A 2XE4A 4WA8A 3UAYA 2C2XA 2IU6A 4YC7A 3PS9A 5CH3A 2QRUA 5TGDA 4QQFA 5CD9A 1QAOA 4TMYA 4TL8A 1O5OA 5CA1B 3FVRA 2WAOA 3TE7A 4QDJA 4AICA 5F1YA 4X1OA 5LL6P 4YI3A 1SO8A 3GLSA 4KE6A 1KPGA 4D8VA 1UQRA 3KOOA 1T1SA 2JI6A 3I39X 4WADA 1Y6RA 3DO8A 4EATA 1HNWB 3PHJA 5FR2A 3HYSA 2ZTUA 2YXBA 3OQJA 5KNDD 4CLXA 3TE6A 3I61A 4FYIA 4C2BA 3MWKA 1NBWB 2DHQA 4OQQA 3BL5A 3L6BA 1ZL2A 2BF7A 3D2AA 3HCBA 1K89A 2X9QA 2C2GA 1T29A 4P80A 4N0MA 1QNLA 4G5SA 3A4NA 5CDSA 1JP7A 3DCYA 1PYGA 3HEMA 3UC9A 3E6AA 3LKDA 4JMLA 3K8QA 1RAEA 4KXWA 4XM0A 4BMXA 4BRUA 2QUHA 3OM8A 1MEOA 3R24A 4UDYX 2PNJA 2HF9A 3EOAI 2W2LA 3DKKA 4R1TA 4I99A 4PYNA 3CTMA 3UV7A 3H87A 4EHAA 5JS2A 2UZIR 4H7FA 4MS3B 2X5OA 4Q3DA 2ZAGA 3JZDA 4N49A 3G0DA 4QDXA 3UGQA 1CB7A 4WBXC 3RHTA 5FWXB 4MYUA 3VR3A 1BYUA 4J2OA 1NW3A 5ICSA 3RF6A 1O9BA 3CVUA 5THKA 1NI5A 4MJXA 3PPVA 3CRW1 4IIBA 3CWCA 4XFDA 1DAIA 4JJ8A 1BE6A 2KLHA 1P80A 1XDWA 3UT6A 3LHFA 1E0DA 1BOOA 1K9VF 1FX0A 2MYNA 2OHXA 4JLKA 4WUVA 2W6OA 3ZHQA 2Y68A 1UUFA 2H63A 5ALHA 2OHOA 3JWIA 1U3TA 4MRAA 1KJQA 2RB5A 7ADHA 1G8KA 3PBKA 1BCSB 3QXCA 4WOCA 3RYFB 2IW3A 3GYGA 1J1UA 2BPOA 1DCMA 1CIVA 5D7NA 4M1KA 3S68A 1SURA 4YR7A 3G3EA 3QBEA 5CURA 2WZQA 5TMPA 3FGOA 5IC6A 5LUAA 2QN1A 4B17A 1OWPA 3ABOB 2XUIA 3EB9A 1UQUA 3MGBA 4GQIA 2LKCA 3GFSA 1LF0A 2YZGA 3C3MA 1ZK2A 4AIRA 4LJ8A 4GRDA 1PUJA 2HTFA 1IN6A 1Z0UA 4DZRA 4EHKA 5BY2A 2CFCA 1QHHB 2CXQA 2GJ8A 3HP1A 1GADO 2WLTA 3ASUA 2XKJE 3OKAA 3R5XA 1R4NA 4G8JA 4DMMA 4PC6A 4YJFB 3TQOA 4QUHA 4C29A 2ACWA 4YP1A 5KNCA 3Q9UA 1DSSG 2SNIE 4LF9B 3W79A 4GMHA 3H2HA 1YDEA 3WGMA 4IJ6A 2HMUA 2J32A 4KI7A 1ND6A 3CLRD 3HYRA 4BO7A 2IHYA 3ZCRA 5GINE 2V4UA 4E3WA 3HKCA 5EC8A 1Q3TA 3HMQA 2Q4OA 1JXAA 3OO0A 3V1NA 2CJFA 2J5RA 4DUGA 1GPUA 1XYGA 1NUSA 1Z75A 2FPPB 3ED5A 5HR5A 2QTMA 4RADA 3EMDA 4UFPA 3IIKA 4PE5B 5HUJA 4E3ZA 2H5IA 4HRVA 5G0TA 2QVYX 4CCSA 1E60A 1YS6A 3ZWYA 1FSFA 4LBVA 4FVTA 1X74A 1N4AA 3EIQA 5TT1A 3GJ6A 2WTUA 2AF4C 2PL1A 2XYPA 2IFTA 3N2KA 1GITA 5BMOA 4YQFA 4J0HA 3KQSA 4JJEA 2F1OA 2QAGC 5I6DA 2VDUE 3IFSA 4KVGA 3B7PA 4TLLB 2XGOA 3GEHA 1M1UA 4Y2SA 3ROKA 1R88A 4Z3OA 2WD8A 1EVKA 4YREA 2IU4A 1QQAA 1XN1A 3GUCA 4N39A 1B8NA 3CZRA 1PFYA 4Y7CA 1K1EA 3T1OA 5KMGB 2FPIA 1UANA 1MAVA 2ACEA 4YRQA 5EIBD 3K5PA 5C51B 5EIOA 2O8FA 2VJDA 4U9HS 3KT0A 1RE1A 2AW5A 3RVRA 3SQWA 4H1VA 2ZJOA 2W42A 3GFPA 1GGEA 1N6OA 4BLTA 1XRNA 1Y1QA 4TZ6A 4B81A 2G06A 4A82A 2IE8A 2ZYAA 4M1OA 1W36D 2IDJA 3PT9A 2P90A 1KEUA 1O4WA 5FA6A 3L0IB 1J9GA 2HL6A 2BCEA 3AF0A 2CK3D 4FTWA 3WAKA 2AD5A 2H07A 2RHBA 3EFHA 4YX9A 3S5JA 4R6WA 4UDOA 1QIHA 3OICA 1V11B 2OYSA 3RODA 3K9WA 1M8KA 5FO0A 1E2BA 2JGIA 4MEAA 2HT6A 1XX6A 4IGKA 2LGJA 4UHFA 5HKBA 1B2LA 2H9IA 1R8QA 1N0WA 4MAMA 4ZHSA 2HQBA 2XE7A 2GYYA 1V25A 2L2QA 4QHSA 1SCUB 4FC7A 1E9FA 3PB3A 1QE3A 3WIBA 1RACA 2QA5A 2EFGA 2QL9A 3IRUA 2BDTA 4BKRA 3SVTA 1X8KA 2W2OA 3ZDEA 2BW0A 3ZWWA 4LJ4A 1Y3CE 3LHSA 2J87A 3D0QA 4GI5A 4B3IA 3PFWO 2YJGA 4B6GA 2XYHA 3GUHA 1HG0A 3EULA 5JQGA 3KYJB 1XCJA 2C7QA 1TI7A 1XFDA 3SYKA 1NVAA 1SH7A 4MV7A 5IJ0A 3DBRB 4J90A 1YBAA 5FBRB 2QT9A 4CETA 2IXFA 1ZWLA 2NUBA 1ULAA 4MIKA 2A1IA 2XGMA 5H3LA 3UG7A 4PG4A 4RELA 1CP3A 1KOJA 3ZCVA 3QX9A 3PA6A 4ZVUA 5L3RA 1U2GC 2IPAB 2J9XB 1I51A 2VIIA 3FFWA 1QM5A 1WTCA 3T7RA 2NO1A 3GG9A 4O8ZA 4L8WB 3ZU4A 1MHTA 1OVMA 2AA3A 4Z3KA 4TT3A 2B0JA 4F12A 3AL3A 3CN7A 3JARA 1MW8X 3Q1LA 3A31A 3H13A 4OMUA 1ECJA 2BHRA 4UULA 4F8JA 2HSDA 5KOYA 3OT4A 3B9QA 2Q4BA 1YHZA 3DMTC 3GDFA 4MRPA 2ZSJA 5TS3A 3RJZA 1PZFA 2DYKA 4HLUC 5BOSA 2OWDA 1R5OA 2X41A 1JPVA 3DE5X 1FSSA 4I50F 4NXMB 4QLAA 4RPJA 3KQNA 3AIMA 2IVFA 4WKNA 3ORRA 1X0VA 3BHJA 5CLHA 5T67A 3AY0A 5A05A 2X8WA 1XUOA 2ISQA 5IRCD 4WXRA 1VSUA 3KZXA 4KXFB 2C1XA 4W5HA 4FJ2A 3ITKA 4Q4DA 3NOVA 1V6AA 3DTYA 3O21A 1P7WA 4TKVB 4CCWA 4CEHB 3I6BA 4B34A 1MPXA 1ODLA 1SC3A 2NYVA 2I33A 2OAP1 3HR7A 3JQAD 3KSMA 4AO6A 5IFKA 1U7XA 1XB2A 2HDNB 4W5WA 4HEA6 3SX2A 3UAGA 1P4SA 4H6VA 2OV3A 2YZNA 3DZFA 1DUSA 1JDVA 4MW7A 1N0IA 1M2VA 1ZH6A 3B6JA 3MTQA 3K70B 3GP3A 1DEOA 1ZIXA 3E58A 1NOIA 3D6MA 3OAAD 4EPTA 2I1WA 4BLSA 2DFLA 4FIZA 4IXTA 5CGZA 2PXAA 3C6KA 4F91B 2Z8YM 1GTJ1 1RQ7A 2PFSA 4Z9FA 1HSOA 2BONA 4BQNA 4GYWA 5J2UB 2RGNC 4RHCA 1TK3A 2FTKE 1OAKA 3QUCA 1N0HA 3WNBA 2FMHA 3OCXA 1M1ZA 2NYRA 2QM7A 4B4UA 5F3WB 4LBWA 1EXNA 2VDVE 4ITVA 5DHQA 4GOKA 1YCFA 2J09A 1V5IA 5L51A 3IUBA 4IGFA 3M83A 4MR8A 3I0MA 1A4IA 5CCBA 4V0OA 1AO0A 2F17A 1OC4A 1ISSA 1C0PA 1J22A 1ZLYA 4DIDA 2F9MA 4MW4A 3W5CA 2Z1MA 2VRWA 4R54A 1UP4A 3UB4A 2WKQA 4BRSA 1ZMTA 1EGVB 3DLIA 4JYMA 2C94A 3C0KA 3T4UA 2XQVA 4GC5A 2RIPA 3U3MA 3PQFA 1I8TA 1HE5A 1OGYA 1NQXA 2I1LA 4K9LA 3UKDA 1W73A 2BGJA 2BF4A 3M6LA 3X2SA 4ARIA 5EYPA 4XIGS 3GLIE 4DR6B 3QE3A 5CT5A 3BRSA 2GN6A 4D8WA 4WWHA 1A8PA 3MJHA 5G02A 1N6KA 3GW8A 5K0CA 4IBOA 3NBYC 1N2CE 3NORA 4GP6A 1XMOB 1NVMB 1XRSB 3PNKA 2W93A 3UHPA 2C0QA 4YRMA 2PRIA 4Y6LA 1X7XB 3UJ8A 1KRXA 2XTMA 5TQJA 1HTTA 4X6UA 2XXAB 4N48A 4MS3A 5K45A 1IDN1 2H85A 1NW9B 3F74A 2VI5A 4RLFA 1VL0A 3IV9A 3MMZA 4H6XA 1ZJWA 2R4QA 3SLGA 1FYVA 2HIAA 2CJWB 2YZ2A 3UYLA 4FB5A 1FIUA 3TJMA 2BSXA 2RBEA 1YJCA 4ND8B 5IZCC 1RZRA 3E9QA 2V7QD 2DPMA 3KSAC 1VKJA 4KKXB 1F0KA 1HBJA 1N9KA 3LO5A 4NOMA 5A5VA 4CV0A 1RYDA 4BNNA 4CFZA 2V45A 3N86A 1GU7A 1VKOA 2P77A 3CCCA 1AZLA 4X66B 4AQYB 5JS1A 1I80A 4G1CA 2VDOB 3NIGB 5H83A 3ZH2A 5TQVA 4HQFA 3WJAA 3OTQA 2AC2A 1ZVJA 3WZMA 4D9BA 1DLJA 2WUVA 3G85A 3O8BA 1G59A 3RYFA 4EY8A 4I1PA 2I6XA 5CCXA 3RU3A 3E9EA 4WINA 1MKYA 3ZTTA 2P9CA 3DOUA 4NZZA 1ZIPA 1R00A 1IXZA 3H9QA 3QITA 3ONFA 4BWFB 3BPSA 2OMEA 2VSQA 5AHOA 1WZEA 3F2IA 4YALA 4TS4A 5JANA 1WXDA 4FDUA 3FYTA 1SC4A 1YULA 1M6HA 4GEGA 4LNHA 1BD3A 1PGNA 3E81A 3ILYA 3JS5A 2Q7DA 3E4CA 1W581 3NH6A 4UTPA 5H8WA 3ZGLA 1WSDA 1A96A 1C4WA 1EX9A 4BU0A 1BRMA 2OB2A 3DDOA 2IZ6A 2AL7A 4YJFA 1ECLA 2C83A 4OI2A 4ZODA 1VI5A 4MWSA 1RI3A 5K6AC 1N77A 4KUEA 2VLBA 1C7FA 3GJYA 4J1TA 4AROA 3KHKA 4G65A 2XMDA 5DNYB 4UUMA 5CD1A 1BVRA 1NMSA 2PQ2A 3U3JA 3CVWA 2D1SA 5D5HA 1IHDA 2XTZA 4JLSA 5T64A 4QJ3A 4QEZA 1VG9B 2X5NA 3E2MA 4R1OA 1CK4A 5JCJA 3VVMA 5IASA 2C77A 1T6ZA 2N75A 3IBTA 2HF2A 4TQ9A 4DDKA 1HRDA 3A1NA 5ALUA 3N05A 2QSJA 3V7WA 4EZEA 5GV7A 2W6JA 1VI6A 4ROSA 3A2LA 4Y6RA 1N4DA 2MSEB 3JWEA 2FDCA 5DYTA 1JZSA 2E48A 1P91A 3HH8A 3ZBTA 1K86A 1L4HA 2QG4A 4HNSA 4V0QA 2IEDA 5DBFA 5EJ8A 3PT5A 2IOYA 4PQFA 5AVSA 4PLGA 1C4XA 3TLXA 4B7AA 4HH4A 721PA 3K0SA 1G18A 2E0IA 3GJ8A 5CB4B 4LVNA 4G2NA 2AK2A 3ONNA 1Z0AA 5BN5A 3BERA 1F8FA 2PUHA 5GOTA 5KWIA 1NYQA 5LJLA 1ZVVA 2P9JA 2OXTA 1Z25A 1T4CA 4JOBA 4LDRA 1XMIA 3MWEA 4L78A 4A0FA 2PK3A 2JVKA 3EZNA 2VQEB 4I5FA 4MGIR 1R4NB 4F8YA 5CITA 4H35A 1UKBA 4DIFA 1NY6A 4KAXA 1C1XB 2F4NA 1IEVA 2CJPA 1QVZA 2QR3A 1FX1A 3KZKA 4H0NA 1CULC 4WQMA 3U9SA 5CAEA 1WB9A 3OTWA 3Q5GA 4IHAA 4V3BA 5DTMA 4LYHA 2YOFA 1I4LD 2HR1A 1OXMA 3FHJA 4G1MB 3Q9NA 1NNLA 1R5JA 3E18A 1L5KA 4R71A 2Q99A 1X7YA 1YB2A 3DBLB 3SZGA 3ZTWA 5IKEA 5JFOA 2Y9MB 2FPPA 2R44A 4DRYA 2LV8A 4S24A 2XTJA 3IQXA 1ZQ1A 1X1DA 4W5NA 2JLWA 3QVJA 3U4HA 5IF3A 4LKOA 3MWFA 3NWEA 3LCRA 1GKKA 2P3QA 1Z8FA 2QRKA 1A5SB 3MMPA 4P7KA 1K92A 3F5MA 2WAYA 3KKNA 4GMDA 2IS4A 4HTFB 2PH3A 2VHCA 4X62B 1YACA 4RAQA 3FZNA 3KQTA 3IQHX 3O1LA 5KCZA 1XPOA 5KOHB 3GFRA 5DTIA 4G23A 5KSWB 1H2EA 5FPKA 2XB9A 4N7MA 3UV3A 2CVZA 4OQDA 2QLMA 3C39A 3VVLA 4DJJA 1V7CA 2XZPA 3TLZA 3WB2A 4DC0A 4MWDA 1QHXA 4OV6B 5IBCA 1KZ9A 3CVYA 1YSCA 2AR9A 4BS9A 1IZYA 1VM6A 2PX0A 2P6RA 3W2GA 1K8ZB 5JAPA 1ECPA 1YS1X 4FKBA 1E20A 1LI5A 2GSDA 3KRTA 2NZ8A 4JJGA 4M0PA 4WASA 2XY4A 5C4IA 4XH9B 2Q7OE 3R44A 1T15A 4YRRA 2R7AA 3EVBA 4AY2A 2HDWA 1G21B 3QPUA 4OCZA 4B75A 3GJ3A 1UJCA 2BMVA 4I6EA 1MW9X 3LS2A 1N2HA 3PR1A 1E5DA 2VF4X 4CFYA 4ENUA 5CLJA 2OM6A 1DBPA 1O54A 5A2GA 5AW5A 4NE9A 5JY6A 1YQQA 2QU8A 1TL7C 3JARB 4UZEA 5D3QA 4D8YA 4EO9A 3BJEA 3KLPX 3IVAA 3HVRA 3GK3A 2GXUA 2VDPB 3K32A 1TLFA 5C80A 4LKRA 1F20A 3LYLA 2HJHA 4NBRA 5LD2C 1EK2A 1I1OA 2ABWA 2V9PA 3C7KA 3O92A 1QKJA 5JAOA 2EBFX 2C59A 4NR0A 2O8CA 4LISA 4IYJA 3LT5A 4UBIA 1NQVA 2FG7C 5F77A 3UWMA 1N8TA 1LK5A 5CDTA 4UQOA 3Q8LA 2PO5A 3UAOA 2FYTA 2PMKA 1DAPA 2RCNA 3LF1A 1MAUA 3D0KA 1NJ1A 5TGTA 4ANFA 5JNVA 5FI5A 3VHXA 3T7AA 3LZDA 4HFJA 3FDIA 4MVJM 4KXNA 4E08A 4YYZA 4JLVA 3ZKWB 5AKKA 3CZMA 3WGHA 4BUJA 1X15A 3D6FA 3H6KA 3PFCA 1SPBS 2I2AA 4JOQA 1CZNA 3PCXA 2OVFA 3RHFA 5KNBH 2BMEA 4HQ0A 2AMYA 3LZ6A 1MQ9A 2Q3BA 3MB8A 1N7IA 1A98A 1UFRA 4K40A 4N7RA 1MOZA 5I7AA 2NU9B 10MHA 2HO5A 2W11A 4EW2A 2BHLA 5AUNB 2WYIA 4MICA 3PTAA 1M76A 5SYAA 3WE7A 2AJDA 2NUPA 3P9PA 4L8LA 1JR3E 1A9PA 2W2KB 1N1GA 2DHDA 3HB7A 4IWYA 4RD3A 4RJLA 1XZLA 3HSYA 1AKWA 5E1DA 2B25A 2D5AA 5K8IA 2NSDA 4AY4A 2DC1A 5I8WA 2KQUA 3JRWA 1TF5A 5I4CA 4UM7A 1WABA 1JQEA 5GV8A 1D2AA 3T9BA 4HS9A 5DB4A 1I4WA 2QP3A 4L7VA 1GL7A 4ZWNA 4C87A 5EKSA 4B3MB 3WMFA 1WKVA 4PPQA 4QUKA 1Z6YA 1S1CA 2NUTA 2QY9A 4Q12A 2O2SA 5B1HA 2O7RA 4WZ6A 3QEJA 5FWYA 3PTZA 5DLEA 1CEYA 2PWAA 3M6MD 3QJ5A 3ZE2B 4MDEA 3GRRA 3R6TA 4AP6A 1S02A 1XEFA 4D26A 3NIDB 3B1KA 4J2TA 4S1OA 2ZSAA 3CW8X 4EB8A 2WZBA 5JZ9A 1Q7TA 1JGTA 4PN7A 3DCJA 1GU0A 4V39A 3OKCA 5L7TA 3VO8A 1QLJA 1QF9A 1YK1A 2ECFA 4PZEA 3OLCX 3UICA 4PRYA 3UT5A 3L41A 3JASA 3NIBA 4D3FA 2WF7A 1WU8A 3K4PA 1M2VB 1ULUA 3IUMA 2EHDA 1GNSA 3MJTA 4R01A 3WLQA 4DLBA 2GEDA 4QOFA 2RGUA 1AHHA 1VJGA 1ZKMA 4MROA 5JXHA 5DBIA 3H0CA 2B78A 4Y6OA 1A72A 1TQDA 4LX0A 3R5FA 1CDDA 2IIQA 3ZJ4A 4X1YA 2CK3A 3WTCA 1ODFA 3K5IA 3K9HA 1J21A 3D8NA 4Q1CA 3JQEA 1BDIA 3PVCA 1XBTA 4MLCA 3NVAA 2WJPA 1U2DC 2P9GA 2PWPA 4NABA 4BO1A 4LRSB 3TFOA 5EG5A 3PE6A 1L4LA 4NP6A 4PYIA 4X1IB 5DGIA 4HWKA 3AR2A 4NNOA 1N2JA 2XH8A 3DFMA 1LY1A 2ZBQA 3GX1A 2QW8A 4F4IA 3ZJ5A 3VO9A 3SOPA 4QUDA 1HZZC 2Z2JA 4WXPA 3RSLA 2AVNA 2DKOA 3R0QA 4G5FA 4TV8B 4BP1A 2O23A 3EVCA 4WKCA 2PSEA 1TZCA 3DEYX 4NK4A 3V9PA 3STUA 3CSUA 2OLKA 3CVOA 2R6CA 1M2OB 4BWVA 2GHQA 4J4TA 1LBHA 2BIFA 1I3CA 3LGAA 1P9LA 1I3MA 2XOKD 3PIRA 3IRVA 4LXUA 4PHHA 1OU0A 2H2AA 3ELUA 3JW8A 1H8EA 2FUG6 2XHEA 1ZUIA 3OC0A 3WJ7A 1TYEB 4OLHA 1UOPA 1PWEA 3PDJA 5CH8A 4NL4H 2PZKA 3HJBA 2NZWA 4AK9A 4HXGA 4RM3A 5LP6F 1U2PA 1DRJA 1EBBA 2IHBA 1WUHS 2A0FA 1T36B 2ES4A 2X6QA 4OUKX 4ZK6A 4IOLA 1PVOA 1GPWB 2R62A 2P79A 5EHIA 3MF4A 3QVKA 1JXQA 2I9KA 2CHFA 2G7MC 4GSLA 4UM9B 4ZYTA 2Q27A 3II6X 3ENKA 3H86A 1DAEA 3NOQA 4YQEA 1WMAA 5BMVA 4LSWA 1SKBA 1DAMA 1LRLA 1XAHA 4DY6A 4AO8A 1T3GA 3HSKA 5BT9A 3AUYA 1D7AA 1ZITA 3OY2A 1RLUA 4OKNA 1GZ3A 1P1FA 2CUNA 2VJBA 4G97A 4H0CA 4IIJA 4P3YA 4EGCB 4JXXA 2OP0A 4LBYA 5DCUA 3NUQA 1D0SA 4AD8A 5JNLA 3ANYB 1AHPA 1F2UB 1L4BA 4FFBB 5CVDA 1P81A 1V1JA 3U40A 1NW5A 1PJ8A 3DEFA 3JV7A 4TTTS 3P9ZA 1P8AA 1A69A 4D02A 1B0AA 2KS6A 4C5BA 3CIOA 1PV2A 4IJWA 4DYHA 4BJ6A 4XRGA 1H4QA 4WGFA 1YUNA 3ON5A 2DQKA 3KAQA 4LQCA 1IYZA 1NDUA 4WRRA 4BGVA 2UUAB 2OB1A 2Q3HA 2ZTHA 4ZJZA 5ALEA 1LK7A 4BKPA 4C7KA 2VXOA 2G40A 2YMPA 4LI3X 1BX3A 3LQYA 3EVDA 5TSDA 1GSIA 4QBKA 3HHEA 1U1CA 3HC7A 1R5BA 1AY0A 2NTEA 4GLFA 3VH3A 4RFLA 3VPAA 4DLWA 4UVGA 3LLCA 1TM2A 2B3DA 2QRPA 2QNRA 4KV7A 3D54D 3WWEA 5CB8A 2W37A 3R7SA 3VR1A 2FJUA 3KKZA 3A0UA 2PX6A 4P3KA 1BXKA 1JHQA 2GBLC 4XD7A 5DI9A 3FXAA 4X3OA 4PG5A 1NIJA 3FR8A 4JL6A 2AFRA 3KR9A 2Y6VA 4HDAA 1TA0A 3NDJA 2M9MA 3OZBA 5DW3A 4M6WB 3VPFA 3W6NA 2PANA 1WCIA 2NVBA 3C3CA 4JJAA 4L0CA 1PT8A 2FZVA 3UT5B 2JANA 3THRA 3ZBUA 2NV0A 1QANA 5JVDA 3PRHA 1O3YA 1K7FB 4PZZA 4V0LA 5DMHA 4BNZA 3TQSA 3ZY5A 1JQLB 2V7VA 3HCAA 4WCDA 1G20E 3D6UA 3UVEA 1KO8A 2D8AA 2OC9A 4QBFA 4LI0A 1H8HA 4IH4A 2YYZA 5KYNA 3JQ8A 4JFRA 4LGMA 4ABTA 1FW8A 3WWPA 4W4TA 3AP2A 4AZ0A 4RKYA 4ZOEA 3LX6A 4RH1A 1N5LA 2LKDA 5HDBB 5I9IA 3VZCA 1CD5A 2UXDB 2JAXA 1XHEA 2X5XA 1FQKA 4K9OA 5EJMA 3RW9A 2J6IA 2CJYA 5CB4A 1V96A 3VTAA 4JXKA 1OH5A 4JBYA 1XZBA 4BB0A 4BV9A 3DE7X 3EWIA 4JA2A 4RJ2A 4UQPA 3NHJA 3USZA 4ZDJA 1BX0A 3U7GA 1QKKA 2WTNA 4NE7A 1T4CB 3GFOA 1FXWF 1JPNA 4DV6B 1YZFA 1IN5A 3SDSA 5CIYA 4HUQB 4ARBA 2OZLB 2W48A 2F00A 4DGQA 5F2OA 3CLTC 5E9QA 2ZK7A 3WZLA 3WRXC 2BT4A 3INGA 4HLQB 4L6IA 4RHXA 1J5EB 1M83A 1W1UA 4M8KA 2J7PD 2NVOA 4O2AB 2J0EA 1PHPA 2HA3A 2Q6IA 1RPJA 4QOSA 3AZOA 3E22B 4FS3A 4B4WA 2VDMB 4KWIA 5LDHA 3BB1A 2NMVA 3K15A 4KR0A 3CWZA 2AE2A 2NNWB 1UPTA 1FUUA 5LZ7A 1Y8QA 3PYXA 1G8AA 3GAZA 1A71A 3C85A 1QX3A 4GOOD 3LBFA 3R7AA 3T06B 4FYKA 2QD1A 4PFQA 1VE1A 1RCUA 4IMPA 2QTZA 1KDPA 4M7PA 3OE4A 1ZIYA 3HKDB 3NEJA 5K3OA 1YR2A 3FB4A 3FRHA 1PX2A 1U02A 4XGRA 5DXAA 3DSRA 5TB5A 2E82A 1F6WA 1QONA 2PQ0A 3DHNA 4Z1MD 3FMPB 3OJLA 4U0JA 1WU7A 4ZDWA 1ONOA 4ZVPA 3IUSA 4BO3A 3RUIA 4J16A 1QVRA 3A3OA 2WHYA 2WMNB 2P2ZA 4YJHB 5AR1A 3K70C 4I50B 2H3HA 3I1FA 3LRTA 4G84A 2X23A 1T0PA 4FKMA 4U5XA 2QRMA 1O5IA 2G09A 4PLCA 3ROGA 3A6LA 2QX8A 2I7TA 1P7PA 2JJ2A 4Z99A 4E5MA 4XX1A 1SZPA 3ZK7A 1FFGA 4FOSA 2R11A 1XTKA 2Q6TA 3CE9A 4Y2JA 5FBKA 1SBHA 4LZNA 1JE0A 3FX2A 4NCIA 5IARA 3ZLTA 1K6MA 4N18A 2A5FA 3DDWA 1TM7E 4Y6PA 4ENRA 1GT6A 3RQIA 2NQ8A 5ANRB 1T0IA 2XT0A 1NJGA 2EWMA 2V8BA 5F5NA 1M0EA 2PKQO 2EHJA 1KQFA 1PFGA 1T43A 2I6UA 1SOAA 2ZATA 4RU1A 3HY6A 4DFDA 3ZDCA 1MX3A 5JV5A 2IHTA 3PF9A 4J7UA 2RARA 1JLKA 2ZJ4A 3IO5A 3ZJUA 2B7CA 3LBIA 4GOJA 3GVPA 4HAZA 3B12A 4KODA 4NFYA 2X1MA 3ABQB 1SCBA 3FVTA 3P0RA 2C0PA 2HXGA 1PJ2A 4N12A 5EZYB 1L5VA 2HN9A 3B1FA 4Z8YA 5IWCA 3D0OA 4CJXA 5EUMA 4K26A 1A4UA 1ZJJA 3PUVA 4KGXA 4X8MA 1ZA1A 3FSEA 1ZRHA 4IV8A 2V55B 4P6VF 3FYHA 2M6SA 1ELOA 3P96A 4D56A 1SCJA 1SIWA 2ZYVX 1EWQA 1JNYA 4WLOA 5IKMA 3AJ9A 3EUAA 1XRRA 5E1MA 3P0EA 1DZ3A 1GZ6A 2PM8A 3LK7A 4JAVC 4KYIB 2FZ5A 2D4HA 4KXVA 4YCMA 5F23A 3F3KA 5JFTA 2CXSA 4KQKA 4XWTA 2QE6A 4JT2A 3WBJA 4BE9A 2CLEB 2WNIA 1AKMA 4OUDB 1U1IA 4DBLC 1VG0B 2WDPA 3BB4A 3DLPX 4UBMA 3VHXB 3EZ9A 3WISA 5K4HA 2C2ZA 3VM6A 3RFXA 2B1IA 4HKTA 2JF0A 3T7CA 4DLUA 121PA 2XNJA 2JFNA 1CC1S 2GUGA 1XZHA 2IOFK 1SCKA 4Z8XA 4P33A 5UKDA 4NLLA 4ND7A 3OQVA 1C0KA 4FJ0A 4F85A 1YQEA 4DV3B 1A97A 4CEJB 4JP3A 3FROA 4YLEA 2OCAA 4YAKA 4OM8A 3FTFA 5IJZA 4BFUA 3CRRA 1TJYA 5TV2A 3V2IA 3DDHA 3L8GA 4NMLA 3WFJA 4DBZA 4DLZA 4RF4A 1X1BA 1YC5A 1N57A 1Z6GA 2Z58A 5A4IS 1QJCA 2DFKB 3VHQA 2FV8A 2PZBA 4MRNA 4RDHA 5IC5A 4ARZA 5EHZA 4BDSA 4L72A 3E9RA 2FA9A 2PMWB 4LSGA 4TS9A 2TSYB 1QGUA 1U2RA 2C7GA 4UBNA 1WXEA 1Q0HA 3SR0A 3DW3X 1CE8A 1ORTA 2GEKA 3E9DA 2ZUTA 2B6HA 2YWGA 3AERA 2ZUSA 5KC9A 1B6GA 5D6NA 4KG7A 2VQFB 4YS6A 3CXRA 4QWMA 3JQ9C 3T5CA 2RK3A 5IN5A 3WLAA 4YUYA 5ICCA 4N01A 3BXZA 4N8SA 4OBEA 3QIVA 3A6ZA 4GOND 3TRDA 3UPDA 1LTHR 1N3LA 3GLGA 4O2AA 2AXEA 2G04A 2WP0A 2B5OA 1OZHA 1C3XA 2WWRA 2QQFA 3ZZNA 3GYBA 4KHPB 2IUFA 4K6OA 2OY0A 2DH6A 4D74A 1TE2A 2F43B 1KYTA 1T3ZA 3AH8A 3ESAA 3CCFA 1ACLA 3RS9A 1J20A 3AIOA 3U48A 5JOQA 1JHYA 4KPUB 1XXHA 2ST1A 5DN6D 2ZT6A 1HNZB 2Y4NA 4WZAA 1F7UA 2CC2A 4K9KA 4YFYA 5CFOA 3T3EA 3PVSA 2RHCA 4GMGA 3ZU2A 2JATA 1U2EA 1CVLA 3DWIA 1L9XA 5DISB 1N2ZA 1NJ2A 3QH4A 3RRNA 2W90A 1L6IA 2NSJA 1QTIA 3EISA 1OX6A 1KIFA 4NYMR 4GBED 5FAKA 4DIUA 1TAHA 1C1DA 5IYZB 2V7EA 4MLPA 2C7OA 4PGHA 4GL2A 3AF3A 3ZLUA 4YO7A 3PXEA 4H0FA 4ZV4A 3W77A 2XWJI 2E4YA 3SOZA 4DJAA 5T6BA 2H1VA 2YTZA 4OQLA 1Q14A 2I4OA 2JLBA 1ZM4A 3DZGA 5ALTA 3AEXA 3H1GA 2ALJA 2J5QA 1JLLA 1QFZA 4XDGA 4B4OA 4LF4B 5B7PA 1QMPA 1S4MA 3CF0A 3QE4A 1GT91 4NDNE 3NCTA 4DLXA 1V0JA 3B7WA 4NARA 1ODSA 4TLBA 3F5DA 2JD2A 1JVBA 1VBFA 2ADOA 4WKBA 3O03A 1IXSB 5DO9A 3ZHOA 2AZMA 1Y3BE 2XNDD 3VJKA 3A6DA 3OC6A 3WTBA 1IB6A 5LN1A 3TG2A 2OQIA 3K05A 1ULTA 4NHEA 5KYGA 1QGZA 2G83A 4K6GA 4A2WA 4HPWA 2PKXA 2FEPA 3AFOA 2Z4RA 2CUZA 1K8YB 1XDGA 4ZREA 2J59A 3PR2B 3VU9A 1PFQA 4Q16A 3QOYA 1C81A 5HQ3B 4JDUA 2QVZX 5DOVA 2YOHA 1EFVA 1SXJA 3K92A 3HPRA 2HJGA 2HADA 4HEJA 2GK6A 1QG6A 4LY6A 4URFA 5JJ5A 1AKEA 3CO5A 3U7IA 1ZI9A 2SHKA 3R40A 4E31A 1NRJB 2DQZA 1DI0A 1QR2A 3DWEX 2PH5A 1K7XB 1QGOA 1C41A 2GXSA 3K31A 3VKVA 1SY7A 2RHMA 1SKYE 3C3DA 4KYVA 5EWJB 2GF2A 1SHTX 3GEPA 4QAJA 5AKYA 3GLKA 3IL2A 3C3EA 3PGJA 3PA8A 2JLSA 2XUDA 3DBVO 2A84A 2J3JA 4JYCA 1RAFA 4QOEA 4CTJA 3ZG6A 1FP2A 1Y4UA 2Y93A 4OFBA 2DHRA 4YMIA 4PLVA 3RVPA 3FNBA 1WEHA 5HP4A 3NHRA 3KUKA 4OQXA 3R77A 4UHJA 1LNQA 4G0ZA 1KYWA 4DREA 5G0WA 3SHWA 4EPYA 5K0SA 2AV6A 3B3GA 1VHWA 1ABEA 2A14A 4MQEA 1OVGA 4O1MA 3TKLA 1UBFA 2BGRA 3SS8A 4EPRA 2QY6A 2ZJ3A 2O19A 3RG8A 5B7GA 3GA5A 1QU2A 1WMFA 5FPYA 5LMZA 2ZRCA 1DBWA 4BHTA 3PGXA 5DEOA 1GJRA 4QXRA 3BD6A 3AU8A 3EG5A 1UK7A 2GBFA 5F73A 1TFUA 3O0TA 1L5WA 1UKCA 4B7ZA 2RFLA 2WAMA 3ND6A 4UVDA 3LDHA 4MIEA 4YBRA 1C9KA 5EJIA 2Q4TA 3MLEA 1KH2A 1SD2A 4TSRA 4BECA 4D5GA 3HL4A 3OJFA 1H2HA 3CLUC 1QO0A 1NMXA 1EQUA 2CVPA 5FLXA 3TZKA 2C96A 2LTAA 3EDYA 2GZAA 5D6OA 2FZGA 4AAYA 3KPJA 2HM7A 1BKDR 5AJWA 3PJGA 1JAYA 1P5RA 3MSCA 4YRKA 1DJMA 1H93A 1LK0A 5K0TA 3ZDBA 1QH9A 3FCSB 1JA1A 1HYBA 2Y1EA 3G17A 1E7MA 1KAOA 2HZBA 1JBEA 2POQX 3D8HA 3LECA 3R0VA 4K7JA 5BSMA 4QUJA 5TQ0A 1C9EA 6NULA 2DUNA 3U56A 2NN3C 3B2EA 5GY7A 4X65B 2QM3A 4R8SA 1UDCA 4QIHA 2ZETA 3BL6A 1ZU5A 3C16C 3I9KA 3IGFA 4OHCA 4ZQEA 4BCDA 5BWCA 1E9DA 1KERA 3SPXA 4O25A 2HH9A 1E2LA 4KIGA 1Q6ZA 3GFFA 4YVFA 5KDOA 1KC3A 1F6BA 2IK8A 1U7OA 3V34A 1GTMA 3Q7SA 1H9AA 4Z4HA 3I4LA 2ZIXB 2H4YA 2DTDA 4G6ZA 2E21A 4V0NA 2TECE 1JR3D 1NVGA 2V98A 4MA5A 4NYJQ 3H2ZA 2O2DA 3A11A 1M34E 1KNXA 2NU7B 2OORC 2VRBA 3S28A 2NTVA 2ZYWX 3KL4A 4WH0A 3TW8A 5JD5A 1FF9A 5F51A 2I55A 4E7OA 2H16A 4PGMA 4H27A 2FUEA 2GK3A 1BHSA 2PYDA 1HE1C 2GBGA 5E38A 4J9VA 4Z2YA 3FUWA 2E6KA 3WMWA 3RTDA 2AG1A 2LD4A 1RKXA 4MVJG 4R7ZA 2IZZA 4EW1A 3FN4A 3U16A 3HCDA 5JQWA 2UAGA 3VDNB 4E09A 5C2JB 5JIBA 4C20A 4H7IA 1O03A 4UCXA 1ODKA 2QYTA 5IK2D 3HKCB 3EXFB 2HSZA 3NFYA 5HKKA 1ESMA 1O94A 2O8DB 5KYUB 2HOQA 3OQ6A 4GYKA 4RX1A 4DIKA 1HT2E 1Y8QB 2B98A 3GZTB 2X9NA 2FG6C 1E2HA 4QNRA 1UBCA 2MINB 1EWVA 5EUBA 5A4DA 1V8DA 1UBKS 2ONCA 3HA7A 1P19A 3ZW9A 4CMBA 1WDWB 1XCMA 2ZSUA 3AVPA 3HKBA 1K88A 3A6EA 2JZOA 3D1VA 5D00A 4EVRA 3FPSA 2QQ5A 5CXUA 2AN3A 1KO1A 2RHRA 3LDFA 4FXOA 1EFPB 4RKEA 4R2XA 4WE3A 4E07A 4PYQA 1M2EA 5LXTA 4F4DA 3U4DA 5F3RA 3QHAA 1VMEA 1AB5A 3MMNA 3EZYA 4Q3NA 3TOXA 4BQRA 2A35A 2P1DA 4AYWA 1LPMA 3DLCA 2REXB 2GDJA 3NONA 1K6XA 2VJYA 4PZAA 2VAMA 3GJRA 3L6CA 1NR5A 4K6CA 1W4CA 4PRLA 5KMGA 5A0VA 4GKBA 2ODTX 5EERA 3H1FA 1KJJA 4IWXA 3DT9A 1N5OX 3CNBA 1SVMA 3QEKA 1J9EA 1M2KA 3OURA 2F48A 1XDDA 3UPUA 5JH7F 3KEQA 2WAAA 3PLNA 1UZMA 2R84A 3FB1A 1UFVA 4HNAA 2CXRA 2IJGX 4I3HA 1EVIA 1I4DD 1JWAB 1KYZA 3P97A 4HDCA 3UWPA 2HDHA 2Y27A 4LHEA 5JQGF 3E22A 3ERCA 3RTBA 3SDZA 3HVJA 4BO4A 3RE1A 4EEKA 1U6JA 3N74A 4C4RA 4YYEA 1IXRC 4CCYB 3OIUA 1GTVA 3LWZA 5TMDA 4HDMA 2CFSA 4NRDA 3A1DA 4QJ4A 3HWSA 3OT1B 4LRQA 2OCPA 3ZHZA 4EFLA 3N2GB 1PT5A 4I9UA 3MINA 4LK3A 4DV1B 2A9KA 1BH6A 4NYMQ 4UXIA 2BI8A 2JHFA 2IT1A 1MNAA 3GOQA 3DYBA 3CPSA 1SU7A 3HKDA 1HEYA 1QX4A 9LDBA 4PXYA 1Q7BA 2ERYA 3W5DA 4HGOA 2QUKA 5T7BA 4M8LA 3RADC 4NICA 4PAGA 5CIWA 3NXKA 1ONNA 5F1PA 3IJ5A 4YJ2F 3FHLA 1NBAA 1VE6A 4YJDA 1XZGA 4HDSA 1JHZA 1LTKA 1BDJA 2G71A 2ZS7A 3EF0A 4DA8A 2GM3A 4B6PA 1BH2A 3MT8A 1AZTA 2O0MA 9ABPA 1HDXA 3PDIA 2QTVA 1Q0SA 3KZMA 3LXUX 3NHSA 1FMCA 3CPEA 3KB6A 3Q85A 2M6LA 5FTLA 3VNVA 2J0UA 2F43A 2FN3A 5K3FB 2YYAA 3I2HA 5KTMA 4R7TA 2P68A 2XIJA 3JRNA 2X6RA 5AW8A 5C3UA 2AWOA 4H9GA 1OTXA 2HLHA 3E7FA 4A8JB 5DSZA 4YCCA 4U1RA 1LRKA 4IFIA 1RBMA 4QG3A 4BLRA 4MK4A 3FFAA 2SICE 4JMPA 4WZAB 1Z73A 2PUVA 5BQ5A 3ADOA 1E79D 3EPLA 3ZHVA 4U7DA 1ZOPA 1IZ9A 1PLKA 3HKEB 1F48A 1GQOA 1O97D 2HF7A 2ICAA 2V4ZA 3IDOA 4MVWA 4RM2A 5J2TA 3H04A 3WLRA 2R6FA 3SYNA 1GU1A 3FOBA 3ONDA 1JG3A 1KMHA 2IDKA 4XI9A 1EMDA 2QTTA 4TMXA 2ZAMA 1DADA 1UT6A 4KUGA 4IIUA 3VISA 5EZYA 3PQ5A 1OY1A 3I72A 1XD8A 2VSFA 3VSEA 4PX9A 2C92A 1Z8HA 1W35A 3NO4A 4GPBA 2B2CA 2ILVA 2CLLB 4D96A 4I4IA 3F9RA 3L6DA 2I2BA 4REQA 1YRBA 5EMMA 2YJTD 4A0GA 4MXDA 1JLLB 1VLHA 2JBHA 3CW2A 1RS0A 1KK3A 3C6XA 1I0IA 1XZJA 3L9WA 4A0HA 5I7HA 1R8YA 4L3OA 2YC4C 1A1VA 5KTPA 3GA0A 5ITWA 2AI2A 1LB1B 3GG2A 4OGFA 5FJIA 2B2NA 4XQEA 2Q5OA 3M9XA 3GAMA 2XOXA 1KZ4A 4DXDA 2L69A 1TCBA 1VI2A 1YTLA 4MUYA 4YCNA 3IVGA 2DQ4A 1BWRA 3CYFA 4G0NA 4JKOA 1GGVA 2HWXA 1IE3A 3K1JA 3S0JA 1U81A 2H57A 4YK7A 2YRWA 3W9BA 3AUAA 4QE3A 2GA9A 2IPNA 5JZSA 3MWDB 1NVWQ 2WG2A 1NJ6A 2F7SA 3I53A 3M6VA 3MRTA 4L8FA 4MW5A 2AEJA 3D4PA 2VNAA 3F6SA 3G5TA 4I81A 1JIKA 4LZPA 2J6CA 4O29A 2HRBA 1T8UA 2ZB8A 2ZT5A 1KAQA 3A25A 3DB2A 1H05A 2ZU0C 4X7RA 4JWTA 4N6GA 2HYIC 3IR5A 1TAGA 1WDTA 2EKBA 4UHDA 1DKPA 2WJJA 3IQFA 2GB4A 1KSGA 3RIYA 2YWXA 3BICA 1MV5A 3FUVA 3LVFO 3QMVA 1YA6A 2KWIA 4XWOA 1F9EA 3EGCA 4RUKA 8ABPA 1E96A 3B8EA 4UMDA 3AKCA 3UQZA 2WB2A 2AKAB 2ZRHA 3SF0A 2C82A 1Y0BA 4LNUA 3UATA 1WTAA 2H1FA 3ZV3A 4B3SB 1D0VA 1KU0A 3AILA 3G2OA 4M89A 3X1JA 5CB6A 4CM9D 1KBZA 5M2QA 5ED4A 1IL0A 5ALKA 4LGCA 3TQRA 4GLJA 1DEHA 1UK9A 3BD9A 4YP6A 4AS3A 2XQGA 3U7JA 4GU5A 2IEIA 3SWWA 3BDIA 3OIYA 1PR4A 3IQDB 2AFHB 5F5XA 3TO5A 2P2SA 2X6TA 5ES4B 2OHHA 3DYIA 1DCTA 1DT3A 1HZZA 4UUOA 3S7ZA 4BLVA 3MTEA 4Q4HB 1TKAA 2G9RA 5HTKA 3P45A 1NV8A 2NZXA 1XU7A 1NATA 3T1QA 2X0FA 2IZ0A 3ICOA 4QFDA 4O3MA 1OLXB 1PWZA 4CMEA 3VNSA 3ZLJA 4KPGA 5A6VA 2IL1A 2C9BA 4BRZA 2OV2A 2YWCA 1AU9A 2NT4A 4MCAA 2H1LA 2CHQA 3ILVA 4TKUB 3SHOA 3OE1A 2O20A 2OSBA 2GDZA 2QPLA 1H3FA 3HFJA 3QKUA 2EX0A 4JROA 3PXBA 1F0PA 5CX1A 5HQ3A 4JVNA 1EB8A 2VF7A 3E0QA 3HCNA 4LJ9A 1QRTA 1JDSA 1G41A 1CV2A 3GBSA 4YBZA 1SBZA 2WLSA 2VP9A 4MMXB 1A95A 2OESA 3JQBC 5KZMB 5M5BA 4I6GA 4UNQA 4HDSB 4ZRDA 5EP1A 2COEA 3WSVA 2VBFA 3Q3JB 1Z7YA 2YN2A 1QMGA 1UPAA 1UIMA 4HDKB 1RWQA 3VX4A 3HJFA 4JB0A 1KBQA 2D0IA 1A9RA 4U2DA 1NMYA 1VOTA 2HMVA 2PS3A 3LQQA 4C6HA 5CVTA 2JLVA 2QUZA 3RSHA 3K0HA 4AN1A 3TRHA 1UPFA 3TPZA 4W6ZA 3SEAA 1DWOA 2K4MA 1IOZA 1R0ZA 2PR2A 3LTEA 5JPDA 4FBLA 3H9GA 3RIMA 2H2DA 1JR6A 3KFVA 3GAFA 1GRQA 3V33A 1P4JA 5AKZA 5TARA 3G5MA 4YXFA 1B16A 2VZ8A 1SUPA 2CHEA 5TS2A 2BM9A 2IYXA 1V47A 1YR1A 2XDQB 1SBIA 2G0NA 5H02A 2OLEA 1DIBA 1G5TA 1G9XA 1UWVA 4HSGA 4AKTA 1XNQB 2VRNA 3CY6A 1Y8ZA 4EW6A 1G17A 3T9FA 1WZIA 3R3YA 4P5PA 4QGSA 5HNKA 2FX3A 2ZSBA 3UMGA 2BTOA 3W8NA 1IQRA 1KF0A 1KDYA 2Q0HA 2PUBA 3DFUA 2YZKA 1NVXQ 3MJEA 3OTIA 3OM0A 1NIPA 5IKOA 1JA9A 3IDQA 5CDFA 2AOTA 2IV2X 3X2EA 3AM3A 3E1KA 2PKCA 3PFBA 5C35A 5ADVA 3FPEA 4RAOA 2QW0X 5E2AA 1MO6A 2ENWA 2HWWA 3N2YA 1QV9A 3IV6A 5GMOA 5ADHA 4YJGA 3LVQE 1FNBA 2FFJA 3UJBA 3MTJA 1EG2A 3MQFA 3F1KA 2E7ZA 6YASA 1PVVA 1Z06A 5EMJA 2R8BA 5LC1A 4B82A 1Z4QA 5KYUA 3ZKWA 3LOQA 2O2HA 2UUCB 5I4IA 4MGYR 1NE2A 5ALQA 4F60A 1D4AA 3ES9A 2C4NA 2OCIA 3PDCA 3ULKA 3KB1A 3KB2A 3Q0IA 3F4BA 3UM9A 2BMJA 3H9UA 4M21A 3K0FB 2NU9A 2ZDQA 3QRWA 2Z2IA 4JU8A 5IT5A 3B5JA 4ZZ2A 3CVJA 2WJWA 4DLVA 5HKKD 3TMAA 4CZ2A 3IP1A 2AFHE 3Q88A 1S4QA 4LK2A 2BEVB 2WUFA 1P8JA 2PGDA 2EFCB 4CODB 4G4JA 1AQIA 2QS9A 1C3LA 1V7PC 3AI3A 4NYJR 2NVUA 5C81A 3G59A 1ZNQO 2Y1XA 2R7NA 3DOOA 3DR5A 2JHAA 4RWZA 4C6RA 2WJHA 2ZWOA 3OEWA 3LPNA 4GPD1 2BV3A 2CUKA 3BWVA 4CIYA 3F47A 1QYRA 5BN4B 3A3NA 3H2YA 3GB9A 2X42A 3KELA 4FCTA 3ZHRA 1BJTA 1CEQA 4IDCA 2GPNA 5HYVA 4AJPA 1PR9A 2AEMA 1P2TA 2VNHA 2X58A 3O7MA 1CU1A 1IZ7A 4NEQA 5ALSA 3ZGNA 3T9CA 1F8YA 1A7KA 2NGRA 4E12A 4CLOB 1YDFA 5H4GA 1LU9A 1QH0A 3BWXA 3KP1A 3RC1A 4AO7A 4DG5A 6LDHA 5IDWA 5DNUA 2OXRA 4LBZA 2VCYA 5CT9A 2CYCA 2RGDA 4GKJB 2CLMB 2RHHA 3W3AA 2CFTA 3N2GA 1KI6A 2HJ9A 2R97A 3BWMA 4LYJA 1BEUB 4RK7A 2Q3EA 1XJ0A 3FOEC 2FR8C 2ODEA 1EWYA 5KQSA 4ZAGA 5DBGA 1T6NA 4Z0HO 4NFHA 3OPYI 2XD9A 2GBCA 1NVBA 2NPIA 4QATA 3DJFA 4DMUB 5BVHB 1AGRA 3M5DA 4M4SA 3JWPA 4FM9A 4YQYA 3CIFA 1UJ2A 3KBOA 1DC8A 4FX5A 4H60A 2FETA 3F98A 1PLLA 4F5WA 4FUQA 2HLDA 3NUZA 1E4OA 1II0A 1K0UA 1ZGHA 1YB5A 3ECAA 3G5UA 4G81A 4P3NA 1BJRE 4KAFA 4X00A 2C42A 2X2EA 3NYQA 4X1KB 4EYOA 3KXPA 2Z2YA 4DWWA 1DHTA 1GO2A 1K68A 1E5VA 1XXLA 4GT1A 2O3RA 3P9IA 2GM4A 3RVMA 5BQXA 3U39A 3NC1C 3LUKA 3K0KA 5AUPB 4PFKA 4URVR 2GZMA 1KZ7B 6GPBA 2R60A 3ZWPA 3T15A 1PR3A 5HIJA 3VR5A 3WKAA 4NMXB 4D6PA 1CUBA 1TQHA 2L17A 1S0UA 5AI9A 3ZU3A 3RVDA 3EARA 3MOGA 2F90A 3W1EA 1N8KA 4BV8A 2GPAA 1CIPA 4LE1A 3GN1A 3GZNB 2H4ZA 5E2BA 4CIDA 2QF7A 4CM8B 1J2JA 1RRCA 2G5TA 2WD7B 2RGCA 3VR6H 5EQDA 2JFVA 3KQVA 1TGVA 3I42A 4RY0A 5C7IO 2BR3A 4DJDC 2JGMA 3S44A 4XQCA 4UU8A 3CE6A 3D9QX 3O4FA 4FYXA 5TF0A 1EK5A 2BMDA 2ZYRA 4MS1A 5G3YA 2DE0X 2Y6UA 2H0RA 3JALA 2DBYA 2PKQP 4RL4A 4BVFA 1DKRA 1GNPA 3L0OA 1WXWA 1JILA 3F46A 2HA6A 1M34A 4IILA 2B20A 3ZWVA 4YRBA 1GCGA 1T36A 3JR7A 3CB2A 4F1JA 5IAJA 3ZWNA 3PITA 2O06A 2DAPA 2HU2A 4TYWA 4MMYB 1LD3A 2CLFB 4IZIA 2CNWA 2DSTA 2QZZA 1RRPA 1T9DA 1WB6A 1RW4A 3C98A 1Y7TA 1SG0A 3N2LA 3MPUA 1JT9A 3C1TA 3N8NA 3QYAA 4M9QA 5C5IA 1YCGA 3FVQA 3NVKI 5B2ZA 1ZYUA 3AK4A 5K09A 1WG8A 4MW6A 4Y1GA 3R9XA 2HHCA 4H1UA 3A36A 3PGA1 1YS9A 2DFTA 1WV0A 3DWFA 5BSUA 1RI2A 3QX7A 1EVJA 1VKZA 4MI3A 3KUXA 4PLYA 2FWAA 2G5CA 2I76A 3BRQA 4A8JA 1G3MA 1U8ZA 1X7WA 2WIGA 3LA8A 4DGSA 2YVQA 4DJEC 1VGVA 1VPWA 4IJ5A 3KQWA 3PHBE 4NY1A 3RK1A 1QK3A 5LWQA 3GMDA 3OFND 1B76A 4B9EA 1VMAA 3MTBA 1Z16A 3PGKA 2J3IA 2JBAB 2IEYA 2A4KA 3ONWA 3KQLA 3KPVA 2O8BB 2XRZA 2HBZA 2NVUB 4JHLA 1JG6A 1DLIA 4YRZA 2GJ4A 2CGEA 3NDRA 1DXYA 3F6BX 1VCIA 4DJ5X 4DR1B 3ZGXA 3BKXA 3GPBA 4KJZA 3UT0A 5T4BA 4Y2TA 4MV5A 3RBZA 1CKEA 3PFIA 5F78A 1AQLA 2GKOA 2ZXFA 3QU9A 1PZXA 4PTYA 4E4YA 1ODTC 1N6IA 1OR8A 4JR0A 5MFPA 3J81A 4HLNA 3V4FA 2OG1A 3DKPA 2PUGA 3X1YA 1GZ4A 6ABPA 3GMIA 4CM5A 3LCUA 4XWAA 5ADWA 2VYQA 3IO3A 1FMFA 3H4VA 2HFKA 1P17A 1CQPA 2I3ZA 3PQ7A 1MO4A 4QAQA 1FZTA 1Q91A 5EJ6A 2ZYUX 5JXGA 4QQNA 1VLLA 3HABA 5HOQA 5LZ9A 2B6NA 2J0UB 4P4SB 1NXTA 3KAKA 1KH1A 5B36A 1P7ZA 3AUTA 4IQ8A 3TSZA 4IFEA 4JR2A 4ARAA 1QYIA 1Z0FA 4TMWA 2QLNA 1V95A 4WLFA 3S2GA 3CF2A 4E88A 5B1YA 4C2TA 2A1UB 3FHTA 3IQZA 4HF7A 5KSPA 3LMKA 1RHRA 2H18A 3P26A 4LWQA 1YFJA 1KKMA 2ZAOA 4GLOA 3ZJTA 1ZVQA 1A9YA 2CLDX 3WL8A 5EJ4A 1CLUA 5BW8A 1T0UA 1TB4A 1P1RA 2R7KA 4PPGA 1US8A 3ZR4B 3N28A 1YAJA 4IPTA 1MQSA 3GGDA 3EEYA 4YJKA 1Y98A 1LLQA 2OQ2A 1Z17A 4X3CA 1G16A 5LP6A 1U2GA 4FHCA 5A04A 2NXEA 1T3TA 3IEMA 2I7CA 5DE3A 2KM1A 4MP3A 4UJ3A 2H4HA 1TFRA 5D86A 4OG2A 3ZE0B 5K3DA 4Q4AA 4CQMA 2GD1O 2GCOA 1H42A 1EAMA 5IULC 1YR7A 4D81A 2XBUA 1L5HB 3ZUPA 4QPCA 5ISMA 3TZEA 3NLLA 3RC2A 4DUGD 1M1NB 3W1WA 3ZPXA 2W58A 2XB4A 3DMTA 3H5NA 4MUMA 4EHHA 4I66A 4EPWA 4HLUA 2V65A 4W9RA 4YT2A 4BMSA 1UDAA 1UADA 2YHBA 1F51E 1V16B 2AFHA 4EKYA 3KXIA 4P86A 4R51A 2C3MA 3ZK8A 2IY9A 3GRFA 5ADUS 5CVUA 2Z09A 3N6RA 3O8OB 5BNWA 3JRXA 1HE8B 3PF8A 5LB2A 3GJZA 4B6JA 1WHSB 1YZUA 4KR7A 4YRSA 1XLTC 4ECEA 1JTVA 3CKKA 4EHBA 1YMQA 1ZONA 1SQ0A 1J9ZA 3IR6A 2WK1A 1SVIA 4ND1A 5DZSA 1IG3A 1YZQA 1UWKA 3L9XA 2NSHA 1R9JA 4INZA 4LG1A 4PIMA 1D9XA 1J42A 1HQYE 1L3BA 3ZW7A 5TT0A 2GZDA 3MJVA 3GH3A 3T52A 2GMWA