1C9TA

Complex of bdellastasin with bovine trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of the complex of the antistasin-type inhibitor bdellastasin with trypsin and modelling of the bdellastasin-microplasmin system.
pubmed doi rcsb
source organism Hirudo medicinalis
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9tA02
1TAWA 1C4U2 3A7VA 1EZSC 2ZCLP 4OS5A 2ZU3A 1UJ1A 5EXMA 2OBOA 4Z0KA 2AGEX 4A1XA 1UVUH 4TPIZ 5CHAC 1C1UH 2P8OC 1O5CB 2ODPA 1K1IA 2ANYA 2XC4A 2ZGHA 1FUJA 2WV5A 3ZVFA 1TQ7B 4FUFA 4AG1A 3MU0A 4Y7BA 4I8HA 4O03A 4AZ2B 2QIQA 3G01A 4XFQA 3TU7H 2ZFFH 3V0XA 1UHBA 1V2KT 2GZ8A 3T28A 3RU4E 1EUFA 1TX8A 1TPAE 3K6ZA 2ZGBH 3PMBB 1P9UA 1GG6C 1W7XH 1VJAU 5E0JA 1IQJA 1O37A 4INKA 4O9VA 5F8ZA 1JBUH 3TIUA 1GI2A 3ODDA 3P8NA 4CRAA 3LOXA 3RDZA 1H9LB 5L2ZH 1FJSA 1HAPH 1LPKB 1YCPH 2SGFE 3HPTB 2G52A 3GCHB 1IOEA 3UOPA 3TH4H 4O3UA 4UD9H 4BXWA 3PROA 3OTJE 2VINA 1ZHRA 2ZFQH 5A8ZA 2NU0E 4CHAB 4IS5A 3ZVGA 1QURH 3SJOA 3FZZA 3P92A 1K28D 2PFEA 1RRKA 2FTMA 4YT6H 3VGCB 3TH3H 1G3EA 2BM2A 1BBRK 1XUGA 3WY8A 1WQVH 3M3VA 2OINA 4ZKNU 1V2QT 2BXTH 4Y6DA 4MPUA 2V35A 2WPMS 2PSXA 1TRYA 4U01A 3H5CB 3KQDA 3HK6B 1D3DB 1SGEE 1DXWA 2FS8A 2Z3EA 2F3CE 2GVFA 1Z6EA 3T5FH 1KTTB 2H9HA 4A6LA 1C2LA 5DK1A 4MNXA 1OSSA 1C2HA 1O2ZA 1VCPA 1IQKA 1S0RA 1UMAH 5AVDA 4ABIA 4MLFB 1SGTA 2Q6DA 1YPGH 2GV6A 1PQ8A 5DG6A 1WSSH 3CENA 1CSOE 1GMDG 3UIRA 3VB6A 1G3CA 3QZQA 1EPTC 1T8OA 2PLXA 5EXLA 3QUMP 1O3CA 3LJJA 4IC5A 1GCTB 4X6NA 2ZFRH 4IN2A 1O2VA 1K9OE 4OS7A 2FX6A 1KLJH 2PSYA 4UE7H 1QJ1B 1SGYE 1WQSA 2BY6X 1W11U 3MO9A 4K60A 1GMCF 4U2WA 1SGFG 1IAUA 1YM0A 2FOAA 2HLCA 3T2NA 2RG3A 2FESH 1Y3UA 1XMNB 1MKWH 3ATKA 1P01A 3OY5U 3A89A 4WJG2 1P2MA 5G4BA 1LMWB 4FUIA 2GZ7A 4MPXA 1D6WA 3U98H 1QRZA 1C4V2 1P10A 2G4UA 2VIDA 4OS4A 1ETTH 3SI3H 1QJ7B 9LPRA 3PLBA 1BHXB 1DOJA 1DY8A 1X7AC 1Y5AT 1O2YA 1CHOF 4TWYA 5T6DA 4MNVA 2ZNKH 3NKKA 3O8BA 4JK5A 1C5YB 1JXPA 1UCYH 1OOKB 3VXFH 1DE7H 3RXEA 1ETRH 1DY9A 4CBNA 3T62A 1GI0A 1RFNA 1J14A 4JYVH 1OWIA 3GCHC 3ZZ4A 5FBEA 2A4QA 5EQRA 2EC9H 2F9OA 1DANH 5GIBA 1THPB 4NCYA 1HLTH 5A0AE 4CHAC 2RA3A 2O8WA 2BDBA 2J9NA 1GVZA 2WYGA 1F2SE 2F9PA 2XNIA 4ABFA 1BDAA 2XCNA 1GBMA 3VGCC 4AB9A 3I78A 3NCLA 3GICB 1C2MA 1ELTA 4Q7YA 1D3TB 1VR1H 2ASUB 1KTSB 1RIWB 1BTUA 1LKBA 1GJ7B 1BHXF 2ZEBA 1C5WB 3ZVDA 2ZU2A 1C5LH 4B73A 2CHAC 2ZFSA 2OQUA 3S0NA 1V2NT 1NESE 3M35A 5C2ZA 3SV2H 2GV7A 2F9UA 4RKOB 1FAKH 1DWBH 4FU7A 5T6FA 1GJDB 1QB1A 1THRH 3MMGA 1V3XA 3M5OA 4NWLA 4Y71A 4WH8A 2IOTA 5FPSA 1A4WH 2Z9IA 1EPTA 3A81A 4ZXXH 5JDUB 3E0NB 1VGCB 2BD9A 2ALPA 2Z6BD 3QN7A 4U30A 5ESBA 2WPHS 1JRTA 3ZZ5A 4WMDA 2ZTYA 1EKBB 2G51A 3SO3A 1MBQA 2CV3A 2F91A 2A4GA 4Q7ZA 4ABDA 1TA2A 3R3GB 3UQVA 3I29A 1C2KA 2SGPE 1CHGA 1MKXK 1RD3B 3A8BA 4DURA 1AI8H 4CRFA 1ELDE 5GCHF 1MCVA 1SGNE 3M5NA 1MU8B 2W5EA 5EPYA 1NTPA 4CR5A 3KQBA 2H9EH 4I33A 4NZLA 5A0CA 1B0EA 3FP7E 4ZUHA 5CMXH 3LGVA 3S7HB 1AO5A 2EI8A 2FS9A 2Q6GA 3P6ZB 2BB4A 4AFQA 5A0BA 1SOTA 1HAXB 2HPPH 4WMFA 1N6XA 2KAIA 1TOCB 3TK9A 3S9BA 4GHTA 1UVTH 1IQEA 6GCHG 1ZOMA 2VWOA 3W94A 1V2LT 2XYAA 3BTTE 1O31A 1C9PA 1C1TA 4X1QU 4X1SU 1YPEH 5JBCS 3GCTF 5JBTA 1O32A 2QGRA 1F0TA 3BTHE 4Y8YA 2O8TA 1G37A 2J38A 4GPGA 2B0FA 1F5LA 4YM9A 1O3AA 8LPRA 1SI5H 1G32B 3ZZ9A 3PWBA 1P04A 2C8ZB 3KHVA 2HPQH 7KMEH 2J4IA 3MU8A 4CRDA 3T25A 1KIGH 3PB1E 3U8RH 4J1YA 4H6SB 2FPZA 1QNJA 1LVMA 5JBBS 4CR9A 1O3JA 1AN1E 1K1LA 3A8DA 3IWMA 3SJIA 5J4QA 1NROH 5JB9S 3SUDA 3RXMA 5C5NA 1ABIH 1UTLM 1L4DA 1TGBA 4BAHB 1P2KA 4X0WU 1MQ6A 3TVJB 3NZIA 1ZGVA 3E16B 2A31A 1TMUH 1GL0E 3GCOA 1ZSKA 1JIRA 1TNKA 1AFEH 2HNTC 2UWLA 1ELGA 3ENSB 4ZHLU 1AB9C 1BZXE 2A5IA 4AFSA 5L30H 1DSUA 1T32A 2ZCKP 5HXFA 2TRMA 3QTOH 1SHHB 3NPSA 3O8RA 2BDGA 4D7GA 4IN1A 3BG4B 2FWWA 2G55A 3BEUA 5HMAA 3MH4A 2IJOB 1IQLA 1BMMH 1SGCA 2BY5X 4YO9A 4FUHA 3MFJA 3S9CA 1ZTLA 3GCNA 1YPLH 1AHTH 1VGCC 1ZJKA 4Q2KA 4RKJB 2NU2E 4K2YA 2PUQH 1BTZA 3LPRA 2HOBA 1SBWA 4ISOA 1QJ6B 4X2YA 4ABGA 1XUFA 2BTCE 3NWUA 3DD2H 1FLEE 1GHXH 4CREA 1MD7A 3I77A 1YC0A 3TGIE 2J94A 5EODA 1HXEH 4KP0A 4JCNA 5LPRA 2ZU1A 2BLQA 1GDNA 5C67A 3ZV9A 3KCGH 3PLKA 2OQ5A 6LPRA 1KYNA 3GOVB 3PMHB 1NS3A 3RC5A 2CF9H 1XXFA 2Z3DA 1D3QB 2BD4A 1GJ6A 3RLWH 4HTCH 4TPYA 2A2QH 4JZDH 3U1JB 4X6MA 2DUCA 5IYTA 1BOQA 5FX5A 5JB8S 1P2OA 3FP8E 4D8NA 1YP9A 1AVXA 4CRCA 3UY9A 3D23A 3UNRA 1V2ST 3STJA 2GDEH 2A7JA 2Y81A 1LVOA 1PQ7A 2SGEE 1LTOA 1SQTA 3QGJA 1C2GA 1YF4A 4TYDA 5CHAB 1O2UA 1ZSLA 3T26A 2VIQA 4WY3A 3A86A 1UTNA 1Y3VA 2F83A 2CXVA 1ZGIA 1Q2WA 3MH6A 2SNWA 1O39A 1NFXA 3SNAA 2FP7B 1GI6A 4H6TA 3RMOH 1BIOA 5A8XA 2XBYA 4M7GA 4AGJA 3BTEE 3ATIA 1O3EA 1DM4B 1G3BA 2ZHEH 2BY9X 2Y5FA 5SGAE 1BTHH 3RXJA 2JETB 1GMHF 1P11E 2J2UA 4X6PA 1GG6B 3N7OA 4INLA 4BAKB 1NU7B 3SN8A 1TONA 2TGPZ 1ID5H 3MH5A 3NXPA 4OS6A 4WMEA 2BDAA 1C9TA 3SI4H 5B6OA 3MYWA 1O2PA 5DGJA 3L6PA 2D26C 1LVBA 1QL9A 1E36B 1P03A 3RXHA 4ABBA 3GY4A 2A4OA 1CGJE 1K1NA 1V2RT 1NU9A 5EOKA 1NRNH 2UWPA 1LVYA 5FBIA 3OU0A 1V2MT 2V0BA 3RC4A 2J34A 1AKSA 3ZVAA 1C5OH 4NFFA 1O2OA 4X1RU 1GJBB 3BEFB 1SGIB 2QYIA 4JMYA 3QWCH 4ZROA 1H8DH 2PUXB 1GBAA 3ZVEA 3RXPA 1C5TA 3GDSA 2BQ7B 4E7NA 4OGYA 3MO6A 3PMJA 2C8XB 5EW2H 2A4RA 3SU0A 1VZQH 1GVLA 4ZKRU 3QLPH 3KF2A 3VB3A 3U8TH 3MNCA 3ITIA 3M7UA 3P95A 2BXUH 1FMGA 3M61U 2HVXA 4I31A 5C3NA 5FPTA 3TLOA 5JYIA 1S5SA 1IQMA 1GI5A 5DP3A 4NZQA 1FQ3A 3CP7A 1EATA 1VITG 3AASA 2V3HH 2A1DB 2RA0A 2BVSH 3SORA 1NZQH 1QBOA 4K1TA 1KY9A 2H2ZA 2ZDMA 3BN9A 3OY6U 1XXDA 1AMHA 1GI8B 1HPGA 1EPTB 1O2IA 1NFYA 1Y59T 3OYPA 1TBQH 3E91A 1LCYA 1SQAA 3SQEE 4GCHG 3VB5A 3RXCA 1O3BA 2JKHA 1EAIA 3R0FA 1DXPA 1HDTH 4MQAA 3TNTA 3UWIA 4TY7A 1DITH 2A7CA 2BD7A 3F1SB 3SBKA 1P0SH 1H9IE 3HK3B 3TJVA 3PTBA 4DW2U 3UFAA 1Y5UT 1VJ9U 3BTKE 5DP8A 5E0HA 1MZDA 1L1GA 3H7TA 1TALA 2G5NA 1O3IA 5K7RA 3HGNA 1EQ9A 1BB0B 2QF0A 1BRUP 4NIYA 1BITA 1O2MA 2JETC 1ZYOA 1QRXA 1HYLA 4I32A 2KAIB 1O5BB 8GCHF 1A5IA 1B7XB 1KSNA 3Q77A 1J8AA 3ZZ7A 4BANB 1TGTA 2Y7XA 5FPYA 1CVWH 1QB6A 2PKAA 1L1JA 1LPGB 4NSYA 2QY0B 1EAUA 2FI5E 3FP6E 1TRNA 1FV9A 1O36A 1BT7A 1B5GH 3LU9B 1FPHH 1E37B 3C1KA 1QBVH 2ZC9H 3LGUA 1F0RA 4XBDA 4FUBA 1Q31A 1HCGA 1O5FH 3M3SA 2FO9A 4CH2B 1WTGH 4KTCA 4D9RA 4WF8A 1TPPA 1O5DH 3S69A 1TQ0B 2OC0A 3MNSA 1HJ9A 1EASA 3TJNA 4A1TA 4X8VH 2GP9B 3C27B 4DOQA 2VH6A 3A7ZA 4CBOA 1ZHMA 1DVAH 3HATH 1NRPH 4VGCC 1LDTT 4Y79A 1ZTKA 1GBEA 1PFXC 4A5TS 1TGCA 1W3CA 1NRSH 1O35A 1P2JA 1P57B 5DPAA 1O3OA 1Y5BT 3E90B 1BMAA 5DP6A 3U69H 3VB4A 2PW8H 3ZZDA 2CGAA 1KXCA 1Z6JH 2C4FH 4GLYA 3M36A 1ELBA 3A7TA 1SFIA 1SOZA 2CHAB 2NU1E 1RGQA 4ZXYH 2FOGA 4DIIH 4U32A 1QB9A 1SLXB 3MNBA 2ODYB 5EXNA 2A2XH 1J15A 3U1IB 1V2TT 3O8DA 3RU4D 1NY22 4B74A 5DJ7A 4ABHA 1EAXA 3BTME 4NIWA 2BZ6H 1WYKA 2PKSC 3E3TA 1UO6A 1FPCH 2A45B 1BRBE 1O2XA 2FZZA 4Y76A 1DDJA 2P3TB 2UWOA 1L1NA 2Z3CA 3B9FH 1YLDA 2Z9LA 1BTPA 3A82A 2GCTC 1HXFH 4IBLH 5T6GA 1YCPK 1GHWH 1XX9A 1C2DA 1P2IA 1QFKH 3RUOA 1G2MA 1LPZB 3BV9B 4BOHA 4RN6A 5DO4H 1ZZZA 4ABEA 2ZHQH 1YKTA 2ZI2H 3ZYDA 5BPEA 3SJKA 3UUZA 1UK3A 1TBZH 1SSXA 2FYRA 5EG4A 3M3TA 3BTQE 1C1RA 4ISLA 3M5MA 2BLWA 3CS7A 2WUBA 1EB1H 4YLQH 1O2RA 4LZ1H 1GHBG 3ZYEA 2ZFTA 2Y80A 2OBQA 2PTCE 1GHZA 2QCYA 1ELAA 2TIOA 3LH3A 2GDDA 1ESAA 2ZHWH 2ZA5A 2GT8A 5ETXA 2QA9E 3BIUH 1N1LA 1T8NA 1FZZA 2V6NA 4IGDA 3K6YA 1HV7A 1W0YH 2AYWA 1C1OA 1BJVA 3E1XB 3MWIU 3GISB 1OXGA 4YLUA 1JMOH 1NRQH 4UFEH 1O2SA 2PGBB 2GCHG 1DFPA 1F7ZA 4B1TA 1KXAA 5CE1A 5E2PA 4SGBE 5DP7A 3A8AA 3E6PH 2BMGB 4AYYB 1GHAG 1YCPM 1NRRH 1BUIA 4R8TB 1TB6H 4UFFH 1O2NA 2SGAA 3F9HA 1AB9B 1GBHA 1QBNA 1GI4A 1MKWK 3V12A 4I7YH 1XUKA 3UWJH 1YLCA 2STAE 1Y8TA 3DUXH 1J17T 4ZMAH 3V13A 1AKSB 2BOHB 4TWWA 5EQQA 1FNIA 5H4IB 1AWHB 3LGYA 4B2CA 2P93A 1DSTA 1EP6A 5LH8A 4K1SA 2CN0H 5C20A 2HALA 5E2OA 3F9EA 4Y11E 1YPHE 3A85A 4DVAU 1O34A 3F68H 5A2MH 2VGCC 1MAYA 4BNRA 4FXGH 4Q7XA 1CE5A 1Z7KA 2OLGA 2ZGXH 1ZHPA 1O3NA 4R0IA 5F03A 1OYQA 4CRBA 1CA0B 1TRMA 2ZKSA 4GAWA 2B8OH 3KQCA 4Z6AH 3T29A 2P59A 4OS2A 1KLIH 2HNTF 2PR3A 1T8MA 4MG3A 1GBDA 5AF9H 5K0HA 1W7GH 2VVUA 3RXGA 1MTVA 4IC6A 3SU2A 2CF8H 1GMDF 4X2WA 5FHTA 1MD8A 4UEHH 1BTXA 1XKBC 2C8YB 1DS2E 1C2IA 3RXSA 3S9AA 2XTTB 3K9XB 5FXLA 5GXPA 5I46H 3SU4A 2BY8X 3Q76A 1EOJA 3UPEA 1MTNB 2ZP0H 8KME2 3TK5A 1SFQB 1TX6A 1AFQC 3MI4A 3A7XA 4I8JA 4IMQA 1OS8A 4LOYH 2PWXA 3FFGA 1GDUA 3FANA 2XXLA 1N6YA 3VFEA 2H5DA 1QTFA 1BRCE 3FVFB 3T27A 4DT7B 2VIWA 3DFLA 1C5QA 1ARCA 2UUJB 1TMTH 1T31A 4KTSA 3Q3KA 1J16A 3F9FA 1TBRH 3PYHA 3OSYA 3ZZAA 3PTNA 4AFZA 1UTOA 2VIOA 2OD3B 1D4PB 2FOFA 4NG9H 2HWLB 4JZ1A 1SG8B 1O38A 3K65B 1L2EA 2ZU5A 1HAVA 4K5ZA 2ESTE 3EYDA 1ELEE 2BZAA 3KGPA 2BDHA 3RXDA 4K8YA 3W95A 4BTTB 2H9TH 4KGAA 1C1VH 1YPKH 3SNEA 1IQIA 1HAOH 1CQQA 1RJXB 4BTIB 4B2AA 2PKAB 2QAAA 1FY5A 2V3OH 1H9HE 2BLOA 1ZMJA 3M7QA 3QO6A 2AERH 1WV7H 2JH0D 4MPWA 3SGBE 4CRGA 3ZVBA 1DX5M 1V2UT 1SQOA 1HUTH 1A3BH 2ZQ1A 1UTQA 3BG8A 3TJOA 2RCEA 2VIPA 2Z7FE 3LJOA 1K1JA 1GBBA 1PPBH 1QL8A 2R2MB 4E05H 1TA6A 3KNXA 1ZPCA 4ISHH 3F6UH 2ZTXA 1AVGH 1ELFA 2W3KA 5EPNA 1T8LA 3P8OA 3ATLA 1A5GH 1GL1A 3RXVA 1GPZA 3A7YA 4NIXA 4FUDA 2HRVA 1SMFE 2XBVA 3QDZB 1GDQA 1S84A 2FOMB 4FUCA 1G30B 1AIXH 1NN6A 4AFUA 3QTVH 1AE5A 2J95A 3KN2A 4YTAA 2XC5A 4PROA 4CH8B 2OXSA 5F8TA 1PJPA 1GBTA 2GX4A 1WU1A 1BMLA 1C1QA 1CA0C 3ZZCA 3GY6A 2DE8A 1MZAA 3QGNB 5T3HA 4X8TH 3BSQA 2PTNA 1TX7A 3GY8A 4JZEH 7GCHG 1C5ZB 4TY6A 2NWNA 4LZ4B 4HFPB 2ZO3H 1P2NA 1SR5C 3KL6A 3VEQB 1E34B 3SU6A 1BTYA 2XWBI 3GY2A 2OUAA 1THSH 4FVDA 1B0FA 1QA7A 4AX9H 3RMNH 4X2VA 7ESTE 4K8BA 1O2WA 3SU5A 3PO1B 1FN6A 1TNHA 2WUCA 5F8XA 1MTNC 1W12U 1FN8A 1ZMNA 5LPFA 3SQHE 3TPIZ 1GWAA 1T4VH 8ESTE 1ABJH 2F9NA 4ZAEA 1ZR0A 2I6SA 5EU8A 3M7TA 4ESTE 1YYY1 4ASHA 1C2JA 2C8WB 1PQ5A 2OC1A 2OTVA 4YOGA 3RXLA 1T7CA 2Y5HA 4DJZB 1GVKB 5IDKA 1HAGE 1G3DA 2AGGX 1CT4E 5GPIB 1EAWA 1Z8JB 1QCPA 4GSOA 3RM0H 1GJ4H 2Q1JA 1G36A 1E35B 4NFEA 1LO6A 4OS1A 1TABE 4MNYA 2AMPA 3BTWE 6GCHF 4AORA 1A1RA 3B8JA 1DUEA 1TFXA 2R0KA 1SLWB 3HKJB 1VITH 5L6NH 3P17H 3DT0H 4ZHMU 5DP4A 1YPMH 3BTDE 2ZDKA 1TMBH 4WXIA 4A1VA 1GJ9B 2ZDLA 3FZDA 3LKWA 2NU4E 4DG4A 1A0LA 1D3PB 3EA8A 1S0QA 2FM2A 1O3FA 4X2XA 3RXIA 1QIXB 4X1PU 2A7HA 1QQUA 3ATWA 1P3CA 4A92A 3Q00A 3DA9B 1O0DH 3ZVCA 2CMYA 3AW1A 1O3DA 3ZZBA 4BTUB 2EEKA 4KTUA 1AUJA 3RU4T 1OWDA 4DCDA 1RXPA 3DHKH 1AU8A 3ELAH 1O5GH 1YGCH 1GBJA 3LT3A 2DE9A 1SL3A 1TNJA 3KIDU 1NT1A 3A7WA 4VGCB 1HAIH 5EGMA 3FAOA 1C5UA 1OP2A 1W0ZU 1AY6H 1V6DA 1PYTD 3EA7A 2R3YA 2ZDAH 3ATMA 2D8WA 1Z8IB 4BAOB 1ESTA 1OWJA 1AWFH 4LK4A 1NM6A 4LXBH 2HGTH 3V7TA 2UUYA 2ZHDA 5L2YH 1NO9H 1L0ZA 1G9IE 2ZGCA 1GI7B 1O2TA 1WAYB 5E8EH 4IW4E 1MMJN 1OWKA 3ZZ6A 1MUEB 3JZ2B 4KKDA 4AG2A 3RMLH 1QRWA 1CA8B 1EZQA 3H7OA 3MTYA 3E8LA 3Q3XA 2PKSB 2XCFA 1HIAA 2G5VA 1Y3WA 2O8UA 1K1OA 3EA9A 4HGCA 1TGNA 4YOJA 4AYVB 3PO1C 2ZF0H 2G4TA 1O3MA 1Z1JA 1OWHA 2GCTB 2BQWB 2EI7A 2NU3E 2TGDA 5AHGH 3SU3A 4DY7B 1C5MD 1GMCG 2FI3E 4NWKA 1LHDH 2O9QA 2Y7ZA 1OYTH 1C5PA 1HGTH 2OCVB 4FUEA 1Z1IA 1BMNH 1W13U 1Z8RA 2FIRH 5FX6A 1F0SA 1ZJDA 3TJUA 2LPRA 3SV9A 1SGRE 2F9VA 2HNTE 1A7SA 1UVPA 4B2BA 4BAQB 2R3UA 3RXTA 2ZU4A 1C5RA 2BVRH 2W3IA 1KXEA 3SGAE 2SFAA 1BBRH 2GD4B 2SNVA 1V2JT 1VCQA 2ZFPH 3EAJA 4WVPE 3P70B 1S81A 1CHOG 1E38B 2QXHA 1G2LA 3SV7A 1LHEH 1QGFA 1FI8A 4B75A 1O2JA 5AFZH 2C90B 5A8YA 4ZHAA 3AAUA 1EB2A 1OKXA 3GY7A 1YPHC 3RXFA 1K1PA 1P8VC 2GZ9A 1V2OT 1SLVB 4XBBA 3VPKA 1O5AB 3MOCA 2BOKA 1ZSJA 4ISNA 1BJUA 2D2DA 1O2KA 5FCKA 1YBWA 2FXRA 2ULLA 1O2HA 3A84A 3HGPA 2WPIS 1ZLRA 2VJ1A 1O2LA 1RTLA 2H5CA 1A2CH 2OC8A 2BDCA 1C5XB 2EI6A 1HAZB 3B23B 2H1UA 1MBMA 4UONA 4IMZA 1FIZA 2Y5GA 1HAVB 1V2WT 1ZMLA 2FDAA 1FIWA 5BRRE 2WV4A 5JPMH 1BRAA 4Y8XA 4JYTA 3TNSA 1MTSA 5GDSH 1AVWA 3TH2H 1EJAA 2JH5D 4ABJA 1WBGB 1SVPA 3MO3A 4NA8A 1PQAA 1V2VT 1ZRBA 1JIMA 1F0UA 3NUMA 4K3JA 1W8BH 1A0HB 1LHCH 4GVUA 1DWEH 1XKAC 1PPGE 2BD8A 2G00A 3VXEH 1EZUC 5ESTE 1ELVA 1ZTJA 1FY1A 5A09A 2VGCB 2PHBA 1GBLA 3QX5H 4X6OA 2ZDNA 1S85A 2O8LA 3D65E 3LC5A 4OGXA 4AOQA 1ARBA 5TJXA 3E0PB 3RC6A 2Z94A 3UTUH 1H8IH 5GCHG 2FOCA 1GGDC 4FU8A 1GCDA 1W14U 4E06H 1OPHB 1XUIA 1HJAB 2VNTA 1VITF 3BF6H 4Y7AA 3PM3A 5HM2A 1RTFB 4B71A 1GJAB 2VH0A 3ZZ3A 1C5NH 1MQ5A 1RS0A 1SGPE 2B7DH 2GGVB 2PGQB 5LGOA 5I25A 3EGKH 1SGQE 3SGQE 3SZNA 3V3MA 4BAMB 4E7RG 3AVZA 2FODA 2VVCA 1MAXA 1DWDH 1EXFA 3UNQA 3DFJA 2W7SA 1FONA 1KXBA 4QT8C 2XBWA 2ZPRA 4GCHF 1FDPA 1MTUA 1EOLA 2AMDA 1AUTC 1UCYE 3HKIB 1AFQB 3SNBA 1D9IA 3A83A 4F49A 1KXDA 2M5TA 3URCA 3GCTG 1F5KU 1AE8H 1KDQA 1GI1A 1INCA 2P94A 3D49H 1TE0A 1ANDA 2WYJA 2R2WU 5C1YA 1C4Y2 1KLTA 3UQOA 3PMAB 4NA7A 2ZZUH 2FX4A 4D76A 1CGHA 2G81E 2YOLA 1TYNA 3SHCH 1IQHA 1MH0A 4FU9A 3ZZ8A 1SGDE 2BD5A 1HBTH 2FYQA 3LIWA 4NIVA 1NFUA 1A46H 3MU4A 1U6QA 1LHFH 1K21H 1H1BA 2B5TB 4Y0YE 3SV8A 3PV4A 1CBWB 1LQEA 1SPJA 5FAHA 4Q80A 1A0JA 2AH4X 1HJ8A 1BQYA 4ZH8A 3RMMH 3GYMA 2BLVA 2XW9A 1GI9B 4JZFH 3LONA 1CT2E 4MDSA 3UOUA 4J2YB 1MKXH 2UUFB 1S82A 1N8OB 9ESTA 2AEIH 1IQGA 1TWXB 1TPOA 5E0GA 4A7IB 4K69A 5ABWA 1FY4A 4MTBA 4JK6A 1PYTC 2P3FH 1GJCB 1OWEA 1PPZA 3EE0B 1QA0A 4XE4A 2AIQA 1GI3A 4GHQA 2A32A 2BX4A 2ZPSA 4MVNA 3MHWU 7LPRA 3F9GA 1T4UH 1BTWA 3SHAH 2P16A 2A0QB 4JZIA 2BD2A 4I8LA 1HB0B 1V2PT 3IG6B 2B9LA 4I8KA 1IQFA 3KEEA 1AZ8A 1PPFE 2QN5T 1PPCE 2VWLA 1BCUH 1GBFA 2FOEA 3BIVH 1UVOA 1UCYK 2A5AA 5C1XA 5HM9A 1OX1A 1C5SA 2OC7A 1O2GH 2QXIA 1D6RA 3MU1A 3A87A 2ANMH 1HJAC 4WH6A 5EW1H 1TIOA 2C3SA 2A5KA 5HGGA 4MPVA 2ZCHP 1XVOA 2WINI 3CS0A 2FOHA 1ZRKA 4THNH 2FMJA 3SNCA 5DP5A 2ZTZA 4NSVA 1A5HA 1HNEE 1KXFA 1GCTC 4INHA 5C1UA 1FXYA 2ZG0H 3SNDA 2R9PA 4Y8ZA 1AZZA 1HIAB 3PLPA 1O5EH 1UTJA 2FLRH 1O33A 3L3TA 2TBSA 2IPHA 2JH6D 2SGDE 1DWCH 3EQ0H 3SJ8A 1DICA 3UREA 1LKAA 2VVVA 3SOSA 2Z9JA 1S6FA 4XSKU 2IN2A 2WPLS 3SV6A 4NA9H 1DLKB 1WOFA 2GMTB 1UVSH 2EA3A 1UK4A 1BA8B 1JRSA 1J9CH 1HAHH 1TOMH 2XRCA 4WXVA 1FY3A 1GMHG 4YZUA 3TITA 2LNCA 3A8CA 2VB0A 3SUEA 1GHBF 3A80A 1JOUB 2ZIQH 6CHAB 4XBCA 1CU1A 3TK6A 1WCZA 4AB8A 2BDIA 1CBWC 2VWNA 4D7FA 5AFYH 4K1EA 1W10U 2QXJA 2D1JA 1GBKA 1HFDA 1UTKA 4H4FA 1F5RA 2TGTA 4YESB 1N8OC 5GWZA 1PPHE 1UHBB 2SGQE 4UFGH 1MTWA 2BY7X 3RM2H 1ZPZA 2BQ6B 1QR3E 2AMQA 3AW0A 3STIA 3JZ1B 2GCHF 4HZHA 1UK2A 1O3KA 2BD3A 1PPEE 1EP5A 1UTPA 1P02A 3UR9A 1ACBE 1F92A 2AGIX 3BTFE 4FUJA 1FAXA 2QF3A 2ZQ2A 3RXKA 1O3PB 3P8FA 1QQ4A 1LQDB 1SB1H 1GHAF 1C1PA 2O8MA 1RIWC 2AFQB 2FLBH 5FCRA 1WUNH 3RXOA 4B76A 1GHVH 1H4WA 1TLDA 4O97A 4F4OC 4NGAH 1O3GA 1P05A 3KQEA 3RXBA 5PTPA 3SUGA 3SUFA 2W7UA 1ELCA 1P12E 2BDYA 4Y10E 1ZPBA 1XM1A 1GJ5H 1IQNA 3URDA 2QC2A 2VWMA 1Z71A 3GY5A 1O30A 2K1QA 2ALVA 1OP0A 1WTHD 1Y3XA 5LPEA 3LGTA 4MNWA 1RTKA 1P09A 1S83A 1TNLA 3LDXH 1CT0E 2AS9A 3L33A 1DLEA 4HI3A 2VU8E 4YT7H 5DP9A 1FY8E 3UR6A 4Y0ZE 1SLUB 1ETSH 3MNXA 2ANKH 1AD8H 2THFB 3IITA 2WPJS 4JYUH 3ZV8A 2H6MA 3RXQA 2ZDVH 3P8GA 1TNIA 5EQSA 1EX3A 5J4SA 1A61H 4XDEA 3BTGE 3RXAA 1TGSZ 2YNAA 4ZKOU 1MU6B 2BHGA 3LGIA 2ZECA 1ANEA 1M9UA 2QV1A 2ZHFH 1LHGH 2QXGA 2Z9GA 1XUHA 4AGKA 5F6MA 4GUXA 3A88A 2BX3A 2ZGJA 1C1SA 4ISIH 2GMTC 1NPMA 1S6HA 1IHTH 3LGWA 2I6QA 3Q3YA 3U9AH 3SW2B 2GKVE 2TGAA 2OP9A 2F9BH 1QL7A 1P3EA 1VCWA 8GCHG 3GDUA 3AAVA 2P8OB 1O3HA 1EJNA 4H42U 3GYLB 2P3UB 2FI4E 2RDLA 6CHAC 2R0LA 1JWTA 3ODFA 2ZWLH 3NK8A 1CGIE 1MCTA 3M5LA 1ORFA 4DGJA 1C2FA 2BYAX 1W2KH 4X1NU 1KDQB 1P06A 4X8UH 2BVXH 4DIHH 3GDVA 1C2EA 1ANCA 2XWAA 1Y3YA 2CJIA 3SU1A 3BEIB 3S7KB 2Y82A 5GJ4B 3U8OH 3VB7A 4I8GA 3RXRA 3M37A 1O2QA 3TGKE 1ANBA 3UNSA 1AGJA 1NFWA 1K2I1 4BXSA 1GBIA 1C5VA 1XVMA 6ESTA 3K2UA 1QY6A 1OP8A 2YNBA 4XOJA 3EDXB 2ILNA 3QK1A 2FTLE 2GT7A 1NC6A 3MH7A 1SHYA 1HAYB 3LH1A 1P2QA 2PV9B 4O3TA 4RSPA 3RP2A 2ODQA 1C1NA 1O3LA 3ESTA 4FUGA 5HYOA 1CO7E 3BG4C 4ZKSU 1AQ7A 1ESBA 2ANWA 2GTBA 1Q3XA 3PWCA 1TNGA 1EJMA 3MU5A 1SGFA 1P9SA 1YPJH 2AIPA 1L4ZA 3SJ9A 5DKMA 4YOIA 2FEQH 2C93B 1K22H 2Z9KA 4UDWH 2G8TA 5JBAS 4X8SH 4KELA 3LC3A 1A3EH 3O8CA 1UTMA 2TPIZ 1C1WH 2FOBA 2ZPQA 1SC8U 4AN7A 2Y6TA 4SGAE 3OX7U 3TGJE 5TCAA 2W26A 1HRTH 1EZXC 1TPSA 2WPKS 1K1MA 2P95A 1E0FD 1GGDB 3RXUA 1Z8GA 2XBXA 4UFDH 4WWYA 1GJ8B 2XC0A 7GCHF 4FVBA 2STBE 2VIVA 2UUKB 3QZRA 5C5OA 1DT2A 5TCCA 1BBRE 1IHSH 1QHRB 3GY3A 3RLYH 4ABAA 1GBCA 1C1MA 1DUAA 2J92A 1GHYH 1XUJA 4D9QA 1DPOA 3D62A 2Q6FA
chains in the Genus database with same CATH superfamily
1TAWA 1C4U2 3A7VA 1EZSC 2ZCLP 4OS5A 2ZU3A 1UJ1A 4XRNA 5EXMA 2OBOA 2KZ4A 4Z0KA 2AGEX 4A1XA 5CDFE 1UVUH 4TPIZ 5CHAC 1C1UH 2P8OC 1O5CB 2ODPA 4RT0A 1K1IA 2ANYA 2XC4A 2ZGHA 1FUJA 2WV5A 3ZVFA 1TQ7B 4FUFA 4AG1A 3MU0A 4Y7BA 4I8HA 4O03A 4AZ2B 2QIQA 3G01A 4XFQA 3TU7H 2ZFFH 3V0XA 1UHBA 1V2KT 2GZ8A 3T28A 3RU4E 1EUFA 1TX8A 1TPAE 3K6ZA 1K0HA 2ZGBH 3PMBB 1P9UA 4XD7D 1GG6C 1W7XH 1VJAU 2JIZD 5E0JA 1IQJA 1O37A 4INKA 4O9VA 5F8ZA 1JBUH 2V3MA 1GI2A 3ODDA 3TIUA 3P8NA 4CRAA 3LOXA 3RDZA 1H9LB 5L2ZH 1FJSA 3SYJA 1HAPH 1LPKB 1YCPH 2SGFE 3HPTB 2G52A 1FX0B 3GCHB 1IOEA 3UOPA 3TH4H 4O3UA 4UD9H 4BXWA 3PROA 3OTJE 2VINA 1ZHRA 2ZFQH 5F53A 2NU0E 4CHAB 4IS5A 5A8ZA 3ZVGA 1QURH 3SJOA 3FZZA 3F0PA 3P92A 3AK5A 1K28D 2PFEA 1RRKA 2FTMA 4YT6H 3VGCB 3TH3H 1G3EA 2BM2A 1BBRK 1XUGA 3WY8A 1WQVH 3M3VA 2OINA 4ZKNU 1V2QT 2BXTH 4Y6DA 4MPUA 2V35A 2WPMS 2OK5A 2PSXA 2QF5A 1TRYA 4U01A 3H5CB 3KQDA 3HK6B 5DN6D 1D3DB 1SGEE 1DXWA 2FS8A 2Z3EA 2F3CE 2GVFA 1Z6EA 3T5FH 1KTTB 2L6OA 2H9HA 4A6LA 1C2LA 5DK1A 4MNXA 1OSSA 1C2HA 1O2ZA 1VCPA 1IQKA 1S0RA 1UMAH 5AVDA 4ABIA 4MLFB 1SGTA 2Q6DA 3OFND 1YPGH 2GV6A 1PQ8A 2WPDD 1WSSH 3CENA 5DG6A 1CSOE 1GMDG 3UIRA 3VB6A 1G3CA 3QZQA 4ZCNA 1EPTC 1T8OA 2PLXA 5EXLA 3QUMP 1O3CA 3LJJA 5EJLA 4IC5A 1GCTB 4X6NA 2ZFRH 4IN2A 1O2VA 1K9OE 4OS7A 2FX6A 1KLJH 2PSYA 4UE7H 1QJ1B 1SGYE 1WQSA 2BY6X 1W11U 3MO9A 4K60A 1GMCF 4U2WA 1SGFG 1IAUA 1YM0A 2FOAA 2HLCA 3T2NA 2RG3A 1W0JD 2FESH 1Y3UA 1XMNB 1MKWH 3ATKA 1P01A 3OY5U 3A89A 4WJG2 1P2MA 5G4BA 1LMWB 1VKYA 4FUIA 2GZ7A 4MPXA 1D6WA 3U98H 1QRZA 1C4V2 1P10A 2G4UA 2VIDA 4OS4A 1ETTH 3SI3H 1QJ7B 3DSOA 9LPRA 3PLBA 1BHXB 1DOJA 1DY8A 1X7AC 1Y5AT 1O2YA 1CHOF 4TWYA 5T6DA 4MNVA 2ZNKH 3NKKA 3O8BA 4JK5A 1C5YB 1JXPA 1UCYH 1OOKB 3VXFH 1DE7H 3RXEA 1ETRH 1SKYE 1DY9A 4CBNA 3T62A 1GI0A 1RFNA 1J14A 4JYVH 1OWIA 3GCHC 3ZZ4A 5FBEA 2A4QA 5EQRA 2EC9H 2F9OA 1DANH 5GIBA 1THPB 4NCYA 1HLTH 5A0AE 4CHAC 2RA3A 2O8WA 2BDBA 2J9NA 1GVZA 2WYGA 1F2SE 2F9PA 2XNIA 4ABFA 1BDAA 2XCNA 1GBMA 3VGCC 4AB9A 3I78A 3NCLA 3GICB 1E1RD 1C2MA 1ELTA 4Q7YA 1D3TB 1VR1H 5HKKD 2ASUB 1KTSB 1RIWB 1BTUA 1LKBA 5KEDA 1GJ7B 1BHXF 2ZEBA 1C5WB 3ZVDA 2ZU2A 1C5LH 2RDEA 4B73A 2CHAC 2ZFSA 2OQUA 3S0NA 1V2NT 1NESE 2WZQA 3M35A 5C2ZA 3SV2H 2GV7A 2F9UA 4RKOB 1FAKH 1DWBH 4FU7A 5T6FA 1GJDB 1QB1A 3PRBA 1THRH 3MMGA 1V3XA 3M5OA 4NWLA 4Y71A 4WH8A 2IOTA 2K0QA 5FPSA 1A4WH 2Z9IA 1EPTA 3A81A 4ZXXH 5JDUB 3E0NB 1VGCB 2BD9A 2ALPA 2Z6BD 3QN7A 4U30A 5ESBA 3MQKC 2WPHS 1JRTA 3ZZ5A 4WMDA 2ZTYA 1EKBB 2G51A 3N7DA 2IJD1 3SO3A 1MBQA 2CV3A 2F91A 2A4GA 4Q7ZA 4ABDA 1TA2A 3R3GB 3F3BA 3UQVA 3I29A 1C2KA 2SGPE 1CHGA 1MKXK 1RD3B 3A8BA 4DURA 1AI8H 4CRFA 1ELDE 5GCHF 1MCVA 1SGNE 3M5NA 1MU8B 2W5EA 5EPYA 1NTPA 4CR5A 3KQBA 2H9EH 4I33A 4NZLA 5A0CA 1B0EA 3FP7E 4ZUHA 5CMXH 3LGVA 3S7HB 1AO5A 2EI8A 2FS9A 2Q6GA 3P6ZB 2BB4A 4AFQA 5A0BA 1SOTA 1HAXB 2HPPH 4WMFA 1N6XA 2KAIA 3OAAD 1TOCB 3TK9A 3S9BA 4GHTA 1UVTH 1IQEA 6GCHG 1ZOMA 2VWOA 3W94A 1V2LT 2EY4C 2XYAA 3BTTE 1O31A 1C9PA 1C1TA 4X1QU 4X1SU 1YPEH 5JBCS 3GCTF 5JBTA 1O32A 2QGRA 1F0TA 3BTHE 4Y8YA 2O8TA 1E79D 1G37A 2J38A 4GPGA 2B0FA 1F5LA 4YM9A 1O3AA 8LPRA 1SI5H 1G32B 3ZZ9A 3PWBA 1P04A 2C8ZB 5EIYA 3KHVA 2HPQH 7KMEH 2J4IA 3MU8A 4CRDA 3T25A 3F2FA 1KIGH 3PB1E 3U8RH 4J1YA 4H6SB 2FPZA 1QNJA 1LVMA 5JBBS 4CR9A 1O3JA 1AN1E 2F43B 5KECA 1K1LA 3A8DA 3IWMA 3SJIA 5J4QA 1NROH 5JB9S 3SUDA 3RXMA 5C5NA 2HVYB 1ABIH 1UTLM 1L4DA 1TGBA 4BAHB 1P2KA 4X0WU 1MQ6A 3TVJB 3NZIA 1ZGVA 3E16B 2A31A 1TMUH 1GL0E 3GCOA 1ZSKA 1JIRA 1TNKA 1AFEH 2HNTC 2IPQX 2UWLA 1ELGA 3ENSB 4ZHLU 1AB9C 1BZXE 2A5IA 4AFSA 5L30H 1DSUA 1T32A 2ZCKP 5HXFA 2TRMA 3QTOH 1SHHB 3NPSA 3O8RA 2BDGA 4D7GA 4IN1A 3BG4B 2FWWA 2G55A 3BEUA 5HMAA 3MH4A 2IJOB 1IQLA 1BMMH 1SGCA 2BY5X 4YO9A 4FUHA 3MFJA 4AC9A 3S9CA 1ZTLA 3GCNA 1YPLH 1AHTH 1VGCC 1ZJKA 2WV9A 4Q2KA 4RKJB 2NU2E 4K2YA 2PUQH 1BTZA 3LPRA 2HOBA 1SBWA 4ISOA 1QJ6B 4X2YA 4ABGA 1XUFA 2BTCE 3NWUA 3DD2H 1FLEE 1GHXH 4CREA 1MD7A 3I77A 1YC0A 3TGIE 2J94A 5DSFA 4TT3D 5EODA 1HXEH 4KP0A 2WSSD 4JCNA 5LPRA 2ZU1A 2BLQA 1GDNA 5C67A 3ZV9A 3KCGH 3PLKA 2OQ5A 2J98A 6LPRA 1KYNA 3GOVB 3PMHB 1NS3A 3RC5A 2HLDD 2CF9H 1XXFA 2Z3DA 1D3QB 2BD4A 1GJ6A 3RLWH 4HTCH 4TPYA 2A2QH 4JZDH 3U1JB 4X6MA 2DUCA 5IYTA 1BOQA 5FX5A 5JB8S 1P2OA 3FP8E 4D8NA 1YP9A 1AVXA 4CRCA 3UY9A 3D23A 3UNRA 1V2ST 3STJA 2GDEH 2A7JA 2Y81A 1LVOA 4OM9A 1PQ7A 2SGEE 1LTOA 1SQTA 3QGJA 1C2GA 1YF4A 4TYDA 5CHAB 1O2UA 1ZSLA 3T26A 2VIQA 4WY3A 3A86A 1UTNA 1Y3VA 2F83A 2CXVA 1ZGIA 1Q2WA 3MH6A 2SNWA 3UAIC 1O39A 1NFXA 3SNAA 2FP7B 1GI6A 4H6TA 3RMOH 1BIOA 5A8XA 2XBYA 4M7GA 4AGJA 3BTEE 3ATIA 4I86A 1O3EA 1DM4B 1G3BA 2ZHEH 2BY9X 2Y5FA 5SGAE 1BTHH 3RXJA 2JETB 1GMHF 1P11E 2J2UA 4X6PA 1GG6B 3N7OA 4INLA 4BAKB 1NU7B 1NBME 3SN8A 1TONA 2TGPZ 1ID5H 3MH5A 3NXPA 4OS6A 4WMEA 2BDAA 1C9TA 3SI4H 5B6OA 3MYWA 1O2PA 5DGJA 4P02A 3L6PA 2D26C 1LVBA 1QL9A 1E36B 1P03A 3RXHA 4ABBA 3GY4A 2A4OA 1CGJE 1K1NA 1V2RT 1NU9A 5EOKA 1NRNH 2UWPA 1LVYA 5FBIA 3OU0A 1V2MT 2V0BA 3RC4A 2J34A 1AKSA 3ZVAA 1C5OH 4NFFA 1O2OA 4X1RU 1GJBB 3BEFB 1SGIB 2QYIA 4JMYA 3QWCH 4ZROA 1H8DH 2PUXB 1GBAA 3ZVEA 3RXPA 1C5TA 3GDSA 2BQ7B 4E7NA 4OGYA 3MO6A 3PMJA 2C8XB 5EW2H 2A4RA 3SU0A 1VZQH 1GVLA 4ZKRU 3QLPH 3KF2A 3VB3A 3U8TH 3MNCA 3ITIA 3M7UA 3P95A 2BXUH 1FMGA 5HIYA 3M61U 2HVXA 4I31A 5C3NA 5FPTA 3TLOA 5JYIA 1S5SA 1IQMA 1GI5A 5DP3A 4NZQA 1FQ3A 3CP7A 1EATA 2LP6A 1VITG 3AASA 2V3HH 2A1DB 4YXWD 2RA0A 2BVSH 3SORA 1NZQH 2W6JD 1QBOA 4K1TA 1KY9A 2H2ZA 2ZDMA 1NBMD 3BN9A 3DSPA 3OY6U 1XXDA 1AMHA 1GI8B 1HPGA 1EPTB 1O2IA 1NFYA 1Y59T 3FOAA 3OYPA 1TBQH 3E91A 1LCYA 1SQAA 3SQEE 3SZEA 4GCHG 3VB5A 3RXCA 1O3BA 2JKHA 1EAIA 3R0FA 1DXPA 1HDTH 4MQAA 3TNTA 3UWIA 4TY7A 1DITH 2A7CA 2BD7A 3F1SB 3SBKA 1P0SH 1H9IE 3HK3B 3TJVA 1YLNA 3PTBA 4DW2U 3UFAA 1Y5UT 1VJ9U 3BTKE 5DP8A 5E0HA 1MZDA 4Q63A 1L1GA 3H7TA 1TALA 2G5NA 2JDID 1O3IA 5K7RA 3HGNA 1EQ9A 1BB0B 4ACBA 2QF0A 1BRUP 3PV5A 4NIYA 1BITA 1O2MA 2JETC 1ZYOA 1QRXA 1HYLA 4I32A 2KAIB 1O5BB 8GCHF 1A5IA 1B7XB 1KSNA 3F2GA 3Q77A 1J8AA 3ZZ7A 4BANB 1TGTA 2Y7XA 5FPYA 1CVWH 1QB6A 2PKAA 1L1JA 1LPGB 4NSYA 2QY0B 1EAUA 2FI5E 3FP6E 1TRNA 1FV9A 1O36A 1BT7A 1B5GH 3LU9B 1FPHH 1E37B 3C1KA 4DT4A 1QBVH 2ZC9H 3LGUA 1F0RA 4XBDA 4FUBA 1Q31A 1HCGA 1O5FH 4F55A 3M3SA 2FO9A 4CH2B 1WTGH 4KTCA 4D9RA 4WF8A 1TPPA 1O5DH 3S69A 1TQ0B 2OC0A 3MNSA 1HJ9A 1EASA 3TJNA 4A1TA 4X8VH 2GP9B 3C27B 4DOQA 2VH6A 3A7ZA 4CBOA 1ZHMA 1DVAH 3HATH 1NRPH 4VGCC 1LDTT 4Y79A 1ZTKA 1GBEA 1PFXC 4A5TS 1TGCA 1W3CA 1NRSH 1EFRD 1O35A 1P2JA 1P57B 1O3OA 2EQNA 5DPAA 1Y5BT 3E90B 1BMAA 5DP6A 3U69H 1COWD 2PW8H 3VB4A 3ZZDA 2CGAA 1KXCA 1Z6JH 2C4FH 4GLYA 3M36A 1ELBA 3A7TA 1SFIA 1SOZA 2CHAB 2NU1E 1RGQA 4ZXYH 2FOGA 4DIIH 3NRLA 4U32A 1QB9A 1SLXB 3MNBA 2ODYB 5B6LA 5EXNA 2A2XH 1J15A 2JJ2D 3U1IB 1V2TT 3O8DA 3RU4D 1NY22 4B74A 5DJ7A 4ABHA 1EAXA 3BTME 3KQ5A 4NIWA 2BZ6H 1WYKA 2PKSC 3E3TA 1UO6A 1FPCH 2A45B 1BRBE 1O2XA 2FZZA 4Y76A 1DDJA 5C0UA 2P3TB 2UWOA 1L1NA 2V7QD 2Z3CA 3B9FH 1YLDA 2Z9LA 1BTPA 3A82A 2GCTC 1HXFH 4IBLH 5T6GA 1YCPK 1GHWH 1XX9A 1C2DA 1P2IA 1QFKH 3RUOA 1G2MA 1LPZB 2VBCA 3BV9B 4BOHA 4RN6A 3CNRA 5DO4H 1ZZZA 4ABEA 2ZHQH 1YKTA 2ZI2H 3ZYDA 5BPEA 1YWUA 3SJKA 3UUZA 1UK3A 1TBZH 1SSXA 2FYRA 5EG4A 1WXRA 2J98B 3M3TA 3BTQE 1C1RA 4ISLA 3M5MA 2BLWA 3CS7A 2WUBA 1EB1H 4YLQH 1O2RA 2KR7A 4LZ1H 1GHBG 4ASUD 3ZYEA 2ZFTA 2Y80A 2OBQA 2PTCE 1GHZA 2QCYA 1ELAA 2TIOA 3LH3A 2GDDA 1ESAA 2ZHWH 2ZA5A 2GT8A 5ETXA 2QA9E 3BIUH 1N1LA 1T8NA 1FZZA 2V6NA 4IGDA 3K6YA 1HV7A 1W0YH 2AYWA 1C1OA 1BJVA 3E1XB 3MWIU 3GISB 1OXGA 4YLUA 1JMOH 1NRQH 4UFEH 1O2SA 2GCHG 2PGBB 1DFPA 1F7ZA 2LELA 4B6EA 4B1TA 1KXAA 5CE1A 5E2PA 4SGBE 5DP7A 3A8AA 3E6PH 2BMGB 4AYYB 1GHAG 1YCPM 1NRRH 1BUIA 4R8TB 3WW7A 1TB6H 4UFFH 1O2NA 2SGAA 3F9HA 1AB9B 1GBHA 1QBNA 1GI4A 1MKWK 3V12A 4I7YH 1XUKA 3UWJH 1YLCA 2STAE 1Y8TA 3DUXH 1J17T 4ZMAH 3V13A 1AKSB 2BOHB 4TWWA 5EQQA 1FNIA 5H4IB 1AWHB 3LGYA 4B2CA 2P93A 1DSTA 1EP6A 5LH8A 4K1SA 2CN0H 5C20A 2HALA 5E2OA 3F9EA 2KCYA 4Y11E 1YPHE 3A85A 4DVAU 1O34A 3F68H 5A2MH 2VGCC 1MAYA 4BNRA 4FXGH 1H8ED 4Q7XA 1CE5A 1Z7KA 2OLGA 2ZGXH 1ZHPA 1O3NA 4R0IA 5F03A 1OYQA 4CRBA 1CA0B 1TRMA 2ZKSA 4GAWA 2B8OH 3KQCA 4Z6AH 3T29A 2P59A 4OS2A 1WDIA 1KLIH 2HNTF 2PR3A 1T8MA 4MG3A 1YY3A 1GBDA 5AF9H 5K0HA 1W7GH 2VVUA 3RXGA 1MTVA 4IC6A 3SU2A 2CF8H 1GMDF 4X2WA 5FHTA 1MD8A 4UEHH 1BTXA 1XKBC 2C8YB 1DS2E 1C2IA 3RXSA 3S9AA 2XTTB 3K9XB 5FXLA 5GXPA 5I46H 3SU4A 2BY8X 3Q76A 1EOJA 3UPEA 1MTNB 2ZP0H 8KME2 3TK5A 1SFQB 1TX6A 1AFQC 3MI4A 3A7XA 4I8JA 4IMQA 1OS8A 4LOYH 2PWXA 3FFGA 1OHHD 1GDUA 3FANA 2XXLA 1N6YA 3VFEA 2H5DA 5EJZA 1QTFA 1BRCE 3FVFB 3T27A 4DT7B 2VIWA 3DFLA 1C5QA 1ARCA 2UUJB 1TMTH 1T31A 4KTSA 3Q3KA 1J16A 3F9FA 3N7EA 1TBRH 3PYHA 3OSYA 3ZZAA 3PTNA 4AFZA 1UTOA 2VIOA 2OD3B 1D4PB 2FOFA 4NG9H 2HWLB 4JZ1A 1SG8B 1O38A 3K65B 1L2EA 2ZU5A 1HAVA 4K5ZA 2ESTE 3EYDA 1ELEE 2BZAA 3KGPA 2BDHA 3RXDA 4K8YA 3W95A 4BTTB 2H9TH 4KGAA 1C1VH 1YPKH 3SNEA 1IQIA 1HAOH 1CQQA 1RJXB 4BTIB 4B2AA 2PKAB 2QAAA 1FY5A 2V3OH 1H9HE 2BLOA 1ZMJA 3M7QA 3WWBA 3EE7A 3QO6A 2AERH 1WV7H 2JH0D 4MPWA 3SGBE 4CRGA 3ZVBA 1DX5M 1V2UT 5C17A 1SQOA 1HUTH 1A3BH 2ZQ1A 1UTQA 3BG8A 3TJOA 2RCEA 2VIPA 2Z7FE 3LJOA 1K1JA 1GBBA 1PPBH 1QL8A 2R2MB 2XOKD 1TA6A 3KNXA 1ZPCA 4ISHH 4E05H 3F6UH 2ZTXA 1AVGH 1ELFA 2W3KA 5EPNA 1T8LA 3P8OA 3ATLA 1A5GH 1GL1A 3RXVA 1GPZA 3A7YA 4NIXA 1UW7A 4FUDA 2HRVA 1SMFE 2XBVA 3QDZB 1GDQA 1S84A 2FOMB 4FUCA 1G30B 1AIXH 1NN6A 4AFUA 3QTVH 1AE5A 2J95A 3KN2A 4YTAA 2XC5A 4PROA 4CH8B 2OXSA 5F8TA 1PJPA 1GBTA 2GX4A 1WU1A 1BMLA 1C1QA 1CA0C 3ZZCA 3GY6A 2DE8A 1MZAA 3QGNB 5T3HA 4X8TH 3BSQA 2PTNA 1TX7A 3GY8A 4JZEH 7GCHG 1C5ZB 4TY6A 2NWNA 4LZ4B 4HFPB 2ZO3H 1P2NA 1SR5C 3KL6A 3VEQB 1E34B 3SU6A 1BTYA 2XWBI 3GY2A 2OUAA 1THSH 2YMSD 4FVDA 1B0FA 3FO8D 1QA7A 4AX9H 3RMNH 4X2VA 4Z1MD 7ESTE 4K8BA 1O2WA 3SU5A 3PO1B 1FN6A 1TNHA 2WUCA 5F8XA 1MTNC 1W12U 1FN8A 1ZMNA 5LPFA 3SQHE 3TPIZ 1GWAA 1T4VH 8ESTE 1ABJH 2F9NA 3OE7D 4ZAEA 1ZR0A 2I6SA 5EU8A 3M7TA 4ESTE 1YYY1 4ASHA 1C2JA 2C8WB 1PQ5A 2OC1A 2OTVA 4YOGA 3RXLA 1T7CA 2Y5HA 4DJZB 1GVKB 5IDKA 1HAGE 1G3DA 2AGGX 1CT4E 5GPIB 1EAWA 1Z8JB 1QCPA 2KCOA 4GSOA 3RM0H 1GJ4H 2Q1JA 1G36A 1E35B 4NFEA 1LO6A 4OS1A 1TABE 4MNYA 2AMPA 3BTWE 6GCHF 4AORA 1A1RA 3B8JA 3ZIAD 1DUEA 3FN8A 1TFXA 2R0KA 1SLWB 3HKJB 1VITH 5L6NH 3P17H 3DT0H 4ZHMU 5DP4A 1YPMH 3BTDE 2ZDKA 1TMBH 4WXIA 4A1VA 1GJ9B 2ZDLA 3FZDA 3LKWA 2NU4E 4DG4A 1A0LA 1D3PB 3EA8A 1S0QA 2FM2A 1O3FA 4X2XA 3RXIA 1QIXB 4X1PU 2A7HA 3DSGA 1QQUA 3ATWA 1P3CA 4A92A 3Q00A 3DA9B 4FETA 1O0DH 3ZVCA 2CMYA 3AW1A 1O3DA 3ZZBA 4BTUB 2EEKA 4KTUA 1AUJA 3RU4T 1OWDA 4DCDA 1RXPA 3DHKH 1AU8A 3ELAH 1O5GH 1YGCH 1GBJA 3LT3A 2DE9A 1SL3A 1TNJA 3KIDU 1NT1A 3A7WA 4VGCB 1HAIH 5EGMA 3FAOA 1C5UA 1OP2A 1W0ZU 1AY6H 1V6DA 1PYTD 3EA7A 2R3YA 2ZDAH 3ATMA 2D8WA 1Z8IB 4BAOB 1ESTA 1OWJA 1AWFH 4LK4A 1NM6A 4LXBH 2HGTH 3V7TA 2UUYA 2ZHDA 5L2YH 5HIZA 2KCAA 1NO9H 1L0ZA 1G9IE 2ZGCA 1GI7B 1O2TA 1WAYB 5E8EH 4IW4E 1MMJN 1OWKA 3ZZ6A 1MUEB 3JZ2B 4KKDA 4AG2A 3RMLH 1QRWA 1CA8B 1EZQA 3H7OA 3MTYA 3E8LA 3Q3XA 2PKSB 2XCFA 1HIAA 2G5VA 1Y3WA 2O8UA 1K1OA 3EA9A 4HGCA 1TGNA 4YOJA 2YMSB 4AYVB 2RFKC 3PO1C 2ZF0H 2G4TA 1O3MA 1Z1JA 1OWHA 2GCTB 2BQWB 2EI7A 2NU3E 2TGDA 3PV2A 5AHGH 3SU3A 4DY7B 1C5MD 1GMCG 2FI3E 4NWKA 1LHDH 2O9QA 2Y7ZA 1OYTH 1C5PA 1HGTH 2OCVB 4FUEA 4F48B 1Z1IA 1BMNH 1W13U 1Z8RA 2FIRH 5FX6A 1F0SA 1ZJDA 3TJUA 2LPRA 3SV9A 1SGRE 2F9VA 2HNTE 1A7SA 1UVPA 4B2BA 4BAQB 2R3UA 3RXTA 2ZU4A 1C5RA 2BVRH 2W3IA 1KXEA 3SGAE 2SFAA 1BBRH 2GD4B 4FOUC 2SNVA 1V2JT 1VCQA 2ZFPH 3OEHD 3EAJA 4WVPE 3P70B 1S81A 1CHOG 1E38B 2QXHA 1G2LA 3SV7A 1LHEH 1QGFA 1FI8A 4B75A 1O2JA 5AFZH 2C90B 5A8YA 4ZHAA 3AAUA 1EB2A 1OKXA 3GY7A 1SQRA 1YPHC 3RXFA 1K1PA 1P8VC 2GZ9A 1V2OT 5CHBA 1SLVB 4XBBA 3VPKA 1O5AB 3MOCA 2BOKA 1ZSJA 4ISNA 1BJUA 2D2DA 1O2KA 5FCKA 1YBWA 2FXRA 2ULLA 1O2HA 3A84A 3HGPA 2WPIS 1ZLRA 2VJ1A 1O2LA 1RTLA 2H5CA 1A2CH 2OC8A 2BDCA 1C5XB 2M2AA 2EI6A 1HAZB 3B23B 2H1UA 1MBMA 4UONA 2J97A 4IMZA 3GS9A 1FIZA 2Y5GA 1HAVB 1V2WT 1ZMLA 2FDAA 1FIWA 5BRRE 2WV4A 5JPMH 1BRAA 4Y8XA 4JYTA 3TNSA 1MTSA 5GDSH 1AVWA 3TH2H 1EJAA 2JH5D 4ABJA 1WBGB 1SVPA 3MO3A 4NA8A 1PQAA 1V2VT 1ZRBA 1JIMA 1F0UA 3NUMA 4K3JA 1W8BH 1A0HB 1LHCH 4GVUA 1DWEH 1XKAC 2QF4A 1PPGE 2BD8A 2G00A 3VXEH 1EZUC 5ESTE 1ELVA 1ZTJA 1FY1A 5A09A 4M9FA 2VGCB 2PHBA 1GBLA 3QX5H 4X6OA 2ZDNA 1S85A 2O8LA 2YMSC 3D65E 3LC5A 4OGXA 4AOQA 1ARBA 5TJXA 3E0PB 3RC6A 2Z94A 3UTUH 1H8IH 5GCHG 2FOCA 1GGDC 4FU8A 1GCDA 1W14U 4E06H 1OPHB 1XUIA 1HJAB 2VNTA 1VITF 3BF6H 4Y7AA 3PM3A 5HM2A 1RTFB 4B71A 1GJAB 2VH0A 3ZZ3A 1C5NH 1MQ5A 1RS0A 1SGPE 2B7DH 2GGVB 2PGQB 5LGOA 5I25A 3EGKH 1SGQE 3SGQE 3SZNA 3V3MA 4BAMB 4E7RG 3AVZA 2FODA 2VVCA 1MAXA 1DWDH 4TSFD 5C94A 1EXFA 3UNQA 3DFJA 3N99A 2W7SA 1FONA 1KXBA 2W6ID 4QT8C 2XBWA 2ZPRA 4GCHF 1KMHB 1FDPA 1QZ8A 1MTUA 1EOLA 2AMDA 1AUTC 1UCYE 2KX4A 3HKIB 1AFQB 3SNBA 1D9IA 3A83A 4F49A 3KYGA 1KXDA 2M5TA 3URCA 3GCTG 1F5KU 1AE8H 1KDQA 1GI1A 1INCA 2P94A 3D49H 1TE0A 1ANDA 2WYJA 2R2WU 5C1YA 1C4Y2 1KLTA 3UQOA 3PMAB 4NA7A 2ZZUH 2FX4A 4D76A 3F0OA 3OEED 1CGHA 2G81E 2YOLA 1TYNA 3SHCH 1IQHA 1MH0A 4FU9A 1H8HD 1SGDE 3ZZ8A 2BD5A 1HBTH 2FYQA 3LIWA 4NIVA 1W0KD 2JJ1D 1NFUA 1A46H 3MU4A 1U6QA 1LHFH 1K21H 1H1BA 2B5TB 4Y0YE 3SV8A 3PV4A 1CBWB 1LQEA 1SPJA 5FAHA 4Q80A 1A0JA 2AH4X 1HJ8A 1BQYA 4ZH8A 3RMMH 3GYMA 2BLVA 2XW9A 1GI9B 4JZFH 3LONA 1CT2E 4MDSA 3UOUA 4J2YB 1MKXH 2K8IA 2UUFB 1S82A 1N8OB 9ESTA 2AEIH 1IQGA 1TWXB 1TPOA 5E0GA 4A7IB 4K69A 5ABWA 1FY4A 4MTBA 4JK6A 1PYTC 2P3FH 1BMFD 1GJCB 1OWEA 3WWFA 1PPZA 3EE0B 1QA0A 4XE4A 2AIQA 1GI3A 4GHQA 2KM0A 2PP6A 2A32A 2BX4A 2ZPSA 4MVNA 4Q4LA 3MHWU 7LPRA 3F9GA 1T4UH 5T1VA 1BTWA 3SHAH 2P16A 2A0QB 4JZIA 2BD2A 4I8LA 1HB0B 1V2PT 3IG6B 2B9LA 4I8KA 1IQFA 3KEEA 1AZ8A 1PPFE 2QN5T 1MABB 1PPCE 2VWLA 3DCLA 1BCUH 1GBFA 2FOEA 3BIVH 1UVOA 1UCYK 2A5AA 5C1XA 5HM9A 1OX1A 1C5SA 2OC7A 1O2GH 2QXIA 1D6RA 3MU1A 3A87A 2ANMH 1HJAC 1E1QD 4WH6A 5EW1H 1TIOA 2C3SA 2A5KA 5HGGA 4MPVA 2ZCHP 1XVOA 2WINI 3CS0A 2FOHA 1ZRKA 4THNH 2FMJA 3SNCA 2CK3D 5DP5A 2ZTZA 4NSVA 1A5HA 1HNEE 1KXFA 1GCTC 4INHA 4HG6A 5C1UA 1FXYA 2ZG0H 3SNDA 2R9PA 4Y8ZA 1AZZA 1HIAB 3PLPA 1O5EH 1UTJA 2FLRH 1O33A 3L3TA 2TBSA 2IPHA 2JH6D 2WHXA 2SGDE 1DWCH 3EQ0H 3SJ8A 1DICA 3UREA 1LKAA 2VVVA 3SOSA 2Z9JA 1S6FA 4XSKU 2IN2A 2WPLS 3SV6A 4NA9H 1DLKB 1WOFA 2GMTB 1UVSH 2EA3A 5IK2D 1UK4A 1BA8B 1JRSA 1J9CH 1HAHH 1TOMH 2XRCA 4WXVA 1FY3A 1GMHG 4YZUA 3TITA 2LNCA 3A8CA 2F4LA 2VB0A 2J5UA 3SUEA 1GHBF 3A80A 1JOUB 2ZIQH 6CHAB 4XBCA 1CU1A 3TK6A 1WCZA 4AB8A 2BDIA 1CBWC 2VWNA 4D7FA 5AFYH 4K1EA 1W10U 2QXJA 2D1JA 1GBKA 1HFDA 1UTKA 4H4FA 4RT1A 5KGOA 1F5RA 3VG8A 2TGTA 4YESB 1N8OC 5EJ1A 5GWZA 3OTPA 1PPHE 1UHBB 2SGQE 4UFGH 1MTWA 2BY7X 3RM2H 1ZPZA 2BQ6B 1QR3E 2AMQA 3AW0A 3STIA 3JZ1B 3H09A 2GCHF 4HZHA 1UK2A 1O3KA 2BD3A 1PPEE 1EP5A 1UTPA 1P02A 3UR9A 1ACBE 1F92A 2AGIX 3BTFE 4FUJA 1FAXA 2QF3A 2ZQ2A 3RXKA 1O3PB 3P8FA 1QQ4A 1LQDB 1SB1H 1GHAF 1C1PA 1RIWC 2AFQB 2FLBH 2O8MA 5FCRA 1WUNH 2QE7D 1S6LA 3RXOA 4B76A 1GHVH 1H4WA 1TLDA 4O97A 4F4OC 4NGAH 1O3GA 1P05A 3KQEA 3RXBA 5PTPA 3SUGA 3SUFA 2W7UA 1ELCA 1P12E 2BDYA 4Y10E 1ZPBA 1XM1A 1GJ5H 1IQNA 3URDA 2QC2A 2VWMA 1Z71A 3GY5A 2GJGA 1O30A 2K1QA 2ALVA 1OP0A 3F2HA 1WTHD 1Y3XA 5LPEA 3LGTA 4MNWA 1RTKA 1P09A 1S83A 1TNLA 3LDXH 1CT0E 2AS9A 3L33A 1DLEA 4HI3A 2VU8E 4YT7H 5DP9A 1FY8E 3UR6A 4Y0ZE 1SLUB 1ETSH 3MNXA 2ANKH 1AD8H 2THFB 3IITA 2WPJS 5FL7D 2KCPA 4JYUH 3ZV8A 2H6MA 3RXQA 2ZDVH 3P8GA 1TNIA 5EQSA 1EX3A 5J4SA 1A61H 4XDEA 3BTGE 3RXAA 1TGSZ 2YNAA 4ZKOU 1MU6B 2BHGA 3LGIA 2ZECA 1ANEA 1M9UA 2QV1A 2ZHFH 1LHGH 2QXGA 2Z9GA 1XUHA 4AGKA 5F6MA 4GUXA 4B6FA 3A88A 2BX3A 2ZGJA 1C1SA 4ISIH 2GMTC 1NPMA 1S6HA 1IHTH 3LGWA 2I6QA 3Q3YA 3U9AH 3SW2B 2GKVE 2TGAA 2OP9A 2F9BH 1QL7A 1P3EA 1VCWA 8GCHG 3W1EA 3GDUA 3AAVA 2P8OB 1O3HA 1EJNA 4H42U 3GYLB 2P3UB 2FI4E 2RDLA 6CHAC 4ACAA 2R0LA 1JWTA 3ODFA 2ZWLH 3NK8A 1CGIE 1MCTA 3M5LA 1ORFA 4DGJA 1C2FA 2BYAX 1W2KH 4X1NU 1KDQB 1P06A 4X8UH 2BVXH 4DIHH 3GDVA 1C2EA 1ANCA 2XWAA 1Y3YA 2CJIA 3SU1A 3BEIB 3S7KB 2Y82A 5GJ4B 3U8OH 3UB0A 3VB7A 4I8GA 2XNDD 3RXRA 3M37A 1O2QA 3TGKE 1ANBA 3UNSA 1AGJA 1NFWA 1K2I1 4BXSA 1GBIA 1C5VA 1XVMA 6ESTA 3K2UA 1QY6A 1OP8A 2YNBA 4XOJA 3EDXB 2ILNA 3QK1A 5C0TA 2FTLE 2GT7A 1NC6A 3MH7A 1SHYA 1HAYB 3LH1A 1P2QA 2KFWA 2PV9B 4O3TA 4RSPA 3RP2A 2ODQA 1C1NA 1O3LA 3ESTA 4FUGA 5HYOA 1CO7E 3BG4C 2AHME 4ZKSU 1AQ7A 1ESBA 2ANWA 3KYFA 2GTBA 1Q3XA 3PWCA 1TNGA 1EJMA 3MU5A 1SGFA 1P9SA 1YPJH 2AIPA 1L4ZA 3SJ9A 5DKMA 4YOIA 2FEQH 2C93B 4P00A 2L74A 1K22H 2Z9KA 4UDWH 2G8TA 5JBAS 4X8SH 4KELA 3LC3A 1A3EH 3O8CA 1UTMA 2TPIZ 1C1WH 3PRDA 2FOBA 2ZPQA 1SC8U 4AN7A 3U28C 2Y6TA 4SGAE 3OX7U 3TGJE 5TCAA 2W26A 1HRTH 1EZXC 1TPSA 2WPKS 1K1MA 2P95A 1E0FD 1GGDB 3RXUA 1Z8GA 2XBXA 3FKSD 5GNDA 4UFDH 4WWYA 1GJ8B 2XC0A 7GCHF 4FVBA 2STBE 2VIVA 2UUKB 3QZRA 5C5OA 1DT2A 5TCCA 1BBRE 1IHSH 1QHRB 3GY3A 3RLYH 4ABAA 1GBCA 1C1MA 1DUAA 2J92A 1GHYH 1XUJA 4RI0A 4D9QA 1DPOA 3D62A 2Q6FA
chains in the Genus database with same CATH topology
1TAWA 1C4U2 3A7VA 1EZSC 2ZCLP 4OS5A 2ZU3A 1UJ1A 5EXMA 2OBOA 4Z0KA 2AGEX 4A1XA 1UVUH 4TPIZ 5CHAC 1C1UH 2P8OC 1O5CB 2ODPA 1K1IA 2ANYA 2XC4A 2ZGHA 1FUJA 2WV5A 3ZVFA 1TQ7B 4FUFA 4AG1A 3MU0A 4Y7BA 4I8HA 4O03A 4AZ2B 2QIQA 3G01A 4XFQA 3TU7H 2ZFFH 3V0XA 1UHBA 1V2KT 2GZ8A 3T28A 3RU4E 1EUFA 1TX8A 1TPAE 3K6ZA 2ZGBH 3PMBB 1P9UA 1GG6C 1W7XH 1VJAU 5E0JA 1IQJA 1O37A 4INKA 4O9VA 5F8ZA 1JBUH 3TIUA 1GI2A 3ODDA 3P8NA 4CRAA 3LOXA 3RDZA 1H9LB 5L2ZH 1FJSA 1HAPH 1LPKB 1YCPH 2SGFE 3HPTB 2G52A 3GCHB 1IOEA 3UOPA 3TH4H 4O3UA 4UD9H 4BXWA 3PROA 3OTJE 2VINA 1ZHRA 2ZFQH 5A8ZA 2NU0E 4CHAB 4IS5A 3ZVGA 1QURH 3SJOA 3FZZA 3P92A 1K28D 2PFEA 1RRKA 2FTMA 4YT6H 3VGCB 3TH3H 1G3EA 2BM2A 1BBRK 1XUGA 3WY8A 1WQVH 3M3VA 2OINA 4ZKNU 1V2QT 2BXTH 4Y6DA 4MPUA 2V35A 2WPMS 2PSXA 1TRYA 4U01A 3H5CB 3KQDA 3HK6B 1D3DB 1SGEE 1DXWA 2FS8A 2Z3EA 2F3CE 2GVFA 1Z6EA 3T5FH 1KTTB 2H9HA 4A6LA 1C2LA 5DK1A 4MNXA 1OSSA 1C2HA 1O2ZA 1VCPA 1IQKA 1S0RA 1UMAH 5AVDA 4ABIA 4MLFB 1SGTA 2Q6DA 1YPGH 2GV6A 1PQ8A 5DG6A 1WSSH 3CENA 1CSOE 1GMDG 3UIRA 3VB6A 1G3CA 3QZQA 1EPTC 1T8OA 2PLXA 5EXLA 3QUMP 1O3CA 3LJJA 4IC5A 1GCTB 4X6NA 2ZFRH 4IN2A 1O2VA 1K9OE 4OS7A 2FX6A 1KLJH 2PSYA 4UE7H 1QJ1B 1SGYE 1WQSA 2BY6X 1W11U 3MO9A 4K60A 1GMCF 4U2WA 1SGFG 1IAUA 1YM0A 2FOAA 2HLCA 3T2NA 2RG3A 2FESH 1Y3UA 1XMNB 1MKWH 3ATKA 1P01A 3OY5U 3A89A 4WJG2 1P2MA 5G4BA 1LMWB 4FUIA 2GZ7A 4MPXA 1D6WA 3U98H 1QRZA 1C4V2 1P10A 2G4UA 2VIDA 4OS4A 1ETTH 3SI3H 1QJ7B 9LPRA 3PLBA 1BHXB 1DOJA 1DY8A 1X7AC 1Y5AT 1O2YA 1CHOF 4TWYA 5T6DA 4MNVA 2ZNKH 3NKKA 3O8BA 4JK5A 1C5YB 1JXPA 1UCYH 1OOKB 3VXFH 1DE7H 3RXEA 1ETRH 1DY9A 4CBNA 3T62A 1GI0A 1RFNA 1J14A 4JYVH 1OWIA 3GCHC 3ZZ4A 5FBEA 2A4QA 5EQRA 2EC9H 2F9OA 1DANH 5GIBA 1THPB 4NCYA 1HLTH 5A0AE 4CHAC 2RA3A 2O8WA 2BDBA 2J9NA 1GVZA 2WYGA 1F2SE 2F9PA 2XNIA 4ABFA 1BDAA 2XCNA 1GBMA 3VGCC 4AB9A 3I78A 3NCLA 3GICB 1C2MA 1ELTA 4Q7YA 1D3TB 1VR1H 2ASUB 1KTSB 1RIWB 1BTUA 1LKBA 1GJ7B 1BHXF 2ZEBA 1C5WB 3ZVDA 2ZU2A 1C5LH 4B73A 2CHAC 2ZFSA 2OQUA 3S0NA 1V2NT 1NESE 3M35A 5C2ZA 3SV2H 2GV7A 2F9UA 4RKOB 1FAKH 1DWBH 4FU7A 5T6FA 1GJDB 1QB1A 1THRH 3MMGA 1V3XA 3M5OA 4NWLA 4Y71A 4WH8A 2IOTA 5FPSA 1A4WH 2Z9IA 1EPTA 3A81A 4ZXXH 5JDUB 3E0NB 1VGCB 2BD9A 2ALPA 2Z6BD 3QN7A 4U30A 5ESBA 2WPHS 1JRTA 3ZZ5A 4WMDA 2ZTYA 1EKBB 2G51A 3SO3A 1MBQA 2CV3A 2F91A 2A4GA 4Q7ZA 4ABDA 1TA2A 3R3GB 3UQVA 3I29A 1C2KA 2SGPE 1CHGA 1MKXK 1RD3B 3A8BA 4DURA 1AI8H 4CRFA 1ELDE 5GCHF 1MCVA 1SGNE 3M5NA 1MU8B 2W5EA 5EPYA 1NTPA 4CR5A 3KQBA 2H9EH 4I33A 4NZLA 5A0CA 1B0EA 3FP7E 4ZUHA 5CMXH 3LGVA 3S7HB 1AO5A 2EI8A 2FS9A 2Q6GA 3P6ZB 2BB4A 4AFQA 5A0BA 1SOTA 1HAXB 2HPPH 4WMFA 1N6XA 2KAIA 1TOCB 3TK9A 3S9BA 4GHTA 1UVTH 1IQEA 6GCHG 1ZOMA 2VWOA 3W94A 1V2LT 2XYAA 3BTTE 1O31A 1C9PA 1C1TA 4X1QU 4X1SU 1YPEH 5JBCS 3GCTF 5JBTA 1O32A 2QGRA 1F0TA 3BTHE 4Y8YA 2O8TA 1G37A 2J38A 4GPGA 2B0FA 1F5LA 4YM9A 1O3AA 8LPRA 1SI5H 1G32B 3ZZ9A 3PWBA 1P04A 2C8ZB 3KHVA 2HPQH 7KMEH 2J4IA 3MU8A 4CRDA 3T25A 1KIGH 3PB1E 3U8RH 4J1YA 4H6SB 2FPZA 1QNJA 1LVMA 5JBBS 4CR9A 1O3JA 1AN1E 1K1LA 3A8DA 3IWMA 3SJIA 5J4QA 1NROH 5JB9S 3SUDA 3RXMA 5C5NA 1ABIH 1UTLM 1L4DA 1TGBA 4BAHB 1P2KA 4X0WU 1MQ6A 3TVJB 3NZIA 1ZGVA 3E16B 2A31A 1TMUH 1GL0E 3GCOA 1ZSKA 1JIRA 1TNKA 1AFEH 2HNTC 2UWLA 1ELGA 3ENSB 4ZHLU 1AB9C 1BZXE 2A5IA 4AFSA 5L30H 1DSUA 1T32A 2ZCKP 5HXFA 2TRMA 3QTOH 1SHHB 3NPSA 3O8RA 2BDGA 4D7GA 4IN1A 3BG4B 2FWWA 2G55A 3BEUA 5HMAA 3MH4A 2IJOB 1IQLA 1BMMH 1SGCA 2BY5X 4YO9A 4FUHA 3MFJA 3S9CA 1ZTLA 3GCNA 1YPLH 1AHTH 1VGCC 1ZJKA 4Q2KA 4RKJB 2NU2E 4K2YA 2PUQH 1BTZA 3LPRA 2HOBA 1SBWA 4ISOA 1QJ6B 4X2YA 4ABGA 1XUFA 2BTCE 3NWUA 3DD2H 1FLEE 1GHXH 4CREA 1MD7A 3I77A 1YC0A 3TGIE 2J94A 5EODA 1HXEH 4KP0A 4JCNA 5LPRA 2ZU1A 2BLQA 1GDNA 5C67A 3ZV9A 3KCGH 3PLKA 2OQ5A 6LPRA 1KYNA 3GOVB 3PMHB 1NS3A 3RC5A 2CF9H 1XXFA 2Z3DA 1D3QB 2BD4A 1GJ6A 3RLWH 4HTCH 4TPYA 2A2QH 4JZDH 3U1JB 4X6MA 2DUCA 5IYTA 1BOQA 5FX5A 5JB8S 1P2OA 3FP8E 4D8NA 1YP9A 1AVXA 4CRCA 3UY9A 3D23A 3UNRA 1V2ST 3STJA 2GDEH 2A7JA 2Y81A 1LVOA 1PQ7A 2SGEE 1LTOA 1SQTA 3QGJA 1C2GA 1YF4A 4TYDA 5CHAB 1O2UA 1ZSLA 3T26A 2VIQA 4WY3A 3A86A 1UTNA 1Y3VA 2F83A 2CXVA 1ZGIA 1Q2WA 3MH6A 2SNWA 1O39A 1NFXA 3SNAA 2FP7B 1GI6A 4H6TA 3RMOH 1BIOA 5A8XA 2XBYA 4M7GA 4AGJA 3BTEE 3ATIA 1O3EA 1DM4B 1G3BA 2ZHEH 2BY9X 2Y5FA 5SGAE 1BTHH 3RXJA 2JETB 1GMHF 1P11E 2J2UA 4X6PA 1GG6B 3N7OA 4INLA 4BAKB 1NU7B 3SN8A 1TONA 2TGPZ 1ID5H 3MH5A 3NXPA 4OS6A 4WMEA 2BDAA 1C9TA 3SI4H 5B6OA 3MYWA 1O2PA 5DGJA 3L6PA 2D26C 1LVBA 1QL9A 1E36B 1P03A 3RXHA 4ABBA 3GY4A 2A4OA 1CGJE 1K1NA 1V2RT 1NU9A 5EOKA 1NRNH 2UWPA 1LVYA 5FBIA 3OU0A 1V2MT 2V0BA 3RC4A 2J34A 1AKSA 3ZVAA 1C5OH 4NFFA 1O2OA 4X1RU 1GJBB 3BEFB 1SGIB 2QYIA 4JMYA 3QWCH 4ZROA 1H8DH 2PUXB 1GBAA 3ZVEA 3RXPA 1C5TA 3GDSA 2BQ7B 4E7NA 4OGYA 3MO6A 3PMJA 2C8XB 5EW2H 2A4RA 3SU0A 1VZQH 1GVLA 4ZKRU 3QLPH 3KF2A 3VB3A 3U8TH 3MNCA 3ITIA 3M7UA 3P95A 2BXUH 1FMGA 3M61U 2HVXA 4I31A 5C3NA 5FPTA 3TLOA 5JYIA 1S5SA 1IQMA 1GI5A 5DP3A 4NZQA 1FQ3A 3CP7A 1EATA 1VITG 3AASA 2V3HH 2A1DB 2RA0A 2BVSH 3SORA 1NZQH 1QBOA 4K1TA 1KY9A 2H2ZA 2ZDMA 3BN9A 3OY6U 1XXDA 1AMHA 1GI8B 1HPGA 1EPTB 1O2IA 1NFYA 1Y59T 3OYPA 1TBQH 3E91A 1LCYA 1SQAA 3SQEE 4GCHG 3VB5A 3RXCA 1O3BA 2JKHA 1EAIA 3R0FA 1DXPA 1HDTH 4MQAA 3TNTA 3UWIA 4TY7A 1DITH 2A7CA 2BD7A 3F1SB 3SBKA 1P0SH 1H9IE 3HK3B 3TJVA 3PTBA 4DW2U 3UFAA 1Y5UT 1VJ9U 3BTKE 5DP8A 5E0HA 1MZDA 1L1GA 3H7TA 1TALA 2G5NA 1O3IA 5K7RA 3HGNA 1EQ9A 1BB0B 2QF0A 1BRUP 4NIYA 1BITA 1O2MA 2JETC 1ZYOA 1QRXA 1HYLA 4I32A 2KAIB 1O5BB 8GCHF 1A5IA 1B7XB 1KSNA 3Q77A 1J8AA 3ZZ7A 4BANB 1TGTA 2Y7XA 5FPYA 1CVWH 1QB6A 2PKAA 1L1JA 1LPGB 4NSYA 2QY0B 1EAUA 2FI5E 3FP6E 1TRNA 1FV9A 1O36A 1BT7A 1B5GH 3LU9B 1FPHH 1E37B 3C1KA 1QBVH 2ZC9H 3LGUA 1F0RA 4XBDA 4FUBA 1Q31A 1HCGA 1O5FH 3M3SA 2FO9A 4CH2B 1WTGH 4KTCA 4D9RA 4WF8A 1TPPA 1O5DH 3S69A 1TQ0B 2OC0A 3MNSA 1HJ9A 1EASA 3TJNA 4A1TA 4X8VH 2GP9B 3C27B 4DOQA 2VH6A 3A7ZA 4CBOA 1ZHMA 1DVAH 3HATH 1NRPH 4VGCC 1LDTT 4Y79A 1ZTKA 1GBEA 1PFXC 4A5TS 1TGCA 1W3CA 1NRSH 1O35A 1P2JA 1P57B 5DPAA 1O3OA 1Y5BT 3E90B 1BMAA 5DP6A 3U69H 3VB4A 2PW8H 3ZZDA 2CGAA 1KXCA 1Z6JH 2C4FH 4GLYA 3M36A 1ELBA 3A7TA 1SFIA 1SOZA 2CHAB 2NU1E 1RGQA 4ZXYH 2FOGA 4DIIH 4U32A 1QB9A 1SLXB 3MNBA 2ODYB 5EXNA 2A2XH 1J15A 3U1IB 1V2TT 3O8DA 3RU4D 1NY22 4B74A 5DJ7A 4ABHA 1EAXA 3BTME 4NIWA 2BZ6H 1WYKA 2PKSC 3E3TA 1UO6A 1FPCH 2A45B 1BRBE 1O2XA 2FZZA 4Y76A 1DDJA 2P3TB 2UWOA 1L1NA 2Z3CA 3B9FH 1YLDA 2Z9LA 1BTPA 3A82A 2GCTC 1HXFH 4IBLH 5T6GA 1YCPK 1GHWH 1XX9A 1C2DA 1P2IA 1QFKH 3RUOA 1G2MA 1LPZB 3BV9B 4BOHA 4RN6A 5DO4H 1ZZZA 4ABEA 2ZHQH 1YKTA 2ZI2H 3ZYDA 5BPEA 3SJKA 3UUZA 1UK3A 1TBZH 1SSXA 2FYRA 5EG4A 3M3TA 3BTQE 1C1RA 4ISLA 3M5MA 2BLWA 3CS7A 2WUBA 1EB1H 4YLQH 1O2RA 4LZ1H 1GHBG 3ZYEA 2ZFTA 2Y80A 2OBQA 2PTCE 1GHZA 2QCYA 1ELAA 2TIOA 3LH3A 2GDDA 1ESAA 2ZHWH 2ZA5A 2GT8A 5ETXA 2QA9E 3BIUH 1N1LA 1T8NA 1FZZA 2V6NA 4IGDA 3K6YA 1HV7A 1W0YH 2AYWA 1C1OA 1BJVA 3E1XB 3MWIU 3GISB 1OXGA 4YLUA 1JMOH 1NRQH 4UFEH 1O2SA 2PGBB 2GCHG 1DFPA 1F7ZA 4B1TA 1KXAA 5CE1A 5E2PA 4SGBE 5DP7A 3A8AA 3E6PH 2BMGB 4AYYB 1GHAG 1YCPM 1NRRH 1BUIA 4R8TB 1TB6H 4UFFH 1O2NA 2SGAA 3F9HA 1AB9B 1GBHA 1QBNA 1GI4A 1MKWK 3V12A 4I7YH 1XUKA 3UWJH 1YLCA 2STAE 1Y8TA 3DUXH 1J17T 4ZMAH 3V13A 1AKSB 2BOHB 4TWWA 5EQQA 1FNIA 5H4IB 1AWHB 3LGYA 4B2CA 2P93A 1DSTA 1EP6A 5LH8A 4K1SA 2CN0H 5C20A 2HALA 5E2OA 3F9EA 4Y11E 1YPHE 3A85A 4DVAU 1O34A 3F68H 5A2MH 2VGCC 1MAYA 4BNRA 4FXGH 4Q7XA 1CE5A 1Z7KA 2OLGA 2ZGXH 1ZHPA 1O3NA 4R0IA 5F03A 1OYQA 4CRBA 1CA0B 1TRMA 2ZKSA 4GAWA 2B8OH 3KQCA 4Z6AH 3T29A 2P59A 4OS2A 1KLIH 2HNTF 2PR3A 1T8MA 4MG3A 1GBDA 5AF9H 5K0HA 1W7GH 2VVUA 3RXGA 1MTVA 4IC6A 3SU2A 2CF8H 1GMDF 4X2WA 5FHTA 1MD8A 4UEHH 1BTXA 1XKBC 2C8YB 1DS2E 1C2IA 3RXSA 3S9AA 2XTTB 3K9XB 5FXLA 5GXPA 5I46H 3SU4A 2BY8X 3Q76A 1EOJA 3UPEA 1MTNB 2ZP0H 8KME2 3TK5A 1SFQB 1TX6A 1AFQC 3MI4A 3A7XA 4I8JA 4IMQA 1OS8A 4LOYH 2PWXA 3FFGA 1GDUA 3FANA 2XXLA 1N6YA 3VFEA 2H5DA 1QTFA 1BRCE 3FVFB 3T27A 4DT7B 2VIWA 3DFLA 1C5QA 1ARCA 2UUJB 1TMTH