1C9PA

Complex of bdellastasin with porcine trypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
b'IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of the complex of the antistasin-type inhibitor bdellastasin with trypsin and modelling of the bdellastasin-microplasmin system.
pubmed doi rcsb
source organism Hirudo medicinalis
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9pA02
2ZEBA 2FYQA 1CGJE 1ZGVA 3ZVAA 4YLUA 5DP8A 2AEIH 5A8YA 4CRBA 2OP9A 5L2YH 3HATH 4NA7A 1HXEH 1W7GH 5FPYA 2ZI2H 4JYUH 4JYVH 1EPTB 5A2MH 3E0PB 2PUQH 1BDAA 3HKJB 2FTMA 1GI3A 1QB6A 5E0JA 1G3DA 3MNCA 3NPSA 2Y80A 5GJ4B 1AVXA 1PQ5A 4AFZA 2G51A 1VITH 1P9SA 3K9XB 1Z71A 2ZDNA 5FAHA 2ZWLH 3SORA 1VITF 1TBRH 3VB4A 4MDSA 1MCVA 4Y8YA 3S7KB 1QBVH 1C5NH 3RC6A 1SHYA 4TY6A 4ABJA 3QGNB 2HPQH 1SVPA 2QCYA 1W0YH 2OCVB 3M5MA 5ABWA 1MTWA 1AD8H 2ZFTA 1YPGH 1MKXK 3UQOA 1P8VC 1HDTH 2XTTB 1P2IA 3PV4A 1C1OA 1O35A 5IDKA 2ILNA 3JZ2B 1K1LA 1TPPA 2HWLB 3F1SB 4ZMAH 4KTSA 3SJOA 1DS2E 4NWLA 1YYY1 3GOVB 1FONA 2A7CA 2P3UB 3U69H 4WMEA 3O8BA 3K65B 1Y3WA 1ESTA 1TIOA 3KL6A 3EAJA 1P05A 3ZZCA 2XRCA 2OQUA 2PTCE 1YPMH 2FI4E 4IMQA 3KQCA 3GY8A 1GJDB 3EGKH 1UVOA 1BA8B 1JRTA 3GY6A 4NA9H 1ZGIA 2JETB 1MH0A 1BITA 4DW2U 3F9FA 3TJOA 3A7ZA 5E0HA 1C5WB 1DWBH 1U6QA 2G55A 1XUFA 1WYKA 3ZYEA 4OS7A 1SGPE 4CR9A 1GBAA 1TAWA 1GPZA 2W5EA 2OC1A 4NIWA 1QRXA 4JK5A 5C2ZA 2BXUH 3U1JB 4DY7B 2J92A 6ESTA 3GY2A 3S9AA 1KLIH 1W12U 1ANDA 1MAYA 1QA0A 1Z1IA 2RA3A 1G37A 1GHZA 5HM9A 1PPHE 1UK2A 4AGJA 2AERH 1C2FA 3SO3A 3A87A 2FIRH 2ALVA 1MU6B 5C1YA 3TJNA 1G32B 1HIAB 4Y11E 1DWCH 2VWMA 3LJJA 1XUKA 1SR5C 2FODA 4GVUA 1KXEA 1HAIH 1EP6A 2PKAA 1P01A 2ZPRA 1SQAA 4UD9H 2XC4A 1WTGH 3MH7A 1SSXA 5A8ZA 1ZZZA 1Y59T 3Q77A 3F9HA 1AMHA 1EOJA 2OTVA 5FCKA 4Y6DA 2ODQA 1BT7A 2FO9A 3P8OA 3A8BA 1ELBA 2A0QB 4ESTE 4BTTB 5E8EH 1IQNA 2UWPA 3AW0A 1V2RT 1C5VA 1DE7H 1Z8RA 2ZU3A 1YPHE 2TGDA 4B76A 2ZHQH 1LHGH 2SNWA 1NN6A 2OQ5A 2QXIA 1MD7A 1VGCC 1GCTB 1GHAF 4TYDA 3NCLA 1O3HA 1GHWH 1ZJDA 1O2TA 4JMYA 1HXFH 1FLEE 3GYLB 3MU1A 4CH8B 2WPMS 3EYDA 1WCZA 3SU5A 3SZNA 1P3EA 4GCHG 2BHGA 2D26C 1OP8A 2FWWA 2HVXA 3KN2A 3LONA 1WSSH 3MYWA 1SMFE 3RC5A 1O3CA 3UPEA 1GMCG 3VGCC 2FOCA 3B8JA 1H8IH 1ANBA 1SFIA 3OY5U 4TWWA 4AZ2B 1J14A 4JK6A 1D4PB 1GI8B 2QC2A 4XBBA 4YZUA 1NPMA 4RSPA 1LHDH 1TX8A 1G9IE 4A5TS 1T7CA 3H7TA 1MKWH 1C1TA 2GP9B 3MU4A 4K8BA 1HGTH 2ZQ2A 3Q3YA 2P93A 4B2AA 1ZRBA 1TRNA 2FPZA 2RG3A 2VIWA 2G52A 3E0NB 5LGOA 2Z3DA 3TJVA 3URCA 4WMDA 1SLXB 1YC0A 2PUXB 4MPVA 3C1KA 2HNTC 4A1XA 3Q00A 3UY9A 1AVWA 4K3JA 5E2PA 2VGCB 4ZKNU 1AKSB 1O5EH 3CS7A 1NRRH 2A4QA 3D65E 3MWIU 5DP7A 1HBTH 1BBRK 1KLTA 2GTBA 2ZTZA 1O5AB 3EA9A 3RXJA 4I8KA 2ZTYA 4ISNA 5GDSH 4CRDA 4WVPE 1D3QB 1B5GH 4LZ1H 3D49H 1JXPA 1EZXC 3GCTF 2Y7XA 1TRMA 3L3TA 4BAQB 1IOEA 1T4VH 2J38A 4YESB 1TNKA 3P8GA 1BOQA 1YM0A 1TRYA 3QWCH 1EZQA 1HAHH 1UVUH 1CHGA 1XMNB 2A5KA 1RD3B 3GY4A 4IMZA 5DP3A 1H1BA 1GBFA 3FZDA 3SJ9A 1O31A 4IW4E 3SU2A 2NU4E 4FU9A 4LZ4B 1AFEH 2VIPA 2K1QA 3UNSA 1LPGB 4IN1A 1FQ3A 4FUBA 1O2OA 2FMJA 3BSQA 3A83A 1YPLH 4MG3A 1W0ZU 2BZ6H 2BMGB 1AZZA 1MTNC 1HLTH 2VVVA 2QXJA 3EQ0H 1V2NT 2H2ZA 3QUMP 1EJMA 3M61U 4KKDA 1RXPA 3RXAA 2O8TA 2LPRA 5EQQA 2QF0A 3SU6A 3U9AH 2XCNA 3S7HB 1QJ7B 4F4OC 2FLBH 3PLBA 5LH8A 3QN7A 1ZPBA 1OWJA 1TOCB 3ZZ8A 2ZU2A 2A2XH 1C1NA 2OINA 1GJ9B 1NU7B 1O2MA 1GBBA 1J8AA 3BTDE 1DY8A 4MVNA 1C5PA 2P16A 1S0RA 3QGJA 2BX4A 2Z9IA 1QJ6B 7KMEH 4ABBA 3MFJA 3STJA 1OSSA 1V2QT 2EI7A 3ZZ9A 1LVYA 1S5SA 2BVRH 3LGTA 1HV7A 9LPRA 4Z6AH 3LC5A 1BTHH 1ETSH 3W94A 1A4WH 1IQKA 2VVCA 3S0NA 9ESTA 1EATA 2FZZA 2VU8E 3TPIZ 5A0BA 1HFDA 3FANA 3KIDU 4AFSA 4K2YA 1ZPCA 2GDDA 3A80A 3ATLA 4Q7ZA 1IQEA 1GGDC 3FFGA 1FY8E 4ISHH 5H4IB 3F68H 3RU4D 4BOHA 3A8DA 1RTFB 1W8BH 1NRNH 1PYTD 3SNCA 4BANB 5T6FA 2BD8A 1C1PA 1T8OA 3UNQA 1N1LA 2R0KA 2GV7A 4X2YA 4CREA 4INHA 3E3TA 3SGQE 1YCPM 2RCEA 4GAWA 1G3BA 1CA0C 1HJ9A 1O33A 1ZLRA 2SNVA 2Z7FE 1MZDA 1ZSJA 2BD2A 1O5BB 1ELFA 1K1IA 7GCHF 1VCWA 1O2VA 1WU1A 1UJ1A 2PHBA 2BDIA 3MO9A 4R0IA 5E2OA 4H6SB 1GHYH 1SGIB 2HLCA 3RXCA 3KEEA 2IPHA 3ODDA 3CENA 1TBZH 3NWUA 2VB0A 1BCUH 3RXPA 2XCFA 1X7AC 1ZOMA 3M37A 4YOGA 1UTLM 1WAYB 3BTME 4J1YA 1HRTH 4TWYA 3V7TA 1ZTLA 2ZU4A 4I8JA 4I33A 1GJ7B 2JH6D 4IN2A 2ZCHP 5EODA 2SGEE 3P92A 5JBTA 4B71A 3RUOA 2BY6X 1Y3UA 4MNXA 1GHAG 3PWBA 1GJ8B 2ZNKH 1H4WA 2A2QH 1PJPA 2WYGA 1V2KT 1S82A 3SNDA 4WF8A 1F7ZA 1T4UH 2CMYA 3BTEE 2EI6A 1EX3A 1O3MA 1C4U2 4X1PU 1GHVH 5DKMA 1GMDG 1C5SA 1EZSC 1ABIH 2BY9X 3PB1E 2BLOA 2F9VA 1P02A 1ZTKA 1K21H 3ZZ4A 1H9HE 3KHVA 1GCDA 1S81A 1YGCH 2PKAB 1P03A 4NA8A 5I46H 1P2OA 4WH8A 1ZMNA 1GDNA 3TVJB 2BM2A 3GCOA 3HPTB 3SU1A 1XVOA 5DP9A 4MPWA 1V2UT 1QQUA 3VB7A 4XDEA 4GLYA 4HGCA 5J4QA 2V35A 2ZECA 4FUFA 1C5QA 1GBIA 1UCYK 4HZHA 3HK3B 1MTVA 1TALA 1Z6JH 1AHTH 1P2KA 1AU8A 2GT8A 1BQYA 1BTZA 1ZHMA 2LNCA 2PFEA 1Y3XA 4D7GA 3E16B 2VNTA 1CBWC 1O3DA 4XE4A 1O2PA 4AFQA 3MO6A 4KP0A 3GYMA 4CRAA 1MMJN 1C5OH 4CBNA 1O2SA 4ISOA 3FP8E 4GCHF 2BDHA 1MUEB 2J95A 2QF3A 2GT7A 4WH6A 1KXAA 1C2HA 1GBMA 4A7IB 1KXBA 1OYQA 2H9TH 1ACBE 1QRWA 2FESH 1QY6A 3AW1A 3NZIA 4HI3A 4X0WU 5FXLA 1CT4E 2D2DA 1V2ST 3VFEA 1GMCF 3QZRA 3UR9A 2R3UA 3QDZB 4OS6A 1PQAA 3GCTG 1SGRE 1ZSKA 4NGAH 1Y3VA 1YCPH 3OY6U 2H6MA 1A61H 3GISB 4TPIZ 4K8YA 4I8HA 1D3PB 4AG1A 2V3HH 1A0HB 1GI7B 1TGSZ 1RFNA 4X8SH 4E06H 3RXDA 1T8LA 1EKBB 1VCPA 1MQ6A 1DWDH 3RXVA 1JWTA 1P2QA 4Y7BA 2CN0H 2GZ7A 5T6DA 5FPSA 4B75A 4Y79A 1KLJH 3GCHB 1EB1H 1GI5A 3T28A 4QT8C 3TIUA 3LT3A 1PPGE 1K1PA 3UWJH 2FOFA 2WPLS 3A81A 1OWDA 4KGAA 2C8ZB 4H4FA 1AVGH 2AYWA 4NZLA 1MTNB 1SBWA 2YOLA 2OD3B 2VWOA 4B74A 2PGQB 4BNRA 3RMOH 2QAAA 3LGIA 2FOMB 1QTFA 1QFKH 4FVDA 1ARBA 4UFFH 3DUXH 5K0HA 2BD4A 1RGQA 1O3LA 4YOIA 1K2I1 3ZZ6A 1P2NA 1G2LA 3LGYA 2AIPA 3RXLA 2Z9KA 2UUJB 2Z9JA 1XXDA 1O2XA 1N8OC 3PYHA 2BZAA 3OSYA 1QB1A 2GCTC 4K1SA 1E36B 4ABAA 1Q31A 5K7RA 3SUDA 3A8AA 3A7TA 2WV5A 3LGVA 3ODFA 1TGBA 1A2CH 1UO6A 1C2LA 1P9UA 3B9FH 3PROA 3SV7A 1BMAA 3RXSA 1GBJA 2GCHG 3M5NA 2ESTE 3SU3A 3OU0A 1T31A 3O8RA 1UTMA 3MH4A 4MTBA 1IQFA 1O39A 5HXFA 1FDPA 2ASUB 3DFLA 2R2WU 1C1QA 1GGDB 4FUGA 2BDCA 3SW2B 1HCGA 2P94A 1EASA 4MQAA 1AO5A 2VH6A 2FOEA 3P8FA 2PR3A 3RMNH 2QIQA 1ELVA 1OKXA 4JZ1A 3ZVFA 1S6FA 4X1QU 3KCGH 3DHKH 1OS8A 1QBNA 2R3YA 1MBMA 2HRVA 4X1SU 2ZHWH 3P70B 2AS9A 4D9QA 3RMLH 2FS9A 2SGFE 3L33A 1DM4B 3HK6B 7GCHG 4X6NA 1CA0B 1JMOH 1SGFG 4AYYB 2XC0A 3M5LA 4KTCA 1C1VH 1C9TA 1SHHB 1SI5H 3S69A 1ANEA 1AFQC 2ZGXH 1O2KA 2C8WB 3SU0A 1RIWC 1V2MT 3SNEA 5EQSA 2BLVA 3PMJA 4THNH 1IQMA 5JBAS 3SNAA 4KTUA 2ZIQH 4K1EA 3ZVCA 1O2UA 1C1SA 1HAXB 1NO9H 1UCYE 1GBKA 3M3TA 1F0RA 3TJUA 3BV9B 1CSOE 1C1UH 1GHXH 4YM9A 5I25A 5CHAC 2YNAA 1NM6A 1KSNA 4FU8A 1J9CH 2QV1A 3E8LA 3T5FH 1O3GA 5EU8A 3U8RH 2Z9LA 2XBXA 4B73A 1O2WA 4ABIA 4X6MA 2B7DH 1EXFA 4FUHA 1OX1A 1SGDE 3ENSB 1ZMLA 1AQ7A 1O2HA 4K60A 3UTUH 1Y5AT 1CT2E 4ZXXH 1BRBE 4GUXA 3ATKA 1CA8B 1Z1JA 2I6SA 4NZQA 2ZU1A 1FMGA 3PMAB 1AI8H 1T8MA 4NIVA 3ATIA 3A82A 3S9CA 4SGAE 3RXRA 4Y76A 4DT7B 1XUGA 1UTOA 3ZYDA 2GKVE 2STBE 2BD7A 1MZAA 1NY22 2CF9H 1GBHA 1TA6A 4O03A 1TA2A 3A7WA 2EEKA 2FOAA 2XBYA 3HKIB 3RU4E 3QZQA 2A31A 3MH5A 1O30A 1T8NA 4INKA 2AGEX 3A86A 1E0FD 3FZZA 2TGTA 5ESBA 1P57B 5FHTA 6LPRA 1NZQH 1SGFA 1VR1H 2GV6A 4I8GA 2G8TA 1PPEE 1HAPH 8GCHG 8ESTE 2P3FH 4AORA 2WPKS 5J4SA 1GMDF 2PWXA 3Q76A 4AN7A 3AAVA 1QGFA 1SGCA 2ZGJA 3P17H 3WY8A 1SLWB 3I77A 1L4ZA 4YT7H 3ZZ3A 1O2LA 3T27A 2R0LA 1C5TA 1TPAE 3PMBB 1UVSH 1V2LT 1KY9A 1WOFA 1SLVB 4CBOA 1W3CA 3TLOA 4BAKB 3C27B 4AFUA 4A6LA 3P6ZB 4XFQA 1UVTH 1GHBG 1GL1A 2V6NA 3AAUA 3JZ1B 1GBCA 5C5NA 1IQHA 4DIHH 2B9LA 1SL3A 1HAVA 1C1WH 3K6ZA 5A0AE 3T25A 3MU5A 5F8TA 1GI6A 2AGGX 1DANH 3R3GB 1O5CB 2ZHEH 1O5FH 1FI8A 1N6XA 2O8WA 1TE0A 2ZQ1A 1IQLA 3STIA 4AB9A 2FDAA 4OS5A 3V13A 1ZYOA 1P06A 2BOHB 2IN2A 4O3UA 4CR5A 1EJAA 1UTQA 5LPRA 1O2QA 4E7NA 5A0CA 2H9HA 5AFYH 1C2MA 4WMFA 2J94A 4Q7XA 2BD5A 1BUIA 3ATMA 2BY8X 2TGAA 3O8DA 3LIWA 1GJAB 1J16A 4FUJA 2AFQB 2R2MB 1C2IA 1QR3E 1DT2A 1AN1E 1YPKH 2PLXA 2ULLA 3K6YA 4AX9H 2GX4A 1ELCA 4X1RU 5EGMA 2QN5T 3ZZBA 1RJXB 2KAIA 2G4UA 4DJZB 2UUKB 4ZHMU 1QURH 4R8TB 2FI3E 2TGPZ 3RLWH 4CRCA 3LOXA 3SQEE 1GDQA 2FP7B 2Y82A 2WINI 5FX5A 1A3EH 3RU4T 1E35B 3VB6A 1A0JA 1C5YB 4Y8ZA 2H5DA 2ANWA 1SQTA 1H8DH 2CGAA 3L6PA 2HNTE 6CHAC 1EOLA 1GI9B 1P09A 4ZXYH 5L6NH 1NRQH 4ABDA 2A4GA 4WJG2 1AUTC 1EB2A 1Q3XA 2BB4A 1FY4A 3GICB 5EPNA 2GD4B 1O3KA 3BIVH 1N8OB 1DOJA 5C3NA 1MU8B 2XWBI 1V6DA 1LQEA 2GCTB 1C9PA 2BDGA 1OP2A 1O2GH 1A1RA 1G36A 1C5MD 1TMBH 1JIRA 1TYNA 2TIOA 2XNIA 2O8MA 4GPGA 4B2BA 4AG2A 5EPYA 1AUJA 7ESTE 1ZPZA 5FPTA 1BTPA 1FXYA 1NRSH 1H9IE 1TGTA 1UTJA 2ANMH 4IGDA 2FXRA 3ESTA 1P04A 1C1RA 3EA7A 1NFUA 1BB0B 2AIQA 2UWLA 2C8YB 5FCRA 1CU1A 5TCAA 1YLCA 1FZZA 1WUNH 3F9GA 1LO6A 2I6QA 1LKBA 1GMHF 3MHWU 5EQRA 3A8CA 3SI4H 3D23A 4MPUA 1V2TT 4UDWH 2W3IA 2BDBA 5LPFA 1TGCA 1QQ4A 5T3HA 1GI4A 1HYLA 3FP7E 1EAXA 1FPHH 2THFB 3U8TH 2VH0A 1GBEA 1MKXH 4X2WA 1W7XH 1K22H 1WQVH 3P95A 2ALPA 2GCHF 1BRAA 1V2JT 3SHAH 4H6TA 1AFQB 2PV9B 4GHTA 4DURA 2BY7X 1ARCA 1OWKA 2WPHS 5SGAE 1ZHRA 3DA9B 5JB9S 1O3PB 4JCNA 5G4BA 2GVFA 4YTAA 4A92A 1TNLA 4X8TH 1MAXA 4YLQH 3F6UH 2ZHFH 2ZZUH 2ZFFH 4J2YB 5CHAB 1D3TB 5JB8S 2HPPH 1IQIA 1DFPA 3TGKE 3GDVA 5FX6A 4IC6A 4RKOB 1LVOA 2ZF0H 1PPZA 2ZA5A 4K5ZA 3ZZAA 2HOBA 1NFXA 1NESE 2J34A 5FBEA 1O3NA 1O36A 1S83A 1VCQA 1XVMA 2OBQA 2XC5A 1AE8H 4Y10E 2HALA 3LH3A 2A4OA 1O3IA 1P11E 3BEUA 2GMTC 3BG4C 4D7FA 2OLGA 3V0XA 2Q6GA 1A5HA 2CHAC 1GJ4H 1BMLA 1LQDB 4UE7H 3FVFB 1AIXH 1L2EA 5GWZA 3LDXH 5DP4A 4B1TA 1BHXF 3LU9B 3RP2A 4O3TA 1P2MA 3LPRA 1QNJA 1PQ7A 1E34B 2F91A 2A1DB 5EXNA 5AVDA 2BVSH 1QRZA 2FYRA 1A0LA 4UEHH 2H9EH 2JH0D 2ZHDA 1HJAC 3LKWA 5CE1A 1O37A 3ZV8A 4GSOA 1DSUA 4IC5A 4XBDA 2VIVA 2G4TA 3NXPA 1UK3A 1VGCB 2M5TA 1GG6C 2H1UA 1OWIA 2G81E 4O9VA 5HGGA 1L1GA 1C2DA 3TU7H 1G2MA 5DK1A 1IQGA 3A7XA 2FM2A 4ASHA 2JH5D 1OWEA 1RTKA 1CQQA 3BG8A 3V3MA 2QGRA 1B7XB 4MPXA 4NWKA 8KME2 3G01A 3RXGA 2QXHA 3M7QA 1IHSH 3BIUH 3NK8A 4UFDH 1LCYA 3PO1C 4JZFH 3VGCB 3SGAE 4X6OA 4I7YH 2ANYA 3SOSA 2FOBA 1LPKB 1ELAA 3CP7A 2ZKSA 2STAE 1FJSA 1L1NA 2EA3A 3PWCA 1EP5A 3M3SA 1DX5M 1EQ9A 2DE8A 1QB9A 1KYNA 2F9OA 1TPSA 4LK4A 1K1MA 3BEIB 2FI5E 1KIGH 5L2ZH 4AGKA 1MKWK 1A5IA 1OYTH 1WBGB 1LVMA 1MQ5A 2WUCA 1ABJH 2Y6TA 1FUJA 3DFJA 1QL8A 1TMTH 1UK4A 1UVPA 8GCHF 2VWNA 4M7GA 1HAZB 5C5OA 4K69A 2A7HA 2CV3A 4NCYA 2WPJS 2Z9GA 4WWYA 2CXVA 3SN8A 1DLKB 1NFWA 3QO6A 3H5CB 3T26A 3RM2H 4FVBA 4FU7A 2VIQA 4BAHB 3SJ8A 1RTLA 1GBTA 1PPCE 3DD2H 4ZKRU 3A7VA 3SV9A 2WV4A 4ISIH 1GHBF 3EE0B 1JBUH 4ZKSU 1SG8B 1MTSA 2FS8A 1HUTH 1B0FA 1CHOG 4XOJA 4ZUHA 3RXKA 2TRMA 5L30H 2J2UA 2SGDE 4HFPB 1BTWA 1JOUB 3QX5H 3LGWA 1LKAA 2Y81A 3SV8A 2BQ6B 4WXVA 3M7TA 1HAVB 3PTNA 3TH4H 1DUAA 1BMMH 1P0SH 4U32A 1VZQH 6CHAB 3LGUA 4BTIB 1HNEE 1K1NA 2F9NA 2PTNA 3ZVDA 2ZCKP 1THRH 4DVAU 1T32A 1BZXE 1ETTH 4YO9A 1W10U 1IAUA 1BBRH 3BTKE 1O32A 2PSYA 2XW9A 4AOQA 2A5IA 1ESBA 2ZDAH 1C5LH 1ZR0A 1P3CA 1TQ7B 2D1JA 3MU8A 3R0FA 1DICA 1PPBH 5HYOA 1GWAA 1BJVA 1ELTA 1AE5A 1ZSLA 1SPJA 1GI1A 1V2PT 3SI3H 2B5TB 1CE5A 1BJUA 1GMHG 3RXMA 2KAIB 1SGEE 1K9OE 3RXEA 1KTTB 1ETRH 3RLYH 3KF2A 1AWHB 4NSVA 1QL7A 1C2JA 3NUMA 1TNGA 5IYTA 1DWEH 3FP6E 2W7SA 2OXSA 2BX3A 2Y5HA 2P3TB 5GCHG 1BRCE 3KQBA 4HTCH 1SGTA 5AFZH 3M7UA 1DPOA 4JZDH 1SOZA 4Y71A 3QTVH 4H42U 1ZHPA 2BD9A 3VPKA 1TPOA 2NU3E 3F9EA 5BRRE 2Y7ZA 4WY3A 4BAMB 1HJ8A 1DXWA 3RDZA 2P8OC 3M5OA 2BDAA 1P12E 3UIRA 1O2IA 3PLKA 4NIXA 1EAUA 3AASA 5EW2H 4DCDA 5EXLA 3MNBA 2ZPQA 5GIBA 2BQWB 1AY6H 2IOTA 1S85A 3MTYA 5BPEA 4CH2B 3SV6A 3N7OA 5E0GA 1XUIA 4MLFB 1TLDA 4ZAEA 3OX7U 1NS3A 4TPYA 1LMWB 1HAYB 1SOTA 1O3JA 4ZHAA 4Q80A 3GCNA 1NC6A 3E6PH 4X2VA 4CHAC 1CVWH 1E37B 4ZH8A 3KGPA 1O0DH 2JKHA 1LHEH 3ZZ7A 2ZDKA 2G00A 3SNBA 1BTUA 1P2JA 4DGJA 2ZGCA 3SBKA 1DDJA 3CS0A 1A3BH 1F5RA 1O3BA 2GMTB 1GI2A 3BG4B 3E91A 4X6PA 2PKSC 1C2KA 4Y0ZE 2B8OH 1W14U 2CHAB 2QA9E 4A1VA 1GBDA 1ELGA 5HMAA 1G3CA 1AZ8A 2DE9A 5F03A 1GJ5H 3SUEA 2B0FA 4SGBE 1C5UA 2OBOA 1Y3YA 2QY0B 4FUDA 1TABE 3LH1A 3Q3XA 1YF4A 3NKKA 3TITA 1MBQA 1O34A 1C4Y2 3PMHB 2Y5GA 1GVKB 2VJ1A 1HJAB 3GY3A 1F0UA 1L1JA 1TBQH 3UFAA 1O38A 2UUYA 1O2RA 3MI4A 1TMUH 2FOGA 3ZZ5A 4ISLA 3I29A 1AB9C 1J15A 2V0BA 1YPHC 4K1TA 2FOHA 4NSYA 1GG6B 1DVAH 4I8LA 3SV2H 1UTNA 1KTSB 1PYTC 3SJKA 3A84A 1MCTA 2C3SA 4NFFA 4ZHLU 3IWMA 3W95A 4Q2KA 2BOKA 3O8CA 1ZJKA 1FAXA 3SQHE 1DXPA 2SGPE 1S84A 3RC4A 3TH3H 2A7JA 3UUZA 1F92A 1RS0A 2ZPSA 2BLQA 4A1TA 3I78A 1THSH 3ITIA 3UQVA 1TNIA 3UOUA 4O97A 2TPIZ 1QBOA 1KXCA 3P8NA 1D6RA 1A46H 6GCHG 3PTBA 1CT0E 1KDQA 4UFEH 1GBLA 1WQSA 3PO1B 2ZC9H 2WUBA 1EAIA 3ZVBA 3VEQB 1GVLA 2ZDVH 1SB1H 1NRPH 1DITH 1SGNE 1V2VT 2Y5FA 3PLPA 3S9BA 2GZ9A 2OC8A 4AB8A 1O2YA 1S0QA 3A85A 2ODYB 5TCCA 4BXSA 1TX6A 2WPIS 4DOQA 1M9UA 2O9QA 1CBWB 2PGBB 4F49A 4X1NU 1XXFA 2UWOA 4ABHA 2Q6DA 2A45B 3TK6A 2NU2E 3RXBA 1YLDA 1UTPA 4WXIA 5JBBS 2ZO3H 1Z6EA 2PW8H 4GHQA 3HGPA 3SUFA 2FX4A 1Q2WA 1UHBA 1ZMJA 3TK9A 1F5KU 1VJ9U 2QXGA 4TY7A 1GVZA 3ATWA 2EI8A 1CO7E 5C1XA 3BTQE 1O2NA 4JZEH 2F9PA 3V12A 1JIMA 1HPGA 3M36A 5DO4H 3D62A 1O3FA 1UCYH 4ABEA 4BXWA 3ZVEA 3BN9A 1YCPK 1GL0E 2NWNA 3VXFH 1ANCA 1D9IA 2VVUA 1FY5A 1FIZA 1W13U 4E7RG 3BTTE 4AYVB 3LC3A 3MO3A 2BQ7B 2IJOB 5F6MA 1XM1A 1S6HA 5B6OA 2F3CE 5A09A 1HAOH 3BTFE 4Z0KA 1NU9A 1W2KH 2Q6FA 1TGNA 1CGHA 1LDTT 1C2GA 2H5CA 1ESAA 1QA7A 1ID5H 4MNVA 3IITA 1XUJA 1QHRB 5PTPA 1IQJA 2P95A 4RN6A 1EPTA 3GY7A 2XBWA 3VB5A 1V2OT 5DGJA 3FAOA 3BTWE 2BD3A 3U98H 3SGBE 2CF8H 1BTYA 2A5AA 1CHOF 2AMDA 2G5NA 1FAKH 3BEFB 4MNYA 1EZUC 3BF6H 4VGCC 4OS1A 3IG6B 2G5VA 3BTHE 3QK1A 1SGYE 1YP9A 5ESTE 3RXHA 3TK5A 1MD8A 1MTUA 2NU0E 4NIYA 1LHCH 4DIIH 4LXBH 1NROH 3RXTA 1YPJH 3TNSA 4IBLH 2W3KA 4ABGA 5JDUB 1ELDE 1VITG 2AH4X 2BYAX 5DP6A 1SQOA 4MNWA 4D9RA 2XYAA 1B0EA 5C20A 2F9UA 3GCHC 1HB0B 1GJBB 2ZFQH 1FIWA 4YT6H 1QL9A 1OXGA 4RKJB 1OWHA 5ETXA 4Y0YE 3MOCA 2C90B 1LPZB 1UMAH 2VWLA 1EPTC 5HM2A 1DY9A 2P8OB 3A89A 4D8NA 1C2EA 2ZGHA 1TX7A 2BXTH 2Z3EA 3QTOH 4NFEA 1EAWA 2SGAA 1YKTA 1IHTH 3LJOA 1CGIE 1Z7KA 2FEQH 2FLRH 2OC7A 5GCHF 5C67A 2ANKH 1UTKA 1TB6H 1TNHA 4CRGA 2TBSA 1V2WT 1DLEA 2ZG0H 1H9LB 5EOKA 1F0TA 1DUEA 3RXIA 2ZP0H 2Z6BD 4CHAB 2BY5X 3SU4A 2GZ8A 1NFYA 1INCA 4DG4A 1C4V2 3KQEA 1RIWB 1TQ0B 1TOMH 4UFGH 2BLWA 1NTPA 1BMNH 3A7YA 2GDEH 1C5ZB 2ZFPH 1AWFH 5LPEA 2BVXH 3TGIE 1FNIA 1SFQB 2PKSB 2XBVA 4BTUB 3GY5A 1TONA 2C93B 3RXFA 1FN6A 4XSKU 3SHCH 3E1XB 1BRUP 3A88A 5GPIB 1W11U 2FTLE 4D76A 1O5GH 2Z94A 2P59A 1ZTJA 4ZKOU 5DJ7A 4I32A 1Y5UT 1HIAA 3ZZDA 2GGVB 1C1MA 3RXOA 1OOKB 1THPB 3URDA 5C1UA 3MNXA 1O3EA 2JETC 4I31A 1YPEH 1RRKA 5F8ZA 2XXLA 5AHGH 1NT1A 3SUGA 4OGYA 3K2UA 1OP0A 1AB9B 4JZIA 3M3VA 2OUAA 4ABFA 3VB3A 1WTHD 2HNTF 4JYTA 1PQ8A 3RXQA 4XBCA 1F5LA 3RM0H 3KQDA 4FUCA 2WYJA 2C4FH 1Y8TA 2Z3CA 3T62A 7LPRA 3T29A 1G3EA 4OS4A 5TJXA 1V3XA 1GDUA 2C8XB 4FUEA 1QJ1B 3MH6A 1XUHA 2BDYA 2W7UA 1E38B 2ZGBH 1DSTA 2QYIA 5JYIA 1SC8U 3UREA 1A5GH 1D3DB 3DT0H 2FX6A 3H7OA 1F0SA 1XKBC 1G30B 1J17T 1C5RA 4X8UH 3Q3KA 3TGJE 1L0ZA 1BBRE 2SFAA 3OYPA 2VINA 5JBCS 4OS2A 1YBWA 3HGNA 4INLA 4B2CA 1O2JA 1F2SE 4U01A 2BTCE 2PSXA 8LPRA 1FN8A 3ELAH 3T2NA 2J4IA 1K1OA 1LTOA 4FUIA 5DG6A 4E05H 6GCHF 2Q1JA 2ZDLA 1WV7H 1ZRKA 1N6YA 3RMMH 1Z8IB 5EXMA 1HAGE 1Y5BT 1P10A 3U1IB 1Z8GA 1FV9A 2V3OH 2YNBA 1EUFA 4ZROA 2O8UA 2OC0A 2ZFSA 4Y7AA 2W26A 2ODPA 2ZDMA 1AGJA 5GXPA 3TNTA 1K1JA 1XX9A 1SGQE 4LOYH 1KXFA 3AVZA 3BTGE 3RXUA 1PPFE 1KDQB 2A32A 5CMXH 1GCTC 3MMGA 2ZCLP 2DUCA 3UWIA 1PFXC 1TNJA 3OTJE 1Z8JB 1FY1A 1BIOA 1EJNA 1GJ6A 2NU1E 2ZTXA 2A4RA 5EW1H 1KXDA 2F83A 1ELEE 1GJCB 4Y8XA 4U30A 1BTXA 1GI0A 3KNXA 1O2ZA 1AKSA 2AGIX 2HGTH 2XWAA 4X2XA 5EG4A 3QLPH 5JPMH 4CRFA 2D8WA 2VIOA 1ORFA 1LVBA 4Q7YA 4BAOB 1LHFH 1JRSA 4OGXA 2VIDA 3UOPA 2AMQA 5DPAA 5A8XA 3ZVGA 2CJIA 2EC9H 3M35A 3UR6A 3PM3A 1BHXB 4NG9H 2AMPA 1O3OA 4FXGH 3UNRA 2SGQE 4KELA 1L4DA 5T6GA 2ZFRH 4U2WA 1FY3A 3MNSA 2ZU5A 5F8XA 1O3AA 3EA8A 1UHBB 1K28D 1TFXA 2RA0A 4YOJA 1QIXB 3GDSA 2RDLA 5FBIA 1QCPA 1VJAU 1XKAC 2UUFB 4UONA 5DP5A 4VGCB 3ZV9A 1O5DH 1TWXB 3VXEH 2F9BH 1A7SA 1SLUB 3E90B 3MU0A 2O8LA 3TH2H 2J9NA 1D6WA 3U8OH 4IS5A 5AF9H 1C5XB 2R9PA 1FPCH 4X8VH 3GDUA 3B23B 3SJIA 3EDXB 2VGCC 4PROA 1OPHB
chains in the Genus database with same CATH superfamily
2ZEBA 2FYQA 1CGJE 1ZGVA 3ZVAA 4YLUA 5DP8A 2AEIH 5A8YA 4CRBA 2OP9A 5L2YH 3HATH 4NA7A 1HXEH 1W7GH 5FPYA 2ZI2H 4JYUH 1QZ8A 4JYVH 1EPTB 5A2MH 3E0PB 2PUQH 1BDAA 3HKJB 2FTMA 1GI3A 1QB6A 5E0JA 1G3DA 3MNCA 3NPSA 2Y80A 5GJ4B 1AVXA 1PQ5A 4AFZA 2G51A 1VITH 1P9SA 3K9XB 1Z71A 5B6LA 2ZDNA 5FAHA 2ZWLH 3SORA 1VITF 1TBRH 3N7DA 3FO8D 3VB4A 4MDSA 1MCVA 4Y8YA 3S7KB 1QBVH 1C5NH 3RC6A 1SHYA 4TY6A 4ABJA 3QGNB 2HPQH 5T1VA 1SVPA 2QCYA 1W0YH 2OCVB 3M5MA 5ABWA 1MTWA 1AD8H 2ZFTA 1YPGH 1MKXK 3UQOA 1P8VC 1HDTH 2XTTB 1P2IA 3PV4A 1C1OA 1O35A 5IDKA 2ILNA 3JZ2B 1K1LA 1TPPA 2HWLB 3F1SB 4ZMAH 4KTSA 3SJOA 1DS2E 2LP6A 4NWLA 1YYY1 3GOVB 1FONA 2A7CA 2P3UB 3U69H 4WMEA 3O8BA 3K65B 1Y3WA 1ESTA 2KCOA 1TIOA 3KL6A 3EAJA 1P05A 3ZZCA 2XRCA 5FL7D 2OQUA 2PTCE 1YPMH 2FI4E 4IMQA 3KQCA 3GY8A 1GJDB 3EGKH 1UVOA 3WWBA 1BA8B 1JRTA 3GY6A 4NA9H 1ZGIA 2JETB 1MH0A 1BITA 4P02A 4DW2U 3F9FA 4FETA 3TJOA 3A7ZA 5E0HA 2KCYA 1C5WB 1DWBH 1U6QA 2G55A 1XUFA 1WYKA 3ZYEA 4OS7A 1SGPE 4CR9A 1GBAA 1TAWA 1GPZA 2W5EA 2OC1A 4NIWA 1QRXA 4JK5A 5C2ZA 2BXUH 3U1JB 4DY7B 2J92A 6ESTA 3GY2A 3S9AA 2RFKC 1KLIH 1W12U 1ANDA 1MAYA 3KQ5A 1QA0A 1Z1IA 2RA3A 1G37A 1GHZA 5HM9A 1PPHE 1UK2A 4AGJA 2AERH 1C2FA 3SO3A 3A87A 2FIRH 2ALVA 1MU6B 5C1YA 3TJNA 1G32B 1HIAB 4Y11E 1DWCH 2VWMA 3LJJA 1XUKA 1SR5C 2FODA 4GVUA 1KXEA 1HAIH 1EP6A 2PKAA 1P01A 2ZPRA 1SQAA 4UD9H 2XC4A 1WTGH 3MH7A 1SSXA 5A8ZA 1ZZZA 1Y59T 3Q77A 3F9HA 1AMHA 1EOJA 2OTVA 5FCKA 4Y6DA 2ODQA 2K0QA 1BT7A 5HKKD 2FO9A 3P8OA 3A8BA 1ELBA 2A0QB 4ESTE 4BTTB 5E8EH 1IQNA 2UWPA 3AW0A 1V2RT 1C5VA 1DE7H 1Z8RA 2ZU3A 1YPHE 2TGDA 4B76A 2ZHQH 1LHGH 2SNWA 1NN6A 2OQ5A 2QXIA 1MD7A 1VGCC 1GCTB 1GHAF 4TYDA 3NCLA 1O3HA 1GHWH 1ZJDA 1O2TA 4JMYA 1HXFH 1FLEE 3GYLB 3MU1A 4B6FA 4CH8B 2WPMS 3EYDA 1WCZA 3SU5A 3F2FA 3SZNA 3W1EA 1P3EA 4GCHG 2BHGA 2D26C 1OP8A 2FWWA 2HVXA 2XOKD 3KN2A 3LONA 1WSSH 3MYWA 1SMFE 3RC5A 1O3CA 3UPEA 1GMCG 3VGCC 2FOCA 3B8JA 1H8IH 1ANBA 1SFIA 3OY5U 4TWWA 4AZ2B 1J14A 4JK6A 1D4PB 1GI8B 2QC2A 4XBBA 4YZUA 1NPMA 4RSPA 2J5UA 1LHDH 1TX8A 2VBCA 1G9IE 4A5TS 1T7CA 3H7TA 1MKWH 1C1TA 2GP9B 3KYGA 3MU4A 4K8BA 1HGTH 2ZQ2A 3Q3YA 2P93A 4B2AA 1ZRBA 1TRNA 2FPZA 2RG3A 2VIWA 2G52A 3E0NB 5LGOA 2Z3DA 1MABB 3TJVA 3URCA 4WMDA 1SLXB 1YC0A 2PUXB 4MPVA 3C1KA 2HNTC 4A1XA 3Q00A 3UY9A 1AVWA 4K3JA 5E2PA 2VGCB 4ZKNU 1AKSB 1O5EH 3CS7A 1NRRH 2A4QA 3D65E 3MWIU 5DP7A 1HBTH 3ZIAD 1BBRK 1KLTA 2GTBA 2ZTZA 1O5AB 3EA9A 3RXJA 4I8KA 2ZTYA 4ISNA 2J97A 5GDSH 4CRDA 4WVPE 1D3QB 1B5GH 4LZ1H 3D49H 1JXPA 1EZXC 3GCTF 2Y7XA 1TRMA 3L3TA 4BAQB 1IOEA 3WWFA 1T4VH 2J38A 4YESB 1TNKA 3P8GA 1BOQA 1YM0A 1TRYA 3QWCH 1EZQA 1HAHH 1UVUH 1CHGA 1XMNB 2A5KA 1RD3B 2WV9A 3GY4A 4IMZA 5DP3A 1H1BA 1GBFA 3FZDA 3SJ9A 1O31A 1W0JD 4IW4E 3SU2A 2NU4E 4FU9A 4LZ4B 1AFEH 2VIPA 2K1QA 3UNSA 1LPGB 4IN1A 1FQ3A 4FUBA 1O2OA 2FMJA 3BSQA 3A83A 5EIYA 1YPLH 4MG3A 1W0ZU 2BZ6H 2BMGB 1AZZA 1MTNC 1YY3A 1HLTH 2VVVA 2QXJA 4F48B 3EQ0H 5EJLA 1V2NT 2H2ZA 3QUMP 1EJMA 3M61U 4KKDA 1RXPA 3RXAA 1EFRD 2O8TA 2LPRA 5EQQA 2QF0A 3SU6A 3U9AH 1UW7A 2XCNA 3S7HB 1QJ7B 4F4OC 2FLBH 3PLBA 5LH8A 3QN7A 1ZPBA 1OWJA 2F43B 1TOCB 3ZZ8A 2ZU2A 2A2XH 1C1NA 2OINA 1GJ9B 1NU7B 1O2MA 1GBBA 1J8AA 3BTDE 1DY8A 1NBMD 4MVNA 2KFWA 1C5PA 2P16A 1S0RA 3QGJA 2BX4A 2Z9IA 3WW7A 1QJ6B 7KMEH 4ABBA 3MFJA 3STJA 1OSSA 1V2QT 2EI7A 3ZZ9A 5GNDA 1LVYA 1S5SA 2BVRH 3LGTA 1HV7A 9LPRA 4Z6AH 3LC5A 1BTHH 1ETSH 3W94A 1A4WH 1IQKA 2VVCA 3S0NA 9ESTA 1EATA 2FZZA 2VU8E 3TPIZ 5A0BA 1HFDA 3FANA 3KIDU 4AFSA 4K2YA 1ZPCA 2GDDA 3A80A 3ATLA 4Q7ZA 1IQEA 1GGDC 3FFGA 5C0UA 4RT0A 1FY8E 3AK5A 4ISHH 3FKSD 5H4IB 3F68H 3RU4D 4BOHA 3A8DA 1RTFB 1W8BH 1NRNH 1PYTD 3SNCA 4BANB 5T6FA 2BD8A 1C1PA 1T8OA 3UNQA 1N1LA 2R0KA 2GV7A 4X2YA 4CREA 4INHA 3E3TA 3SGQE 1YCPM 2RCEA 4GAWA 1G3BA 1CA0C 3CNRA 1HJ9A 1O33A 1ZLRA 2SNVA 1K0HA 2Z7FE 1MZDA 1ZSJA 2BD2A 1O5BB 1ELFA 1K1IA 7GCHF 1VCWA 1O2VA 1WU1A 3UB0A 1UJ1A 2PHBA 2BDIA 3MO9A 4R0IA 5E2OA 4H6SB 1GHYH 1SGIB 2HLCA 3RXCA 3KEEA 4RI0A 2IPHA 3ODDA 3CENA 1TBZH 3NWUA 2VB0A 1BCUH 3RXPA 2XCFA 1X7AC 1ZOMA 5C0TA 3M37A 4YOGA 1E1RD 1UTLM 1WAYB 3BTME 4J1YA 1HRTH 4TWYA 2V3MA 3V7TA 1ZTLA 2ZU4A 4I8JA 4I33A 1GJ7B 2JH6D 4IN2A 2ZCHP 5EODA 2SGEE 3P92A 5JBTA 4B71A 3RUOA 2BY6X 1Y3UA 4MNXA 1GHAG 3PWBA 1GJ8B 2ZNKH 1H4WA 2A2QH 5DN6D 1PJPA 2WYGA 1V2KT 1S82A 3SNDA 4WF8A 1F7ZA 1T4UH 2CMYA 3BTEE 2EI6A 1EX3A 1O3MA 1C4U2 4X1PU 4TT3D 1GHVH 5DKMA 1GMDG 3F2GA 1C5SA 1EZSC 1ABIH 2BY9X 3PB1E 2BLOA 2HLDD 2F9VA 1P02A 1ZTKA 1K21H 3ZZ4A 1H9HE 3KHVA 2WHXA 1GCDA 1S81A 1YGCH 2PKAB 1P03A 4NA8A 5I46H 1P2OA 4WH8A 1ZMNA 1GDNA 3TVJB 2BM2A 3GCOA 3HPTB 3SU1A 1XVOA 1OHHD 5DP9A 4MPWA 1V2UT 1QQUA 3VB7A 4XDEA 1S6LA 4GLYA 4HGCA 5J4QA 2V35A 2ZECA 4FUFA 1C5QA 1GBIA 1UCYK 4HZHA 3HK3B 1MTVA 1TALA 1Z6JH 1AHTH 1P2KA 1AU8A 2GT8A 1BQYA 1BTZA 1ZHMA 2LNCA 2PFEA 1Y3XA 4D7GA 3E16B 2VNTA 1CBWC 1O3DA 4XE4A 1O2PA 1WXRA 4AFQA 3MO6A 4KP0A 3GYMA 4CRAA 1MMJN 1C5OH 4CBNA 1O2SA 4ISOA 3FP8E 4GCHF 2BDHA 1MUEB 2J95A 2QF3A 2GT7A 4WH6A 1KXAA 1C2HA 1GBMA 4A7IB 1KXBA 1OYQA 2H9TH 1ACBE 1QRWA 2FESH 1QY6A 3AW1A 3NZIA 4HI3A 4X0WU 5FXLA 1CT4E 2D2DA 1V2ST 3VFEA 1GMCF 3QZRA 3UR9A 2R3UA 3QDZB 4OS6A 1PQAA 3GCTG 3PRBA 1SGRE 1ZSKA 3EE7A 4NGAH 1Y3VA 1YCPH 3OY6U 2H6MA 1A61H 3GISB 4TPIZ 4K8YA 4I8HA 1D3PB 4AG1A 2V3HH 1A0HB 1GI7B 1TGSZ 1RFNA 4X8SH 4E06H 3RXDA 1T8LA 1EKBB 1VCPA 1MQ6A 4OM9A 1DWDH 3RXVA 1JWTA 1P2QA 4Y7BA 2CN0H 2GZ7A 5T6DA 5FPSA 4B75A 4Y79A 1KLJH 3GCHB 1EB1H 1GI5A 3T28A 4QT8C 3TIUA 3LT3A 1PPGE 1K1PA 3UWJH 2FOFA 2WPLS 3A81A 1OWDA 4KGAA 2C8ZB 4H4FA 1AVGH 2AYWA 4NZLA 1MTNB 1SBWA 2YOLA 2OD3B 2VWOA 3OE7D 4B74A 2PGQB 4BNRA 3RMOH 2L6OA 2QAAA 3LGIA 2FOMB 1QTFA 1QFKH 2JJ2D 4FVDA 1ARBA 4UFFH 3DUXH 5K0HA 2BD4A 1RGQA 1O3LA 4YOIA 1K2I1 3ZZ6A 2RDEA 1P2NA 1G2LA 3LGYA 2AIPA 3RXLA 2Z9KA 2UUJB 2Z9JA 1XXDA 4FOUC 1O2XA 1SKYE 1N8OC 3OFND 2BZAA 3PYHA 3OSYA 1QB1A 2GCTC 4K1SA 1E36B 2J98A 4ABAA 1Q31A 2CK3D 5K7RA 3SUDA 3A8AA 3A7TA 2WV5A 4AC9A 3LGVA 3ODFA 1TGBA 1A2CH 1UO6A 1C2LA 1P9UA 3B9FH 3PROA 3SV7A 1BMAA 3RXSA 1GBJA 2GCHG 3M5NA 2ESTE 3SU3A 3OU0A 1T31A 3O8RA 1UTMA 3MH4A 4MTBA 1IQFA 1O39A 5HXFA 1FDPA 2ASUB 3DFLA 2R2WU 1C1QA 1GGDB 4FUGA 2BDCA 3SW2B 1HCGA 2P94A 1EASA 5CHBA 2M2AA 1AO5A 3PV2A 4MQAA 2VH6A 2FOEA 3P8FA 2PR3A 3RMNH 2QIQA 1ELVA 1OKXA 4JZ1A 3ZVFA 1S6FA 4X1QU 3KCGH 3DHKH 1OS8A 1QBNA 2R3YA 1MBMA 2HRVA 4X1SU 2ZHWH 3P70B 2AS9A 4D9QA 3RMLH 2FS9A 2SGFE 3L33A 1DM4B 3HK6B 7GCHG 4X6NA 1CA0B 1JMOH 1SGFG 4AYYB 2XC0A 3M5LA 4KTCA 1C1VH 1C9TA 1SHHB 1SI5H 3S69A 1ANEA 1AFQC 2ZGXH 1O2KA 2C8WB 3SU0A 1RIWC 1V2MT 4XD7D 3SNEA 2YMSC 5EQSA 2BLVA 3PMJA 4THNH 1IQMA 5C17A 5JBAS 3SNAA 4KTUA 2ZIQH 4K1EA 3ZVCA 1O2UA 1C1SA 1HAXB 1NO9H 1UCYE 1GBKA 3M3TA 1F0RA 3TJUA 3BV9B 2F4LA 1CSOE 1C1UH 1GHXH 4YM9A 5I25A 3H09A 5CHAC 2YNAA 1NM6A 1KSNA 4FU8A 4ACAA 1J9CH 2QV1A 1WDIA 3E8LA 3T5FH 1O3GA 5EU8A 3U8RH 2JIZD 2Z9LA 2XBXA 1NBME 4B73A 1O2WA 4ABIA 4X6MA 2B7DH 1EXFA 4FUHA 1OX1A 1SGDE 3ENSB 1ZMLA 1AQ7A 1O2HA 4K60A 3UTUH 1Y5AT 1CT2E 4ZXXH 1BRBE 2WZQA 4GUXA 3ATKA 1CA8B 1Z1JA 2I6SA 4NZQA 2ZU1A 1FMGA 3PMAB 1AI8H 1T8MA 4NIVA 3ATIA 3A82A 3GS9A 3S9CA 4SGAE 3RXRA 4Y76A 4DT7B 1XUGA 4Q4LA 1UTOA 3ZYDA 2GKVE 2STBE 2BD7A 1MZAA 1NY22 2CF9H 1GBHA 1TA6A 4O03A 1TA2A 3A7WA 2EEKA 2FOAA 2XBYA 3HKIB 3RU4E 3QZQA 3F2HA 5HIZA 2A31A 3MH5A 1O30A 1T8NA 4INKA 2AGEX 4B6EA 3A86A 1E0FD 3FZZA 2TGTA 5ESBA 1P57B 5FHTA 6LPRA 1NZQH 1SGFA 1VR1H 2GV6A 5EJZA 4I8GA 2G8TA 1PPEE 1HAPH 8GCHG 8ESTE 2P3FH 4AORA 2WPKS 5J4SA 1GMDF 2PWXA 3Q76A 3UAIC 4AN7A 3AAVA 1QGFA 1SGCA 2ZGJA 3P17H 3WY8A 1SLWB 3I77A 1L4ZA 4YT7H 3ZZ3A 1O2LA 3T27A 2R0LA 1C5TA 2QF4A 1TPAE 3PMBB 5EJ1A 1UVSH 1V2LT 1KY9A 1WOFA 1SLVB 4CBOA 1W3CA 3TLOA 4BAKB 3C27B 4AFUA 4A6LA 3P6ZB 4XFQA 1UVTH 1GHBG 1GL1A 2V6NA 3AAUA 3JZ1B 1GBCA 5C5NA 1IQHA 4DIHH 2B9LA 1SL3A 1HAVA 1C1WH 3K6ZA 5A0AE 3T25A 3MU5A 5F8TA 1GI6A 2AGGX 1DANH 3R3GB 1O5CB 2ZHEH 1O5FH 1FI8A 1N6XA 2O8WA 1TE0A 2ZQ1A 1IQLA 3STIA 4AB9A 2FDAA 4OS5A 3V13A 1ZYOA 1P06A 2BOHB 2IN2A 4O3UA 3N99A 4CR5A 1EJAA 1UTQA 5LPRA 1O2QA 4E7NA 5A0CA 2H9HA 5AFYH 1C2MA 4WMFA 2J94A 4Q7XA 2BD5A 1BUIA 3ATMA 2BY8X 2TGAA 3O8DA 3LIWA 1GJAB 1J16A 4FUJA 2AFQB 2R2MB 5HIYA 1C2IA 1QR3E 1DT2A 1AN1E 1YPKH 2PLXA 2ULLA 3FOAA 3K6YA 4AX9H 5IK2D 2GX4A 1ELCA 4X1RU 5EGMA 2IPQX 2QN5T 3ZZBA 1RJXB 2KAIA 2G4UA 4DJZB 2UUKB 4ZHMU 1QURH 4R8TB 2FI3E 2TGPZ 3RLWH 4CRCA 3LOXA 5CDFE 3SQEE 1GDQA 2FP7B 2Y82A 2WINI 3F0OA 5FX5A 1A3EH 3RU4T 1E35B 3VB6A 1A0JA 1C5YB 4Y8ZA 2H5DA 2ANWA 1SQTA 1H8DH 2CGAA 3PV5A 3L6PA 2HNTE 6CHAC 1EOLA 1GI9B 1P09A 4ZXYH 5L6NH 1NRQH 1BMFD 4ABDA 2A4GA 4WJG2 1AUTC 1EB2A 1Q3XA 2BB4A 1FY4A 3GICB 5EPNA 2GD4B 1O3KA 3BIVH 1N8OB 1DOJA 5C3NA 1MU8B 2XWBI 1V6DA 3SYJA 1LQEA 2GCTB 1C9PA 2BDGA 1OP2A 1O2GH 1A1RA 1G36A 1C5MD 1TMBH 1JIRA 1TYNA 2TIOA 2XNIA 2O8MA 4GPGA 4B2BA 4AG2A 5EPYA 1AUJA 7ESTE 1ZPZA 5FPTA 1BTPA 1FXYA 1NRSH 1H9IE 1TGTA 1UTJA 2ANMH 4IGDA 2FXRA 3ESTA 1P04A 1C1RA 3EA7A 1NFUA 1BB0B 2AIQA 2UWLA 2C8YB 5FCRA 1CU1A 5TCAA 1YLCA 1FZZA 1WUNH 3F9GA 4ZCNA 1LO6A 2I6QA 1LKBA 1GMHF 3MHWU 5EQRA 3A8CA 3SI4H 3D23A 4MPUA 1V2TT 2YMSD 4UDWH 1SQRA 2W3IA 2BDBA 5LPFA 1TGCA 1QQ4A 5T3HA 1GI4A 1HYLA 3FP7E 1EAXA 1FPHH 2THFB 3U8TH 2VH0A 1GBEA 1MKXH 4HG6A 4X2WA 1W7XH 1K22H 1WQVH 3P95A 2ALPA 2GCHF 1BRAA 1V2JT 3SHAH 4H6TA 1AFQB 2J98B 2PV9B 4GHTA 4DURA 2YMSB 2BY7X 1ARCA 1OWKA 2WPHS 5SGAE 1ZHRA 3DA9B 5JB9S 5F53A 1O3PB 4JCNA 5G4BA 2GVFA 4YTAA 4A92A 1TNLA 4X8TH 1MAXA 4YLQH 3F6UH 2ZHFH 2ZZUH 2ZFFH 3F0PA 4J2YB 5CHAB 1D3TB 5JB8S 2HPPH 1IQIA 1DFPA 3TGKE 3GDVA 5FX6A 4IC6A 4RKOB 1LVOA 2ZF0H 1PPZA 2ZA5A 4K5ZA 3ZZAA 2HOBA 1NFXA 1NESE 2J34A 5FBEA 4P00A 1O3NA 1O36A 1S83A 1VCQA 1XVMA 2OBQA 2XC5A 1AE8H 4Y10E 2HALA 3LH3A 2A4OA 1O3IA 1P11E 3BEUA 2EQNA 2GMTC 3BG4C 4D7FA 2OLGA 3V0XA 2Q6GA 1A5HA 2CHAC 1GJ4H 1BMLA 1LQDB 4UE7H 4TSFD 3FVFB 1AIXH 1L2EA 5GWZA 3LDXH 5DP4A 4B1TA 1BHXF 3LU9B 2WPDD 3RP2A 4O3TA 1P2MA 3LPRA 1QNJA 1PQ7A 1E34B 2F91A 2A1DB 5EXNA 5AVDA 2BVSH 1QRZA 2FYRA 1A0LA 4UEHH 2H9EH 2JH0D 2ZHDA 1HJAC 3LKWA 5CE1A 1O37A 3ZV8A 4GSOA 1DSUA 4IC5A 4XBDA 2VIVA 4XRNA 2G4TA 3NXPA 1UK3A 1VGCB 2M5TA 1GG6C 2H1UA 1OWIA 2G81E 4O9VA 5HGGA 1L1GA 1C2DA 3TU7H 1G2MA 5DK1A 1IQGA 3A7XA 2FM2A 4ASHA 2JH5D 1OWEA 1RTKA 1CQQA 3BG8A 3V3MA 2QGRA 1B7XB 4MPXA 4NWKA 8KME2 3G01A 3RXGA 2QXHA 3M7QA 1IHSH 3BIUH 3NK8A 4UFDH 1LCYA 3PO1C 4JZFH 3VGCB 3SGAE 4X6OA 4I7YH 2ANYA 3SOSA 2FOBA 1LPKB 1ELAA 3CP7A 2ZKSA 2STAE 1FJSA 1L1NA 2EA3A 3PWCA 1EP5A 3M3SA 1DX5M 1EQ9A 2DE8A 1QB9A 2KX4A 1KYNA 2F9OA 1TPSA 4LK4A 1K1MA 3BEIB 2FI5E 1KIGH 5L2ZH 4AGKA 1MKWK 1A5IA 1OYTH 1WBGB 1LVMA 1MQ5A 2WUCA 1ABJH 2Y6TA 1FUJA 3DFJA 1QL8A 1TMTH 1UK4A 1UVPA 8GCHF 2VWNA 4M7GA 1HAZB 5C5OA 4K69A 1H8HD 2A7HA 2CV3A 4NCYA 2WPJS 2Z9GA 4WWYA 2CXVA 3SN8A 1DLKB 1NFWA 3QO6A 3H5CB 3T26A 3RM2H 4FVBA 4FU7A 2VIQA 4BAHB 3SJ8A 1RTLA 1GBTA 1PPCE 3DD2H 1W0KD 2GJGA 4ZKRU 3A7VA 3SV9A 2WV4A 4ISIH 1GHBF 3EE0B 1JBUH 4ZKSU 1SG8B 1MTSA 2FS8A 1HUTH 1B0FA 1CHOG 4XOJA 4ZUHA 3RXKA 2TRMA 5L30H 2J2UA 2SGDE 4HFPB 1BTWA 1JOUB 3QX5H 3LGWA 1LKAA 2Y81A 3SV8A 2BQ6B 4DT4A 4WXVA 3M7TA 1HAVB 1VKYA 3PTNA 3TH4H 1DUAA 2HVYB 1BMMH 1P0SH 4U32A 1VZQH 6CHAB 3LGUA 4BTIB 1HNEE 1K1NA 2F9NA 2PTNA 3ZVDA 2ZCKP 1THRH 2KCAA 1T32A 4DVAU 1BZXE 1COWD 1ETTH 4YO9A 1W10U 1IAUA 1BBRH 3BTKE 1O32A 2PSYA 2XW9A 4AOQA 2A5IA 1ESBA 2ZDAH 1C5LH 1ZR0A 1P3CA 1TQ7B 2D1JA 3MU8A 3R0FA 1DICA 1PPBH 4Z1MD 5HYOA 1GWAA 1BJVA 1ELTA 1AE5A 1ZSLA 1SPJA 2OK5A 1GI1A 1V2PT 3SI3H 2B5TB 1CE5A 1BJUA 1GMHG 3RXMA 2KAIB 1SGEE 1K9OE 3RXEA 1KTTB 1ETRH 3RLYH 3KF2A 1AWHB 4NSVA 1QL7A 1C2JA 3NUMA 1TNGA 5IYTA 1DWEH 3FP6E 2W7SA 2OXSA 2BX3A 2Y5HA 2P3TB 5GCHG 1BRCE 3KQBA 4HTCH 1SGTA 5AFZH 2LELA 3M7UA 1DPOA 4JZDH 1SOZA 4Y71A 3QTVH 4H42U 4ASUD 1ZHPA 2IJD1 2BD9A 3VPKA 1TPOA 2NU3E 3F9EA 5BRRE 2Y7ZA 4WY3A 4BAMB 1HJ8A 1DXWA 3RDZA 2P8OC 3M5OA 2BDAA 1P12E 3UIRA 1O2IA 3PLKA 4NIXA 1EAUA 5DSFA 3AASA 5EW2H 4DCDA 5EXLA 3MNBA 2ZPQA 5GIBA 2BQWB 1AY6H 2IOTA 1S85A 3MTYA 5BPEA 4CH2B 3SV6A 3F3BA 3N7OA 5E0GA 1XUIA 4MLFB 1TLDA 4ZAEA 3OX7U 1NS3A 4TPYA 1LMWB 1HAYB 1SOTA 1O3JA 4ZHAA 4Q80A 3GCNA 1NC6A 3E6PH 4X2VA 4CHAC 1CVWH 1E37B 4ZH8A 3KGPA 1O0DH 2JKHA 1LHEH 2K8IA 3ZZ7A 2ZDKA 2G00A 3SNBA 1FX0B 1BTUA 1P2JA 4DGJA 2ZGCA 3SBKA 1DDJA 3CS0A 3OAAD 1A3BH 1F5RA 1O3BA 2GMTB 1GI2A 3BG4B 3E91A 4X6PA 3NRLA 2V7QD 2PKSC 1C2KA 4Y0ZE 3U28C 2B8OH 1W14U 2CHAB 2QA9E 4A1VA 1GBDA 1ELGA 5HMAA 1G3CA 1AZ8A 2DE9A 5F03A 1GJ5H 3SUEA 2B0FA 4SGBE 1C5UA 2OBOA 1Y3YA 2QY0B 4FUDA 1TABE 3LH1A 3Q3XA 1YF4A 3NKKA 3TITA 1MBQA 1O34A 1C4Y2 3PMHB 2Y5GA 1GVKB 2VJ1A 1HJAB 2QF5A 3GY3A 1F0UA 1L1JA 1TBQH 3UFAA 1O38A 2UUYA 1O2RA 3MI4A 1TMUH 2FOGA 3ZZ5A 4ISLA 3I29A 1AB9C 1J15A 2V0BA 1YPHC 4K1TA 2FOHA 4NSYA 1GG6B 1DVAH 4I8LA 3SV2H 1UTNA 1KTSB 1PYTC 3SJKA 3A84A 1MCTA 2C3SA 4NFFA 4ZHLU 3IWMA 3OEED 3W95A 4Q2KA 2BOKA 3O8CA 1ZJKA 1FAXA 3SQHE 1DXPA 2SGPE 1S84A 3RC4A 3TH3H 2A7JA 3UUZA 1F92A 1RS0A 2ZPSA 2BLQA 4A1TA 3I78A 1THSH 3ITIA 3UQVA 1TNIA 3UOUA 4O97A 2TPIZ 1QBOA 1KXCA 3P8NA 1D6RA 1A46H 6GCHG 3PTBA 1CT0E 1KDQA 4UFEH 1GBLA 1WQSA 3FN8A 3PO1B 2ZC9H 2WUBA 1EAIA 3ZVBA 3VEQB 1GVLA 2ZDVH 1SB1H 1NRPH 1DITH 1SGNE 1V2VT 2Y5FA 3PLPA 3S9BA 2GZ9A 2OC8A 4AB8A 1O2YA 1S0QA 3A85A 3PRDA 2ODYB 5TCCA 4BXSA 1TX6A 2WPIS 4DOQA 1M9UA 2O9QA 1CBWB 2PGBB 4F49A 4X1NU 1XXFA 2UWOA 4ABHA 2Q6DA 2A45B 3TK6A 2NU2E 3RXBA 4F55A 1YLDA 1UTPA 4WXIA 5JBBS 2ZO3H 1Z6EA 2PW8H 4GHQA 3HGPA 3SUFA 2FX4A 1Q2WA 1UHBA 1ZMJA 2KR7A 3TK9A 1F5KU 1VJ9U 2QXGA 4TY7A 1GVZA 3ATWA 2EI8A 1CO7E 3DSPA 5C1XA 3BTQE 1O2NA 4JZEH 2F9PA 3V12A 1JIMA 1HPGA 3DSGA 3M36A 5DO4H 3D62A 1O3FA 1UCYH 4ABEA 4BXWA 3ZVEA 3BN9A 1YCPK 1GL0E 2NWNA 3VXFH 1ANCA 1D9IA 2VVUA 1FY5A 1FIZA 1W13U 4E7RG 5KGOA 3BTTE 4AYVB 3LC3A 3DCLA 3MO3A 2BQ7B 2IJOB 5F6MA 1XM1A 1S6HA 5B6OA 2F3CE 5A09A 1HAOH 3BTFE 4Z0KA 1NU9A 1W2KH 2Q6FA 1TGNA 1CGHA 1LDTT 1C2GA 1H8ED 2H5CA 1ESAA 1QA7A 1ID5H 4MNVA 3IITA 1XUJA 1QHRB 2PP6A 5PTPA 1IQJA 2P95A 4RN6A 2KZ4A 1EPTA 3GY7A 2XBWA 3VB5A 1V2OT 5DGJA 3FAOA 3BTWE 3VG8A 2BD3A 3U98H 2W6JD 3SGBE 2CF8H 1BTYA 2A5AA 1CHOF 2AMDA 2G5NA 1FAKH 3BEFB 4MNYA 1EZUC 3BF6H 2XNDD 4VGCC 4OS1A 3IG6B 2EY4C 2G5VA 3BTHE 3QK1A 1SGYE 1YP9A 5ESTE 3RXHA 3TK5A 1MD8A 1MTUA 2NU0E 4NIYA 1LHCH 4DIIH 4LXBH 1NROH 3RXTA 1YPJH 3TNSA 4IBLH 2W3KA 4ABGA 5JDUB 1ELDE 1VITG 2AH4X 2BYAX 5DP6A 1SQOA 4MNWA 4D9RA 2XYAA 1B0EA 5C20A 2F9UA 3GCHC 1HB0B 1GJBB 2ZFQH 1FIWA 4YT6H 1QL9A 1OXGA 4RKJB 4RT1A 1OWHA 5ETXA 4Y0YE 3N7EA 3MOCA 3OTPA 2C90B 1LPZB 1UMAH 2VWLA 4I86A 1EPTC 5HM2A 1DY9A 2P8OB 3A89A 4D8NA 1C2EA 2ZGHA 1TX7A 2BXTH 2W6ID 2Z3EA 3QTOH 4NFEA 1EAWA 2SGAA 1YKTA 3OEHD 1IHTH 3LJOA 1CGIE 1Z7KA 2FEQH 2FLRH 2OC7A 5GCHF 5C67A 2ANKH 1UTKA 1TB6H 1TNHA 4CRGA 2TBSA 1V2WT 1DLEA 2ZG0H 1H9LB 5EOKA 1F0TA 1DUEA 3RXIA 2ZP0H 2Z6BD 4CHAB 1KMHB 2BY5X 3SU4A 2GZ8A 1NFYA 1INCA 4DG4A 2L74A 1C4V2 3KQEA 1RIWB 4ACBA 3SZEA 1TQ0B 1TOMH 4UFGH 2BLWA 1NTPA 1BMNH 3A7YA 2GDEH 1C5ZB 2ZFPH 1AWFH 5LPEA 2BVXH 3TGIE 1FNIA 1SFQB 2PKSB 2XBVA 4BTUB 3GY5A 1TONA 2C93B 3RXFA 1FN6A 4XSKU 3SHCH 3E1XB 1BRUP 3A88A 5GPIB 1W11U 2FTLE 4D76A 1O5GH 2Z94A 2P59A 1ZTJA 4ZKOU 5DJ7A 4I32A 1Y5UT 1HIAA 3ZZDA 2GGVB 3DSOA 1C1MA 5KECA 4Q63A 3RXOA 1OOKB 1THPB 3URDA 5C1UA 3MNXA 1O3EA 2JETC 4I31A 1YPEH 1RRKA 5F8ZA 2XXLA 5AHGH 1NT1A 3SUGA 4OGYA 3K2UA 1OP0A 1AB9B 4JZIA 3M3VA 2OUAA 4ABFA 3VB3A 1WTHD 2HNTF 4JYTA 1PQ8A 3RXQA 4XBCA 1F5LA 3RM0H 3KQDA 4FUCA 2WYJA 2C4FH 1Y8TA 2Z3CA 4M9FA 3T62A 7LPRA 3T29A 1G3EA 4OS4A 5TJXA 1V3XA 1GDUA 2C8XB 4FUEA 1QJ1B 3MH6A 1XUHA 2BDYA 2W7UA 1E38B 2ZGBH 3MQKC 1DSTA 2QYIA 5JYIA 1SC8U 3UREA 1A5GH 5C94A 1D3DB 3DT0H 2FX6A 3H7OA 1F0SA 1XKBC 1G30B 1J17T 1C5RA 4X8UH 3Q3KA 3TGJE 1L0ZA 1BBRE 2SFAA 3OYPA 2VINA 5JBCS 4OS2A 1YBWA 2JDID 3HGNA 4INLA 4B2CA 1O2JA 1F2SE 1E79D 2BTCE 2PSXA 4U01A 1FN8A 8LPRA 3ELAH 3T2NA 2J4IA 1K1OA 1LTOA 4FUIA 5DG6A 4E05H 6GCHF 2Q1JA 2ZDLA 1WV7H 1ZRKA 1N6YA 3RMMH 1Z8IB 5EXMA 1HAGE 1Y5BT 1P10A 3U1IB 1Z8GA 1FV9A 2V3OH 2YNBA 1EUFA 4ZROA 2O8UA 2OC0A 2ZFSA 4Y7AA 2W26A 2ODPA 2ZDMA 5KEDA 1AGJA 5GXPA 3TNTA 1K1JA 2WSSD 1XX9A 1SGQE 4LOYH 1KXFA 3AVZA 3BTGE 3RXUA 1PPFE 1KDQB 2A32A 5CMXH 1GCTC 3MMGA 2ZCLP 2DUCA 3UWIA 1PFXC 1TNJA 3OTJE 1Z8JB 1FY1A 1BIOA 3KYFA 1EJNA 1GJ6A 2NU1E 2ZTXA 2A4RA 5EW1H 1KXDA 2AHME 2F83A 1ELEE 1GJCB 4Y8XA 4U30A 1BTXA 1GI0A 3KNXA 1O2ZA 1AKSA 2AGIX 2HGTH 2QE7D 2XWAA 4X2XA 5EG4A 5JPMH 3QLPH 4CRFA 2D8WA 2VIOA 1ORFA 1LVBA 4Q7YA 2KM0A 4BAOB 1LHFH 1JRSA 4OGXA 2VIDA 3UOPA 2AMQA 5DPAA 5A8XA 3ZVGA 2CJIA 2EC9H 3M35A 3UR6A 3PM3A 1BHXB 4NG9H 2AMPA 1O3OA 4FXGH 3UNRA 2SGQE 4KELA 1L4DA 5T6GA 2ZFRH 4U2WA 1FY3A 1YWUA 3MNSA 2ZU5A 5F8XA 1O3AA 3EA8A 1UHBB 1K28D 1TFXA 2RA0A 4YOJA 1QIXB 3GDSA 2RDLA 5FBIA 1QCPA 2KCPA 1VJAU 1XKAC 2UUFB 1E1QD 4UONA 5DP5A 4VGCB 3ZV9A 4YXWD 1O5DH 1TWXB 3VXEH 2F9BH 1A7SA 1SLUB 3E90B 3MU0A 2O8LA 3TH2H 2J9NA 1D6WA 3U8OH 4IS5A 1YLNA 1C5XB 2R9PA 1FPCH 5AF9H 4X8VH 3GDUA 3B23B 3SJIA 2JJ1D 3EDXB 2VGCC 4PROA 1OPHB
chains in the Genus database with same CATH topology
2ZEBA 2FYQA 1CGJE 1ZGVA 3ZVAA 4YLUA 5DP8A 2AEIH 5A8YA 4CRBA 2OP9A 5L2YH 3HATH 4NA7A 1HXEH 1W7GH 5FPYA 2ZI2H 4JYUH 4JYVH 1EPTB 5A2MH 3E0PB 2PUQH 1BDAA 3HKJB 2FTMA 1GI3A 1QB6A 5E0JA 1G3DA 3MNCA 3NPSA 2Y80A 5GJ4B 1AVXA 1PQ5A 4AFZA 2G51A 1VITH 1P9SA 3K9XB 1Z71A 2ZDNA 5FAHA 2ZWLH 3SORA 1VITF 1TBRH 3VB4A 4MDSA 1MCVA 4Y8YA 3S7KB 1QBVH 1C5NH 3RC6A 1SHYA 4TY6A 4ABJA 3QGNB 2HPQH 1SVPA 2QCYA 1W0YH 2OCVB 3M5MA 5ABWA 1MTWA 1AD8H 2ZFTA 1YPGH 1MKXK 3UQOA 1P8VC 1HDTH 2XTTB 1P2IA 3PV4A 1C1OA 1O35A 5IDKA 2ILNA 3JZ2B 1K1LA 1TPPA 2HWLB 3F1SB 4ZMAH 4KTSA 3SJOA 1DS2E 4NWLA 1YYY1 3GOVB 1FONA 2A7CA 2P3UB 3U69H 4WMEA 3O8BA 3K65B 1Y3WA 1ESTA 1TIOA 3KL6A 3EAJA 1P05A 3ZZCA 2XRCA 2OQUA 2PTCE 1YPMH 2FI4E 4IMQA 3KQCA 3GY8A 1GJDB 3EGKH 1UVOA 1BA8B 1JRTA 3GY6A 4NA9H 1ZGIA 2JETB 1MH0A 1BITA 4DW2U 3F9FA 3TJOA 3A7ZA 5E0HA 1C5WB 1DWBH 1U6QA 2G55A 1XUFA 1WYKA 3ZYEA 4OS7A 1SGPE 4CR9A 1GBAA 1TAWA 1GPZA 2W5EA 2OC1A 4NIWA 1QRXA 4JK5A 5C2ZA 2BXUH 3U1JB 4DY7B 2J92A 6ESTA 3GY2A 3S9AA 1KLIH 1W12U 1ANDA 1MAYA 1QA0A 1Z1IA 2RA3A 1G37A 1GHZA 5HM9A 1PPHE 1UK2A 4AGJA 2AERH 1C2FA 3SO3A 3A87A 2FIRH 2ALVA 1MU6B 5C1YA 3TJNA 1G32B 1HIAB 4Y11E 1DWCH 2VWMA 3LJJA 1XUKA 1SR5C 2FODA 4GVUA 1KXEA 1HAIH 1EP6A 2PKAA 1P01A 2ZPRA 1SQAA 4UD9H 2XC4A 1WTGH 3MH7A 1SSXA 5A8ZA 1ZZZA 1Y59T 3Q77A 3F9HA 1AMHA 1EOJA 2OTVA 5FCKA 4Y6DA 2ODQA 1BT7A 2FO9A 3P8OA 3A8BA 1ELBA 2A0QB 4ESTE 4BTTB 5E8EH 1IQNA 2UWPA 3AW0A 1V2RT 1C5VA 1DE7H 1Z8RA 2ZU3A 1YPHE 2TGDA 4B76A 2ZHQH 1LHGH 2SNWA 1NN6A 2OQ5A 2QXIA 1MD7A 1VGCC 1GCTB 1GHAF 4TYDA 3NCLA 1O3HA 1GHWH 1ZJDA 1O2TA 4JMYA 1HXFH 1FLEE 3GYLB 3MU1A 4CH8B 2WPMS 3EYDA 1WCZA 3SU5A 3SZNA 1P3EA 4GCHG 2BHGA 2D26C 1OP8A 2FWWA 2HVXA 3KN2A 3LONA 1WSSH 3MYWA 1SMFE 3RC5A 1O3CA 3UPEA 1GMCG 3VGCC 2FOCA 3B8JA 1H8IH 1ANBA 1SFIA 3OY5U 4TWWA 4AZ2B 1J14A 4JK6A 1D4PB 1GI8B 2QC2A 4XBBA 4YZUA 1NPMA 4RSPA 1LHDH 1TX8A 1G9IE 4A5TS 1T7CA 3H7TA 1MKWH 1C1TA 2GP9B 3MU4A 4K8BA 1HGTH 2ZQ2A 3Q3YA 2P93A 4B2AA 1ZRBA 1TRNA 2FPZA 2RG3A 2VIWA 2G52A 3E0NB 5LGOA 2Z3DA 3TJVA 3URCA 4WMDA 1SLXB 1YC0A 2PUXB 4MPVA 3C1KA 2HNTC 4A1XA 3Q00A 3UY9A 1AVWA 4K3JA 5E2PA 2VGCB 4ZKNU 1AKSB 1O5EH 3CS7A 1NRRH 2A4QA 3D65E 3MWIU 5DP7A 1HBTH 1BBRK 1KLTA 2GTBA 2ZTZA 1O5AB 3EA9A 3RXJA 4I8KA 2ZTYA 4ISNA 5GDSH 4CRDA 4WVPE 1D3QB 1B5GH 4LZ1H 3D49H 1JXPA 1EZXC 3GCTF 2Y7XA 1TRMA 3L3TA 4BAQB 1IOEA 1T4VH 2J38A 4YESB 1TNKA 3P8GA 1BOQA 1YM0A 1TRYA 3QWCH 1EZQA 1HAHH 1UVUH 1CHGA 1XMNB 2A5KA 1RD3B 3GY4A 4IMZA 5DP3A 1H1BA 1GBFA 3FZDA 3SJ9A 1O31A 4IW4E 3SU2A 2NU4E 4FU9A 4LZ4B 1AFEH 2VIPA 2K1QA 3UNSA 1LPGB 4IN1A 1FQ3A 4FUBA 1O2OA 2FMJA 3BSQA 3A83A 1YPLH 4MG3A 1W0ZU 2BZ6H 2BMGB 1AZZA 1MTNC 1HLTH 2VVVA 2QXJA 3EQ0H 1V2NT 2H2ZA 3QUMP 1EJMA 3M61U 4KKDA 1RXPA 3RXAA 2O8TA 2LPRA 5EQQA 2QF0A 3SU6A 3U9AH 2XCNA 3S7HB 1QJ7B 4F4OC 2FLBH 3PLBA 5LH8A 3QN7A 1ZPBA 1OWJA 1TOCB 3ZZ8A 2ZU2A 2A2XH 1C1NA 2OINA 1GJ9B 1NU7B 1O2MA 1GBBA 1J8AA 3BTDE 1DY8A 4MVNA 1C5PA 2P16A 1S0RA 3QGJA 2BX4A 2Z9IA 1QJ6B 7KMEH 4ABBA 3MFJA 3STJA 1OSSA 1V2QT 2EI7A 3ZZ9A 1LVYA 1S5SA 2BVRH 3LGTA 1HV7A 9LPRA 4Z6AH 3LC5A 1BTHH 1ETSH 3W94A 1A4WH 1IQKA 2VVCA 3S0NA 9ESTA 1EATA 2FZZA 2VU8E 3TPIZ 5A0BA 1HFDA 3FANA 3KIDU 4AFSA 4K2YA 1ZPCA 2GDDA 3A80A 3ATLA 4Q7ZA 1IQEA 1GGDC 3FFGA 1FY8E 4ISHH 5H4IB 3F68H 3RU4D 4BOHA 3A8DA 1RTFB 1W8BH 1NRNH 1PYTD 3SNCA 4BANB 5T6FA 2BD8A 1C1PA 1T8OA 3UNQA 1N1LA 2R0KA 2GV7A 4X2YA 4CREA 4INHA 3E3TA 3SGQE 1YCPM 2RCEA 4GAWA 1G3BA 1CA0C 1HJ9A 1O33A 1ZLRA 2SNVA 2Z7FE 1MZDA 1ZSJA 2BD2A 1O5BB 1ELFA 1K1IA 7GCHF 1VCWA 1O2VA 1WU1A 1UJ1A 2PHBA 2BDIA 3MO9A 4R0IA 5E2OA 4H6SB 1GHYH 1SGIB 2HLCA 3RXCA 3KEEA 2IPHA 3ODDA 3CENA 1TBZH 3NWUA 2VB0A 1BCUH 3RXPA 2XCFA 1X7AC 1ZOMA 3M37A 4YOGA 1UTLM 1WAYB 3BTME 4J1YA 1HRTH 4TWYA 3V7TA 1ZTLA 2ZU4A 4I8JA 4I33A 1GJ7B 2JH6D 4IN2A 2ZCHP 5EODA 2SGEE 3P92A 5JBTA 4B71A 3RUOA 2BY6X 1Y3UA 4MNXA 1GHAG 3PWBA 1GJ8B 2ZNKH 1H4WA 2A2QH 1PJPA 2WYGA 1V2KT 1S82A 3SNDA 4WF8A 1F7ZA 1T4UH 2CMYA 3BTEE 2EI6A 1EX3A 1O3MA 1C4U2 4X1PU 1GHVH 5DKMA 1GMDG 1C5SA 1EZSC 1ABIH 2BY9X 3PB1E 2BLOA 2F9VA 1P02A 1ZTKA 1K21H 3ZZ4A 1H9HE 3KHVA 1GCDA 1S81A 1YGCH 2PKAB 1P03A 4NA8A 5I46H 1P2OA 4WH8A 1ZMNA 1GDNA 3TVJB 2BM2A 3GCOA 3HPTB 3SU1A 1XVOA 5DP9A 4MPWA 1V2UT 1QQUA 3VB7A 4XDEA 4GLYA 4HGCA 5J4QA 2V35A 2ZECA 4FUFA 1C5QA 1GBIA 1UCYK 4HZHA 3HK3B 1MTVA 1TALA 1Z6JH 1AHTH 1P2KA 1AU8A 2GT8A 1BQYA 1BTZA 1ZHMA 2LNCA 2PFEA 1Y3XA 4D7GA 3E16B 2VNTA 1CBWC 1O3DA 4XE4A 1O2PA 4AFQA 3MO6A 4KP0A 3GYMA 4CRAA 1MMJN 1C5OH 4CBNA 1O2SA 4ISOA 3FP8E 4GCHF 2BDHA 1MUEB 2J95A 2QF3A 2GT7A 4WH6A 1KXAA 1C2HA 1GBMA 4A7IB 1KXBA 1OYQA 2H9TH 1ACBE 1QRWA 2FESH 1QY6A 3AW1A 3NZIA 4HI3A 4X0WU 5FXLA 1CT4E 2D2DA 1V2ST 3VFEA 1GMCF 3QZRA 3UR9A 2R3UA 3QDZB 4OS6A 1PQAA 3GCTG 1SGRE 1ZSKA 4NGAH 1Y3VA 1YCPH 3OY6U 2H6MA 1A61H 3GISB 4TPIZ 4K8YA 4I8HA 1D3PB 4AG1A 2V3HH 1A0HB 1GI7B 1TGSZ 1RFNA 4X8SH 4E06H 3RXDA 1T8LA 1EKBB 1VCPA 1MQ6A 1DWDH 3RXVA 1JWTA 1P2QA 4Y7BA 2CN0H 2GZ7A 5T6DA 5FPSA 4B75A 4Y79A 1KLJH 3GCHB 1EB1H 1GI5A 3T28A 4QT8C 3TIUA 3LT3A 1PPGE 1K1PA 3UWJH 2FOFA 2WPLS 3A81A 1OWDA 4KGAA 2C8ZB 4H4FA 1AVGH 2AYWA 4NZLA 1MTNB 1SBWA 2YOLA 2OD3B 2VWOA 4B74A 2PGQB 4BNRA 3RMOH 2QAAA 3LGIA 2FOMB 1QTFA 1QFKH 4FVDA 1ARBA 4UFFH 3DUXH 5K0HA 2BD4A 1RGQA 1O3LA 4YOIA 1K2I1 3ZZ6A 1P2NA 1G2LA 3LGYA 2AIPA 3RXLA 2Z9KA 2UUJB 2Z9JA 1XXDA 1O2XA 1N8OC 3PYHA 2BZAA 3OSYA 1QB1A 2GCTC 4K1SA 1E36B 4ABAA 1Q31A 5K7RA 3SUDA 3A8AA 3A7TA 2WV5A 3LGVA 3ODFA 1TGBA 1A2CH 1UO6A 1C2LA 1P9UA 3B9FH 3PROA 3SV7A 1BMAA 3RXSA 1GBJA 2GCHG 3M5NA 2ESTE 3SU3A 3OU0A 1T31A 3O8RA 1UTMA 3MH4A 4MTBA 1IQFA 1O39A 5HXFA 1FDPA 2ASUB 3DFLA 2R2WU 1C1QA 1GGDB 4FUGA 2BDCA 3SW2B 1HCGA 2P94A 1EASA 4MQAA 1AO5A 2VH6A 2FOEA 3P8FA 2PR3A 3RMNH 2QIQA 1ELVA 1OKXA 4JZ1A 3ZVFA 1S6FA 4X1QU 3KCGH 3DHKH 1OS8A 1QBNA 2R3YA 1MBMA 2HRVA 4X1SU 2ZHWH 3P70B 2AS9A 4D9QA 3RMLH 2FS9A 2SGFE 3L33A 1DM4B 3HK6B 7GCHG 4X6NA 1CA0B 1JMOH 1SGFG 4AYYB 2XC0A 3M5LA 4KTCA 1C1VH 1C9TA 1SHHB 1SI5H 3S69A 1ANEA 1AFQC 2ZGXH 1O2KA 2C8WB 3SU0A 1RIWC 1V2MT 3SNEA 5EQSA 2BLVA 3PMJA 4THNH 1IQMA 5JBAS 3SNAA 4KTUA 2ZIQH 4K1EA 3ZVCA 1O2UA 1C1SA 1HAXB 1NO9H 1UCYE 1GBKA 3M3TA 1F0RA 3TJUA 3BV9B 1CSOE 1C1UH 1GHXH 4YM9A 5I25A 5CHAC 2YNAA 1NM6A 1KSNA 4FU8A 1J9CH 2QV1A 3E8LA 3T5FH 1O3GA 5EU8A 3U8RH 2Z9LA 2XBXA 4B73A 1O2WA 4ABIA 4X6MA 2B7DH 1EXFA 4FUHA 1OX1A 1SGDE 3ENSB 1ZMLA 1AQ7A 1O2HA 4K60A 3UTUH 1Y5AT 1CT2E 4ZXXH 1BRBE 4GUXA 3ATKA 1CA8B 1Z1JA 2I6SA 4NZQA 2ZU1A 1FMGA 3PMAB 1AI8H 1T8MA 4NIVA 3ATIA 3A82A 3S9CA 4SGAE 3RXRA 4Y76A 4DT7B 1XUGA 1UTOA 3ZYDA 2GKVE 2STBE 2BD7A 1MZAA 1NY22 2CF9H 1GBHA 1TA6A 4O03A 1TA2A 3A7WA 2EEKA 2FOAA 2XBYA 3HKIB 3RU4E 3QZQA 2A31A 3MH5A 1O30A 1T8NA 4INKA 2AGEX 3A86A 1E0FD 3FZZA 2TGTA 5ESBA 1P57B 5FHTA 6LPRA 1NZQH 1SGFA 1VR1H 2GV6A 4I8GA 2G8TA 1PPEE 1HAPH 8GCHG 8ESTE 2P3FH 4AORA 2WPKS 5J4SA 1GMDF 2PWXA 3Q76A 4AN7A 3AAVA 1QGFA 1SGCA 2ZGJA 3P17H 3WY8A 1SLWB 3I77A 1L4ZA 4YT7H 3ZZ3A 1O2LA 3T27A 2R0LA 1C5TA 1TPAE 3PMBB 1UVSH 1V2LT 1KY9A 1WOFA 1SLVB 4CBOA 1W3CA 3TLOA 4BAKB 3C27B 4AFUA 4A6LA 3P6ZB 4XFQA 1UVTH 1GHBG 1GL1A 2V6NA 3AAUA 3JZ1B 1GBCA 5C5NA 1IQHA 4DIHH 2B9LA 1SL3A 1HAVA 1C1WH 3K6ZA 5A0AE 3T25A 3MU5A 5F8TA 1GI6A 2AGGX 1DANH 3R3GB 1O5CB 2ZHEH 1O5FH 1FI8A 1N6XA 2O8WA 1TE0A 2ZQ1A 1IQLA 3STIA 4AB9A 2FDAA 4OS5A 3V13A 1ZYOA 1P06A 2BOHB 2IN2A 4O3UA 4CR5A 1EJAA 1UTQA 5LPRA 1O2QA 4E7NA 5A0CA 2H9HA 5AFYH 1C2MA 4WMFA 2J94A 4Q7XA 2BD5A 1BUIA 3ATMA 2BY8X 2TGAA 3O8DA 3LIWA 1GJAB 1J16A 4FUJA 2AFQB 2R2MB 1C2IA 1QR3E 1DT2A 1AN1E 1YPKH 2PLXA 2ULLA 3K6YA 4AX9H 2GX4A 1ELCA 4X1RU 5EGMA 2QN5T 3ZZBA 1RJXB 2KAIA 2G4UA 4DJZB 2UUKB 4ZHMU 1QURH 4R8TB 2FI3E 2TGPZ 3RLWH 4CRCA 3LOXA 3SQEE 1GDQA 2FP7B 2Y82A 2WINI 5FX5A 1A3EH 3RU4T 1E35B 3VB6A 1A0JA 1C5YB 4Y8ZA 2H5DA 2ANWA 1SQTA 1H8DH 2CGAA 3L6PA 2HNTE 6CHAC 1EOLA 1GI9B 1P09A 4ZXYH 5L6NH 1NRQH 4ABDA 2A4GA 4WJG2 1AUTC 1EB2A 1Q3XA 2BB4A 1FY4A 3GICB 5EPNA 2GD4B 1O3KA 3BIVH 1N8OB 1DOJA 5C3NA 1MU8B 2XWBI 1V6DA 1LQEA 2GCTB 1C9PA