1C9PA

Complex of bdellastasin with porcine trypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of the antistasin-type inhibitor bdellastasin with trypsin and modelling of the bdellastasin-microplasmin system.
pubmed doi rcsb
source organism Hirudo medicinalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9pA02
1P9UA 5JBTA 1XXDA 1SG8B 4NZLA 2OC8A 2W3IA 3EDXB 5CMXH 1YM0A 2W26A 1BBRK 1SGTA 4HGCA 1C5ZB 3MU1A 1SQTA 1TMBH 5EQQA 1VZQH 2F91A 1GBEA 4WF8A 3A8BA 2W5EA 1AVWA 2Z9JA 1NFYA 2AMPA 3SU0A 1UVUH 4JZEH 2VWNA 4BAQB 1OWEA 1ZHMA 2ILNA 4QT8C 2G8TA 1DE7H 1TNHA 1S83A 4K1EA 4B2BA 1HXEH 1TNJA 4K1TA 3ZZ9A 4ZXYH 3IITA 3C27B 1LPZB 2BY8X 1CBWB 2G55A 1GMDG 1H9HE 1NS3A 5K0HA 1IQJA 1VITH 3ZZBA 5GDSH 4K3JA 1GMHG 4NZQA 1CA0C 3MH7A 1BMLA 3F1SB 1BHXB 1C1NA 4H4FA 3SN8A 3F9GA 3K65B 4K8BA 1GJ5H 2ZGXH 3SHCH 4D7FA 1P8VC 2FESH 2VINA 4X1RU 1FV9A 1BA8B 3SGQE 3I77A 1EOJA 1O30A 3RP2A 3PTBA 2Z3EA 1C2MA 2ZHEH 1MTNB 2CXVA 1QHRB 1FMGA 2EI7A 4CRDA 4JZDH 2H9TH 3GISB 3O8DA 1LMWB 2Y5FA 4DIIH 4TWWA 5DG6A 1FQ3A 9ESTA 1ELGA 2UWLA 4I8KA 4FVDA 4F4OC 3BTQE 3KL6A 5EOKA 1VR1H 3UWIA 1GI7B 5C2ZA 3MOCA 2WINI 1BOQA 3VPKA 1Z8JB 5DPAA 1P2NA 2VWOA 5FCRA 1JXPA 2SGFE 3HKIB 1KXCA 4BXWA 2A45B 1X7AC 1SR5C 4KKDA 1SGYE 1Y8TA 3QGNB 3TJNA 2FOBA 1ZRBA 2FZZA 3FP6E 2Z3CA 4ZKOU 1IAUA 4X1SU 2FI4E 1KIGH 1C5YB 1OKXA 4CHAC 1FXYA 3M7UA 2Z9KA 3A7WA 3H7OA 3OY5U 2GX4A 2PV9B 3DT0H 3UNQA 1MZDA 1TX6A 1BBRH 5ESTE 1YKTA 3SUGA 7GCHF 1O5BB 4FUIA 4Y8XA 2FPZA 1SFIA 1XX9A 2G81E 1ELAA 2G51A 1S82A 3K6ZA 3TIUA 3ZZ8A 1QL9A 4IS5A 3UY9A 4H42U 1HJ8A 2ZIQH 1PPGE 4Y71A 1TRNA 4FUDA 1KDQB 4AN7A 3L6PA 1K1JA 1O5EH 4AGKA 1OWIA 2STBE 3K9XB 1ELEE 5C67A 1LTOA 1OYQA 2P93A 4K1SA 2PSXA 1YBWA 4ABHA 4FUCA 2EEKA 3GY2A 3M3SA 3MWIU 2BDYA 1S6FA 3WY8A 3GDUA 4YO9A 5DO4H 1ZMNA 3A7TA 3LGYA 2XRCA 4NA7A 1Z8IB 2VVVA 5AFZH 1TGSZ 3EQ0H 1MCTA 2Y82A 3AW1A 2QGRA 4MPXA 2ZCHP 4B75A 1W0ZU 3FZDA 3P92A 1AD8H 4GHQA 1YPKH 4AYVB 1HAHH 5AHGH 1RGQA 2JETB 2BVSH 3STJA 2ZWLH 1HJAB 1O2SA 2A32A 1EKBB 1C1MA 3E3TA 5FBEA 1GJ8B 1FIZA 4JYUH 1IQGA 1W12U 4D9QA 1GI3A 3PO1C 1LVOA 1UHBA 3PLKA 1ABJH 2ODYB 3LKWA 5EW2H 1C2LA 1WBGB 2XC4A 2CF8H 2CN0H 1QTFA 3M36A 1TABE 2PHBA 1V6DA 3O8RA 1C1SA 1SGNE 2ODPA 3KF2A 1XUFA 2ZFFH 3A8DA 4Y7AA 1DANH 2ZCKP 1ANCA 1ESBA 1GMCG 2FLBH 3VXEH 2HGTH 1ZTJA 4LK4A 1B7XB 1YPLH 3A84A 2C8WB 2BQWB 1AKSA 1GI6A 3FP8E 4AG1A 1SPJA 2GCTB 3MU8A 2BM2A 1RTLA 3M5MA 3A83A 5TCCA 2HNTE 3RXVA 1PPZA 1MKXK 3A88A 1H9IE 5E2PA 5T6DA 1DWCH 1LHEH 1TBZH 1UTOA 2NU1E 1HIAB 5HM2A 1HCGA 1C5SA 1WAYB 2ZU4A 4RN6A 1GVKB 4XBDA 1C5XB 1FI8A 3R0FA 1F0TA 3BIVH 1F0RA 1FY5A 2GT8A 3SU5A 1E35B 2JH6D 4KGAA 1FY1A 8GCHG 4ISOA 3LGIA 1O2IA 4HTCH 1DPOA 1OSSA 2GMTC 4Y76A 1BTHH 4E7NA 1HDTH 1BT7A 1MTNC 2ZQ2A 3U69H 2BD9A 1XKAC 3ESTA 2BMGB 3Q00A 3U1JB 4DCDA 3QN7A 2UUJB 1KXEA 1DVAH 4Y0YE 3SUFA 1BTWA 3M3VA 4Q7YA 4VGCC 3SV7A 3BSQA 3OSYA 3CP7A 1O3LA 1MKWH 1S0QA 2Y80A 1GBHA 5DJ7A 1E36B 1DICA 3M7TA 1UMAH 5FX5A 4IW4E 1MD8A 2BHGA 1O2PA 3Q76A 1Q31A 1G9IE 3RMMH 2WPJS 1HAVA 5FBIA 2ZPRA 1ELTA 3CS0A 4BTTB 5EPNA 1L2EA 3ZZ4A 1D3QB 1GBJA 1CGIE 3SZNA 1G32B 4XOJA 3P8GA 3RXLA 1N6XA 1GDQA 4ISLA 3RMOH 2Y7XA 1T4VH 3PMHB 1HAOH 3BEUA 2W7SA 1GCTC 4TYDA 3W95A 3BG8A 2PUQH 2AIPA 1L0ZA 1ZOMA 1CHOG 4DURA 2P94A 2ZFTA 1XMNB 2VIPA 5L2ZH 4ISHH 4DY7B 1HAXB 1QA7A 1O3CA 1GHXH 1C5MD 2XBVA 1D6RA 1HAPH 4CRFA 1DOJA 1Z1JA 2ZDAH 1DITH 5FPTA 3A81A 1C2KA 1ARCA 2XBWA 4JCNA 2VGCB 4WVPE 4GSOA 3S7HB 5F8XA 1PPFE 3PB1E 3E0PB 3OYPA 1ZPZA 2O8TA 2BY7X 4GCHG 1TE0A 2ZFSA 3PWBA 1H9LB 4IBLH 3P8NA 1W14U 2BD7A 1S81A 1D3PB 2VU8E 3UOPA 4FUEA 4I32A 1GJCB 1V2PT 3BTWE 5EGMA 1LCYA 3A85A 2AEIH 2V0BA 1BTUA 3UQVA 3GCHB 2OLGA 4B2AA 1MU8B 3M37A 2ZPSA 1UK2A 3ELAH 4X2XA 1QIXB 1O2KA 3I29A 4BTIB 4D9RA 1O39A 1FPCH 3ZV8A 1GBCA 4FUBA 1GWAA 1A0LA 3VGCC 4ABEA 1QR3E 4XDEA 1G3DA 4NSVA 2BLOA 2PKAB 1UTPA 2XYAA 3DA9B 4X1QU 1K1OA 4SGBE 1P02A 1TNIA 1BBRE 1V3XA 3OU0A 1DWDH 1AUTC 1TRYA 3PMJA 3JZ1B 3M7QA 3SGAE 4ZAEA 5CHAC 4VGCB 1D6WA 1K9OE 3LPRA 5JYIA 2WV5A 5A0AE 1JBUH 3ZVFA 4AFUA 3TU7H 1UCYK 3VB7A 2IPHA 1OWJA 3KHVA 2FYRA 1P06A 1RD3B 2QY0B 3A8AA 1GG6C 1MCVA 1WCZA 2OUAA 5A8YA 1XUHA 3UNSA 2J94A 4CHAB 2Y5HA 1XVMA 2O8LA 3LU9B 5E8EH 2BXTH 2YOLA 4FU7A 2BD8A 1DY9A 1CHGA 4K2YA 4ABAA 3NCLA 1IQMA 2PKAA 4O03A 1HAVB 2FI3E 1HAIH 2YNAA 1DS2E 1C5PA 3M61U 1WQVH 2CGAA 2QF0A 5HGGA 4WXIA 3NWUA 2Q1JA 2ZGBH 4NIXA 1YCPM 4OGXA 1W13U 3W94A 3RXJA 1IQLA 2RCEA 1Y3UA 1C9TA 2V3OH 3QDZB 5DP8A 6GCHG 1O3BA 4NA8A 3RXEA 3HGPA 2J38A 1P2OA 2ZCLP 1GGDB 3BTME 1ZHRA 1SHYA 1HRTH 2SGPE 5CE1A 3RU4T 1K21H 3MNXA 1TNGA 2ODQA 2ZC9H 4KELA 2QXHA 6GCHF 4GUXA 3TJUA 1C2IA 2BD4A 3KQEA 4KTUA 1GMHF 4DIHH 4X1NU 2BDBA 1SC8U 2C8YB 1ZGIA 2ZDVH 4INLA 1GHWH 1LHGH 1O2NA 2F83A 3GCHC 2FOEA 4WH6A 1DUAA 1GJ6A 1Z7KA 2FOHA 2ALPA 4HI3A 2SGDE 4R0IA 2F9OA 1C1PA 1S6HA 2TIOA 1O33A 5FX6A 1DWBH 1BJVA 4MTBA 4HZHA 2CV3A 3TITA 4BAKB 2ZHDA 3V12A 1C5OH 4ZMAH 1JIMA 1EXFA 2ZF0H 1ZSKA 2G5NA 4ABGA 1Y5AT 1NFXA 3D49H 2GCHF 1BTXA 4GHTA 3RXBA 2HALA 2VIOA 2EA3A 5HXFA 1K1PA 2HLCA 4XBBA 3A7VA 1CQQA 4AOQA 2J92A 2XNIA 3CS7A 1FN8A 1AGJA 4YTAA 1KXDA 3LGUA 1FAKH 5SGAE 2ZG0H 1GDNA 3SNDA 1SLVB 1Q2WA 2QN5T 4FVBA 2WPLS 3M5NA 1SGRE 2EC9H 4ZHAA 2ZDLA 1DM4B 3GY3A 1OWDA 3T26A 2AS9A 2OQUA 1TGCA 2Z6BD 1GVLA 2QXIA 1BUIA 4Q7ZA 1S0RA 4CRGA 3RU4D 3TVJB 1HBTH 1TALA 4MNWA 2LPRA 2P3FH 4X8TH 3TGJE 3LJJA 4X2YA 2JKHA 4NWKA 1TNLA 3LONA 2FM2A 3SORA 4YZUA 5FHTA 1EATA 4MPUA 3AVZA 3GY6A 4YLUA 2ZU3A 3GDSA 1SB1H 3FFGA 3HK6B 1OP8A 1SMFE 1OOKB 2GMTB 4TWYA 2O8WA 1AVXA 1KYNA 3RM2H 2D2DA 1F0SA 2IJOB 5EXLA 1AMHA 2EI8A 1O5GH 4I33A 3VGCB 2BLQA 4CBNA 2OC7A 2D8WA 3NZIA 1BB0B 1C5WB 1OS8A 1TPAE 1Z6EA 2BVRH 2FEQH 1L1JA 3GDVA 1T7CA 2GKVE 4BAMB 1O2XA 2I6SA 3LH3A 1LPGB 1YCPK 4ZKSU 4UE7H 3URDA 2XCFA 1LQDB 1A5IA 3BTEE 1UK3A 2J95A 2BXUH 5EPYA 1GMCF 2BLVA 3SNAA 4LZ4B 1DDJA 3P95A 1P05A 1GHVH 1P3CA 4E05H 1HYLA 3NPSA 1TGTA 2ZEBA 2A7JA 1LQEA 4FUHA 5T3HA 3TH4H 1G3BA 4UFEH 1JRTA 1W3CA 1SHHB 4HFPB 3TGKE 5L2YH 3FANA 2VJ1A 1P3EA 1DLEA 3IWMA 4Q7XA 3VFEA 3QK1A 4NFEA 5A8ZA 3SHAH 1JRSA 1UTJA 3A7YA 3RMNH 2UWOA 5A0CA 1KXBA 3MNSA 1C4V2 1ELVA 4KTCA 3E16B 4UONA 2LNCA 3M5LA 4X8VH 1Z1IA 2A31A 2IN2A 1TONA 3GCOA 4THNH 3SBKA 2H9HA 1P04A 3ODDA 3SU3A 2P16A 3RLYH 2TGPZ 3LGVA 4TY7A 1GHAF 1TPOA 1GCTB 3BTHE 6CHAB 5DP9A 2QAAA 1AHTH 3EAJA 4OS7A 5C3NA 1AKSB 1MTSA 3QUMP 1QB1A 4DOQA 5G4BA 1ZTKA 1QL7A 3PTNA 1F5KU 3AASA 3RXKA 1QURH 1AO5A 1CT2E 1P57B 3MMGA 5C1UA 2BOHB 3MH5A 5JBBS 3BEIB 1A0JA 4FXGH 3ZZ5A 2OP9A 1GDUA 1IQFA 1ZPBA 1MMJN 3BTGE 1C5NH 1UVTH 3AAVA 3F9FA 2OXSA 1EPTA 3P17H 3SQEE 2Y6TA 3A80A 1ZJDA 2BDHA 8GCHF 4H6TA 1YCPH 3E1XB 4Q2KA 1SGCA 4IN1A 4DT7B 3BTKE 4I31A 2YNBA 1GI2A 1ZJKA 2CHAB 1A1RA 1C2FA 1KSNA 2PLXA 1H8IH 3MU0A 2BOKA 5DKMA 1BRCE 1ETSH 3BV9B 2ZFQH 2OINA 4ISNA 1AB9C 1S85A 1NRQH 4Y6DA 1UVOA 3RXSA 3RXTA 1YPHC 1YC0A 1A3EH 1T32A 3RXOA 3L3TA 4ASHA 1BMNH 1MQ5A 1EZXC 4CR5A 4OS6A 1C1OA 2SNVA 3STIA 4XBCA 2A4GA 3BTTE 3U8TH 4AORA 1CE5A 4ESTE 1GCDA 2NU3E 3ATKA 1HV7A 1ELBA 3U8OH 1BTZA 2ZDMA 2TRMA 3T62A 5TJXA 4AX9H 1D4PB 1GI5A 4WH8A 1O2LA 5LGOA 4DGJA 5ABWA 1HNEE 3ODFA 3Q3XA 1O3HA 3MNBA 3LDXH 4AG2A 1B5GH 3GCNA 3TK9A 2DUCA 4OS2A 1UTNA 1O2YA 1SLUB 1RXPA 1F0UA 2V6NA 4PROA 4E06H 1GI9B 1AUJA 2ZZUH 5I25A 4K69A 4GLYA 3UTUH 1Y3YA 2C3SA 5EG4A 3GICB 3OTJE 3VB6A 4X2VA 1AFQC 1U6QA 2FI5E 1V2RT 4U2WA 3QZRA 1V2UT 4M7GA 1DUEA 2FTLE 2G00A 1O5AB 4X8SH 1ARBA 1EASA 3DFLA 4MQAA 3H7TA 3UREA 3FAOA 3K2UA 3QO6A 4MVNA 1V2KT 1P12E 4NIVA 2VVCA 3V0XA 3VB4A 1GI4A 4AZ2B 3TPIZ 7KMEH 2W3KA 2GT7A 1TAWA 2AIQA 2HPPH 3LOXA 2B9LA 4O3TA 1EB2A 1K1MA 3DD2H 1YYY1 3OY6U 1O3DA 1O3GA 1KTSB 1QRXA 4X1PU 1GHZA 4NA9H 2WUBA 4GCHF 5JB8S 5A0BA 2QIQA 3D65E 3EGKH 3DFJA 3LC5A 4YT7H 2R9PA 3ITIA 1TNKA 1MKXH 2ZU1A 1PFXC 1MTWA 1PQ7A 4X6NA 1O2RA 2QXGA 2ZDNA 1V2TT 3RXFA 2ZFRH 4NCYA 2JH0D 4Y0ZE 1YPHE 3RXRA 3A8CA 5EQSA 2A0QB 2BY6X 2JETC 1QCPA 3RXUA 2BZ6H 1LPKB 1ZPCA 1WQSA 2JH5D 2O8MA 2B8OH 4FU9A 1TX8A 3BN9A 1D3DB 2ASUB 2ZDKA 1P2KA 3N7OA 1FN6A 1V2LT 2GTBA 1XKBC 2Z9GA 6ESTA 3EYDA 1FPHH 1NRRH 2NU0E 1PYTD 1KDQA 4B1TA 1QBNA 1QJ7B 1W2KH 1XM1A 1UVSH 2ZNKH 4U01A 3F9EA 1MAYA 1EOLA 1E0FD 1ZMLA 2HNTF 4LXBH 2FX6A 1GL0E 1H1BA 2FOCA 2FOGA 1AZZA 3M5OA 1NFWA 4JZIA 3ENSB 5FXLA 1ZSJA 3KGPA 3ATLA 4O97A 1O3NA 7ESTE 1C2JA 1QB9A 5DK1A 1NU9A 1WUNH 4IGDA 3FVFB 1ELCA 1GBKA 4AFZA 2Z9LA 2EI6A 3T5FH 1SVPA 1ID5H 1HAYB 1EUFA 1HXFH 4A1VA 3V7TA 1GI1A 1AE8H 1MKWK 2VVUA 1ANDA 1NRPH 1OWKA 4B71A 3GY5A 3URCA 1L4ZA 1ZR0A 4WMDA 4X2WA 1ZMJA 5BRRE 5E2OA 2ZGCA 1JMOH 4J2YB 1C1VH 1UTKA 1GI0A 2PKSB 3SNBA 4A1TA 1P2IA 5JBAS 1P01A 5AFYH 1IQNA 4DJZB 2AGIX 2AH4X 4BOHA 1EZQA 2QF3A 2XW9A 3NXPA 5JDUB 1V2WT 4AFSA 1BMAA 1WSSH 2CF9H 1SGDE 1G2LA 2FTMA 1Y5UT 2BLWA 4H6SB 2WV4A 4J1YA 3OX7U 5JPMH 4JZFH 4D8NA 4MNXA 2WPHS 2ZFPH 5LPFA 1GMDF 2A5IA 3G01A 1M9UA 1QFKH 4CR9A 4UFFH 1UTQA 2ZO3H 1MTUA 3VB5A 1BTPA 1O2JA 1QJ1B 4X6MA 1TRMA 1UO6A 1EZUC 1V2QT 2VIDA 2DE9A 1GBFA 3PMBB 4D7GA 1TOMH 1CGHA 1CT0E 3RC5A 1FIWA 2NWNA 2FLRH 3ZYDA 2ANWA 1SGFA 4ABJA 1AWHB 3PV4A 1O3FA 1SGQE 3QX5H 1GJ7B 3FP7E 3LIWA 1N8OB 1THRH 4A1XA 1AY6H 4IMQA 1N8OC 1OYTH 7GCHG 1NESE 4OS5A 3KQCA 1Y59T 3RC6A 1XUIA 1IQEA 3GCTF 2ZTZA 2Z3DA 2BDAA 1DX5M 2OD3B 3SV8A 3UOUA 4UFDH 2DE8A 2HRVA 1TPSA 4BTUB 3ZZCA 3BF6H 1C9PA 4WJG2 3MHWU 2GCHG 2ZECA 4SGAE 8KME2 1ACBE 5EODA 5C20A 2PW8H 1MU6B 3SV6A 3EA8A 3HK3B 1ZTLA 1IOEA 2HWLB 3ATIA 2GVFA 2KAIA 3BTDE 4FUGA 1DY8A 2A5AA 1O2MA 1P0SH 3MO6A 2WPIS 2AMQA 3SNCA 1SGFG 5C1YA 1FDPA 2PGQB 3P8FA 5I46H 4NIYA 4UD9H 2R3UA 1V2MT 1FJSA 4U30A 3E91A 4XE4A 1FLEE 3AAUA 1SI5H 4BXSA 3DUXH 4Q80A 1UCYH 5A8XA 2BX3A 2UUKB 2RA3A 1O3EA 3RMLH 3ZZ3A 3MTYA 1EAIA 1PPCE 1RJXB 3HPTB 3UFAA 2AFQB 1ZHPA 4CBOA 2J4IA 4NSYA 4CRAA 5JBCS 3ZZ7A 1P03A 1C2GA 3JZ2B 1FY3A 2H5DA 4Y79A 3RXMA 1O3MA 3BG4B 1F2SE 1O3IA 1CT4E 5F8ZA 1BIOA 2CHAC 5AVDA 2PFEA 1PQ8A 2XBXA 1TPPA 1B0EA 5IYTA 1AB9B 1N1LA 1GHBF 2KAIB 1ZZZA 3QTVH 1IQHA 2H2ZA 1NPMA 2H6MA 4ABDA 5A2MH 3EA7A 1LVYA 4JYVH 2OCVB 1GL1A 1ELDE 5J4QA 4GPGA 8ESTE 2F9VA 3S69A 3AW0A 4JZ1A 3P6ZB 3RXQA 5JB9S 1V2NT 1C1WH 3TK6A 1GVZA 2A4OA 1A7SA 2PTCE 1ETTH 3SV9A 3Q3YA 4O3UA 2D1JA 2WYGA 3KQBA 2A7HA 3S0NA 1THSH 4B74A 2GDDA 1G36A 4X6OA 1BJUA 5B6OA 3ZVCA 3A86A 1HLTH 4RKJB 1W11U 2BQ6B 2BDCA 4WMEA 2GDEH 2VNTA 4B2CA 5K7RA 1C1TA 1FY8E 5F8TA 5J4SA 4WXVA 1BHXF 1C2HA 1J14A 2WPMS 1TBRH 3EA9A 2I6QA 8LPRA 2ULLA 1UHBB 2AMDA 2BD5A 3KN2A 1QGFA 4TPYA 1W0YH 3RXDA 1Z6JH 2F9UA 1O2OA 1OX1A 1BZXE 3RC4A 3ZVAA 1NRNH 4ABFA 1J17T 1CGJE 1O3AA 1MZAA 1O2ZA 2Q6DA 1O37A 1VGCB 5ESBA 1P2MA 4YM9A 1VGCC 1IHTH 1Z8GA 4XFQA 3E8LA 2BTCE 3TJVA 2CMYA 1KLTA 4UFGH 1MD7A 2A1DB 3ZVBA 2XC5A 2Y81A 1K28D 5AF9H 1W7XH 1QJ6B 2F9NA 1NT1A 2A7CA 1ZYOA 2Z7FE 1A0HB 1S5SA 3M35A 3SO3A 2O9QA 1UJ1A 1A5GH 2W7UA 4NWLA 1K1NA 1O36A 4YLQH 5DP4A 1XUGA 4Y10E 3MI4A 3EE0B 1TMUH 3PROA 4ZHMU 3MH6A 4GVUA 1V2JT 2BDGA 2OBOA 3F68H 4JYTA 1H8DH 4JK6A 1HJAC 1N6YA 4BANB 4AGJA 4MLFB 1RIWC 3U1IB 4RSPA 1QL8A 3ZZDA 3SJ8A 1TBQH 1GBIA 3U98H 6LPRA 1TYNA 1VCQA 4FUJA 3C1KA 2ZU5A 5GIBA 3SGBE 1AI8H 1W8BH 2C4FH 2R2WU 1HPGA 1AN1E 2V35A 4NG9H 1MBQA 1VJ9U 1L1NA 4OS1A 3V13A 2HNTC 1JWTA 1ESAA 3BEFB 1VJAU 1DWEH 4YT6H 1INCA 4IC5A 4ISIH 2SGAA 1XUKA 4DG4A 4A5TS 4A6LA 2G52A 2WPKS 4IMZA 2BDIA 3T2NA 1KY9A 2XBYA 2P8OB 4LZ1H 2FYQA 3GY8A 4NGAH 1TMTH 2GCTC 3LJOA 5E0GA 4YOGA 1J9CH 4B76A 4BNRA 2H9EH 3SI3H 4FU8A 2NU2E 2Q6FA 3HGNA 4OGYA 4JK5A 1BMMH 2IOTA 1F7ZA 1XVOA 3E0NB 1RRKA 2ALVA 1EPTC 1HGTH 3GYMA 1F92A 4FUFA 1ANBA 1NRSH 1CBWC 2FMJA 3D62A 3SUDA 1ETRH 1GBBA 3HKJB 1NFUA 3UWJH 1T31A 2A5KA 1EP5A 1LVBA 1MQ6A 1JIRA 2RG3A 2ANKH 1GJ4H 1LHCH 1EB1H 2F9PA 1C1RA 2O8UA 1A3BH 3HATH 1EZSC 3UQOA 1HFDA 1GHYH 2Z94A 4E7RG 5FAHA 1O2GH 4CRBA 3ATMA 1VITF 5GCHF 1BRUP 1SLWB 4OS4A 1EAUA 2QCYA 2BY5X 1D9IA 1O3KA 1C5UA 5H4IB 2AGEX 3SJOA 1Q3XA 3O8CA 5BPEA 4A92A 1GBTA 4YOIA 4MG3A 2TGTA 2BVXH 2C8ZB 2XWBI 4I7YH 3BIUH 1F5LA 3ZZ6A 2V3HH 1PPHE 2QV1A 1YLCA 2FODA 1A61H 1NY22 1SLXB 2ZI2H 2J9NA 5CHAB 1PPBH 1P11E 3GY4A 3PLPA 4NFFA 1HUTH 7LPRA 1EJMA 1BCUH 1DSTA 1W10U 1QBOA 3FZZA 3SU2A 3A82A 3ZZAA 4X0WU 1O5CB 1SBWA 3ZVGA 1GG6B 1SQAA 1CU1A 2VIQA 2VIWA 1OWHA 2QA9E 4Z0KA 2P3UB 3F9HA 5LPEA 3PWCA 1O34A 1RIWB 1NN6A 1GJAB 2ZGHA 1NTPA 2F9BH 2QYIA 1TGBA 1A5HA 3RUOA 2BD3A 1O5FH 1QA0A 1Y3VA 5EU8A 3KQDA 1EAWA 1O5DH 3ZV9A 1TWXB 4UEHH 3PLBA 1Z8RA 1KLJH 1J15A 2SFAA 3MH4A 3QGJA 1DXWA 2XXLA 5EQRA 4IC6A 3R3GB 2FOMB 4I8HA 1O2HA 2ANMH 1DXPA 2R3YA 2Z9IA 3ZYEA 1ELFA 4UDWH 4MNVA 2TGDA 5F6MA 1O2TA 1YGCH 1W7GH 1P09A 1MH0A 1Y3XA 2ZKSA 3MYWA 5FPYA 1C5RA 1SFQB 3UR9A 3IG6B 5DP5A 1GGDC 2QC2A 1PYTC 3LGTA 2ZU2A 3I78A 1FONA 3NUMA 3UPEA 1XUJA 1QBVH 1EJNA 1C4U2 2PSYA 4I8GA 5DP6A 3SI4H 1LKAA 3TJOA 1IQKA 3RLWH 3A89A 1O2QA 3SW2B 1MUEB 2VIVA 5EXMA 1HAGE 4I8JA 1OXGA 2D26C 2Y7ZA 1UCYE 2ZQ1A 1CSOE 1YLDA 2ESTE 4BAHB 1QB6A 4ZXXH 1UK4A 3BG4C 1C2EA 5FPSA 1T8LA 4Y8ZA 3UR6A 1FNIA 5DP3A 2NU4E 1CVWH 3GCTG 4ZUHA 2XWAA 2ZPQA 5T6GA 3S9BA 1ZRKA 2C90B 1GBAA 2Y5GA 3RXCA 2R2MB 4K60A 4WY3A 3VB3A 1TGNA 2B5TB 2OC1A 1G3CA 4U32A 1V2VT 2XTTB 1C2DA 4Y11E 2XC0A 4WWYA 2OC0A 1C5TA 2GGVB 1EAXA 3E90B 4ZH8A 5EXNA 1O2VA 2GV6A 1OPHB 3RU4E 5E0JA 1FAXA 2P8OC 1K22H 3KEEA 2FS9A 2GZ7A 2M5TA 4YOJA 1GBLA 3ZVEA 1O2WA 3SQHE 2FP7B 1TOCB 1TFXA 1YPEH 2GV7A 2P95A 1WV7H 4IN2A 3Q77A 1QRWA 1AWFH 2BYAX 1LHDH 4NIWA 2GD4B 1UTMA 2FS8A 5EW1H 1FY4A 5IDKA 1OP2A 2SNWA 3T25A 3A87A 3SOSA 4CRCA 1RTKA 3QWCH 1LHFH 1YPJH 4K5ZA 1P9SA 1QQ4A 3V3MA 3TNTA 1SGEE 1G37A 2F3CE 1NM6A 1T4UH 1CA0B 2HPQH 1EX3A 5T6FA 4WMFA 1DFPA 4BAOB 3CENA 5GJ4B 1A46H 2SGQE 1PJPA 3PM3A 1K2I1 3SJ9A 5A09A 2AERH 5DGJA 1F5RA 4X8UH 2FXRA 4CH2B 5L30H 1GHBG 2AGGX 2HOBA 3U9AH 1FZZA 2UUYA 1NZQH 5GWZA 2OTVA 2K1QA 3A7ZA 3UNRA 2J34A 4CH8B 1AU8A 2B0FA 1SGPE 1CA8B 1T8NA 2ZA5A 3GY7A 1NC6A 2ZTYA 1TQ0B 4KP0A 4O9VA 4JMYA 2A2XH 3RXHA 1QY6A 1O32A 1C1QA 2THFB 1VCWA 1TLDA 1KXAA 3SU6A 1G3EA 1GJBB 3E6PH 2OQ5A 1AQ7A 1G30B 5E0HA 1HJ9A 4ABBA 4ZHLU 1GHAG 3MNCA 1GPZA 2FDAA 3PYHA 1BITA 1AZ8A 2H1UA 3P70B 1IHSH 1GBMA 1A4WH 2FX4A 1TQ7B 1TB6H 3MO3A 1QNJA 1C5QA 1YP9A 3QZQA 2PR3A 3B23B 5C5NA 4F49A 1O0DH 2C93B 2QXJA 4RKOB 3P8OA 1NU7B 2VB0A 2GP9B 1KXFA 1DSUA 1FUJA 3M3TA 2BQ7B 5C1XA 3SUEA 2HVXA 1PQ5A 1IQIA 4GAWA 1WTHD 1A2CH 6CHAC 2ZHQH 3UIRA 1AVGH 1E34B 1E37B 1ABIH 5HYOA 1C4Y2 1KLIH 1KTTB 1L1GA 3LGWA 4MPVA 3VEQB 3S9CA 2UWPA 4R8TB 4D76A 2PWXA 3TH3H 3LC3A 1J8AA 1L4DA 1GBDA 3PMAB 2VGCC 1UTLM 4DW2U 4TPIZ 2PTNA 5LH8A 1PQAA 4MNYA 1GI8B 1RS0A 2BB4A 4X6PA 1BQYA 2ANYA 2A4QA 3RDZA 1D3TB 2VH6A 1PPEE 2J2UA 3S7KB 1BRBE 4AB8A 3D23A 2AYWA 1HB0B 5GXPA 3RXPA 1K1LA 1V2OT 4ABIA 3U8RH 3H5CB 5PTPA 1XXFA 2A2QH 3Q3KA 1MAXA 1EPTB 1ESTA 1SQOA 1WYKA 1QQUA 3NKKA 3LT3A 1JOUB 1WOFA 3KIDU 2BD2A 3F6UH 2GZ8A 1Z71A 3L33A 1CO7E 3PO1B 1QRZA 3MFJA 3GYLB 1RFNA 2H5CA 3TGIE 3SNEA 2B7DH 1T8OA 1LVMA 2ZGJA 4YESB 1EP6A 5FCKA 1GJDB 1RTFB 1SOTA 2G5VA 4CREA 5DP7A 4ZKRU 2BZAA 3T29A 2P59A 1LDTT 2TBSA 3B8JA 3MU5A 1H4WA 1BDAA 1B0FA 3T27A 1YPMH 1SGIB 4K8YA 2SGEE 1P2QA 3MU4A 1O3OA 1NROH 1CHOF 4B73A 1HAZB 2P3TB 3ATWA 1C5VA 1MTVA 4MPWA 9LPRA 2GZ9A 4I8LA 2R0KA 4AFQA 1SSXA 1E38B 3SJIA 1ZGVA 2FOFA 1HIAA 4INHA 3TLOA 2UUFB 1LKBA 1BTYA 1VCPA 4MDSA 3SV2H 1WU1A 2C8XB 2PGBB 2WYJA 5HM9A 1MBMA 1NO9H 2STAE 2VWLA 1S84A 1TX7A 3T28A 4Y7BA 3TH2H 1EJAA 2PKSC 3RXIA 2OBQA 2TGAA 3NK8A 2G4TA 2FWWA 1OP0A 4KTSA 1AFQB 1O31A 1O38A 3GOVB 1P2JA 2A4RA 3K6YA 3SU1A 3DHKH 3TK5A 4AYYB 1TA6A 2ZTXA 2BX4A 3SJKA 4ZKNU 1TA2A 3BTFE 1V2ST 2VH0A 3KNXA 1G2MA 4A7IB 1C1UH 5L6NH 2VWMA 1DT2A 4Y8YA 1VITG 3A7XA 1O2UA 5GCHG 4DVAU 5TCAA 1YF4A 2Q6GA 1O3PB 1LO6A 5LPRA 1AE5A 2TPIZ 3QLPH 1J16A 1O35A 2RA0A 4INKA 5GPIB 2FOAA 3O8BA 1TIOA 1YPGH 3VXFH 2RDLA 5HMAA 2ZP0H 1Y5BT 3B9FH 2CJIA 1DLKB 1SL3A 1UVPA 1Y3WA 1O3JA 1BRAA 2WUCA 2G4UA 4Z6AH 1P10A 2FO9A 3TNSA 3UUZA 5C5OA 2ZHWH 4AB9A 1K1IA 1ANEA 4LOYH 1GJ9B 3KCGH 5F03A 3RXGA 4XSKU 1C5LH 1THPB 3RXAA 1ORFA 1ZSLA 3QTOH 2R0LA 3S9AA 1WTGH 3SU4A 1AIXH 2ZHFH 2FIRH 1T8MA 1EQ9A 3RM0H 5ETXA 1SOZA 2PUXB 4ZROA 2BY9X 3MO9A 4TY6A 3ZVDA 1AFEH 3LH1A 2XCNA 1ZLRA
chains in the Genus database with same CATH superfamily
1P9UA 5GNDA 5JBTA 1XXDA 4ZCNA 1SG8B 4NZLA 2OC8A 2W3IA 3NRLA 3EDXB 5CMXH 1YM0A 2W26A 1BBRK 1SGTA 4HGCA 1C5ZB 3MU1A 1SQTA 1TMBH 5EQQA 1VZQH 2F91A 1GBEA 4WF8A 3A8BA 2HVYB 2W5EA 1AVWA 2Z9JA 1NFYA 2AMPA 3SU0A 1UVUH 4JZEH 2VWNA 4BAQB 2CK3D 1OWEA 1ZHMA 2ILNA 4QT8C 2G8TA 1DE7H 1TNHA 1S83A 4K1EA 4B2BA 1HXEH 1TNJA 4K1TA 3ZZ9A 4ZXYH 3IITA 3C27B 1LPZB 2BY8X 2KCYA 1CBWB 2G55A 1GMDG 1H9HE 1NS3A 5K0HA 1IQJA 1VITH 3ZZBA 5GDSH 4K3JA 1GMHG 4NZQA 1CA0C 3MH7A 1BMLA 3F1SB 1BHXB 1C1NA 3H09A 4H4FA 3SN8A 3F9GA 3K65B 4K8BA 1GJ5H 2ZGXH 4XRNA 3SHCH 1P8VC 2FESH 2VINA 4X1RU 1FV9A 1BA8B 3SGQE 3CNRA 3I77A 1EOJA 1O30A 5KGOA 3PTBA 2Z3EA 1C2MA 2ZHEH 3RP2A 1MTNB 2CXVA 1QHRB 1FMGA 2EI7A 4CRDA 4JZDH 2H9TH 3GISB 3O8DA 1LMWB 2Y5FA 4DIIH 4TWWA 5DG6A 1FQ3A 9ESTA 1ELGA 2UWLA 4I8KA 4FVDA 4F4OC 3BTQE 3KL6A 5EOKA 1VR1H 3UWIA 1GI7B 5C2ZA 3MOCA 1VKYA 1BOQA 2WINI 3VPKA 1Z8JB 5DPAA 1P2NA 2VWOA 5FCRA 1JXPA 2SGFE 3HKIB 1KXCA 4BXWA 2A45B 1X7AC 1SR5C 4KKDA 1SGYE 1Y8TA 3QGNB 3DSOA 3TJNA 2FOBA 1ZRBA 2FZZA 3FP6E 2Z3CA 4ZKOU 1IAUA 4X1SU 2FI4E 1KIGH 1C5YB 1OKXA 4CHAC 1FXYA 3M7UA 2Z9KA 3A7WA 3H7OA 3OY5U 2GX4A 2PV9B 3DT0H 3UNQA 1MZDA 1TX6A 1BBRH 5ESTE 1YKTA 3SUGA 7GCHF 1O5BB 4FUIA 4Y8XA 2FPZA 1SFIA 1XX9A 2G81E 4Z1MD 1ELAA 2G51A 1S82A 3K6ZA 3TIUA 3ZZ8A 1QL9A 4IS5A 3UY9A 4H42U 4DT4A 1HJ8A 2ZIQH 2WV9A 1PPGE 4Y71A 1TRNA 4FUDA 1KDQB 4AN7A 3L6PA 1K1JA 1O5EH 4AGKA 1OWIA 2STBE 3K9XB 1ELEE 3SZEA 1LTOA 1OYQA 2KM0A 2P93A 4K1SA 5C67A 2PSXA 1YBWA 4ABHA 4FUCA 2EEKA 3GY2A 3M3SA 3MWIU 2BDYA 1S6FA 3WY8A 3GDUA 4YO9A 5DO4H 1ZMNA 3A7TA 3LGYA 2KCAA 2XRCA 4NA7A 1Z8IB 2VVVA 5AFZH 1TGSZ 3EQ0H 1MCTA 2Y82A 3AW1A 2QGRA 4MPXA 2ZCHP 4B75A 1W0ZU 3FZDA 3P92A 1AD8H 4GHQA 1YPKH 4AYVB 1HAHH 5AHGH 1RGQA 2JETB 2BVSH 3STJA 2ZWLH 1HJAB 1O2SA 2QE7D 2A32A 2RDEA 1EKBB 1C1MA 3E3TA 5FBEA 1GJ8B 1FIZA 4JYUH 1IQGA 1W12U 4D9QA 1GI3A 3PO1C 1LVOA 1UHBA 3PLKA 1ABJH 2ODYB 3LKWA 5EW2H 1C2LA 1WBGB 2XC4A 2CF8H 2CN0H 1QTFA 3M36A 1TABE 2PHBA 1V6DA 3O8RA 1C1SA 1SGNE 2ODPA 3KF2A 1XUFA 2ZFFH 3A8DA 4Y7AA 1DANH 2LP6A 2ZCKP 1ANCA 1ESBA 1GMCG 3ZIAD 2FLBH 3VXEH 2HGTH 1ZTJA 4LK4A 1B7XB 1YPLH 3A84A 2C8WB 2BQWB 1AKSA 1GI6A 3FP8E 4FETA 4AG1A 1SPJA 2GCTB 3MU8A 2BM2A 3KYFA 3W1EA 1RTLA 3M5MA 3A83A 5TCCA 2HNTE 3RXVA 1PPZA 1MKXK 1WDIA 1H9IE 3A88A 5E2PA 5T6DA 1DWCH 1LHEH 1TBZH 1UTOA 2NU1E 1HIAB 5HM2A 1HCGA 1C5SA 1WAYB 2ZU4A 4RN6A 4TT3D 1GVKB 4XBDA 1C5XB 1FI8A 3R0FA 1F0TA 3BIVH 1F0RA 1FY5A 2GT8A 2KR7A 3SU5A 1E35B 2JH6D 4KGAA 1FY1A 8GCHG 4ISOA 3LGIA 1O2IA 4HTCH 1DPOA 1OSSA 2GMTC 4Y76A 1BTHH 4E7NA 1HDTH 1BT7A 5HIZA 1MTNC 2ZQ2A 3U69H 2BD9A 1XKAC 3ESTA 2BMGB 3Q00A 2F43B 3U1JB 2YMSD 4DCDA 3QN7A 2UUJB 1KXEA 1DVAH 4Y0YE 3SUFA 1BTWA 3M3VA 4Q7YA 4VGCC 3SV7A 3BSQA 3OSYA 3CP7A 1O3LA 1MKWH 1S0QA 2Y80A 1GBHA 5DJ7A 1E36B 1DICA 3M7TA 1UMAH 5FX5A 4IW4E 1MD8A 2BHGA 1O2PA 3Q76A 1Q31A 1G9IE 3RMMH 2WPJS 1HAVA 5FBIA 2ZPRA 1ELTA 3CS0A 4BTTB 5EPNA 1L2EA 3ZZ4A 1D3QB 1GBJA 1CGIE 3SZNA 1G32B 4XOJA 3P8GA 3RXLA 1N6XA 3FO8D 1GDQA 4ISLA 3RMOH 2Y7XA 1T4VH 3PMHB 1HAOH 3BEUA 2W7SA 1GCTC 4TYDA 3W95A 3BG8A 2PUQH 2AIPA 1L0ZA 1ZOMA 1CHOG 4DURA 2P94A 2ZFTA 1XMNB 2VIPA 5L2ZH 4ISHH 4DY7B 1HAXB 1QA7A 1O3CA 1GHXH 1C5MD 2XBVA 1D6RA 1HAPH 4CRFA 1DOJA 1Z1JA 2ZDAH 1DITH 5FPTA 3A81A 1C2KA 1ARCA 2XBWA 4JCNA 2VGCB 4WVPE 4GSOA 3S7HB 5T1VA 5F8XA 1PPFE 3PB1E 3E0PB 3OYPA 1ZPZA 2O8TA 2BY7X 4GCHG 2XNDD 1TE0A 2ZFSA 3PWBA 1H9LB 4IBLH 3P8NA 1W14U 2BD7A 4Q63A 1S81A 1D3PB 2VU8E 3UOPA 4FUEA 4I32A 1GJCB 1V2PT 3BTWE 5EGMA 1LCYA 3A85A 4YXWD 2AEIH 2V0BA 1BTUA 3UQVA 3GCHB 2OLGA 4B2AA 1MU8B 3M37A 2ZPSA 1UK2A 3ELAH 1E79D 4X2XA 1YY3A 1QIXB 1O2KA 3I29A 4BTIB 4D9RA 3PRBA 1O39A 1FPCH 3UB0A 3ZV8A 1GBCA 4FUBA 1GWAA 1A0LA 3VGCC 4ABEA 1QR3E 4XDEA 1G3DA 4NSVA 2BLOA 2PKAB 1UTPA 5IK2D 2XYAA 3DA9B 4X1QU 1K1OA 3F3BA 4SGBE 1P02A 1OHHD 2V7QD 1TNIA 1BBRE 1V3XA 3OU0A 1DWDH 1AUTC 1TRYA 3PMJA 3JZ1B 3M7QA 3SGAE 4ZAEA 5CHAC 4VGCB 1D6WA 1K9OE 3LPRA 5JYIA 2WV5A 5A0AE 1JBUH 3ZVFA 4AFUA 3TU7H 1UCYK 3VB7A 2IPHA 1OWJA 3KHVA 2FYRA 3OTPA 1P06A 1RD3B 2QY0B 3A8AA 2OK5A 1GG6C 1MCVA 1WCZA 4I86A 2OUAA 5EJZA 5A8YA 1XUHA 3UNSA 2J94A 4CHAB 2Y5HA 1XVMA 1EFRD 2O8LA 3LU9B 5E8EH 2BXTH 2YOLA 4FU7A 2BD8A 1DY9A 1CHGA 4K2YA 4ABAA 3NCLA 1IQMA 2PKAA 4O03A 5EJLA 1HAVB 4F55A 2FI3E 1HAIH 2YNAA 1DS2E 1C5PA 3M61U 1WQVH 2CGAA 2QF0A 5HGGA 4WXIA 3NWUA 2Q1JA 2ZGBH 4NIXA 5FL7D 1YCPM 4OGXA 1W13U 3W94A 3RXJA 1IQLA 2RCEA 1Y3UA 1C9TA 2V3OH 3QDZB 5DP8A 6GCHG 1O3BA 4NA8A 3RXEA 3HGPA 2J38A 1P2OA 2ZCLP 1GGDB 3BTME 1ZHRA 1SHYA 1HRTH 2SGPE 3N99A 5CE1A 3RU4T 1K21H 3MNXA 1TNGA 2ODQA 2ZC9H 4KELA 2QXHA 6GCHF 4GUXA 3PRDA 3TJUA 1C2IA 2BD4A 3KQEA 4KTUA 5CDFE 1GMHF 4DIHH 4X1NU 3DCLA 2BDBA 1SC8U 2C8YB 1ZGIA 2ZDVH 4INLA 1GHWH 1LHGH 1O2NA 2F83A 3GCHC 2FOEA 5B6LA 4WH6A 1DUAA 1GJ6A 1Z7KA 2FOHA 2ALPA 4HI3A 2SGDE 4R0IA 2F9OA 1C1PA 1S6HA 2TIOA 1O33A 5FX6A 1DWBH 1BJVA 4MTBA 4HZHA 2CV3A 3TITA 4BAKB 2ZHDA 3V12A 1C5OH 4ZMAH 1JIMA 1EXFA 2ZF0H 1ZSKA 2G5NA 4ABGA 1Y5AT 1NFXA 3D49H 2GCHF 4OM9A 1BTXA 4GHTA 3RXBA 2J98B 2HALA 2VIOA 2EA3A 5HXFA 1K1PA 2HLCA 4XBBA 3A7VA 1CQQA 2LELA 4AOQA 2J92A 2XNIA 3CS7A 1FN8A 1AGJA 4YTAA 1KXDA 3LGUA 1FAKH 1KMHB 5SGAE 2ZG0H 1GDNA 3SNDA 1SLVB 1Q2WA 2QN5T 4FVBA 2WPLS 3M5NA 1SGRE 2EC9H 4ZHAA 1W0JD 2ZDLA 1DM4B 3GY3A 1OWDA 1K0HA 3T26A 2AS9A 2OQUA 1TGCA 2Z6BD 1E1RD 1GVLA 5C0UA 2QXIA 1BUIA 4Q7ZA 1S0RA 4CRGA 3RU4D 3TVJB 1HBTH 1TALA 4MNWA 2LPRA 2P3FH 4X8TH 3TGJE 3LJJA 4X2YA 2JKHA 4NWKA 1TNLA 3LONA 2FM2A 3SORA 4YZUA 5FHTA 1EATA 4MPUA 3AVZA 3GY6A 2VBCA 4YLUA 2ZU3A 3GDSA 1SB1H 3FFGA 3HK6B 1OP8A 1SMFE 1OOKB 2GMTB 4TWYA 2O8WA 1AVXA 1KYNA 3RM2H 2D2DA 1F0SA 2IJOB 5EXLA 1AMHA 2EI8A 1O5GH 4I33A 3VGCB 2BLQA 4CBNA 2V3MA 2OC7A 2D8WA 3NZIA 1BB0B 2IPQX 1C5WB 1OS8A 1TPAE 1Z6EA 2BVRH 2FEQH 1L1JA 3GDVA 1T7CA 2GKVE 4BAMB 1O2XA 2I6SA 3KYGA 3LH3A 1LPGB 1YCPK 4ZKSU 4UE7H 3URDA 2W6ID 2XCFA 1LQDB 1A5IA 3BTEE 1SKYE 1UK3A 2J95A 2BXUH 5EPYA 1GMCF 2BLVA 3SNAA 4LZ4B 1DDJA 3P95A 1P05A 1GHVH 1P3CA 4E05H 1HYLA 3NPSA 1TGTA 2ZEBA 2A7JA 1LQEA 4FUHA 5T3HA 3TH4H 1G3BA 4UFEH 1JRTA 1W3CA 1SHHB 4HFPB 3TGKE 5L2YH 3FANA 2VJ1A 1P3EA 1DLEA 3IWMA 4Q7XA 3VFEA 3QK1A 4NFEA 5A8ZA 3SHAH 1JRSA 1UTJA 3A7YA 3RMNH 2UWOA 3F2HA 5A0CA 1KXBA 3MNSA 1C4V2 1ELVA 4KTCA 3E16B 4UONA 2LNCA 3M5LA 3VG8A 4X8VH 1Z1IA 2A31A 2IN2A 1TONA 3GCOA 4THNH 3SBKA 2H9HA 1P04A 3ODDA 3SU3A 2P16A 3RLYH 2TGPZ 3LGVA 4TY7A 1GHAF 1TPOA 1GCTB 3BTHE 6CHAB 5DP9A 2QAAA 1AHTH 3EAJA 4OS7A 5C3NA 1AKSB 1MTSA 3QUMP 1QB1A 4DOQA 5G4BA 1ZTKA 1QL7A 3PTNA 1F5KU 3AASA 3RXKA 1QURH 1AO5A 1CT2E 1P57B 3MMGA 5C1UA 2BOHB 3MH5A 5JBBS 3BEIB 1A0JA 4FXGH 3ZZ5A 5F53A 2OP9A 1GDUA 3DSPA 1IQFA 1ZPBA 1MMJN 3BTGE 1C5NH 1UVTH 3AAVA 3F9FA 2OXSA 1EPTA 2K0QA 3P17H 3SQEE 2Y6TA 3A80A 1ZJDA 2BDHA 8GCHF 4H6TA 1YCPH 3E1XB 4Q2KA 2KX4A 1SGCA 4IN1A 4DT7B 3BTKE 4I31A 2YNBA 1GI2A 1ZJKA 2CHAB 1A1RA 1C2FA 1KSNA 2PLXA 1H8IH 3MU0A 2BOKA 5DKMA 1BRCE 1ETSH 3BV9B 2ZFQH 2OINA 4ISNA 1AB9C 5CHBA 1S85A 1NRQH 4Y6DA 1UVOA 3RXSA 3RXTA 1YPHC 1YC0A 1A3EH 1T32A 3RXOA 3L3TA 4ASHA 1BMNH 3WWBA 1MQ5A 1EZXC 4CR5A 3OFND 1C1OA 2SNVA 4OS6A 3STIA 4XBCA 2A4GA 3BTTE 3U8TH 4AORA 1CE5A 4ESTE 1GCDA 2NU3E 3ATKA 1HV7A 1ELBA 3U8OH 1BTZA 2ZDMA 2TRMA 3T62A 5TJXA 4AX9H 1D4PB 1GI5A 2L6OA 1O2LA 4WH8A 4DGJA 5LGOA 1BMFD 5ABWA 1HNEE 3ODFA 3Q3XA 1O3HA 3MNBA 3LDXH 4AG2A 1B5GH 3GCNA 3TK9A 2DUCA 4OS2A 1UTNA 1O2YA 1SLUB 1RXPA 1F0UA 2V6NA 4PROA 4E06H 1GI9B 1AUJA 2ZZUH 5I25A 4K69A 4GLYA 3UTUH 1Y3YA 2C3SA 5EG4A 3GICB 3OTJE 3VB6A 4X2VA 1AFQC 1U6QA 2FI5E 1V2RT 4U2WA 3QZRA 1V2UT 4M7GA 1DUEA 2FTLE 2G00A 1O5AB 4X8SH 1ARBA 1EASA 3DFLA 4MQAA 3H7TA 3UREA 3FAOA 3OEED 3K2UA 3QO6A 4MVNA 1V2KT 1P12E 4NIVA 2VVCA 3V0XA 3VB4A 1GI4A 4AZ2B 3TPIZ 7KMEH 2GT7A 2HPPH 1TAWA 2AIQA 2J98A 2W3KA 3LOXA 2B9LA 4O3TA 1EB2A 1K1MA 2WPDD 1YYY1 3OY6U 3DD2H 1O3DA 3KQ5A 1O3GA 1KTSB 1QRXA 4X1PU 1GHZA 4NA9H 2WUBA 4GCHF 5JB8S 5A0BA 2QIQA 3D65E 3EGKH 3DFJA 3LC5A 4YT7H 2R9PA 3ITIA 1TNKA 1MKXH 2ZU1A 1PFXC 1MTWA 1PQ7A 4X6NA 1O2RA 2QXGA 2ZDNA 1V2TT 3RXFA 2ZFRH 4NCYA 3F2FA 2JH0D 4Y0ZE 1YPHE 4Q4LA 3RXRA 3A8CA 5DN6D 5EQSA 2A0QB 2BY6X 2JETC 1QCPA 3RXUA 2BZ6H 1LPKB 1ZPCA 1WQSA 2JH5D 2O8MA 2B8OH 4FU9A 1TX8A 3BN9A 1D3DB 2ASUB 2ZDKA 1P2KA 3N7OA 1FN6A 1V2LT 2GTBA 1XKBC 2Z9GA 6ESTA 3EYDA 1FPHH 1NRRH 2NU0E 1PYTD 1KDQA 4B1TA 1QBNA 1QJ7B 1W2KH 4RT1A 1XM1A 1UVSH 2ZNKH 4U01A 5KEDA 3F9EA 1MAYA 1EOLA 1E0FD 1ZMLA 2HNTF 4LXBH 2FX6A 1GL0E 1H1BA 2FOCA 2J5UA 2FOGA 1AZZA 3M5OA 1NFWA 2KFWA 4JZIA 3ENSB 5FXLA 1ZSJA 3KGPA 3ATLA 4O97A 1O3NA 4ACAA 1C2JA 1QB9A 7ESTE 5DK1A 1NU9A 1WUNH 4IGDA 3FVFB 1ELCA 1GBKA 4AFZA 2Z9LA 2EI6A 3T5FH 1SVPA 1ID5H 1HAYB 1EUFA 1HXFH 4A1VA 1NBMD 3V7TA 1GI1A 1AE8H 1MKWK 2VVUA 1ANDA 1NRPH 2RFKC 4FOUC 1OWKA 4B71A 3GY5A 3URCA 1L4ZA 1ZR0A 4WMDA 4X2WA 1ZMJA 5BRRE 5E2OA 2ZGCA 1JMOH 4J2YB 1C1VH 1UTKA 1GI0A 2PKSB 3SNBA 4A1TA 1P2IA 5JBAS 1P01A 2K8IA 5AFYH 1IQNA 4DJZB 2AGIX 2AH4X 4BOHA 1EZQA 2QF3A 2XW9A 1NBME 3NXPA 5JDUB 1V2WT 4AFSA 1BMAA 1YWUA 1WSSH 2CF9H 1SGDE 1G2LA 2FTMA 1Y5UT 2BLWA 4H6SB 2WV4A 4J1YA 3OX7U 5JPMH 4JZFH 4D8NA 4MNXA 2WPHS 2ZFPH 5C17A 5LPFA 1GMDF 2A5IA 3G01A 1M9UA 1QFKH 4CR9A 4UFFH 1UTQA 2ZO3H 1MTUA 3VB5A 1BTPA 1O2JA 1QJ1B 4X6MA 1TRMA 1UO6A 3WW7A 1EZUC 1V2QT 2VIDA 2DE9A 1GBFA 3PMBB 4D7GA 1TOMH 1CGHA 1CT0E 3RC5A 2M2AA 1FIWA 2NWNA 2FLRH 3ZYDA 2ANWA 1SGFA 4ABJA 1AWHB 2J97A 3PV4A 1O3FA 1SGQE 3QX5H 1GJ7B 3FP7E 3LIWA 1N8OB 1THRH 4A1XA 1AY6H 4IMQA 1N8OC 1OYTH 7GCHG 1NESE 1QZ8A 4OS5A 3KQCA 1Y59T 3RC6A 1XUIA 1IQEA 4ACBA 3GCTF 2ZTZA 2Z3DA 2BDAA 1DX5M 2OD3B 3SV8A 3UOUA 4UFDH 2DE8A 2HRVA 1TPSA 4BTUB 3ZZCA 3BF6H 4TSFD 1C9PA 4WJG2 3MHWU 2GCHG 2ZECA 4SGAE 8KME2 1ACBE 5EODA 5C20A 2PW8H 1MU6B 3SV6A 3EA8A 3HK3B 1ZTLA 1IOEA 2HWLB 3ATIA 2GVFA 2KAIA 3BTDE 4FUGA 5HIYA 1DY8A 2A5AA 1O2MA 1P0SH 3MO6A 2WPIS 2AMQA 3EE7A 3SNCA 1SGFG 5C1YA 1FDPA 2PGQB 3P8FA 5I46H 4NIYA 4UD9H 2R3UA 1V2MT 1FJSA 2QF4A 4U30A 3E91A 4XE4A 1FLEE 3AAUA 1SI5H 4BXSA 3DUXH 4Q80A 1UCYH 5A8XA 2BX3A 2UUKB 3F0OA 2RA3A 1O3EA 3RMLH 3ZZ3A 2JIZD 3MTYA 1EAIA 1PPCE 1RJXB 3HPTB 3UFAA 2AFQB 1ZHPA 4CBOA 2J4IA 4NSYA 4CRAA 5JBCS 3ZZ7A 5DSFA 1P03A 1C2GA 3JZ2B 1FY3A 2H5DA 2JJ2D 4Y79A 3RXMA 2XOKD 1O3MA 3BG4B 1F2SE 1O3IA 1CT4E 1H8ED 5F8ZA 1BIOA 2CHAC 5AVDA 2PFEA 1PQ8A 2XBXA 1TPPA 1B0EA 5IYTA 1AB9B 1N1LA 1GHBF 2KAIB 1ZZZA 3QTVH 1IQHA 2H2ZA 1NPMA 2H6MA 2L74A 4ABDA 5A2MH 3EA7A 1LVYA 4JYVH 2OCVB 1GL1A 1ELDE 5J4QA 4GPGA 8ESTE 2F9VA 3S69A 3AW0A 4JZ1A 3P6ZB 3RXQA 5JB9S 1V2NT 1C1WH 3TK6A 1GVZA 2A4OA 1A7SA 2PTCE 1ETTH 3SV9A 3Q3YA 4O3UA 2D1JA 2WYGA 3KQBA 2A7HA 3S0NA 1THSH 4B74A 2GDDA 1G36A 4X6OA 1BJUA 5B6OA 3ZVCA 3A86A 1HLTH 4RKJB 1W11U 2BQ6B 2BDCA 4WMEA 2GDEH 2VNTA 4B2CA 5K7RA 1C1TA 1FY8E 5F8TA 5J4SA 4WXVA 1BHXF 1C2HA 1J14A 2WPMS 1TBRH 3EA9A 2I6QA 8LPRA 2ULLA 1UHBB 2AMDA 2BD5A 2YMSC 3KN2A 1QGFA 2YMSB 4TPYA 1W0YH 3RXDA 5KECA 1Z6JH 2F9UA 1O2OA 4P00A 1OX1A 1BZXE 3RC4A 3ZVAA 1NRNH 4ABFA 2KCPA 1J17T 1CGJE 1O3AA 1MZAA 1O2ZA 2Q6DA 1O37A 1VGCB 5ESBA 4AC9A 1COWD 1P2MA 4YM9A 1VGCC 1IHTH 1Z8GA 4XFQA 3E8LA 2BTCE 3TJVA 2CMYA 1KLTA 4UFGH 1MD7A 2A1DB 3ZVBA 2XC5A 2Y81A 1K28D 5AF9H 1W7XH 1QJ6B 2F9NA 1NT1A 2GJGA 2A7CA 1ZYOA 2Z7FE 1A0HB 1S5SA 3M35A 3SO3A 2O9QA 1UJ1A 1A5GH 2W7UA 4NWLA 1K1NA 1O36A 1SQRA 4YLQH 5DP4A 1XUGA 4Y10E 3MI4A 3OAAD 3EE0B 1TMUH 3PROA 4ZHMU 3MH6A 4GVUA 1V2JT 2BDGA 2OBOA 3F68H 4JYTA 1H8DH 4JK6A 1HJAC 2KZ4A 1N6YA 4BANB 4AGJA 4MLFB 1RIWC 3U1IB 4RSPA 1QL8A 2JDID 3ZZDA 3SJ8A 1TBQH 1GBIA 3U98H 6LPRA 1TYNA 1VCQA 4FUJA 3C1KA 2ZU5A 5GIBA 3SGBE 1AI8H 1W8BH 2C4FH 2R2WU 1HPGA 1AN1E 2V35A 4NG9H 1MBQA 1VJ9U 1L1NA 4OS1A 3V13A 2HNTC 1JWTA 1ESAA 3BEFB 1VJAU 1DWEH 3PV2A 4YT6H 1INCA 4IC5A 4ISIH 2SGAA 1XUKA 4DG4A 4A5TS 4A6LA 2G52A 2WPKS 4IMZA 2BDIA 3T2NA 1KY9A 2XBYA 2P8OB 4LZ1H 2FYQA 3GY8A 4NGAH 1TMTH 2GCTC 3LJOA 5E0GA 3AK5A 4YOGA 1J9CH 4B76A 4BNRA 2H9EH 3SI3H 4FU8A 2NU2E 2Q6FA 3HGNA 4OGYA 4JK5A 1BMMH 2IOTA 1F7ZA 1XVOA 3E0NB 1RRKA 2ALVA 1EPTC 1HGTH 3GYMA 1F92A 4FUFA 1ANBA 4RT0A 1NRSH 1CBWC 2FMJA 3D62A 3SUDA 1ETRH 1GBBA 3HKJB 1NFUA 3UWJH 1T31A 2A5KA 1EP5A 1LVBA 1MQ6A 1JIRA 2RG3A 2ANKH 1GJ4H 1LHCH 1EB1H 2F9PA 1C1RA 2O8UA 1A3BH 3HATH 1EZSC 3UQOA 1HFDA 1GHYH 2Z94A 4E7RG 5FAHA 4F48B 1O2GH 4CRBA 3ATMA 1VITF 5GCHF 1BRUP 1SLWB 4OS4A 1EAUA 3DSGA 2QCYA 2BY5X 1D9IA 1O3KA 1C5UA 5H4IB 2AGEX 3SJOA 1Q3XA 3O8CA 5BPEA 4A92A 1GBTA 4YOIA 4MG3A 2TGTA 2BVXH 2C8ZB 2XWBI 4I7YH 3BIUH 1F5LA 3ZZ6A 2V3HH 1PPHE 2QV1A 1YLCA 2FODA 1A61H 1NY22 1SLXB 2ZI2H 2J9NA 5CHAB 3OEHD 3FN8A 1PPBH 1P11E 3GY4A 3PLPA 4NFFA 1HUTH 7LPRA 1EJMA 1BCUH 1DSTA 1W10U 1QBOA 2QF5A 3FZZA 3SU2A 3A82A 3ZZAA 4X0WU 1O5CB 1SBWA 3ZVGA 1GG6B 1SQAA 1CU1A 2VIQA 2VIWA 1OWHA 2QA9E 4Z0KA 2P3UB 3F9HA 5LPEA 3U28C 3PWCA 1O34A 1RIWB 1NN6A 1GJAB 5HKKD 2ZGHA 1NTPA 2F9BH 2QYIA 1TGBA 1A5HA 2JJ1D 3RUOA 2BD3A 1O5FH 1QA0A 4B6FA 1Y3VA 5EU8A 3KQDA 1EAWA 1O5DH 3ZV9A 1TWXB 4UEHH 3PLBA 1Z8RA 1KLJH 1J15A 2SFAA 3MH4A 3QGJA 1DXWA 2XXLA 5EQRA 4IC6A 3R3GB 2FOMB 4I8HA 1O2HA 2ANMH 1DXPA 2R3YA 2Z9IA 3ZYEA 1ELFA 4UDWH 4MNVA 2TGDA 5F6MA 1O2TA 1YGCH 1W7GH 3GS9A 1P09A 1MH0A 1Y3XA 2ZKSA 3MYWA 5FPYA 1C5RA 1SFQB 3UR9A 3IG6B 5DP5A 1GGDC 2QC2A 1PYTC 3LGTA 2ZU2A 3I78A 1FONA 3NUMA 3UPEA 1XUJA 1QBVH 1EJNA 1C4U2 2PSYA 4I8GA 5DP6A 3SI4H 1LKAA 3TJOA 1IQKA 3RLWH 3A89A 1O2QA 3SW2B 1MUEB 2VIVA 3OE7D 5EXMA 3F0PA 1HAGE 4I8JA 1OXGA 2D26C 2Y7ZA 1UCYE 2ZQ1A 1CSOE 1YLDA 2ESTE 4BAHB 3WWFA 1QB6A 4ZXXH 1YLNA 1UK4A 3BG4C 1C2EA 5FPSA 1T8LA 4Y8ZA 3UR6A 1FNIA 5DP3A 3UAIC 4M9FA 2NU4E 1CVWH 3GCTG 4ZUHA 2XWAA 2ZPQA 5T6GA 3S9BA 1ZRKA 2C90B 1GBAA 2Y5GA 3RXCA 2R2MB 4K60A 4WY3A 3VB3A 1TGNA 2B5TB 2OC1A 1G3CA 4U32A 1V2VT 2XTTB 1C2DA 1FX0B 4Y11E 2XC0A 4WWYA 2OC0A 1C5TA 2GGVB 1EAXA 3E90B 4ZH8A 5EXNA 1O2VA 2GV6A 1OPHB 3RU4E 5E0JA 1FAXA 2P8OC 1K22H 3KEEA 2FS9A 2GZ7A 2M5TA 4YOJA 1GBLA 4B6EA 3ZVEA 1O2WA 3SQHE 2FP7B 3MQKC 1TOCB 1TFXA 1YPEH 2GV7A 2P95A 1WV7H 4IN2A 3Q77A 1QRWA 1AWFH 2BYAX 1LHDH 4NIWA 2GD4B 1UTMA 2FS8A 5EW1H 1FY4A 5IDKA 1OP2A 2SNWA 3T25A 3A87A 3SOSA 4CRCA 1RTKA 3QWCH 1LHFH 1YPJH 4K5ZA 1P9SA 1QQ4A 3V3MA 3TNTA 1SGEE 2F4LA 1G37A 2F3CE 1NM6A 1T4UH 1CA0B 2HPQH 1EX3A 5T6FA 4WMFA 1DFPA 4BAOB 3CENA 5GJ4B 1A46H 2SGQE 1PJPA 3PM3A 1K2I1 3SJ9A 5A09A 5C94A 2AERH 5DGJA 1F5RA 4X8UH 2FXRA 4CH2B 5L30H 1GHBG 2AGGX 2HOBA 4D7FA 3U9AH 1FZZA 2UUYA 1NZQH 5GWZA 2OTVA 2K1QA 3A7ZA 3UNRA 2J34A 4CH8B 1AU8A 2B0FA 1SGPE 1CA8B 1T8NA 2ZA5A 3GY7A 1NC6A 2ZTYA 1TQ0B 4KP0A 4O9VA 4JMYA 2A2XH 3RXHA 1QY6A 1O32A 1C1QA 2THFB 3FKSD 1VCWA 1TLDA 1KXAA 3SU6A 1G3EA 2KCOA 1GJBB 3E6PH 2OQ5A 1AQ7A 1G30B 5E0HA 1HJ9A 4ABBA 4ZHLU 1GHAG 3MNCA 1GPZA 2FDAA 3PYHA 1BITA 1AZ8A 2H1UA 3P70B 5EJ1A 1IHSH 1GBMA 1A4WH 2FX4A 1TQ7B 1TB6H 3MO3A 1QNJA 1C5QA 1YP9A 3QZQA 2PR3A 3B23B 5C5NA 4F49A 2EY4C 1O0DH 2C93B 2QXJA 4RKOB 3P8OA 1NU7B 2VB0A 2GP9B 1KXFA 1DSUA 1FUJA 2WHXA 3M3TA 2BQ7B 5C1XA 3SUEA 2HVXA 1PQ5A 1IQIA 4GAWA 1WTHD 1A2CH 6CHAC 2ZHQH 3UIRA 1AVGH 1E34B 1E37B 1ABIH 5HYOA 1C4Y2 1KLIH 1KTTB 1L1GA 3LGWA 4MPVA 3VEQB 3S9CA 2UWPA 4R8TB 4D76A 2PWXA 3TH3H 3LC3A 1J8AA 1L4DA 1GBDA 2EQNA 3PMAB 2VGCC 1UTLM 4DW2U 4TPIZ 2PTNA 5LH8A 1PQAA 4MNYA 1GI8B 1RS0A 2BB4A 4X6PA 1BQYA 2ANYA 1UW7A 2A4QA 3RDZA 1D3TB 2VH6A 1PPEE 2J2UA 3S7KB 1BRBE 4AB8A 3D23A 1S6LA 2AYWA 1HB0B 5GXPA 2PP6A 3RXPA 1W0KD 1K1LA 1V2OT 4ABIA 3U8RH 3H5CB 5PTPA 1XXFA 2A2QH 3Q3KA 1MAXA 1EPTB 1ESTA 1SQOA 1WYKA 1QQUA 3NKKA 3LT3A 1JOUB 2AHME 1WOFA 3KIDU 2BD2A 3F6UH 2GZ8A 1Z71A 3L33A 1CO7E 3PO1B 1QRZA 3MFJA 3GYLB 1RFNA 2H5CA 3TGIE 3SNEA 2B7DH 1T8OA 1LVMA 2ZGJA 4YESB 1EP6A 5FCKA 1GJDB 3SYJA 1RTFB 1SOTA 2G5VA 4CREA 5DP7A 2HLDD 4ZKRU 2BZAA 3T29A 2P59A 1LDTT 2TBSA 3B8JA 3MU5A 1H4WA 4ASUD 1BDAA 1B0FA 3T27A 1YPMH 1SGIB 4K8YA 2SGEE 2WSSD 1P2QA 3MU4A 1O3OA 1NROH 1CHOF 4B73A 1HAZB 3N7DA 2P3TB 3ATWA 1C5VA 1MTVA 4MPWA 9LPRA 3FOAA 1E1QD 2GZ9A 4I8LA 2R0KA 4AFQA 1SSXA 1E38B 3SJIA 1ZGVA 2FOFA 1HIAA 4INHA 3TLOA 2UUFB 1LKBA 1BTYA 1VCPA 4MDSA 3SV2H 1WU1A 2C8XB 2PGBB 2WYJA 5HM9A 1MBMA 1NO9H 2STAE 2VWLA 1S84A 1TX7A 3T28A 4Y7BA 3TH2H 1EJAA 2PKSC 3RXIA 4HG6A 2OBQA 2TGAA 3NK8A 2G4TA 2FWWA 1OP0A 4KTSA 3PV5A 1AFQB 1O31A 1O38A 3GOVB 1P2JA 2A4RA 3K6YA 3SU1A 3DHKH 3TK5A 4AYYB 1TA6A 2ZTXA 2BX4A 3SJKA 4ZKNU 1TA2A 3BTFE 1V2ST 2VH0A 3KNXA 1G2MA 4A7IB 2W6JD 1C1UH 5L6NH 1MABB 2VWMA 1DT2A 4Y8YA 2WZQA 5EIYA 1VITG 3A7XA 1O2UA 5GCHG 4DVAU 3N7EA 5TCAA 4P02A 1YF4A 2Q6GA 1O3PB 1LO6A 5LPRA 1AE5A 2TPIZ 3QLPH 1J16A 1O35A 2RA0A 4INKA 5GPIB 2FOAA 3O8BA 1TIOA 1YPGH 3VXFH 2RDLA 5HMAA 2ZP0H 1Y5BT 3F2GA 3B9FH 2CJIA 1DLKB 1SL3A 1UVPA 1Y3WA 5C0TA 1O3JA 1BRAA 2WUCA 2G4UA 4Z6AH 1P10A 2FO9A 3TNSA 3UUZA 5C5OA 2ZHWH 4AB9A 1K1IA 1ANEA 4LOYH 1GJ9B 3KCGH 5F03A 3RXGA 4XSKU 1WXRA 1C5LH 1THPB 3RXAA 1ORFA 1ZSLA 3QTOH 2R0LA 3S9AA 1WTGH 3SU4A 4RI0A 1AIXH 2ZHFH 2IJD1 2FIRH 1H8HD 1T8MA 1EQ9A 3RM0H 5ETXA 1SOZA 2PUXB 4ZROA 2BY9X 3MO9A 4TY6A 3ZVDA 1AFEH 3LH1A 2XCNA 1ZLRA 4XD7D
chains in the Genus database with same CATH topology
1P9UA 5JBTA 1XXDA 1SG8B 4NZLA 2OC8A 2W3IA 3EDXB 5CMXH 1YM0A 2W26A 1BBRK 1SGTA 4HGCA 1C5ZB 3MU1A 1SQTA 1TMBH 5EQQA 1VZQH 2F91A 1GBEA 4WF8A 3A8BA 2W5EA 1AVWA 2Z9JA 1NFYA 2AMPA 3SU0A 1UVUH 4JZEH 2VWNA 4BAQB 1OWEA 1ZHMA 2ILNA 4QT8C 2G8TA 1DE7H 1TNHA 1S83A 4K1EA 4B2BA 1HXEH 1TNJA 4K1TA 3ZZ9A 4ZXYH 3IITA 3C27B 1LPZB 2BY8X 1CBWB 2G55A 1GMDG 1H9HE 1NS3A 5K0HA 1IQJA 1VITH 3ZZBA 5GDSH 4K3JA 1GMHG 4NZQA 1CA0C 3MH7A 1BMLA 3F1SB 1BHXB 1C1NA 4H4FA 3SN8A 3F9GA 3K65B 4K8BA 1GJ5H 2ZGXH 3SHCH 4D7FA 1P8VC 2FESH 2VINA 4X1RU 1FV9A 1BA8B 3SGQE 3I77A 1EOJA 1O30A 3RP2A 3PTBA 2Z3EA 1C2MA 2ZHEH 1MTNB 2CXVA 1QHRB 1FMGA 2EI7A 4CRDA 4JZDH 2H9TH 3GISB 3O8DA 1LMWB 2Y5FA 4DIIH 4TWWA 5DG6A 1FQ3A 9ESTA 1ELGA 2UWLA 4I8KA 4FVDA 4F4OC 3BTQE 3KL6A 5EOKA 1VR1H 3UWIA 1GI7B 5C2ZA 3MOCA 2WINI 1BOQA 3VPKA 1Z8JB 5DPAA 1P2NA 2VWOA 5FCRA 1JXPA 2SGFE 3HKIB 1KXCA 4BXWA 2A45B 1X7AC 1SR5C 4KKDA 1SGYE 1Y8TA 3QGNB 3TJNA 2FOBA 1ZRBA 2FZZA 3FP6E 2Z3CA 4ZKOU 1IAUA 4X1SU 2FI4E 1KIGH 1C5YB 1OKXA 4CHAC 1FXYA 3M7UA 2Z9KA 3A7WA 3H7OA 3OY5U 2GX4A 2PV9B 3DT0H 3UNQA 1MZDA 1TX6A 1BBRH 5ESTE 1YKTA 3SUGA 7GCHF 1O5BB 4FUIA 4Y8XA 2FPZA 1SFIA 1XX9A 2G81E 1ELAA 2G51A 1S82A 3K6ZA 3TIUA 3ZZ8A 1QL9A 4IS5A 3UY9A 4H42U 1HJ8A 2ZIQH 1PPGE 4Y71A 1TRNA 4FUDA 1KDQB 4AN7A 3L6PA 1K1JA 1O5EH 4AGKA 1OWIA 2STBE 3K9XB 1ELEE 5C67A 1LTOA 1OYQA 2P93A 4K1SA 2PSXA 1YBWA 4ABHA 4FUCA 2EEKA 3GY2A 3M3SA 3MWIU 2BDYA 1S6FA 3WY8A 3GDUA 4YO9A 5DO4H 1ZMNA 3A7TA 3LGYA 2XRCA 4NA7A 1Z8IB 2VVVA 5AFZH 1TGSZ 3EQ0H 1MCTA 2Y82A 3AW1A 2QGRA 4MPXA 2ZCHP 4B75A 1W0ZU 3FZDA 3P92A 1AD8H 4GHQA 1YPKH 4AYVB 1HAHH 5AHGH 1RGQA 2JETB 2BVSH 3STJA 2ZWLH 1HJAB 1O2SA 2A32A 1EKBB 1C1MA 3E3TA 5FBEA 1GJ8B 1FIZA 4JYUH 1IQGA 1W12U 4D9QA 1GI3A 3PO1C 1LVOA 1UHBA 3PLKA 1ABJH 2ODYB 3LKWA 5EW2H 1C2LA 1WBGB 2XC4A 2CF8H 2CN0H 1QTFA 3M36A 1TABE 2PHBA 1V6DA 3O8RA 1C1SA 1SGNE 2ODPA 3KF2A 1XUFA 2ZFFH 3A8DA 4Y7AA 1DANH 2ZCKP 1ANCA 1ESBA 1GMCG 2FLBH 3VXEH 2HGTH 1ZTJA 4LK4A 1B7XB 1YPLH 3A84A 2C8WB 2BQWB 1AKSA 1GI6A 3FP8E 4AG1A 1SPJA 2GCTB 3MU8A 2BM2A 1RTLA 3M5MA 3A83A 5TCCA 2HNTE 3RXVA 1PPZA 1MKXK 3A88A 1H9IE 5E2PA 5T6DA 1DWCH 1LHEH 1TBZH 1UTOA 2NU1E 1HIAB 5HM2A 1HCGA 1C5SA 1WAYB 2ZU4A 4RN6A 1GVKB 4XBDA 1C5XB 1FI8A 3R0FA 1F0TA 3BIVH 1F0RA 1FY5A 2GT8A 3SU5A 1E35B 2JH6D 4KGAA 1FY1A 8GCHG 4ISOA 3LGIA 1O2IA 4HTCH 1DPOA 1OSSA 2GMTC 4Y76A 1BTHH 4E7NA 1HDTH 1BT7A 1MTNC 2ZQ2A 3U69H 2BD9A 1XKAC 3ESTA 2BMGB 3Q00A 3U1JB 4DCDA 3QN7A 2UUJB 1KXEA 1DVAH 4Y0YE 3SUFA 1BTWA 3M3VA 4Q7YA 4VGCC 3SV7A 3BSQA 3OSYA 3CP7A 1O3LA 1MKWH 1S0QA 2Y80A 1GBHA 5DJ7A 1E36B 1DICA 3M7TA 1UMAH 5FX5A 4IW4E 1MD8A 2BHGA 1O2PA 3Q76A 1Q31A 1G9IE 3RMMH 2WPJS 1HAVA 5FBIA 2ZPRA 1ELTA 3CS0A 4BTTB 5EPNA 1L2EA 3ZZ4A 1D3QB 1GBJA 1CGIE 3SZNA 1G32B 4XOJA 3P8GA 3RXLA 1N6XA 1GDQA 4ISLA 3RMOH 2Y7XA 1T4VH 3PMHB 1HAOH 3BEUA 2W7SA 1GCTC 4TYDA 3W95A 3BG8A 2PUQH 2AIPA 1L0ZA 1ZOMA 1CHOG 4DURA 2P94A 2ZFTA 1XMNB 2VIPA 5L2ZH 4ISHH 4DY7B 1HAXB 1QA7A 1O3CA 1GHXH 1C5MD 2XBVA 1D6RA 1HAPH 4CRFA 1DOJA 1Z1JA 2ZDAH 1DITH 5FPTA 3A81A 1C2KA 1ARCA 2XBWA 4JCNA 2VGCB 4WVPE 4GSOA 3S7HB 5F8XA 1PPFE 3PB1E 3E0PB 3OYPA 1ZPZA 2O8TA 2BY7X 4GCHG 1TE0A 2ZFSA 3PWBA 1H9LB 4IBLH 3P8NA 1W14U 2BD7A 1S81A 1D3PB 2VU8E 3UOPA 4FUEA 4I32A 1GJCB 1V2PT 3BTWE 5EGMA 1LCYA 3A85A 2AEIH 2V0BA 1BTUA 3UQVA 3GCHB 2OLGA 4B2AA 1MU8B 3M37A 2ZPSA 1UK2A 3ELAH 4X2XA 1QIXB 1O2KA 3I29A 4BTIB 4D9RA 1O39A 1FPCH 3ZV8A 1GBCA 4FUBA 1GWAA 1A0LA 3VGCC 4ABEA 1QR3E 4XDEA 1G3DA 4NSVA 2BLOA 2PKAB 1UTPA 2XYAA 3DA9B 4X1QU 1K1OA 4SGBE 1P02A 1TNIA 1BBRE 1V3XA 3OU0A 1DWDH 1AUTC 1TRYA 3PMJA 3JZ1B 3M7QA 3SGAE 4ZAEA 5CHAC 4VGCB 1D6WA 1K9OE 3LPRA 5JYIA 2WV5A 5A0AE 1JBUH 3ZVFA 4AFUA 3TU7H 1UCYK 3VB7A 2IPHA 1OWJA 3KHVA 2FYRA 1P06A 1RD3B 2QY0B 3A8AA 1GG6C 1MCVA 1WCZA 2OUAA 5A8YA 1XUHA 3UNSA 2J94A 4CHAB 2Y5HA 1XVMA 2O8LA 3LU9B 5E8EH 2BXTH 2YOLA 4FU7A 2BD8A 1DY9A 1CHGA 4K2YA 4ABAA 3NCLA 1IQMA 2PKAA 4O03A 1HAVB 2FI3E 1HAIH 2YNAA 1DS2E 1C5PA 3M61U 1WQVH 2CGAA 2QF0A 5HGGA 4WXIA 3NWUA 2Q1JA 2ZGBH 4NIXA 1YCPM 4OGXA 1W13U 3W94A 3RXJA 1IQLA 2RCEA 1Y3UA 1C9TA 2V3OH 3QDZB 5DP8A 6GCHG 1O3BA 4NA8A 3RXEA 3HGPA 2J38A 1P2OA 2ZCLP 1GGDB 3BTME 1ZHRA 1SHYA 1HRTH 2SGPE 5CE1A 3RU4T 1K21H 3MNXA 1TNGA 2ODQA 2ZC9H 4KELA 2QXHA 6GCHF 4GUXA 3TJUA 1C2IA 2BD4A 3KQEA 4KTUA 1GMHF 4DIHH 4X1NU 2BDBA 1SC8U 2C8YB 1ZGIA 2ZDVH 4INLA 1GHWH 1LHGH 1O2NA 2F83A 3GCHC 2FOEA 4WH6A 1DUAA 1GJ6A 1Z7KA 2FOHA 2ALPA 4HI3A 2SGDE 4R0IA 2F9OA 1C1PA 1S6HA 2TIOA 1O33A 5FX6A 1DWBH 1BJVA 4MTBA 4HZHA 2CV3A 3TITA 4BAKB 2ZHDA 3V12A 1C5OH 4ZMAH 1JIMA 1EXFA 2ZF0H 1ZSKA 2G5NA 4ABGA 1Y5AT 1NFXA 3D49H 2GCHF 1BTXA 4GHTA 3RXBA 2HALA 2VIOA 2EA3A 5HXFA 1K1PA 2HLCA 4XBBA 3A7VA 1CQQA 4AOQA 2J92A 2XNIA 3CS7A 1FN8A 1AGJA 4YTAA 1KXDA 3LGUA 1FAKH 5SGAE 2ZG0H 1GDNA 3SNDA 1SLVB 1Q2WA 2QN5T 4FVBA 2WPLS 3M5NA 1SGRE 2EC9H 4ZHAA 2ZDLA 1DM4B 3GY3A 1OWDA 3T26A 2AS9A 2OQUA 1TGCA 2Z6BD 1GVLA 2QXIA 1BUIA 4Q7ZA 1S0RA 4CRGA 3RU4D 3TVJB 1HBTH 1TALA 4MNWA 2LPRA 2P3FH 4X8TH 3TGJE 3LJJA 4X2YA 2JKHA 4NWKA 1TNLA 3LONA 2FM2A 3SORA 4YZUA 5FHTA 1EATA 4MPUA 3AVZA 3GY6A 4YLUA 2ZU3A 3GDSA 1SB1H 3FFGA 3HK6B 1OP8A 1SMFE 1OOKB 2GMTB 4TWYA 2O8WA 1AVXA 1KYNA 3RM2H 2D2DA 1F0SA 2IJOB 5EXLA 1AMHA 2EI8A 1O5GH 4I33A 3VGCB 2BLQA 4CBNA 2OC7A 2D8WA 3NZIA 1BB0B 1C5WB 1OS8A 1TPAE 1Z6EA 2BVRH 2FEQH 1L1JA 3GDVA 1T7CA 2GKVE 4BAMB 1O2XA 2I6SA 3LH3A 1LPGB 1YCPK 4ZKSU 4UE7H 3URDA 2XCFA 1LQDB 1A5IA 3BTEE 1UK3A 2J95A 2BXUH 5EPYA 1GMCF 2BLVA 3SNAA 4LZ4B 1DDJA 3P95A 1P05A 1GHVH 1P3CA 4E05H 1HYLA 3NPSA 1TGTA 2ZEBA 2A7JA 1LQEA 4FUHA 5T3HA 3TH4H 1G3BA 4UFEH 1JRTA 1W3CA 1SHHB 4HFPB 3TGKE 5L2YH 3FANA 2VJ1A 1P3EA 1DLEA 3IWMA 4Q7XA 3VFEA 3QK1A 4NFEA 5A8ZA 3SHAH 1JRSA 1UTJA 3A7YA 3RMNH 2UWOA 5A0CA 1KXBA 3MNSA 1C4V2 1ELVA 4KTCA 3E16B 4UONA 2LNCA 3M5LA 4X8VH 1Z1IA 2A31A 2IN2A 1TONA 3GCOA 4THNH 3SBKA 2H9HA 1P04A 3ODDA 3SU3A 2P16A 3RLYH 2TGPZ 3LGVA 4TY7A 1GHAF 1TPOA 1GCTB 3BTHE 6CHAB 5DP9A 2QAAA 1AHTH 3EAJA 4OS7A 5C3NA 1AKSB 1MTSA 3QUMP 1QB1A 4DOQA 5G4BA 1ZTKA 1QL7A 3PTNA 1F5KU 3AASA 3RXKA 1QURH 1AO5A 1CT2E 1P57B 3MMGA 5C1UA 2BOHB 3MH5A 5JBBS 3BEIB 1A0JA 4FXGH 3ZZ5A 2OP9A 1GDUA 1IQFA 1ZPBA 1MMJN 3BTGE 1C5NH 1UVTH 3AAVA 3F9FA 2OXSA 1EPTA 3P17H 3SQEE 2Y6TA 3A80A 1ZJDA 2BDHA 8GCHF 4H6TA 1YCPH 3E1XB 4Q2KA 1SGCA 4IN1A 4DT7B 3BTKE 4I31A 2YNBA 1GI2A 1ZJKA 2CHAB 1A1RA 1C2FA 1KSNA 2PLXA 1H8IH 3MU0A 2BOKA 5DKMA 1BRCE 1ETSH 3BV9B 2ZFQH 2OINA 4ISNA 1AB9C 1S85A 1NRQH 4Y6DA 1UVOA 3RXSA 3RXTA 1YPHC 1YC0A 1A3EH 1T32A 3RXOA 3L3TA 4ASHA 1BMNH 1MQ5A 1EZXC 4CR5A 4OS6A 1C1OA 2SNVA 3STIA 4XBCA 2A4GA 3BTTE 3U8TH 4AORA 1CE5A 4ESTE 1GCDA 2NU3E 3ATKA 1HV7A 1ELBA 3U8OH 1BTZA 2ZDMA 2TRMA 3T62A 5TJXA 4AX9H 1D4PB 1GI5A 4WH8A 1O2LA 5LGOA 4DGJA 5ABWA 1HNEE 3ODFA 3Q3XA 1O3HA 3MNBA 3LDXH 4AG2A 1B5GH 3GCNA 3TK9A 2DUCA 4OS2A 1UTNA 1O2YA 1SLUB 1RXPA 1F0UA 2V6NA 4PROA 4E06H 1GI9B 1AUJA 2ZZUH 5I25A 4K69A 4GLYA 3UTUH 1Y3YA 2C3SA 5EG4A 3GICB 3OTJE 3VB6A 4X2VA 1AFQC 1U6QA 2FI5E 1V2RT 4U2WA 3QZRA 1V2UT 4M7GA 1DUEA 2FTLE 2G00A 1O5AB 4X8SH 1ARBA 1EASA 3DFLA 4MQAA 3H7TA 3UREA 3FAOA 3K2UA 3QO6A 4MVNA 1V2KT 1P12E 4NIVA 2VVCA 3V0XA 3VB4A 1GI4A 4AZ2B 3TPIZ 7KMEH 2W3KA 2GT7A 1TAWA 2AIQA 2HPPH 3LOXA 2B9LA 4O3TA 1EB2A 1K1MA 3DD2H 1YYY1 3OY6U 1O3DA 1O3GA 1KTSB 1QRXA 4X1PU 1GHZA 4NA9H 2WUBA 4GCHF 5JB8S 5A0BA 2QIQA 3D65E 3EGKH 3DFJA 3LC5A 4YT7H 2R9PA 3ITIA 1TNKA 1MKXH 2ZU1A 1PFXC 1MTWA 1PQ7A 4X6NA 1O2RA 2QXGA 2ZDNA 1V2TT 3RXFA 2ZFRH 4NCYA 2JH0D 4Y0ZE 1YPHE 3RXRA 3A8CA 5EQSA 2A0QB 2BY6X 2JETC 1QCPA 3RXUA 2BZ6H 1LPKB 1ZPCA 1WQSA 2JH5D 2O8MA 2B8OH 4FU9A 1TX8A 3BN9A 1D3DB 2ASUB 2ZDKA 1P2KA 3N7OA 1FN6A 1V2LT 2GTBA 1XKBC 2Z9GA 6ESTA 3EYDA 1FPHH 1NRRH 2NU0E 1PYTD 1KDQA 4B1TA 1QBNA 1QJ7B 1W2KH 1XM1A 1UVSH 2ZNKH 4U01A 3F9EA 1MAYA 1EOLA 1E0FD 1ZMLA 2HNTF 4LXBH 2FX6A 1GL0E 1H1BA 2FOCA 2FOGA 1AZZA 3M5OA 1NFWA 4JZIA 3ENSB 5FXLA 1ZSJA 3KGPA 3ATLA 4O97A 1O3NA 7ESTE 1C2JA 1QB9A 5DK1A 1NU9A 1WUNH 4IGDA 3FVFB 1ELCA 1GBKA 4AFZA 2Z9LA