1C9PA

Complex of bdellastasin with porcine trypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of the complex of the antistasin-type inhibitor bdellastasin with trypsin and modelling of the bdellastasin-microplasmin system.
pubmed doi rcsb
source organism Hirudo medicinalis
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9pA02
1S0RA 4IN1A 3M61U 1ZMLA 4E7NA 2BQ7B 1ANBA 2G5VA 1F0RA 2FLRH 1WCZA 3C27B 4WXVA 2BYAX 3NK8A 1THRH 3LGTA 1TABE 1HXEH 1O2MA 2PGQB 3BG4C 1G32B 3ATWA 3A8DA 2VVVA 1DLEA 4YZUA 1XXFA 2BLOA 3P8OA 4FUBA 1GBBA 4KP0A 5HM9A 4ZMAH 1PQ7A 1L1GA 2BDAA 4FVBA 3TK6A 6ESTA 4E7RG 4Q7ZA 3M5LA 4FUIA 4ABDA 2ZA5A 4U2WA 3SUFA 3RC5A 2J34A 3P6ZB 1A5IA 4GVUA 1S83A 2FZZA 4WVPE 1S82A 3K65B 1DXPA 2Y82A 3LT3A 3E3TA 1WTHD 2EC9H 5A09A 1C4Y2 1ID5H 3CS7A 2VJ1A 1V2OT 1SGDE 2AIQA 2WPJS 1A7SA 4Y7BA 3TPIZ 7LPRA 1KXBA 1LKAA 8GCHG 3LH3A 1G30B 1K1JA 1O2NA 4BOHA 3A86A 1FN8A 3HGPA 1EZSC 3LJJA 2GMTB 1QCPA 3SOSA 4D7GA 2GCHG 1HGTH 1F0UA 2FI3E 2H5CA 2QYIA 2SGFE 1CE5A 1JIRA 4AYVB 4INKA 2V6NA 5FX5A 4TYDA 2VNTA 1HCGA 2BY7X 4NFEA 2AGEX 3SO3A 1EOLA 5GCHF 5AVDA 2STAE 2JKHA 1FLEE 3LPRA 1O2HA 4RSPA 3N7OA 1PPHE 3SUEA 1YPGH 4LOYH 1EXFA 3UUZA 5F8TA 1ZGIA 1TBRH 2ZFRH 4MVNA 1MTUA 2TBSA 5I25A 1YCPK 1CGIE 3BTKE 1V2MT 1ZMNA 2GZ7A 4ZKNU 1L1NA 1QIXB 3MU0A 2SGAA 2YOLA 2D2DA 1LHGH 4MDSA 4UD9H 3U1JB 1THPB 1O36A 1V2PT 1UK3A 2QXGA 1KXDA 1T4VH 5CE1A 1XMNB 5H4IB 1PPEE 3KF2A 1TGSZ 4AG1A 1MD8A 4X6OA 1GMHG 3KEEA 2HNTC 2Z94A 2A2XH 2Z9KA 3VGCC 6CHAB 1NROH 1TPSA 3C1KA 1SLVB 4VGCB 5HXFA 2TGPZ 4BAHB 1ETRH 2W3KA 3JZ2B 1SL3A 2QXHA 1O34A 1Y8TA 1G3CA 3LGVA 1YPLH 1EAUA 4NA7A 1GL1A 1O2OA 1P2NA 2G00A 1QQ4A 1K2I1 5A0CA 2P95A 4UFEH 1EJNA 2CGAA 1CBWC 1C1TA 1ZRKA 2RA0A 3SV9A 1VGCC 1TNJA 1QFKH 1TLDA 1T8MA 3EYDA 4I8HA 1XVMA 1O3MA 5JBAS 4O3TA 3MO6A 1W2KH 3A8BA 1KXEA 1MMJN 2A1DB 3SN8A 3T28A 2ZNKH 5LPRA 2F9VA 1HRTH 3QO6A 1O3CA 2XC4A 3M5OA 5DG6A 4CH2B 1YPMH 4H6SB 2BVXH 1XUKA 1AWHB 1IQGA 2ZU3A 2XC5A 1O39A 2OC7A 1TA2A 3LONA 3M7TA 3GCHC 2FP7B 1TGNA 4K5ZA 2OD3B 4JZEH 3K6YA 4NZLA 3KL6A 4NIXA 4X0WU 3PMBB 3BG4B 1O3HA 2K1QA 1LVOA 1CT0E 3S69A 1UJ1A 2BX4A 1GBHA 1G3DA 2XC0A 5FBIA 4ESTE 1CO7E 5FXLA 2G51A 5J4SA 5FBEA 4K3JA 4D9RA 1HV7A 2ZDVH 3MWIU 5AFZH 2BDHA 2J2UA 1F5KU 3RUOA 1FY8E 3GCTG 1FAKH 3UIRA 3R3GB 1W8BH 2J94A 3R0FA 5FPSA 3RXCA 1JRSA 2FYRA 3GYLB 1GJDB 1MU6B 2DE9A 1SGCA 4AZ2B 2BTCE 4TPYA 3A7YA 2R0LA 1CA0C 2QN5T 3H7OA 1T8NA 3PO1C 4DOQA 2ZU2A 2PSXA 1ZTKA 1AIXH 1OKXA 3ZZDA 3ZZ4A 2C93B 4AGKA 3S9BA 2HPPH 3ZV9A 1BTPA 2J4IA 3UNRA 1BTYA 2PR3A 4I32A 1C4U2 4LZ4B 2BDGA 1BITA 5L2YH 2W5EA 1ORFA 4ABHA 2B5TB 1C5RA 3P92A 5F8ZA 2PLXA 1ZHMA 3TK5A 2LNCA 2XWBI 1B0EA 1RJXB 1YLDA 1KTTB 1LPZB 4Q7XA 2BY5X 1GI1A 1F92A 1IQKA 5PTPA 1OWKA 3AAUA 1MD7A 3HKJB 3RU4T 1AMHA 2IOTA 1TMUH 2ZPQA 3QTOH 2VWNA 3VB3A 1EP6A 3MNCA 3ZZ6A 3TGJE 2Z7FE 3MH7A 2FLBH 4UE7H 5LPFA 2KAIB 1DDJA 2AMDA 2AIPA 1EOJA 1O31A 1V2LT 1TALA 1IHSH 1PQ8A 5EQQA 1ETTH 1AE8H 1C1PA 1Y5BT 2SFAA 1MCTA 3QZQA 4ZXXH 5FAHA 2OUAA 2ZU1A 1CHOF 1TFXA 3EE0B 3ZZ5A 4BAKB 4B71A 5L6NH 2O8UA 2Y7XA 3LIWA 2ZI2H 3NPSA 3ZVFA 1BZXE 1JBUH 1O5AB 4GPGA 1H4WA 4CRCA 2BDYA 3RXIA 1XVOA 3PB1E 4Y8YA 2A45B 3ZZ7A 1SGIB 4PROA 3RXAA 3MU8A 4CRGA 3T29A 1DWBH 4YT7H 1VJ9U 1XX9A 4DG4A 1GCDA 3QDZB 1LKBA 8KME2 1QBVH 2P59A 3TJVA 2F9NA 7GCHF 1L1JA 1A1RA 3LGIA 1GI4A 1ELDE 3NWUA 1BJVA 2EI7A 1IQNA 2P93A 1Q3XA 4GLYA 4ZAEA 2CXVA 1P3CA 4K69A 5GIBA 3SZNA 3DD2H 1OPHB 4ZHAA 4XDEA 4I8LA 1UK2A 3UQVA 1JRTA 5FHTA 1GHXH 3LGYA 2FYQA 3PYHA 3GISB 1LVYA 2A4QA 1NFWA 1Z6JH 3NCLA 2ZGHA 2WV5A 1N6YA 2GV7A 4D76A 3RU4E 4WF8A 3S0NA 1K1OA 1J17T 3LU9B 3GCNA 1H9LB 1A0JA 1GHBF 3GCHB 2HNTE 3IG6B 1GHAG 4DJZB 2WUCA 2FESH 1TWXB 1BMMH 5C5OA 1NTPA 1HPGA 2VWLA 1D4PB 1ZLRA 1SGNE 1GBEA 2VIVA 1TONA 2A31A 1AZ8A 4NIWA 1UHBB 1E0FD 1HAVB 2HGTH 1DLKB 2B8OH 2ZDKA 3M3TA 2C90B 1L4ZA 4FXGH 2FOCA 4HTCH 2ZF0H 3SUGA 1IAUA 1SLUB 3RXOA 5IYTA 1GMDF 2Y7ZA 3SHCH 4JZ1A 2QC2A 2OBQA 5AHGH 2BD9A 3TGKE 4Y11E 3WY8A 1TBQH 2A5AA 4AFSA 2WYJA 4YO9A 1Z8IB 1CA0B 3BTEE 4YOGA 2OTVA 3O8BA 3PO1B 3GDVA 4BXSA 1G2LA 1ZPZA 2B9LA 2VGCB 1RGQA 4AFQA 2FIRH 4A7IB 6GCHG 2OLGA 4D9QA 4ABGA 3E0PB 4XBDA 2A7HA 3E91A 2VH6A 3QWCH 3U8OH 1D3QB 3EA9A 1DOJA 1P12E 5JBCS 1PFXC 1TQ0B 1GBLA 1GWAA 3PLPA 1QRZA 4UONA 4X1NU 4FVDA 1C5UA 4JZDH 4FUGA 4YOIA 1AFQC 1AQ7A 3Q76A 2SGQE 1MKWK 1QRXA 4M7GA 1ZR0A 4O9VA 2VH0A 1J16A 1YM0A 1FQ3A 3F9EA 1RFNA 5GJ4B 1C2JA 2GCTB 1YBWA 4XE4A 4Q7YA 2ZFFH 1AU8A 3KQDA 2FOHA 2SNVA 1GVLA 3FAOA 1ACBE 1O3DA 1O5FH 1Z6EA 1FUJA 4B74A 1BTHH 3VPKA 1O2WA 2WINI 4TY7A 5A8ZA 3O8RA 2P8OB 3SUDA 1W13U 3LH1A 1J15A 1ZPBA 4AFZA 2D8WA 4X2XA 2H6MA 3ZZ8A 1ESTA 1HBTH 1YPHC 2BY8X 2ZEBA 4NZQA 3MI4A 4XOJA 1TPAE 5K0HA 1DITH 3RXBA 3ZVEA 3L3TA 5EQRA 1W7XH 1UTPA 1W11U 4TPIZ 1ETSH 1DICA 3EDXB 2BY9X 3A7TA 4Y0ZE 4KTSA 5GPIB 5HM2A 2FWWA 1EZXC 1LCYA 5T6FA 5EXMA 3QLPH 1NRRH 1QURH 3SU5A 1KLIH 1K1NA 1HAHH 1Y3YA 1A61H 4KKDA 7KMEH 2J92A 1VCWA 1Z7KA 1NU9A 1SFQB 3TH4H 3SHAH 1GVZA 1NRPH 3GY4A 2W7UA 1OP8A 4O97A 3PV4A 4IN2A 4GUXA 1Y3VA 1B5GH 2G4UA 1YYY1 4FUJA 4H6TA 1EATA 2FS9A 2BOKA 1RD3B 2PTNA 1OS8A 1G2MA 2FPZA 3TK9A 3SV7A 1GBFA 3A82A 2ZC9H 3KIDU 4K8YA 1GBDA 1TGCA 1ELEE 1UTMA 1C1VH 2G52A 3FVFB 3OSYA 1O37A 1EP5A 5GWZA 5C20A 4YLQH 2WPIS 4X1RU 2ZU4A 1ESAA 3QK1A 1P02A 3HKIB 4GCHG 3RLYH 1S6HA 1TNKA 3LC3A 2PKSC 2G81E 3LOXA 3VXEH 1LQDB 1C5OH 2YNBA 4MPWA 1NM6A 4AB9A 1Z8JB 2XW9A 1GHYH 4DURA 4Y79A 3SW2B 1GI8B 3RLWH 1EPTC 1OWDA 2J9NA 4IMQA 4WH8A 4R8TB 3LC5A 3MU1A 1ELCA 4X6MA 3G01A 4JZFH 3RXTA 4AORA 1Z8RA 4ZXYH 2P3UB 2D1JA 3O8DA 3V0XA 4AN7A 1SFIA 2WUBA 2XXLA 3L6PA 1G3EA 1HIAB 1V3XA 1D6WA 3PLBA 4CREA 1AN1E 1ANEA 2XBYA 4O03A 3LGWA 3BTTE 3SU6A 1DUEA 3P70B 2GP9B 1C1UH 3VFEA 3MH4A 4DVAU 4B1TA 1D6RA 1AUJA 3E16B 3K9XB 1AFQB 2VIQA 1P2OA 1FV9A 4Y71A 1UTNA 3S9AA 4BAQB 3CS0A 5HMAA 1SOZA 1WU1A 1VITG 1UHBA 5JB8S 2CF9H 1TGBA 3DT0H 4IMZA 4AFUA 1SHYA 1HAVA 1C2MA 3CP7A 2VVUA 1Z1IA 3RXDA 5E8EH 3AASA 1DS2E 1V2VT 2OXSA 2UUJB 1EAIA 1GHZA 1Y5AT 3T25A 3RM0H 2BDBA 2O8LA 3V13A 4MPUA 1C5TA 1KTSB 1BJUA 1C1MA 1C5PA 4F4OC 1X7AC 1FIZA 4YT6H 1A3BH 3RXHA 2B7DH 1G36A 3BG8A 1GJAB 1H8IH 2PV9B 2UWPA 2H9EH 1ARCA 1UVSH 2GV6A 2M5TA 5FX6A 4OS1A 1VR1H 1QY6A 3A7WA 3QX5H 1BMAA 5FCRA 1QR3E 3URCA 3BN9A 1GBAA 2OQ5A 1W12U 2C8XB 1ZPCA 2ILNA 2ANWA 1TPOA 2P94A 4Y10E 4K8BA 4NWKA 3SNEA 2TGDA 1AKSB 1GJ9B 2OC0A 1SGQE 1F0TA 1HJ8A 1OWEA 1SLXB 1SLWB 1IQHA 1HJ9A 5GXPA 1O2XA 2ALVA 1LHCH 1T4UH 3RC6A 2FOFA 3MNXA 3RU4D 1YLCA 4ISIH 5TCCA 1O3BA 5DP7A 5IDKA 3HPTB 4X1PU 1O5BB 8GCHF 1K21H 1P2KA 1TX6A 3FZZA 1GBKA 1SGRE 1GJ4H 2ZGBH 4BNRA 4DT7B 1UVOA 1ELBA 5E0JA 1UCYH 1ZYOA 4K2YA 4X2YA 2GZ8A 3OYPA 1V2ST 4K60A 1YPHE 4IGDA 1SVPA 3I29A 1O3PB 2DUCA 1TRMA 2BZAA 1HAOH 1DUAA 1AVGH 1WTGH 5ETXA 1A5HA 3SJKA 5JDUB 2UWLA 1A3EH 3E0NB 1SI5H 2PGBB 4XBBA 1O0DH 1TNHA 2ASUB 1O32A 1HAPH 2XBXA 5EU8A 2F9OA 1T32A 5HGGA 3GY7A 2Q6GA 3EA8A 2BXUH 1RIWC 4E05H 1AB9B 2AEIH 4NGAH 4LXBH 4IW4E 1ZZZA 3GDSA 1MQ6A 1DWCH 1FJSA 1WBGB 5F03A 3RXGA 4FUDA 2ESTE 2QF3A 1CA8B 1GMHF 3BTGE 3OX7U 1J8AA 1JOUB 4X1SU 1C2FA 5ESTE 3B8JA 1C5YB 2QV1A 1W14U 1Y59T 3TH2H 3Q3KA 2BQ6B 1NRNH 1FAXA 3A83A 1C1RA 3RXMA 1O2QA 1HFDA 1WOFA 3VB5A 2A32A 2ANKH 2GKVE 1OYQA 2BDIA 4CRBA 2UUFB 1MTNC 2CN0H 1JWTA 3SV6A 2STBE 3MHWU 3A80A 3GYMA 1SQOA 1C2KA 4K1EA 4HI3A 2AGIX 3SQHE 2Q6DA 4DY7B 3ZYDA 3GOVB 1FY5A 1WYKA 1C1OA 3K2UA 2UUKB 2QIQA 1UVPA 1C2DA 5C67A 1ZOMA 4QT8C 4CRAA 1SHHB 1O38A 2BB4A 2PKAB 1CHGA 1FONA 4BAOB 1C2LA 1YPKH 1SGFA 2ZHWH 2XRCA 1KLTA 1TNIA 5LH8A 1CU1A 1SMFE 2BVRH 3L33A 1K1LA 4A6LA 2ZPSA 3AVZA 3HGNA 1LO6A 2SGDE 3RMLH 2TRMA 1OXGA 4CBNA 1BBRH 4OS6A 1FIWA 3TJOA 3VB6A 4AYYB 3UQOA 3BTFE 4MG3A 5DP6A 1HIAA 2C8YB 1QB6A 2FODA 2FX6A 2XTTB 1GDUA 2ZFTA 3SJ9A 1SGFG 1P05A 1KLJH 2AH4X 2ZDNA 1DXWA 1HAGE 3ZVGA 1EJAA 1U6QA 1HUTH 1DM4B 3A85A 1ANDA 3MO9A 3RXPA 3GCTF 2BLVA 1BDAA 2AS9A 1Q31A 1MBMA 1O2RA 4D8NA 3DFLA 1YPJH 3TH3H 2UWOA 8ESTE 2RDLA 2Y6TA 1BTZA 4JYVH 3FANA 5DO4H 1TAWA 2ZDMA 2Z9LA 4INHA 1AGJA 1C5LH 4GHTA 4X8TH 1O2ZA 1GDNA 1MH0A 3RMMH 4GSOA 1CHOG 1IQEA 1S5SA 2P3TB 1BIOA 3MU4A 3EGKH 1G3BA 1AWFH 3QTVH 1F7ZA 2AGGX 3VGCB 4IC6A 2AERH 3OU0A 5EW1H 4Y7AA 1MTSA 2CMYA 3SU0A 2F3CE 1ZHRA 3KQEA 1ZMJA 2IJOB 7GCHG 2FO9A 2FOMB 4I8KA 3H5CB 4DGJA 1TQ7B 1IQFA 1QHRB 3T2NA 1V2RT 1GI2A 5A0BA 2I6QA 1TRYA 1FPHH 1O2IA 1O2TA 1C5MD 2ZTZA 1YCPH 3GY3A 1AKSA 2ZPRA 1CBWB 1MTVA 3DA9B 1AVXA 1YP9A 3ZVBA 4X1QU 1VGCB 1A2CH 1CGJE 3SGBE 3EA7A 1DWDH 1O2SA 2NU1E 1OSSA 1OX1A 1DFPA 4B2BA 5L2ZH 2FS8A 1OYTH 2F91A 1AO5A 1ABJH 1MZAA 3P8NA 3B23B 3TNTA 2R3YA 4WWYA 3K6ZA 1SGEE 4BANB 1ZJDA 2NU4E 1QB9A 2ZFSA 1FNIA 1GMCG 3QN7A 2ZGXH 5AF9H 1MTNB 4UFGH 3AW1A 1WUNH 3LJOA 3MFJA 4JK6A 2ZFPH 3A7XA 1A5GH 1QA7A 3CENA 1KSNA 2BHGA 4OS4A 5EG4A 3MNBA 3M5NA 2FOGA 4O3UA 3TJNA 3UNQA 2YNAA 1NFUA 4IC5A 1F2SE 2FTMA 4A1VA 4ABFA 1H8DH 3M5MA 4CHAC 5DPAA 3RMNH 4OGYA 3ATIA 3H7TA 4I33A 2VIDA 1GMDG 1TYNA 1XXDA 2HVXA 1PPCE 1C5SA 3U8RH 3UOUA 1EB2A 3VB4A 2ANMH 3IWMA 4WY3A 1C2GA 2AMQA 4RKJB 4WMFA 1TPPA 1LMWB 2OINA 4HFPB 2G8TA 3IITA 4SGAE 1P9SA 4OS2A 1QNJA 2GT7A 1E37B 2QAAA 3T62A 4ABIA 1O2VA 3ODDA 1QQUA 1SG8B 1V6DA 1XM1A 2OQUA 4CBOA 1IQIA 2PW8H 3S9CA 5HYOA 1BTXA 1UTLM 2TIOA 2ZWLH 1O3OA 3A89A 2Y81A 2PUQH 1D3TB 4IBLH 4Y76A 4XSKU 1Y5UT 1BRAA 1PPBH 4NIYA 4AOQA 5K7RA 1QJ7B 1MAXA 4X2WA 2ZHQH 4Z6AH 1ZRBA 4B76A 3PMHB 2P16A 1E35B 2HALA 4MLFB 1K1IA 1KYNA 3KQBA 1VCPA 2IPHA 3RXSA 1MKXH 1DVAH 3NZIA 5E0GA 1SPJA 1FZZA 2XBWA 4X8SH 2SGPE 2V35A 1QJ6B 1GJ8B 3MU5A 1ZTJA 3SQEE 3URDA 3SJOA 1P09A 2Z9IA 2PKAA 1LTOA 2AFQB 1RXPA 4JCNA 5C1UA 1DANH 1P3EA 1ELGA 4B75A 5DP8A 1ABIH 4OS7A 2F9BH 1LVMA 3HK3B 3A81A 3EQ0H 3QGJA 2PHBA 3KCGH 4ZROA 3SU3A 1CVWH 1TB6H 1DY9A 4ZKRU 5T6DA 1GCTC 1MQ5A 1NT1A 4CRDA 3UTUH 1VCQA 2JH5D 1GBMA 2Z3DA 1QTFA 1RTKA 1MAYA 4GAWA 1P0SH 5EQSA 3A87A 1O3IA 2FEQH 2O9QA 3GY8A 3RXRA 5G4BA 4FU7A 3A8AA 2GZ9A 4MNYA 2ODQA 5BRRE 3Q00A 2TPIZ 4MPXA 1ESBA 3P95A 1GPZA 3MOCA 1GG6C 3BIVH 2R3UA 1UK4A 2QCYA 1P2QA 1QL9A 2GMTC 3ZZCA 2FX4A 2ULLA 1HJAC 1K9OE 1C2IA 1WV7H 1FY3A 1NRSH 2RCEA 1C1NA 1PJPA 1RRKA 1VITH 4BTUB 3M7UA 1GHVH 5LGOA 1HDTH 3RXUA 1BTUA 3V12A 4XFQA 4Z0KA 3UREA 1K28D 3UOPA 1DSUA 1L4DA 5C1XA 2NWNA 1O5EH 3KNXA 3SV2H 5EW2H 4SGBE 2FMJA 3T5FH 1IOEA 2BD4A 2Z6BD 4MNVA 2FDAA 1P10A 1A46H 3KGPA 5C5NA 4X6PA 3Q3YA 2DE8A 4YESB 1KXCA 3SV8A 4ZH8A 3FP8E 1BTWA 1MBQA 1KIGH 4BTIB 4WMDA 1TOMH 3ZZ3A 1EKBB 4DIIH 3RXLA 1ARBA 4FUHA 3BTQE 5EPYA 1UVTH 3RDZA 4FUCA 3I78A 4DCDA 3ELAH 3FP7E 1H9HE 4ABAA 4U01A 3UWIA 1Y3WA 1DE7H 4X8UH 4ZHLU 2O8MA 4KTUA 1SBWA 1W7GH 3SJIA 6CHAC 2FOEA 1K1MA 1PYTC 3SBKA 1C5VA 1EAWA 4ASHA 4GCHF 3DHKH 3ITIA 1Q2WA 3ATLA 1NFYA 2P3FH 1K1PA 1V2UT 3ZVAA 1AVWA 3M35A 2ZO3H 1XKAC 3M3VA 5C2ZA 1XUHA 3PWCA 3ZZBA 2HNTF 3RXKA 4ZKOU 2JH0D 1P04A 3ESTA 5DP3A 3GY6A 3SI4H 1ZSKA 1UCYE 2A7CA 1D9IA 2J38A 3HATH 4J2YB 1J9CH 2EI8A 1O3FA 1C1SA 2Z9GA 3PMJA 2EI6A 2AYWA 1ZSLA 1EZQA 1GBJA 1MZDA 3RXQA 1BBRK 4DW2U 5A2MH 3U69H 1O33A 4JYUH 3PMAB 1MCVA 2BX3A 1ELFA 4NA9H 5FCKA 2TGTA 1AFEH 4ABJA 1WSSH 1P57B 1VITF 1O2UA 2BLWA 1BHXF 1GCTB 1BRUP 3U1IB 1EAXA 1W0ZU 5CMXH 1C2EA 2A4OA 5FPYA 1MKWH 3AAVA 4I31A 5ESBA 3RXEA 1UO6A 1CT2E 1Y3XA 4H4FA 5GCHG 2CJIA 2ZZUH 2WYGA 3GCOA 2VWOA 4INLA 2W7SA 1W10U 2V3OH 1RTFB 1SC8U 3SNBA 1N1LA 2A5KA 2GX4A 5EGMA 3TJUA 4JYTA 3PROA 5C3NA 3M7QA 3Q77A 4FUFA 1GJ7B 3F68H 1C5NH 3F9FA 3ZZAA 2F9PA 1SSXA 1GG6B 3SU2A 4UFFH 3MNSA 8LPRA 1HJAB 2Y5HA 4NWLA 1V2TT 3MO3A 3ZVDA 4CRFA 3O8CA 2ODPA 4NA8A 4UFDH 1OWIA 1FN6A 4I8GA 2PFEA 2ZHDA 5AFYH 5BPEA 1XUJA 5EOKA 1GI6A 1GBIA 2GCHF 2QGRA 1GGDC 2RA3A 1GHWH 2H2ZA 4YM9A 1O35A 1FMGA 3T26A 4ISNA 4WH6A 2BZ6H 1A0LA 3E90B 5DJ7A 3QUMP 3UWJH 2ZHEH 1C2HA 3U8TH 2PKSB 1O3LA 1AD8H 3M3SA 4YLUA 3S7HB 9LPRA 3DUXH 4AGJA 3ATKA 1B7XB 1EJMA 3QGNB 1O5DH 1BCUH 3SORA 2R0KA 1O3AA 1BBRE 1EPTB 1JXPA 5C1YA 2HWLB 3F9HA 2BMGB 2BQWB 1GL0E 3BIUH 4KGAA 1D3PB 1E34B 4ZHMU 1HB0B 1F5LA 2R2MB 4WMEA 1AY6H 1KY9A 1FY4A 2CHAC 1NY22 3P8GA 4U32A 4JZIA 2HLCA 2TGAA 1NO9H 2D26C 1SGYE 3RM2H 1AI8H 1HXFH 4IS5A 3HK6B 4CR9A 1KXFA 1SGPE 1BMNH 1QRWA 1PQAA 1UTJA 1UMAH 5J4QA 2NU3E 1O2JA 5SGAE 5DKMA 3W95A 2G4TA 3SJ8A 1IHTH 2VIWA 1C1QA 4X8VH 3RC4A 1FDPA 2GTBA 5A0AE 1K22H 2C3SA 1HYLA 2GGVB 4ABEA 2PTCE 5EXLA 2W3IA 2QA9E 3BTWE 3E1XB 1HLTH 1GBTA 2RG3A 3BEUA 1P8VC 1VJAU 2XCNA 2Y80A 1QL8A 1A0HB 1N8OC 5DP4A 3D65E 2NU2E 1XUFA 2ZTYA 5JBTA 5T3HA 1UTQA 2EEKA 1DSTA 1ELVA 4TWWA 4TWYA 2HPQH 3STIA 1YKTA 5EODA 2C4FH 1CGHA 1J14A 2A2QH 3S7KB 1C5ZB 1AUTC 3MH6A 2ZDLA 2FTLE 3TIUA 2PUXB 1THSH 3SNCA 4E06H 3V7TA 1EX3A 1UTOA 1E36B 1T31A 1AHTH 5E0HA 2FXRA 1GJ6A 1S6FA 3BTHE 1CT4E 1MKXK 3P17H 1EASA 1O2PA 1P01A 2GD4B 3AW0A 1ZTLA 4U30A 2G55A 5GDSH 2ZHFH 1T8LA 3M36A 1V2WT 2OBOA 5T6GA 2CV3A 3ZZ9A 2A5IA 1OP2A 1YPEH 3SI3H 4MNXA 2O8TA 2OP9A 1HAYB 4LK4A 5JB9S 2BLQA 4LZ1H 1DPOA 3VXFH 5F6MA 1IQJA 4FU8A 2VGCC 4K1SA 1OWHA 2XBVA 3T27A 1F5RA 4NFFA 1CSOE 1LHEH 2FI4E 2BD3A 1B0FA 1DT2A 2ZKSA 2Y5FA 2XWAA 1WQSA 1HAZB 1BRCE 1GGDB 1GI9B 1CQQA 1D3DB 4D7FA 4ABBA 1AZZA 2HOBA 1VZQH 2VWMA 1PQ5A 7ESTE 3QZRA 2V0BA 1LPGB 1NPMA 5DK1A 4MTBA 1ANCA 1N6XA 3FFGA 2ZCKP 2UUYA 4FUEA 1O30A 2GCTC 2A4GA 2ZCHP 3TGIE 3F6UH 1QL7A 2QXIA 3U9AH 1FY1A 3U98H 2BM2A 1TNLA 2PWXA 1RIWB 1KDQB 2JETC 1P03A 1SB1H 2H1UA 4MNWA 4OGXA 2SGEE 2P8OC 3A8CA 3V3MA 1C5XB 1L2EA 4ISHH 3TVJB 1SQTA 1M9UA 1O2KA 1XKBC 3E8LA 4WJG2 3NXPA 3EAJA 1W3CA 2OC1A 2CHAB 1P9UA 1UTKA 2BD2A 1SGTA 1BQYA 1RS0A 2ODYB 5E2PA 3PTBA 4ISLA 3RXJA 3STJA 3I77A 4Y8XA 4ZKSU 3KQCA 1BB0B 1LQEA 4KTCA 5FPTA 3LGUA 4UDWH 3RP2A 1GHBG 4KELA 3F1SB 2I6SA 3OY6U 4JK5A 4I7YH 1AE5A 1BRBE 3D23A 1T7CA 2C8ZB 4A92A 5JPMH 1XUGA 1BUIA 2EA3A 3UY9A 1GDQA 1LHDH 3BF6H 3SU4A 1C1WH 3SGQE 2ZGJA 3TNSA 2CF8H 3RXFA 1L0ZA 4A1TA 5I46H 1HAIH 1V2KT 2VIPA 5TJXA 3TITA 1S0QA 2BD7A 4HZHA 5DP9A 2WPLS 1BHXB 5EPNA 1O3KA 3VEQB 2BXTH 3BTDE 4R0IA 3MTYA 3E6PH 2ZDAH 2Z3CA 3W94A 1N8OB 1BA8B 5DP5A 1QB1A 1MU8B 1GMCF 4X2VA 2QXJA 3OY5U 3KHVA 1EPTA 1O3EA 1GJCB 1GJBB 3RMOH 1GHAF 1NESE 1QBOA 4B73A 2A0QB 1JIMA 2F9UA 1GBCA 2PSYA 3ODFA 3B9FH 3BEIB 1MTWA 1O2GH 5A8YA 3SU1A 2BD5A 3P8FA 4MPVA 5CHAC 1DY8A 1Z71A 2H5DA 3TLOA 1A4WH 3ZVCA 2XNIA 1O3NA 5E2OA 4JMYA 4RKOB 3PM3A 2W26A 1OP0A 2GDDA 1NU7B 1TRNA 1TMTH 2Z9JA 4NG9H 1JMOH 4TY6A 2Y5GA 2ZU5A 1HNEE 2WV4A 1TE0A 1LHFH 4NCYA 2F83A 1E38B 1NN6A 3NKKA 1ZSJA 2OCVB 4J1YA 3VB7A 3SNDA 3ZYEA 2G5NA 1WQVH 3PTNA 1F0SA 2ZCLP 1TNGA 1GI7B 1QGFA 3BSQA 1TOCB 2H9HA 1O5CB 5ABWA 1O5GH 6GCHF 3GICB 2Z3EA 1C4V2 2ZFQH 2JH6D 2R2WU 4H42U 1P2JA 1S85A 2WPKS 5B6OA 1MUEB 4NSVA 3MMGA 3LKWA 3A84A 2FI5E 3OTJE 2Q1JA 2FOAA 2BD8A 3ATMA 4MQAA 4RN6A 1GVKB 2AMPA 2WPHS 6LPRA 4XBCA 2FOBA 2A7JA 4NSYA 2Q6FA 4NIVA 2ANYA 2JETB 4CR5A 2GDEH 1TBZH 5LPEA 3KN2A 9ESTA 3M37A 1PPGE 3UR9A 1H1BA 2IN2A 2ZGCA 4K1TA 2ALPA 1LVBA 1BT7A 1EZUC 1YGCH 2QY0B 1C5QA 1FXYA 3A7VA 1RTLA 1YCPM 5DGJA 4A5TS 2GT8A 2V3HH 1FI8A 1UCYK 4AX9H 1P06A 3UFAA 1BOQA 2A4RA 2OC8A 2ZECA 1O3GA 4I8JA 2B0FA 2VINA 4WXIA 1TIOA 1P11E 1V2NT 2VIOA 3SNAA 2QF0A 1TGTA 3SGAE 2XYAA 2ZTXA 1LDTT 1ZHPA 2HRVA 2VU8E 1NZQH 4HGCA 2BVSH 1GI0A 1O2YA 2XCFA 1QBNA 4YTAA 4F49A 2BDCA 1GI5A 1G9IE 3TU7H 4THNH 2J95A 4OS5A 5L30H 1INCA 1OWJA 1FPCH 1UVUH 4UEHH 1YF4A 5A8XA 1T8OA 1YC0A 2R9PA 3PWBA 1WAYB 4CHAB 3A7ZA 2ZQ1A 1EB1H 1C5WB 3D49H 1DX5M 3FZDA 3UNSA 5JBBS 1S84A 1ELAA 1BMLA 3D62A 3ENSB 2BOHB 1ELTA 1P2IA 1SOTA 1H9IE 5JYIA 1TMBH 1Z1JA 1IQMA 1PYTD 2KAIA 1SR5C 1O3JA 3RXVA 3ZV8A 1KDQA 3GY2A 3NUMA 3DFJA 1O2LA 3JZ1B 1C9PA 1PPZA 3PLKA 4BAMB 1NC6A 2ZIQH 1NS3A 1IQLA 4B2AA 2ZP0H 3LDXH 4DIHH 2O8WA 1OOKB 1QA0A 2FM2A 4Q2KA 5F8XA 1Z8GA 3UPEA 3A88A 4Q80A 4Y6DA 5EXNA 5CHAB 1V2QT 1ZJKA 1S81A 4ISOA 2H9TH 4VGCC 1PPFE 1TX8A 2NU0E 3F9GA 3MYWA 4BTTB 4Y8ZA 1EQ9A 1V2JT 3Q3XA 4GHQA 4X6NA 2VVCA 2VB0A 1LPKB 1QJ1B 2WPMS 2BY6X 1AB9C 1W0YH 1SQAA 2THFB 4FU9A 3BEFB 3GDUA 4CH8B 1GJ5H 5TCAA 4AG2A 1C9TA 1G37A 1NFXA 1XUIA 4AB8A 4ZUHA 1KXAA 2ZQ2A 3UR6A 3FP6E 1NRQH 3BTME 1ZGVA 1TX7A 3BV9B 2ZG0H 3GY5A 4Y0YE 4A1XA 2C8WB 4YOJA 1Y3UA 2SNWA 1P2MA 2GVFA 1HAXB 1TA6A 1EUFA 1GI3A 2LPRA 1DWEH 3MH5A 4BXWA 4B2CA
chains in the Genus database with same CATH superfamily
1S0RA 4IN1A 3M61U 1ZMLA 4E7NA 1KMHB 2BQ7B 1ANBA 2G5VA 1F0RA 2FLRH 1WCZA 2K0QA 3C27B 4WXVA 2BYAX 3NK8A 1THRH 3LGTA 1TABE 1HXEH 1O2MA 2PGQB 3BG4C 1G32B 3ATWA 3A8DA 2VVVA 1DLEA 4YZUA 1XXFA 2BLOA 3P8OA 4FUBA 1GBBA 4KP0A 5DN6D 5HM9A 4ZMAH 1PQ7A 1L1GA 2BDAA 4FVBA 3TK6A 6ESTA 4E7RG 4Q7ZA 3M5LA 4FUIA 4ABDA 2ZA5A 4U2WA 3SUFA 3RC5A 2J34A 3P6ZB 1A5IA 4GVUA 1S83A 2FZZA 4WVPE 1S82A 3K65B 1DXPA 2Y82A 3LT3A 3E3TA 1WTHD 3H09A 2EC9H 5A09A 1C4Y2 1ID5H 3CS7A 2VJ1A 1V2OT 1SGDE 2AIQA 2WPJS 1A7SA 4Y7BA 3TPIZ 2V7QD 7LPRA 1KXBA 1LKAA 8GCHG 3LH3A 1G30B 1K1JA 1O2NA 4BOHA 3A86A 1FN8A 3HGPA 1EZSC 3LJJA 2GMTB 1QCPA 3SOSA 4D7GA 2GCHG 1HGTH 1F0UA 2FI3E 2H5CA 2QYIA 2SGFE 1CE5A 1JIRA 4AYVB 4INKA 2V6NA 5FX5A 4TYDA 2VNTA 1HCGA 2BY7X 4NFEA 2AGEX 3SO3A 1EOLA 5GCHF 5AVDA 2STAE 2JKHA 3OEHD 1FLEE 3LPRA 1O2HA 4RSPA 3N7OA 1PPHE 3SUEA 1YPGH 4LOYH 1EXFA 3UUZA 5F8TA 1ZGIA 1TBRH 2ZFRH 4MVNA 1MTUA 2TBSA 5I25A 1YCPK 2YMSB 1CGIE 3BTKE 1V2MT 1ZMNA 2GZ7A 4YXWD 4ZKNU 1L1NA 1QIXB 3MU0A 2SGAA 2YOLA 2D2DA 1LHGH 4MDSA 4UD9H 3U1JB 1THPB 1O36A 1V2PT 1UK3A 2QXGA 1KXDA 1T4VH 5CE1A 1XMNB 5H4IB 1PPEE 3KF2A 1TGSZ 4AG1A 1MD8A 4X6OA 1GMHG 3KEEA 2HNTC 2Z94A 2A2XH 2Z9KA 3VGCC 6CHAB 1K0HA 1NROH 1TPSA 3C1KA 3F3BA 1SLVB 4VGCB 5HXFA 2TGPZ 4BAHB 1ETRH 2W3KA 3JZ2B 1SL3A 2QXHA 1O34A 1Y8TA 1G3CA 3LGVA 1YPLH 1EAUA 2KCPA 4NA7A 1GL1A 1O2OA 1P2NA 2G00A 1QQ4A 1K2I1 5A0CA 2P95A 4UFEH 1EJNA 2CGAA 1CBWC 1C1TA 1ZRKA 2RA0A 3SV9A 1VGCC 1TNJA 1QFKH 1TLDA 1T8MA 3EYDA 4I8HA 1XVMA 1O3MA 5JBAS 4O3TA 3MO6A 1W2KH 3A8BA 1KXEA 1MMJN 2A1DB 3SN8A 3T28A 2ZNKH 5LPRA 2F9VA 1HRTH 3QO6A 1O3CA 2XC4A 3M5OA 5DG6A 4CH2B 4F55A 1YPMH 4H6SB 2BVXH 1XUKA 4RI0A 1AWHB 1IQGA 2ZU3A 2XC5A 1O39A 2OC7A 1TA2A 3LONA 2J98B 3M7TA 3GCHC 2FP7B 1TGNA 4K5ZA 2OD3B 4JZEH 3K6YA 4NZLA 3KL6A 4NIXA 4X0WU 3PMBB 3BG4B 1O3HA 2K1QA 1LVOA 1CT0E 3S69A 1UJ1A 2BX4A 1GBHA 1G3DA 2XC0A 5FBIA 4ESTE 1CO7E 5FXLA 2G51A 5J4SA 5FBEA 4K3JA 4D9RA 1HV7A 2ZDVH 3MWIU 5AFZH 2BDHA 2J2UA 2KCAA 1F5KU 3RUOA 1FY8E 3GCTG 1FAKH 3UIRA 3R3GB 3EE7A 1W8BH 2J94A 3R0FA 5FPSA 3RXCA 1JRSA 2FYRA 3GYLB 2M2AA 1GJDB 1MU6B 2DE9A 1SGCA 4AZ2B 2BTCE 4TPYA 3A7YA 2R0LA 1CA0C 2QN5T 3H7OA 1T8NA 3PO1C 4DOQA 5EIYA 2ZU2A 2PSXA 1ZTKA 1AIXH 1OKXA 3ZZDA 3ZZ4A 2C93B 4AGKA 3S9BA 2HPPH 3ZV9A 1BTPA 2J4IA 3UNRA 1BTYA 2PR3A 2L6OA 4I32A 1C4U2 4LZ4B 2BDGA 1BITA 5L2YH 2W5EA 3KQ5A 1ORFA 4ABHA 2B5TB 2JDID 1C5RA 2J5UA 3P92A 5F8ZA 2PLXA 1ZHMA 3TK5A 2LNCA 2XWBI 1B0EA 1RJXB 1YLDA 1KTTB 1LPZB 4Q7XA 2BY5X 1GI1A 1F92A 1IQKA 5PTPA 1OWKA 3AAUA 1MD7A 3HKJB 3RU4T 1AMHA 2IOTA 1TMUH 2ZPQA 3QTOH 2VWNA 3VB3A 1EP6A 3MNCA 3ZZ6A 3TGJE 2Z7FE 3MH7A 2WSSD 2FLBH 4UE7H 5LPFA 2KAIB 1DDJA 2AMDA 2AIPA 1EOJA 1O31A 1V2LT 1TALA 1IHSH 1PQ8A 5EQQA 1ETTH 1AE8H 1C1PA 1Y5BT 2SFAA 1MCTA 3QZQA 4ZXXH 5FAHA 2OUAA 2ZU1A 1CHOF 1TFXA 3EE0B 3ZZ5A 4BAKB 4B71A 5L6NH 2O8UA 1FX0B 3UB0A 2Y7XA 3LIWA 2ZI2H 3NPSA 3ZVFA 1BZXE 1JBUH 1O5AB 4GPGA 1H4WA 4CRCA 1S6LA 2BDYA 3RXIA 1XVOA 3PB1E 4Y8YA 2A45B 3ZZ7A 1SGIB 4PROA 3RXAA 3MU8A 4CRGA 3T29A 1DWBH 4YT7H 1VJ9U 1XX9A 4DG4A 1GCDA 3F2HA 3QDZB 1LKBA 2IJD1 8KME2 1QBVH 2P59A 3TJVA 2F9NA 7GCHF 1L1JA 1A1RA 3LGIA 1GI4A 1ELDE 3NWUA 1BJVA 2EI7A 1IQNA 2P93A 1Q3XA 4GLYA 4ZAEA 2CXVA 1P3CA 4K69A 5GIBA 3SZNA 3DD2H 1OPHB 4ZHAA 4XDEA 4I8LA 1UK2A 3UQVA 1JRTA 5FHTA 1GHXH 3LGYA 2FYQA 3PYHA 3GISB 1LVYA 2W6JD 2A4QA 1NFWA 1Z6JH 3NCLA 2ZGHA 2WV5A 1N6YA 2GV7A 4D76A 3RU4E 5C0UA 4WF8A 3S0NA 4I86A 1K1OA 1J17T 3LU9B 4P00A 3GCNA 1H9LB 1A0JA 1GHBF 3GCHB 2HNTE 3IG6B 1GHAG 4DJZB 2WUCA 2FESH 1TWXB 1BMMH 5C5OA 1NTPA 1HPGA 2VWLA 2J97A 1D4PB 1ZLRA 1H8HD 3OFND 1SGNE 1GBEA 2VIVA 1TONA 2A31A 1AZ8A 4NIWA 1UHBB 1E0FD 5HIYA 1HAVB 2HGTH 1DLKB 2B8OH 2ZDKA 3M3TA 2C90B 1L4ZA 4FXGH 2FOCA 4HTCH 2ZF0H 3SUGA 1IAUA 4F48B 1SLUB 3RXOA 5IYTA 1GMDF 2Y7ZA 3SHCH 4JZ1A 2QC2A 4XRNA 2OBQA 5AHGH 2BD9A 3TGKE 4Y11E 3WY8A 1TBQH 2A5AA 4AFSA 2WYJA 4YO9A 1Z8IB 1CA0B 3BTEE 4YOGA 2OTVA 3O8BA 3PO1B 3GDVA 4BXSA 1G2LA 1ZPZA 2B9LA 2VGCB 1RGQA 4AFQA 2FIRH 4A7IB 6GCHG 2OLGA 4D9QA 4ABGA 3E0PB 4XBDA 2A7HA 3E91A 2VH6A 3QWCH 4B6FA 3U8OH 1D3QB 2VBCA 3EA9A 1DOJA 1P12E 5JBCS 1PFXC 1TQ0B 1GBLA 1GWAA 3PLPA 1QRZA 4UONA 4X1NU 4FVDA 1C5UA 4JZDH 4FUGA 4YOIA 1AFQC 1AQ7A 3Q76A 2SGQE 1MKWK 1QRXA 4M7GA 1ZR0A 4O9VA 2VH0A 1J16A 1YM0A 1FQ3A 3F9EA 1RFNA 5GJ4B 1C2JA 2GCTB 1YBWA 4XE4A 4Q7YA 2ZFFH 3WW7A 1AU8A 3KQDA 2FOHA 2SNVA 1GVLA 3FAOA 1ACBE 1O3DA 1O5FH 1Z6EA 1FUJA 4B74A 5F53A 1BTHH 3VPKA 1O2WA 2WINI 4TY7A 5A8ZA 3O8RA 2P8OB 3SUDA 1W13U 3LH1A 1J15A 1ZPBA 4AFZA 2D8WA 4X2XA 2H6MA 3ZZ8A 1ESTA 1HBTH 1YPHC 2BY8X 2ZEBA 4NZQA 3MI4A 4XOJA 1TPAE 1YY3A 5K0HA 1DITH 3RXBA 1WXRA 3ZVEA 3L3TA 5EQRA 1W7XH 1UTPA 1W11U 4TPIZ 4DT4A 1ETSH 1DICA 3EDXB 2BY9X 3A7TA 4Y0ZE 4KTSA 4RT0A 5GPIB 5KECA 5HM2A 2FWWA 1EZXC 1LCYA 5T6FA 5EXMA 3F0OA 3QLPH 1NRRH 1QURH 3SU5A 1KLIH 1K1NA 1HAHH 1Y3YA 1A61H 4KKDA 7KMEH 2J92A 2YMSD 1VCWA 1Z7KA 1NU9A 5EJLA 1SFQB 3TH4H 3SHAH 1GVZA 1NRPH 3GY4A 2W7UA 1OP8A 4O97A 3PV4A 4IN2A 4GUXA 1Y3VA 1B5GH 2G4UA 5C17A 1YYY1 4FUJA 1W0KD 4H6TA 2F4LA 1EATA 2FS9A 2BOKA 1RD3B 2PTNA 2KM0A 1OS8A 1G2MA 2FPZA 3TK9A 3SV7A 1GBFA 3A82A 2ZC9H 3KIDU 4K8YA 1GBDA 1TGCA 1ELEE 1UTMA 1C1VH 2G52A 3FVFB 3OSYA 1O37A 1EP5A 5GWZA 5C20A 4YLQH 2WPIS 4X1RU 2ZU4A 1ESAA 3QK1A 1P02A 3HKIB 4GCHG 3RLYH 1S6HA 1TNKA 3LC3A 2PKSC 2G81E 3LOXA 3VXEH 1LQDB 1C5OH 2YNBA 4MPWA 1NM6A 4AB9A 1Z8JB 2XW9A 1GHYH 4DURA 4Y79A 2WV9A 3SW2B 1GI8B 3RLWH 1EPTC 1OWDA 2J9NA 1COWD 4IMQA 4WH8A 4R8TB 1SKYE 3LC5A 3MU1A 1ELCA 4X6MA 3G01A 4JZFH 3RXTA 3PV5A 4AORA 1Z8RA 4ZXYH 2P3UB 2D1JA 3O8DA 3V0XA 4AN7A 1SFIA 2WUBA 2XXLA 3L6PA 1G3EA 1HIAB 1V3XA 1D6WA 3PLBA 4CREA 1AN1E 1ANEA 2XBYA 4O03A 3LGWA 3BTTE 3SU6A 1DUEA 3P70B 2GP9B 1C1UH 3VFEA 3MH4A 4DVAU 4B1TA 1D6RA 1AUJA 3E16B 3K9XB 1AFQB 2VIQA 1P2OA 1FV9A 4Y71A 3N7DA 1SQRA 1UTNA 3S9AA 4BAQB 3CS0A 1MABB 5HMAA 1SOZA 1WU1A 1VITG 1UHBA 5JB8S 2CF9H 1TGBA 3DT0H 4IMZA 4AFUA 1SHYA 1HAVA 1C2MA 3CP7A 2VVUA 3VG8A 1Z1IA 3RXDA 5E8EH 3AASA 1DS2E 1V2VT 2OXSA 2UUJB 1EAIA 1GHZA 1Y5AT 3T25A 3RM0H 2BDBA 2O8LA 3PRBA 3V13A 4MPUA 1C5TA 1KTSB 1BJUA 1C1MA 1C5PA 4F4OC 1X7AC 1FIZA 2RDEA 4YT6H 1A3BH 3RXHA 2B7DH 1G36A 3BG8A 1GJAB 1H8IH 2PV9B 2UWPA 2H9EH 1ARCA 5IK2D 1UVSH 2GV6A 2M5TA 2EQNA 5FX6A 4OS1A 1VR1H 1QY6A 3A7WA 3QX5H 1BMAA 5FCRA 3SZEA 1QR3E 3URCA 3BN9A 1GBAA 2OQ5A 1W12U 2C8XB 1ZPCA 2ILNA 2ANWA 1TPOA 2P94A 4Y10E 4K8BA 4NWKA 3SNEA 2TGDA 1AKSB 5T1VA 1GJ9B 2OC0A 1SGQE 3DSOA 1F0TA 1HJ8A 1OWEA 1SLXB 1SLWB 5HIZA 1IQHA 3DSGA 1HJ9A 5GXPA 1O2XA 4AC9A 2ALVA 1LHCH 1T4UH 3RC6A 2FOFA 3MNXA 3RU4D 1YLCA 4ISIH 5TCCA 1O3BA 5DP7A 5IDKA 3HPTB 4X1PU 5KEDA 1O5BB 8GCHF 1K21H 1P2KA 1TX6A 3FZZA 1GBKA 1SGRE 1GJ4H 2ZGBH 4BNRA 4DT7B 1UVOA 1ELBA 5E0JA 1UCYH 1ZYOA 4K2YA 4X2YA 2GZ8A 3OYPA 1V2ST 4K60A 1YPHE 4IGDA 1SVPA 3I29A 5CDFE 2AHME 1O3PB 2DUCA 4M9FA 1TRMA 2BZAA 1HAOH 1DUAA 1AVGH 1WTGH 5ETXA 1A5HA 3SJKA 5JDUB 2UWLA 1A3EH 3E0NB 1SI5H 2PGBB 4XBBA 1O0DH 1TNHA 2ASUB 1O32A 1HAPH 2XBXA 5EU8A 2F9OA 1T32A 5HGGA 3GY7A 2Q6GA 3EA8A 2BXUH 1RIWC 4E05H 1AB9B 2AEIH 4NGAH 4LXBH 4IW4E 1ZZZA 3GDSA 1MQ6A 1DWCH 1FJSA 1WBGB 5F03A 1E1RD 3RXGA 4FUDA 2ESTE 2QF3A 1CA8B 1GMHF 3BTGE 3OX7U 1J8AA 1JOUB 4X1SU 1C2FA 5ESTE 3B8JA 1C5YB 2QV1A 1EFRD 1W14U 1Y59T 3TH2H 3Q3KA 2BQ6B 1NRNH 1FAXA 3A83A 1YWUA 1C1RA 3RXMA 1O2QA 1HFDA 3DSPA 1WOFA 3VB5A 3KYFA 2A32A 2ANKH 2GKVE 1OYQA 2BDIA 2K8IA 1WDIA 2UUFB 3PV2A 1MTNC 4CRBA 2CN0H 1JWTA 3SV6A 2STBE 3MHWU 3A80A 3GYMA 1SQOA 1C2KA 4K1EA 4HI3A 2AGIX 3SQHE 2Q6DA 4DY7B 3ZYDA 3GOVB 1FY5A 1WYKA 1C1OA 3WWBA 3K2UA 2UUKB 2QIQA 1UVPA 1C2DA 5C67A 1ZOMA 4QT8C 4CRAA 1SHHB 1O38A 2BB4A 2PKAB 1CHGA 1FONA 4BAOB 1C2LA 1YPKH 1SGFA 2ZHWH 2XRCA 1KLTA 1TNIA 5LH8A 1CU1A 1SMFE 2BVRH 3L33A 1K1LA 4A6LA 2ZPSA 3AVZA 3HGNA 1LO6A 2SGDE 3RMLH 2TRMA 1OXGA 4CBNA 1BBRH 4OS6A 1FIWA 3TJOA 3VB6A 4AYYB 3UQOA 3BTFE 4MG3A 5DP6A 4Z1MD 1HIAA 2C8YB 1QB6A 2FODA 2FX6A 2XTTB 1GDUA 2ZFTA 3SJ9A 1SGFG 1P05A 1KLJH 2AH4X 2ZDNA 1DXWA 1HAGE 3ZVGA 1EJAA 1U6QA 1HUTH 1QZ8A 1DM4B 3A85A 1ANDA 3MO9A 3RXPA 3GCTF 2BLVA 1BDAA 2AS9A 1Q31A 1MBMA 1O2RA 4D8NA 3DFLA 1YPJH 3TH3H 2UWOA 8ESTE 2RDLA 2Y6TA 1BTZA 4JYVH 3FANA 5DO4H 1TAWA 2ZDMA 2Z9LA 4INHA 3FN8A 1AGJA 1C5LH 4GHTA 4X8TH 1O2ZA 1GDNA 1MH0A 3OAAD 3RMMH 4GSOA 1CHOG 1IQEA 1S5SA 2P3TB 1BIOA 3MU4A 3EGKH 1G3BA 1AWFH 3QTVH 1F7ZA 2AGGX 2IPQX 3VGCB 4IC6A 2AERH 3OU0A 5EW1H 4Y7AA 1MTSA 2CMYA 3SU0A 2F3CE 1ZHRA 3KQEA 1ZMJA 2IJOB 2GJGA 2FO9A 7GCHG 2FOMB 4I8KA 3H5CB 4DGJA 1TQ7B 1IQFA 1QHRB 3T2NA 1V2RT 1GI2A 5A0BA 2I6QA 1TRYA 1FPHH 1O2IA 1O2TA 1C5MD 2ZTZA 1YCPH 3GY3A 1AKSA 2ZPRA 1CBWB 1MTVA 3DA9B 1AVXA 1YP9A 3ZVBA 4X1QU 1NBME 1VGCB 1A2CH 1CGJE 3SGBE 3EA7A 1DWDH 1O2SA 2NU1E 1OSSA 1OX1A 1DFPA 4B2BA 5L2ZH 2FS8A 1OYTH 5C0TA 2F91A 1AO5A 1ABJH 1MZAA 3P8NA 3B23B 3TNTA 2R3YA 4WWYA 3K6ZA 1SGEE 4BANB 1ZJDA 2NU4E 1QB9A 2ZFSA 1FNIA 1GMCG 3QN7A 2ZGXH 5AF9H 1MTNB 4UFGH 3AW1A 1WUNH 3LJOA 3MFJA 4JK6A 2ZFPH 3A7XA 1A5GH 1QA7A 3CENA 1KSNA 2BHGA 4OS4A 5EG4A 3MNBA 3M5NA 2FOGA 4O3UA 3TJNA 3UNQA 2YNAA 1NFUA 4IC5A 1F2SE 2FTMA 4A1VA 4ABFA 1H8DH 3M5MA 4CHAC 5DPAA 3RMNH 4OGYA 3ATIA 3H7TA 4I33A 2VIDA 1GMDG 1TYNA 1XXDA 2HVXA 1PPCE 1C5SA 3U8RH 3UOUA 1EB2A 3VB4A 2EY4C 2ANMH 3IWMA 4WY3A 1C2GA 2AMQA 4RKJB 4WMFA 2OK5A 1TPPA 1LMWB 2OINA 1UW7A 3W1EA 4HFPB 2G8TA 3IITA 2F43B 4SGAE 1P9SA 4OS2A 1QNJA 2GT7A 1E37B 2QAAA 3T62A 4ABIA 1O2VA 3ODDA 2JJ1D 1QQUA 1SG8B 3ZIAD 1V6DA 1XM1A 2OQUA 4CBOA 1IQIA 2PW8H 3S9CA 5HYOA 1BTXA 1UTLM 2TIOA 2ZWLH 1O3OA 3A89A 4HG6A 2Y81A 2PUQH 1D3TB 4IBLH 4Y76A 4XSKU 1Y5UT 1BRAA 1PPBH 4NIYA 4AOQA 5K7RA 1QJ7B 1MAXA 4X2WA 2ZHQH 4Z6AH 1ZRBA 4B76A 3PMHB 2LELA 2P16A 1E35B 2HALA 4MLFB 1K1IA 1KYNA 3KQBA 1VCPA 2IPHA 3RXSA 1MKXH 1DVAH 3NZIA 5E0GA 1SPJA 1FZZA 5GNDA 2XBWA 4X8SH 2SGPE 2HVYB 2V35A 1QJ6B 1GJ8B 3MU5A 1ZTJA 3SQEE 3URDA 3SJOA 1P09A 2Z9IA 2PKAA 1LTOA 2AFQB 1RXPA 4JCNA 5C1UA 1DANH 1P3EA 1ELGA 4B75A 5DP8A 1ABIH 4OS7A 2F9BH 1LVMA 3HK3B 5HKKD 3A81A 3EQ0H 3QGJA 2PHBA 3F0PA 3KCGH 2KX4A 4ZROA 3SU3A 1CVWH 1TB6H 1DY9A 4ZKRU 5T6DA 1GCTC 1MQ5A 1NT1A 4CRDA 3UTUH 1VCQA 2JH5D 1GBMA 2Z3DA 1QTFA 1RTKA 1MAYA 4GAWA 1P0SH 5EQSA 3A87A 1O3IA 2FEQH 2O9QA 3GY8A 3RXRA 5G4BA 4FU7A 3A8AA 2GZ9A 2XOKD 4MNYA 2QF4A 2ODQA 5BRRE 3Q00A 2TPIZ 4MPXA 1ESBA 3P95A 3PRDA 1GPZA 3MOCA 1GG6C 2LP6A 3BIVH 2R3UA 1UK4A 2KZ4A 1P2QA 1QL9A 2GMTC 2QCYA 2FX4A 2ULLA 3ZZCA 1HJAC 1K9OE 1C2IA 1WV7H 1FY3A 1NRSH 2RCEA 1C1NA 1PJPA 1RRKA 1VITH 4BTUB 3M7UA 1GHVH 5LGOA 1HDTH 3RXUA 1BTUA 3V12A 4XFQA 4Z0KA 3UREA 1K28D 3UOPA 1DSUA 1L4DA 3OEED 2NWNA 1O5EH 3KNXA 5C1XA 3SV2H 5EW2H 4SGBE 2FMJA 3T5FH 1IOEA 2BD4A 2Z6BD 4MNVA 2FDAA 1P10A 1A46H 3KGPA 5C5NA 4X6PA 3Q3YA 2DE8A 4YESB 1KXCA 3SV8A 4ZH8A 3FP8E 1BTWA 1MBQA 2KR7A 1KIGH 4BTIB 4WMDA 1TOMH 3FOAA 3ZZ3A 1EKBB 4DIIH 3RXLA 1ARBA 4FUHA 3BTQE 5EPYA 1UVTH 3RDZA 4FUCA 3I78A 4DCDA 3ELAH 3FP7E 1H9HE 4ABAA 4U01A 3UWIA 5B6LA 1Y3WA 1DE7H 4X8UH 4ZHLU 2O8MA 4KTUA 1SBWA 3N99A 1W7GH 3SJIA 4Q4LA 6CHAC 4ASUD 2FOEA 1K1MA 1PYTC 3SBKA 1C5VA 1EAWA 4ASHA 1BMFD 4GCHF 2KCYA 3DHKH 3ITIA 1Q2WA 3ATLA 1NFYA 2P3FH 1K1PA 1V2UT 3ZVAA 1AVWA 3M35A 2ZO3H 1XKAC 3M3VA 5C2ZA 1XUHA 4ZCNA 3PWCA 1OHHD 3ZZBA 2HNTF 3RXKA 4ZKOU 2JH0D 1P04A 3ESTA 5DP3A 3GY6A 3SI4H 1ZSKA 1UCYE 2A7CA 1D9IA 2J38A 3HATH 4J2YB 1J9CH 2EI8A 1O3FA 3FKSD 1C1SA 2Z9GA 3PMJA 2EI6A 2AYWA 1ZSLA 1EZQA 1GBJA 1MZDA 3RXQA 1BBRK 4DW2U 5A2MH 3U69H 4TT3D 1O33A 4JYUH 3PMAB 1MCVA 2BX3A 1ELFA 4NA9H 5FCKA 2TGTA 2WHXA 1AFEH 4ABJA 1WSSH 1P57B 1VITF 1O2UA 2BLWA 1BHXF 1GCTB 1BRUP 3U1IB 1EAXA 1W0ZU 5CMXH 1C2EA 2A4OA 5FPYA 1MKWH 3AAVA 4I31A 5ESBA 3RXEA 1UO6A 1CT2E 1Y3XA 1NBMD 4H4FA 5GCHG 2CJIA 2ZZUH 2WYGA 3GCOA 2VWOA 4INLA 2W7SA 1W10U 2V3OH 1RTFB 1SC8U 2JIZD 3SNBA 1N1LA 2A5KA 2GX4A 5EGMA 3TJUA 4JYTA 3PROA 3U28C 5C3NA 3M7QA 3Q77A 4FUFA 1GJ7B 1W0JD 4OM9A 3F68H 1C5NH 3F9FA 3ZZAA 2F9PA 1SSXA 1GG6B 3SU2A 4UFFH 3MNSA 8LPRA 1HJAB 2Y5HA 4NWLA 1V2TT 3MO3A 3ZVDA 4CRFA 3O8CA 2ODPA 4NA8A 4UFDH 4ACBA 1OWIA 1FN6A 4I8GA 2PFEA 2ZHDA 5AFYH 5BPEA 1XUJA 4FOUC 5EOKA 1GI6A 1GBIA 2GCHF 2QGRA 1GGDC 2RA3A 1GHWH 2H2ZA 4YM9A 1O35A 1FMGA 3T26A 4ISNA 4WH6A 2BZ6H 1A0LA 3E90B 5DJ7A 3QUMP 3UWJH 2ZHEH 1C2HA 3U8TH 2PKSB 1O3LA 1AD8H 3M3SA 4YLUA 3S7HB 9LPRA 3DUXH 4AGJA 3ATKA 1B7XB 1EJMA 3QGNB 1O5DH 1BCUH 3SORA 2R0KA 1O3AA 1BBRE 1EPTB 1JXPA 5C1YA 2QE7D 2WZQA 2HWLB 3F9HA 2BMGB 5FL7D 2BQWB 1GL0E 3BIUH 4KGAA 3MQKC 1D3PB 1E34B 3NRLA 4ZHMU 1HB0B 1F5LA 2R2MB 4WMEA 1AY6H 1KY9A 1H8ED 1FY4A 2CHAC 1NY22 3P8GA 4U32A 3SYJA 4JZIA 2HLCA 2TGAA 1NO9H 2D26C 1SGYE 3RM2H 1AI8H 1HXFH 4IS5A 3CNRA 3HK6B 4CR9A 1KXFA 1SGPE 1BMNH 1QRWA 1PQAA 1UTJA 1UMAH 5DSFA 5J4QA 2NU3E 1O2JA 5SGAE 5DKMA 3W95A 2G4TA 3SJ8A 1IHTH 2VIWA 1C1QA 4X8VH 3RC4A 1FDPA 2GTBA 5A0AE 1K22H 2C3SA 1E79D 1HYLA 2GGVB 4ABEA 2PTCE 4P02A 2W3IA 5EXLA 2QA9E 3BTWE 3E1XB 1HLTH 1GBTA 3OE7D 2RG3A 3BEUA 1P8VC 1VJAU 2XCNA 2Y80A 1QL8A 1A0HB 1N8OC 5DP4A 3D65E 3UAIC 2NU2E 1XUFA 2ZTYA 5JBTA 5T3HA 1UTQA 2EEKA 1DSTA 1ELVA 4TWWA 4TWYA 2HPQH 3STIA 1YKTA 5EODA 2C4FH 1CGHA 1J14A 2A2QH 3S7KB 1C5ZB 1AUTC 3MH6A 2ZDLA 2FTLE 3TIUA 2PUXB 2W6ID 1THSH 3SNCA 4E06H 3V7TA 1EX3A 1UTOA 1E36B 1T31A 1AHTH 5E0HA 2FXRA 1GJ6A 4FETA 1S6FA 3BTHE 1CT4E 1MKXK 3P17H 1EASA 1O2PA 4RT1A 1P01A 2GD4B 3AW0A 1ZTLA 4U30A 2G55A 5GDSH 2ZHFH 1T8LA 3M36A 1V2WT 2OBOA 5T6GA 2CV3A 3ZZ9A 2A5IA 1OP2A 1YPEH 3SI3H 4MNXA 2O8TA 2OP9A 1HAYB 4LK4A 5JB9S 2BLQA 4LZ1H 1DPOA 3VXFH 5F6MA 1IQJA 4FU8A 2VGCC 4K1SA 1OWHA 2XBVA 3T27A 1F5RA 4NFFA 1CSOE 1LHEH 2FI4E 2BD3A 2PP6A 1B0FA 1DT2A 2ZKSA 2Y5FA 2XWAA 1WQSA 1HAZB 2QF5A 1BRCE 1GGDB 1GI9B 1CQQA 1D3DB 4D7FA 4ABBA 1AZZA 2HOBA 1VZQH 2VWMA 1PQ5A 7ESTE 3QZRA 2V0BA 1LPGB 1NPMA 5DK1A 4MTBA 3AK5A 1ANCA 1N6XA 3FFGA 2ZCKP 2UUYA 4FUEA 1O30A 2GCTC 2A4GA 2ZCHP 3TGIE 4TSFD 3F6UH 1QL7A 2QXIA 3U9AH 1FY1A 3U98H 2BM2A 1TNLA 4ACAA 2PWXA 1RIWB 1KDQB 2JETC 1P03A 1SB1H 2H1UA 4MNWA 4OGXA 2SGEE 2P8OC 3A8CA 3V3MA 1C5XB 1L2EA 4ISHH 3TVJB 1SQTA 1M9UA 1O2KA 1XKBC 3E8LA 4WJG2 3NXPA 3EAJA 1W3CA 2OC1A 2CHAB 1P9UA 1UTKA 2BD2A 5C94A 1SGTA 1BQYA 1RS0A 2ODYB 5E2PA 3PTBA 4ISLA 3RXJA 3STJA 3I77A 4Y8XA 4ZKSU 3KQCA 1BB0B 1LQEA 4KTCA 5FPTA 3LGUA 4UDWH 3RP2A 1GHBG 4KELA 3F1SB 2I6SA 3OY6U 4JK5A 4I7YH 1AE5A 1BRBE 3D23A 1T7CA 2C8ZB 4A92A 5JPMH 5EJ1A 1XUGA 1BUIA 2EA3A 3UY9A 1GDQA 1LHDH 3BF6H 3SU4A 1C1WH 3SGQE 2ZGJA 3TNSA 2CF8H 3RXFA 1L0ZA 4A1TA 5I46H 1HAIH 1V2KT 2VIPA 5TJXA 3TITA 1S0QA 2BD7A 4HZHA 5DP9A 2WPLS 1BHXB 5EPNA 1O3KA 3VEQB 2BXTH 3BTDE 4R0IA 3MTYA 3E6PH 2ZDAH 2Z3CA 3W94A 1N8OB 1BA8B 5DP5A 1QB1A 1MU8B 1GMCF 4X2VA 2QXJA 3OY5U 3KHVA 1EPTA 1O3EA 1GJCB 1GJBB 3RMOH 1GHAF 1NESE 1QBOA 2L74A 4B73A 2A0QB 1JIMA 2F9UA 1GBCA 2PSYA 3ODFA 3B9FH 3BEIB 1MTWA 1O2GH 5A8YA 3SU1A 2BD5A 3P8FA 4MPVA 5CHAC 1DY8A 1Z71A 2H5DA 3TLOA 1A4WH 3ZVCA 2XNIA 1O3NA 5E2OA 4JMYA 4XD7D 4RKOB 3PM3A 2W26A 1OP0A 2GDDA 1NU7B 1TRNA 1TMTH 2Z9JA 4NG9H 1JMOH 4TY6A 2Y5GA 2ZU5A 1HNEE 2WV4A 1TE0A 2XNDD 1LHFH 4NCYA 2F83A 1E38B 1NN6A 3NKKA 1ZSJA 2OCVB 4J1YA 3VB7A 3SNDA 3ZYEA 2G5NA 1WQVH 3PTNA 1F0SA 2KFWA 2ZCLP 3GS9A 1TNGA 1GI7B 1QGFA 3BSQA 1TOCB 3F2GA 2H9HA 4Q63A 2KCOA 1O5CB 5ABWA 1O5GH 6GCHF 3GICB 2Z3EA 1C4V2 2ZFQH 2JH6D 2R2WU 4H42U 1P2JA 1S85A 2WPKS 5B6OA 2J98A 3DCLA 1MUEB 4NSVA 3MMGA 3LKWA 3A84A 2FI5E 3OTJE 4B6EA 2Q1JA 2FOAA 2BD8A 3ATMA 4MQAA 4RN6A 1GVKB 2AMPA 2WPHS 6LPRA 4XBCA 2FOBA 2CK3D 2A7JA 4NSYA 2Q6FA 4NIVA 2ANYA 2JETB 4CR5A 2GDEH 1TBZH 5LPEA 3KN2A 9ESTA 3M37A 1PPGE 3UR9A 1H1BA 2IN2A 2ZGCA 2JJ2D 4K1TA 2ALPA 1LVBA 1BT7A 1EZUC 3F2FA 1YGCH 2QY0B 1C5QA 1YLNA 1FXYA 3A7VA 1RTLA 1YCPM 5CHBA 5DGJA 4A5TS 2GT8A 2V3HH 1FI8A 1UCYK 4AX9H 1P06A 3UFAA 3N7EA 1BOQA 2A4RA 2OC8A 2ZECA 1O3GA 4I8JA 2B0FA 2VINA 4WXIA 1TIOA 1P11E 1V2NT 2VIOA 3SNAA 2QF0A 1VKYA 1TGTA 3SGAE 2XYAA 2ZTXA 1LDTT 1ZHPA 2HRVA 2VU8E 1NZQH 4HGCA 2BVSH 5KGOA 1GI0A 1O2YA 2XCFA 1QBNA 4YTAA 4F49A 3OTPA 2HLDD 2BDCA 1GI5A 1G9IE 3TU7H 4THNH 2J95A 4OS5A 5L30H 1INCA 3WWFA 1OWJA 1FPCH 1UVUH 4UEHH 1YF4A 5A8XA 1T8OA 1YC0A 2R9PA 3PWBA 1WAYB 4CHAB 3A7ZA 2ZQ1A 1EB1H 1C5WB 3D49H 1DX5M 3FZDA 3UNSA 5JBBS 1S84A 3KYGA 1ELAA 1BMLA 3D62A 2YMSC 3ENSB 2BOHB 1ELTA 1P2IA 1SOTA 1H9IE 5JYIA 1TMBH 1Z1JA 1IQMA 1PYTD 2KAIA 1SR5C 1O3JA 3RXVA 3ZV8A 1KDQA 3GY2A 3NUMA 3DFJA 1O2LA 2WPDD 3JZ1B 1C9PA 1PPZA 3PLKA 4BAMB 1NC6A 2ZIQH 1NS3A 1IQLA 4B2AA 1E1QD 2ZP0H 3LDXH 4DIHH 2O8WA 1OOKB 1QA0A 2FM2A 4Q2KA 5F8XA 1Z8GA 3UPEA 3A88A 4Q80A 4Y6DA 5EXNA 5CHAB 1V2QT 1ZJKA 1S81A 2RFKC 4ISOA 3FO8D 2H9TH 4VGCC 1PPFE 1TX8A 2NU0E 3F9GA 3MYWA 4BTTB 4Y8ZA 1EQ9A 1V2JT 3Q3XA 4GHQA 2V3MA 4X6NA 2VVCA 2VB0A 1LPKB 1QJ1B 2WPMS 2BY6X 1AB9C 1W0YH 1SQAA 2THFB 4FU9A 3BEFB 3GDUA 4CH8B 1GJ5H 5TCAA 4AG2A 1C9TA 1G37A 1NFXA 1XUIA 4AB8A 4ZUHA 1KXAA 2ZQ2A 5EJZA 3UR6A 3FP6E 1NRQH 3BTME 1ZGVA 1TX7A 3BV9B 2ZG0H 3GY5A 4Y0YE 4A1XA 2C8WB 4YOJA 1Y3UA 2SNWA 1P2MA 2GVFA 1HAXB 1TA6A 1EUFA 1GI3A 2LPRA 1DWEH 3MH5A 4BXWA 4B2CA
chains in the Genus database with same CATH topology
1S0RA 4IN1A 3M61U 1ZMLA 4E7NA 2BQ7B 1ANBA 2G5VA 1F0RA 2FLRH 1WCZA 3C27B 4WXVA 2BYAX 3NK8A 1THRH 3LGTA 1TABE 1HXEH 1O2MA 2PGQB 3BG4C 1G32B 3ATWA 3A8DA 2VVVA 1DLEA 4YZUA 1XXFA 2BLOA 3P8OA 4FUBA 1GBBA 4KP0A 5HM9A 4ZMAH 1PQ7A 1L1GA 2BDAA 4FVBA 3TK6A 6ESTA 4E7RG 4Q7ZA 3M5LA 4FUIA 4ABDA 2ZA5A 4U2WA 3SUFA 3RC5A 2J34A 3P6ZB 1A5IA 4GVUA 1S83A 2FZZA 4WVPE 1S82A 3K65B 1DXPA 2Y82A 3LT3A 3E3TA 1WTHD 2EC9H 5A09A 1C4Y2 1ID5H 3CS7A 2VJ1A 1V2OT 1SGDE 2AIQA 2WPJS 1A7SA 4Y7BA 3TPIZ 7LPRA 1KXBA 1LKAA 8GCHG 3LH3A 1G30B 1K1JA 1O2NA 4BOHA 3A86A 1FN8A 3HGPA 1EZSC 3LJJA 2GMTB 1QCPA 3SOSA 4D7GA 2GCHG 1HGTH 1F0UA 2FI3E 2H5CA 2QYIA 2SGFE 1CE5A 1JIRA 4AYVB 4INKA 2V6NA 5FX5A 4TYDA 2VNTA 1HCGA 2BY7X 4NFEA 2AGEX 3SO3A 1EOLA 5GCHF 5AVDA 2STAE 2JKHA 1FLEE 3LPRA 1O2HA 4RSPA 3N7OA 1PPHE 3SUEA 1YPGH 4LOYH 1EXFA 3UUZA 5F8TA 1ZGIA 1TBRH 2ZFRH 4MVNA 1MTUA 2TBSA 5I25A 1YCPK 1CGIE 3BTKE 1V2MT 1ZMNA 2GZ7A 4ZKNU 1L1NA 1QIXB 3MU0A 2SGAA 2YOLA 2D2DA 1LHGH 4MDSA 4UD9H 3U1JB 1THPB 1O36A 1V2PT 1UK3A 2QXGA 1KXDA 1T4VH 5CE1A 1XMNB 5H4IB 1PPEE 3KF2A 1TGSZ 4AG1A 1MD8A 4X6OA 1GMHG 3KEEA 2HNTC 2Z94A 2A2XH 2Z9KA 3VGCC 6CHAB 1NROH 1TPSA 3C1KA 1SLVB 4VGCB 5HXFA 2TGPZ 4BAHB 1ETRH 2W3KA 3JZ2B 1SL3A 2QXHA 1O34A 1Y8TA 1G3CA 3LGVA 1YPLH 1EAUA 4NA7A 1GL1A 1O2OA 1P2NA 2G00A 1QQ4A 1K2I1 5A0CA 2P95A 4UFEH 1EJNA 2CGAA 1CBWC 1C1TA 1ZRKA 2RA0A 3SV9A 1VGCC 1TNJA 1QFKH 1TLDA 1T8MA 3EYDA 4I8HA 1XVMA 1O3MA 5JBAS 4O3TA 3MO6A 1W2KH 3A8BA 1KXEA 1MMJN 2A1DB 3SN8A 3T28A 2ZNKH 5LPRA 2F9VA 1HRTH 3QO6A 1O3CA 2XC4A 3M5OA 5DG6A 4CH2B 1YPMH 4H6SB 2BVXH 1XUKA 1AWHB 1IQGA 2ZU3A 2XC5A 1O39A 2OC7A 1TA2A 3LONA 3M7TA 3GCHC 2FP7B 1TGNA 4K5ZA 2OD3B 4JZEH 3K6YA 4NZLA 3KL6A 4NIXA 4X0WU 3PMBB 3BG4B 1O3HA 2K1QA 1LVOA 1CT0E 3S69A 1UJ1A 2BX4A 1GBHA 1G3DA 2XC0A 5FBIA 4ESTE 1CO7E 5FXLA 2G51A 5J4SA 5FBEA 4K3JA 4D9RA 1HV7A 2ZDVH 3MWIU 5AFZH 2BDHA 2J2UA 1F5KU 3RUOA 1FY8E 3GCTG 1FAKH 3UIRA 3R3GB 1W8BH 2J94A 3R0FA 5FPSA 3RXCA 1JRSA 2FYRA 3GYLB 1GJDB 1MU6B 2DE9A 1SGCA 4AZ2B 2BTCE 4TPYA 3A7YA 2R0LA 1CA0C 2QN5T 3H7OA 1T8NA 3PO1C 4DOQA 2ZU2A 2PSXA 1ZTKA 1AIXH 1OKXA 3ZZDA 3ZZ4A 2C93B 4AGKA 3S9BA 2HPPH 3ZV9A 1BTPA 2J4IA 3UNRA 1BTYA 2PR3A 4I32A 1C4U2 4LZ4B 2BDGA 1BITA 5L2YH 2W5EA 1ORFA 4ABHA 2B5TB 1C5RA 3P92A 5F8ZA 2PLXA 1ZHMA 3TK5A 2LNCA 2XWBI 1B0EA 1RJXB 1YLDA 1KTTB 1LPZB 4Q7XA 2BY5X 1GI1A 1F92A 1IQKA 5PTPA 1OWKA 3AAUA 1MD7A 3HKJB 3RU4T 1AMHA 2IOTA 1TMUH 2ZPQA 3QTOH 2VWNA 3VB3A 1EP6A 3MNCA 3ZZ6A 3TGJE 2Z7FE 3MH7A 2FLBH 4UE7H 5LPFA 2KAIB 1DDJA 2AMDA 2AIPA 1EOJA 1O31A 1V2LT 1TALA 1IHSH 1PQ8A 5EQQA 1ETTH 1AE8H 1C1PA 1Y5BT 2SFAA 1MCTA 3QZQA 4ZXXH 5FAHA 2OUAA 2ZU1A 1CHOF 1TFXA 3EE0B 3ZZ5A 4BAKB 4B71A 5L6NH 2O8UA 2Y7XA 3LIWA 2ZI2H 3NPSA 3ZVFA 1BZXE 1JBUH 1O5AB 4GPGA 1H4WA 4CRCA 2BDYA 3RXIA 1XVOA 3PB1E 4Y8YA 2A45B 3ZZ7A 1SGIB 4PROA 3RXAA 3MU8A 4CRGA 3T29A 1DWBH 4YT7H 1VJ9U 1XX9A 4DG4A 1GCDA 3QDZB 1LKBA 8KME2 1QBVH 2P59A 3TJVA 2F9NA 7GCHF 1L1JA 1A1RA 3LGIA 1GI4A 1ELDE 3NWUA 1BJVA 2EI7A 1IQNA 2P93A 1Q3XA 4GLYA 4ZAEA 2CXVA 1P3CA 4K69A 5GIBA 3SZNA 3DD2H 1OPHB 4ZHAA 4XDEA 4I8LA 1UK2A 3UQVA 1JRTA 5FHTA 1GHXH 3LGYA 2FYQA 3PYHA 3GISB 1LVYA 2A4QA 1NFWA 1Z6JH 3NCLA 2ZGHA 2WV5A 1N6YA 2GV7A 4D76A 3RU4E 4WF8A 3S0NA 1K1OA 1J17T 3LU9B 3GCNA 1H9LB 1A0JA 1GHBF 3GCHB 2HNTE 3IG6B 1GHAG 4DJZB 2WUCA 2FESH 1TWXB 1BMMH 5C5OA 1NTPA 1HPGA 2VWLA 1D4PB 1ZLRA 1SGNE 1GBEA 2VIVA 1TONA 2A31A 1AZ8A 4NIWA 1UHBB 1E0FD 1HAVB 2HGTH 1DLKB 2B8OH 2ZDKA 3M3TA 2C90B 1L4ZA 4FXGH 2FOCA 4HTCH 2ZF0H 3SUGA 1IAUA 1SLUB 3RXOA 5IYTA 1GMDF 2Y7ZA 3SHCH 4JZ1A 2QC2A 2OBQA 5AHGH 2BD9A 3TGKE 4Y11E 3WY8A 1TBQH 2A5AA 4AFSA 2WYJA 4YO9A 1Z8IB 1CA0B 3BTEE 4YOGA 2OTVA 3O8BA 3PO1B 3GDVA 4BXSA 1G2LA 1ZPZA 2B9LA 2VGCB 1RGQA 4AFQA 2FIRH 4A7IB 6GCHG 2OLGA 4D9QA 4ABGA 3E0PB 4XBDA 2A7HA 3E91A 2VH6A 3QWCH 3U8OH 1D3QB 3EA9A 1DOJA 1P12E 5JBCS 1PFXC 1TQ0B 1GBLA 1GWAA 3PLPA 1QRZA 4UONA 4X1NU 4FVDA 1C5UA 4JZDH 4FUGA 4YOIA 1AFQC 1AQ7A 3Q76A 2SGQE 1MKWK 1QRXA 4M7GA 1ZR0A 4O9VA 2VH0A 1J16A 1YM0A 1FQ3A 3F9EA 1RFNA 5GJ4B 1C2JA 2GCTB 1YBWA 4XE4A 4Q7YA 2ZFFH 1AU8A 3KQDA 2FOHA 2SNVA 1GVLA 3FAOA 1ACBE 1O3DA 1O5FH 1Z6EA 1FUJA 4B74A 1BTHH 3VPKA 1O2WA 2WINI 4TY7A 5A8ZA 3O8RA 2P8OB 3SUDA 1W13U 3LH1A 1J15A 1ZPBA 4AFZA 2D8WA 4X2XA 2H6MA 3ZZ8A 1ESTA 1HBTH 1YPHC 2BY8X 2ZEBA 4NZQA 3MI4A 4XOJA 1TPAE 5K0HA 1DITH 3RXBA 3ZVEA 3L3TA 5EQRA 1W7XH 1UTPA 1W11U 4TPIZ 1ETSH 1DICA 3EDXB 2BY9X 3A7TA 4Y0ZE 4KTSA 5GPIB 5HM2A 2FWWA 1EZXC 1LCYA 5T6FA 5EXMA 3QLPH 1NRRH 1QURH 3SU5A 1KLIH 1K1NA 1HAHH 1Y3YA 1A61H 4KKDA 7KMEH 2J92A 1VCWA 1Z7KA 1NU9A 1SFQB 3TH4H 3SHAH 1GVZA 1NRPH 3GY4A 2W7UA 1OP8A 4O97A 3PV4A 4IN2A 4GUXA 1Y3VA 1B5GH 2G4UA 1YYY1 4FUJA 4H6TA 1EATA 2FS9A 2BOKA 1RD3B 2PTNA 1OS8A 1G2MA 2FPZA 3TK9A 3SV7A 1GBFA 3A82A 2ZC9H 3KIDU 4K8YA 1GBDA 1TGCA 1ELEE 1UTMA 1C1VH 2G52A 3FVFB 3OSYA 1O37A 1EP5A 5GWZA 5C20A 4YLQH 2WPIS 4X1RU 2ZU4A 1ESAA 3QK1A 1P02A 3HKIB 4GCHG 3RLYH 1S6HA 1TNKA 3LC3A 2PKSC 2G81E 3LOXA 3VXEH 1LQDB 1C5OH 2YNBA 4MPWA 1NM6A 4AB9A 1Z8JB 2XW9A 1GHYH 4DURA 4Y79A 3SW2B 1GI8B 3RLWH 1EPTC 1OWDA 2J9NA 4IMQA 4WH8A 4R8TB 3LC5A 3MU1A 1ELCA 4X6MA 3G01A 4JZFH 3RXTA 4AORA 1Z8RA 4ZXYH 2P3UB 2D1JA 3O8DA 3V0XA 4AN7A 1SFIA 2WUBA 2XXLA 3L6PA 1G3EA 1HIAB 1V3XA 1D6WA 3PLBA 4CREA 1AN1E 1ANEA 2XBYA 4O03A 3LGWA 3BTTE 3SU6A 1DUEA 3P70B 2GP9B 1C1UH 3VFEA 3MH4A 4DVAU 4B1TA 1D6RA 1AUJA 3E16B 3K9XB 1AFQB 2VIQA 1P2OA 1FV9A 4Y71A 1UTNA 3S9AA 4BAQB 3CS0A 5HMAA 1SOZA 1WU1A 1VITG 1UHBA 5JB8S 2CF9H 1TGBA 3DT0H 4IMZA 4AFUA 1SHYA 1HAVA 1C2MA 3CP7A 2VVUA 1Z1IA 3RXDA 5E8EH 3AASA 1DS2E 1V2VT 2OXSA 2UUJB 1EAIA 1GHZA 1Y5AT 3T25A 3RM0H 2BDBA 2O8LA 3V13A 4MPUA 1C5TA 1KTSB 1BJUA 1C1MA 1C5PA 4F4OC 1X7AC 1FIZA 4YT6H 1A3BH 3RXHA 2B7DH 1G36A 3BG8A 1GJAB 1H8IH 2PV9B 2UWPA 2H9EH 1ARCA 1UVSH 2GV6A 2M5TA 5FX6A 4OS1A 1VR1H 1QY6A 3A7WA 3QX5H 1BMAA 5FCRA 1QR3E 3URCA 3BN9A 1GBAA 2OQ5A 1W12U 2C8XB 1ZPCA 2ILNA 2ANWA 1TPOA 2P94A 4Y10E 4K8BA 4NWKA 3SNEA 2TGDA 1AKSB 1GJ9B 2OC0A 1SGQE 1F0TA 1HJ8A 1OWEA 1SLXB 1SLWB 1IQHA 1HJ9A 5GXPA 1O2XA 2ALVA 1LHCH 1T4UH 3RC6A 2FOFA 3MNXA 3RU4D 1YLCA 4ISIH 5TCCA 1O3BA 5DP7A 5IDKA 3HPTB 4X1PU 1O5BB 8GCHF 1K21H 1P2KA 1TX6A 3FZZA 1GBKA 1SGRE 1GJ4H 2ZGBH 4BNRA 4DT7B 1UVOA 1ELBA 5E0JA 1UCYH 1ZYOA 4K2YA 4X2YA 2GZ8A 3OYPA 1V2ST 4K60A 1YPHE 4IGDA 1SVPA 3I29A 1O3PB 2DUCA 1TRMA 2BZAA 1HAOH 1DUAA 1AVGH 1WTGH 5ETXA 1A5HA 3SJKA 5JDUB 2UWLA 1A3EH 3E0NB 1SI5H 2PGBB 4XBBA 1O0DH 1TNHA 2ASUB 1O32A 1HAPH 2XBXA 5EU8A 2F9OA 1T32A 5HGGA 3GY7A 2Q6GA 3EA8A 2BXUH 1RIWC 4E05H 1AB9B 2AEIH 4NGAH 4LXBH 4IW4E 1ZZZA 3GDSA 1MQ6A 1DWCH 1FJSA 1WBGB 5F03A 3RXGA 4FUDA 2ESTE 2QF3A 1CA8B 1GMHF 3BTGE 3OX7U 1J8AA 1JOUB 4X1SU 1C2FA 5ESTE 3B8JA 1C5YB 2QV1A 1W14U 1Y59T 3TH2H 3Q3KA 2BQ6B 1NRNH 1FAXA 3A83A 1C1RA 3RXMA 1O2QA 1HFDA 1WOFA 3VB5A 2A32A 2ANKH 2GKVE 1OYQA 2BDIA 4CRBA 2UUFB 1MTNC 2CN0H 1JWTA 3SV6A 2STBE 3MHWU 3A80A 3GYMA 1SQOA 1C2KA 4K1EA 4HI3A 2AGIX 3SQHE 2Q6DA 4DY7B 3ZYDA 3GOVB 1FY5A 1WYKA 1C1OA 3K2UA 2UUKB 2QIQA 1UVPA 1C2DA 5C67A 1ZOMA 4QT8C 4CRAA 1SHHB 1O38A 2BB4A 2PKAB 1CHGA 1FONA 4BAOB 1C2LA 1YPKH 1SGFA 2ZHWH 2XRCA 1KLTA 1TNIA 5LH8A 1CU1A 1SMFE 2BVRH 3L33A 1K1LA 4A6LA 2ZPSA 3AVZA 3HGNA 1LO6A 2SGDE 3RMLH 2TRMA 1OXGA 4CBNA 1BBRH 4OS6A 1FIWA 3TJOA 3VB6A 4AYYB 3UQOA 3BTFE 4MG3A 5DP6A 1HIAA 2C8YB 1QB6A 2FODA 2FX6A 2XTTB 1GDUA 2ZFTA 3SJ9A 1SGFG 1P05A 1KLJH 2AH4X 2ZDNA 1DXWA 1HAGE 3ZVGA 1EJAA 1U6QA 1HUTH 1DM4B 3A85A 1ANDA 3MO9A 3RXPA 3GCTF 2BLVA 1BDAA 2AS9A 1Q31A 1MBMA 1O2RA 4D8NA 3DFLA 1YPJH 3TH3H 2UWOA 8ESTE 2RDLA 2Y6TA 1BTZA 4JYVH 3FANA 5DO4H 1TAWA 2ZDMA 2Z9LA 4INHA 1AGJA 1C5LH 4GHTA 4X8TH 1O2ZA 1GDNA 1MH0A 3RMMH 4GSOA 1CHOG 1IQEA 1S5SA 2P3TB 1BIOA 3MU4A 3EGKH 1G3BA 1AWFH 3QTVH 1F7ZA 2AGGX 3VGCB 4IC6A 2AERH 3OU0A 5EW1H 4Y7AA 1MTSA 2CMYA 3SU0A 2F3CE 1ZHRA 3KQEA 1ZMJA 2IJOB 7GCHG 2FO9A 2FOMB 4I8KA 3H5CB 4DGJA 1TQ7B 1IQFA 1QHRB 3T2NA 1V2RT 1GI2A 5A0BA 2I6QA 1TRYA 1FPHH 1O2IA 1O2TA 1C5MD 2ZTZA 1YCPH 3GY3A 1AKSA 2ZPRA