1C9TA

Complex of bdellastasin with bovine trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of the antistasin-type inhibitor bdellastasin with trypsin and modelling of the bdellastasin-microplasmin system.
pubmed doi rcsb
source organism Hirudo medicinalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 53
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9tA02
3F6UH 4YM9A 1GHYH 1GBDA 1O32A 3I29A 2QF0A 2FM2A 1YPJH 1TRNA 5I25A 2UUJB 3M36A 1SLWB 1VCWA 2J4IA 2RDLA 5K0HA 5L2YH 5GPIB 3LONA 2ZU5A 2H5CA 1XUKA 1A0HB 1ELFA 2LPRA 1MAXA 2ZFTA 4HZHA 5J4QA 5LH8A 2Y6TA 3BTKE 2AYWA 4MTBA 1O3HA 5C1XA 1Z6JH 1O2PA 3GDVA 4K8BA 1PQ5A 3PTNA 3LGUA 5EW1H 1KXEA 1QRXA 1NRQH 5J4SA 3SI4H 1DXPA 3M61U 3T28A 3T25A 1UK2A 1HAVB 2P3FH 4WVPE 3M3SA 1FAXA 3RXTA 3SV2H 1CA8B 1NZQH 1ZPCA 1YF4A 1IQJA 1NY22 4AZ2B 1LHCH 1QRZA 4Y0ZE 4A7IB 3UQOA 1EZSC 1ZHPA 1SGEE 2PSYA 1VGCB 3RU4E 3U8TH 2QCYA 1SGRE 2SNWA 3NKKA 3SGQE 3MU4A 1DS2E 4ZH8A 4KTUA 1AE8H 4I8JA 1YCPK 1BTPA 1A2CH 4OS7A 1EOJA 3VB5A 2WPMS 2G4UA 1SLUB 3A88A 2VIPA 1L4ZA 3B8JA 1HJ9A 1VJAU 2C8ZB 4MQAA 3MU0A 1P8VC 3A7YA 1D6RA 1FPHH 1DY9A 2VWLA 3DUXH 5FX5A 1ZTJA 1Y3YA 1RRKA 2AMDA 1FY8E 1FN6A 1HAPH 2ZDAH 1VGCC 1DE7H 1GI2A 3TJNA 2FEQH 3VB4A 1C9PA 1E36B 1E0FD 3RP2A 1LPGB 1UO6A 4AFQA 3LU9B 5AHGH 3TGKE 1GJ9B 1FDPA 1ZGVA 1ZGIA 4E06H 4I31A 3PYHA 1YM0A 3M7TA 2TGPZ 3A81A 2A31A 1MMJN 1SPJA 1BUIA 3ESTA 1ANDA 1HBTH 1SSXA 3BEUA 3BTFE 1P3CA 1LHGH 4INLA 1TNJA 2ESTE 1PPZA 3RMOH 1AKSB 2VB0A 3ZZ8A 1O2QA 4MNWA 5DP3A 1AWFH 1MU8B 1AHTH 2QXIA 1C2KA 1ANCA 1SGYE 4MDSA 3LIWA 1BIOA 1CT4E 1G32B 1EAXA 1V2MT 5ETXA 5G4BA 1PPHE 2W3KA 5C2ZA 1ZRBA 1ZPBA 1ELEE 5C1YA 2Q6GA 2H6MA 1IOEA 1TBRH 1M9UA 3CS0A 1FJSA 1AD8H 1P2JA 3M5NA 2P3TB 1NO9H 2BLQA 2THFB 2Z94A 4LZ1H 1NRNH 1OXGA 2BY5X 1A7SA 1C1SA 1EPTC 2A2XH 2ASUB 4O9VA 2XRCA 1K9OE 1AE5A 1S81A 2BDBA 4ZXYH 4MVNA 2BVRH 1EUFA 4CREA 1BDAA 2FWWA 3P17H 2D2DA 4Q80A 5TCAA 4K1SA 3LGWA 1YPGH 2AH4X 2C8YB 2FLBH 8GCHG 2OTVA 1O3IA 1NT1A 1DT2A 2Z9KA 1XMNB 1V2RT 2HALA 1A0JA 2ZGBH 1C5XB 1GDQA 1GHWH 2ZDVH 1Y59T 5FPYA 2F91A 1DLKB 5HGGA 3FFGA 1AIXH 5AF9H 3KQDA 2IOTA 1O2JA 1GI5A 1P02A 1WQSA 1Y3WA 1SQOA 1E38B 2A4OA 1ANEA 4BTUB 3QZRA 1ARBA 2P94A 3HKJB 3A7VA 2KAIB 3LOXA 5DP5A 3SO3A 4R8TB 3PWBA 4YLQH 4JYVH 3PLPA 3O8CA 2FX4A 3T29A 3QN7A 1GJ8B 1W13U 5T6FA 1AKSA 2C8XB 4O03A 5GDSH 1FIWA 4NIYA 3A86A 5A09A 1T4UH 3RLYH 2PV9B 2AGIX 4UEHH 3PLKA 2FDAA 2FOBA 3UR9A 3GYLB 1O2UA 2ZCKP 2PKAB 4WMFA 3RU4D 1O2HA 1O2GH 1BMAA 1K1LA 1KLTA 1C5SA 2V6NA 3AW0A 3KF2A 5C5NA 1V2OT 2B0FA 1V6DA 4ISOA 4ABDA 2WYJA 4Z6AH 3K2UA 1S82A 2CF9H 2QYIA 4OS6A 2CV3A 1G36A 1EJMA 3TK6A 3B23B 4GCHG 1FY3A 4E7RG 1QJ7B 1ZRKA 2P16A 3MNXA 1TNIA 5C1UA 3BTDE 1CGJE 1JXPA 2AERH 3SJKA 1T4VH 2YNAA 1W7XH 2GTBA 1TGCA 2M5TA 5FXLA 5C20A 1YPEH 4CRBA 2VU8E 5JBTA 2GV7A 2Z9IA 1ZMNA 5CHAB 1IQEA 1RTKA 1TPOA 3PWCA 3SZNA 1TNGA 2XWAA 1MU6B 1EXFA 2WPJS 2UUFB 1P10A 3LC5A 4Q2KA 1C2LA 1GHBF 3RXPA 2CGAA 3A83A 1F92A 3QUMP 2BDYA 3A8BA 1LHDH 4AORA 1ELVA 1P2IA 1SL3A 2Q6DA 3H5CB 4WH8A 1MCVA 2D1JA 3UWJH 4ZMAH 2IPHA 3MYWA 2XWBI 3QZQA 5JBCS 4YO9A 1V2ST 3PMAB 1BBRK 4J2YB 1TLDA 1FONA 2XBXA 2FS8A 4ABBA 3T27A 1A3BH 4I8KA 1N8OC 1MQ5A 1DSTA 3KQEA 2ZFQH 1OP0A 3T26A 1YCPM 2JETC 2PWXA 3MO3A 4NA9H 3TNTA 5L6NH 2BD3A 2A5AA 3U8OH 2ZPRA 1PYTD 1MD8A 2A1DB 2OCVB 2GT8A 4RSPA 1O2KA 1VJ9U 1UTLM 1RS0A 1XKBC 2B8OH 2TGTA 2Z9LA 4ISIH 1ZHMA 3P8OA 2SNVA 1OYQA 3MU5A 3E3TA 2A4RA 2NU4E 1D4PB 1Y3UA 5EODA 1OS8A 3T2NA 1DICA 1FQ3A 1EZQA 3EA9A 4MG3A 1CE5A 1OSSA 3SJ8A 1THSH 4K2YA 1BBRH 4K5ZA 1D3TB 2HGTH 4KP0A 1IQHA 9LPRA 2HNTE 4IGDA 1GCTB 3ZVDA 2TRMA 4INHA 3Q77A 3ODDA 3A87A 4UD9H 1KSNA 1CVWH 3QGNB 5B6OA 5GJ4B 4A6LA 1LVMA 3MTYA 1S0RA 3N7OA 1FY1A 3UPEA 3MNCA 1THPB 3UNSA 4AYYB 3V7TA 3TJVA 4MPVA 2O9QA 1Y5UT 1ACBE 3A7WA 5E0JA 2OXSA 2PTNA 1Z71A 6CHAB 1NFUA 1SGFA 4KTSA 1C1UH 3LT3A 1RJXB 2FOHA 2HLCA 2HRVA 1Q3XA 2BVSH 3ZZ5A 1AVXA 4ZAEA 3RXLA 3UQVA 2SGQE 1IQLA 3MHWU 1XVMA 3LJJA 1O3OA 2ULLA 3GISB 1FLEE 1LDTT 3HPTB 2FOMB 1ZZZA 4FUBA 3SNBA 2FPZA 3M7QA 4TY7A 4UFEH 1EAWA 1ZPZA 1GJAB 4INKA 2ZWLH 4WY3A 4PROA 4AGJA 2BVXH 1JRSA 3MU8A 3F1SB 2FODA 1MTSA 2FI5E 2EEKA 4ZKRU 1TX6A 1DANH 4DT7B 1GL1A 2HWLB 3SU0A 3RC5A 1SVPA 1O2LA 2ZF0H 4OGYA 2F9OA 1ZR0A 4FUHA 3TITA 1NROH 1JMOH 3AASA 2AMPA 1UJ1A 1A3EH 2ZHWH 4Q7ZA 4K3JA 1GBMA 5GXPA 3O8BA 4H4FA 1SGIB 1SGQE 1GVKB 3RMNH 1KXCA 2C3SA 3MOCA 2TIOA 1O2WA 1SGCA 4OS2A 2G8TA 2SGAA 2ZDNA 2QIQA 5C3NA 3KGPA 1MKWK 1MH0A 4YT7H 1OWDA 1KXBA 5DG6A 1XXFA 4X2XA 2F9NA 4GSOA 5ESBA 1W8BH 1YPKH 1F5KU 4X1RU 1DITH 1A5HA 1MKXH 4AFSA 4O97A 2ANKH 2H9EH 1SLVB 3LC3A 5HM2A 5DP4A 4B73A 2AGGX 4I8HA 4XFQA 1TONA 1C2MA 3LH1A 3UY9A 1CU1A 2BMGB 2ZFSA 1YGCH 2OP9A 3KHVA 1UCYE 1ORFA 3RXOA 1AB9C 1S6HA 2PFEA 3L6PA 3UIRA 1GVLA 2G81E 3UOUA 4Y71A 1Z1IA 4GCHF 1GGDB 1G2MA 2ZFRH 3KQBA 1W11U 4A1VA 4X8VH 4D76A 2XYAA 1GJ7B 1V2JT 1J15A 3GCNA 2A7CA 1V2QT 2BQWB 4NFFA 6GCHG 4M7GA 4GHQA 2ANWA 4Q7XA 2B5TB 2RA3A 1LPZB 1C5ZB 4TWYA 4BTIB 2FZZA 3ZZCA 1TAWA 2J9NA 1GJ4H 2WPLS 4ISLA 4KKDA 2ZQ2A 5EQQA 3PM3A 4WWYA 1TGSZ 1UTPA 1QTFA 1GI1A 5CHAC 2FOFA 4AB9A 4ISHH 4IMZA 5F8ZA 2YOLA 1H8DH 2VGCC 3SU5A 1SHHB 1D9IA 2OD3B 1K1NA 1W14U 4MPUA 2A2QH 2BTCE 2ALPA 3R0FA 5CMXH 1ZSJA 2QGRA 4B71A 4BTTB 3S9BA 3SU1A 3RUOA 4AFUA 1PJPA 1Z1JA 1EKBB 2VJ1A 1PPCE 3O8RA 1GG6B 1ETSH 3IWMA 5IYTA 1HJ8A 1Z8RA 4D8NA 1T8LA 2P8OC 3KL6A 3U98H 1ZYOA 5A8XA 1QBVH 4GPGA 1TGNA 2HNTF 1MUEB 2Z9GA 1C1QA 1GBEA 1PPGE 3GCOA 4CR9A 4XBCA 4JZ1A 2FTLE 1TNLA 2FO9A 2O8TA 4X2YA 1GMDG 4ZROA 1GMHG 5ESTE 1C1TA 1C5UA 3M3TA 1XXDA 3F9EA 3BTQE 5JYIA 3SI3H 4ABIA 5DP6A 1WUNH 1GBCA 5BRRE 3ZYEA 1P57B 2GCTB 1B0FA 1FN8A 3P8FA 3Q00A 2OBQA 4U01A 3S9AA 2P93A 3GDUA 3SJ9A 1HXFH 5IDKA 1S83A 2BDGA 3SBKA 3G01A 5FCKA 1UVPA 4XBDA 2GZ7A 1C5TA 4KTCA 4ZHMU 2EI8A 3FVFB 1V2KT 1BA8B 3TH4H 1YP9A 1G3DA 1XUIA 2OC0A 1QBNA 3E0NB 5EPYA 2ZGCA 1PQ7A 1QJ6B 2ZCLP 1K1PA 2ZU2A 3RXIA 1ZOMA 2ZIQH 1GI6A 1P9UA 4DGJA 1ETTH 2OC1A 1FPCH 1Y5BT 3ZZ6A 2WYGA 1ARCA 2GX4A 4Y6DA 2JH6D 4LOYH 1FI8A 3KN2A 2F3CE 5A0AE 1O3AA 1TMBH 1TRMA 1LVYA 1HDTH 3M5LA 1SI5H 2BY8X 1FMGA 1O3MA 4A5TS 8LPRA 3LJOA 4Y7BA 4X1SU 3RXFA 1HAGE 1A5IA 1TQ0B 3MWIU 3TK5A 1SQTA 1O30A 2BOHB 2FYQA 2FX6A 2QY0B 3CP7A 3KQCA 1HUTH 3U1IB 5EW2H 4IS5A 3S69A 1YPLH 1QFKH 1A61H 3MMGA 2G5NA 3M3VA 3WY8A 1OWJA 3SW2B 1GMCF 2Z3DA 2BDHA 3FP7E 1J16A 5FHTA 1C2EA 3SUGA 4RKJB 1GBJA 1GDUA 1TFXA 3ZYDA 3V13A 1NRSH 1F0SA 3NXPA 2FTMA 3NUMA 4AG1A 4NIXA 1NFXA 4YZUA 1C4V2 1SGDE 3EDXB 3HK6B 1LQEA 4THNH 1J17T 4CBNA 5JBAS 2Z9JA 4YT6H 5DJ7A 1SOZA 1XUHA 4Y10E 2NWNA 2BB4A 4RN6A 1KXAA 1HIAB 1TPAE 1VCQA 3RM2H 2GGVB 2GMTC 1ZSKA 3SQHE 3P8GA 2VH0A 3NPSA 1AZZA 2AIQA 2EC9H 2R2MB 2G51A 4MPWA 3LGIA 2FP7B 3QTOH 1K1OA 1GCTC 1NN6A 1S85A 1F2SE 2DE8A 4ABGA 3STIA 5JB9S 2W3IA 4AOQA 3ATIA 3BTWE 1PPEE 3PB1E 4I7YH 3RXVA 1ELGA 1TPPA 1MBQA 1ZTLA 1O3LA 3HK3B 3MU1A 1C1WH 2J38A 1UVUH 4I33A 5DP7A 1LKAA 3UUZA 2ZNKH 1XUFA 2ILNA 1HCGA 1P9SA 2QA9E 4FVBA 3Q3YA 1G2LA 1QR3E 1O3GA 1VITG 4WMEA 2V3OH 1S6FA 2PW8H 1YYY1 1BHXB 5LGOA 1J9CH 5FPTA 4WF8A 1MTUA 2GCHG 2DE9A 7ESTE 3TU7H 4YOIA 1O3PB 1S84A 2G00A 3TPIZ 3ZZ7A 5C67A 4FUEA 4MLFB 1ZSLA 1O5CB 1DUEA 3E16B 3HGNA 1AFEH 3MH6A 4CH8B 4FU8A 5I46H 4ABFA 4B2AA 1DX5M 1EJAA 1LHEH 1P11E 3GCHB 5DKMA 2F9VA 2F9UA 1BRUP 3SV6A 1P3EA 4A92A 1Y3XA 1BRBE 1P05A 1O2MA 3B9FH 1O2XA 3RXMA 1WSSH 1N8OB 1Z8JB 3GY5A 5GWZA 4Y8YA 3LKWA 5DGJA 3E90B 4XDEA 3PLBA 1HJAB 2A7HA 5T6GA 5FX6A 2CN0H 1KTSB 2G5VA 4NG9H 4TPIZ 3I78A 2PGQB 3MH5A 3GCTG 2STAE 5E8EH 4BANB 5F8XA 4FU7A 1VZQH 1CO7E 3S7KB 3EE0B 1C2IA 3SNDA 1FY4A 3MNBA 1CBWC 2V3HH 4BAQB 4JMYA 4E05H 3ZV8A 3URCA 1GBBA 3KEEA 2GVFA 3PV4A 2ZPQA 1ZTKA 2A7JA 4OS1A 3UNQA 4MNYA 3A85A 3S9CA 1T31A 5AFYH 4ESTE 2GMTB 2AEIH 3C1KA 4X2WA 5E2OA 1QCPA 2XC5A 2D8WA 2CF8H 3CS7A 1F0UA 1O2VA 2ZU1A 1BMLA 1SGFG 1P04A 3SOSA 1TMUH 4X8SH 4JK5A 3VB6A 2PUXB 3ZVGA 4IW4E 1HYLA 3EAJA 4UDWH 1NPMA 4GHTA 2VH6A 1FXYA 1BOQA 1ZMJA 1EZXC 1XX9A 3MH4A 2FLRH 1QY6A 1O2OA 2ZHEH 3MO9A 2TGDA 1SFIA 1MAYA 4Y8XA 1TB6H 3RXQA 1UTNA 3A8CA 4LZ4B 1YCPH 3UWIA 4AFZA 1ETRH 3RXKA 2BDCA 4FU9A 1GBHA 3SV9A 3JZ1B 3T62A 1SOTA 5GCHF 3RXCA 1D6WA 5JPMH 2W5EA 1KY9A 1O3JA 2A5IA 3R3GB 2ALVA 4NCYA 3D62A 3EGKH 1HAYB 3NWUA 1QA7A 5EU8A 3TVJB 3V0XA 4JZIA 1HV7A 7KMEH 2ODQA 3EYDA 1O3KA 2G55A 4K60A 1C2DA 4I8GA 3PO1B 4D9QA 1BTZA 2BY7X 5FBIA 2ZO3H 3URDA 2BY9X 1GJ5H 1FV9A 1GJBB 1UVOA 3OY6U 4UE7H 1V2VT 3U9AH 5E2PA 3SUEA 1S0QA 1MZAA 4X8UH 1ANBA 4YTAA 1AB9B 3SQEE 1SFQB 1GHAG 5FCRA 1LCYA 1XKAC 4JK6A 4X6NA 1QB6A 1C1NA 3SGAE 1P0SH 1IHSH 1TGBA 3P95A 1DFPA 2SGEE 2VIQA 4ZHLU 1HLTH 1C5QA 3SNAA 2PSXA 1KXFA 1L1GA 1EB1H 3TK9A 3EQ0H 1OWHA 4BNRA 3UTUH 1BMNH 1EB2A 1CHOG 1JBUH 4FUJA 3ZZDA 4A1XA 1A0LA 1BTYA 2HNTC 4K1TA 1HRTH 1TX8A 3BEIB 1BMMH 1FAKH 3ZV9A 1AZ8A 1C5VA 5DPAA 1F5LA 4ABJA 3NK8A 2GV6A 1P2KA 3K9XB 3UR6A 2CJIA 1SR5C 3QK1A 1GI4A 1H4WA 4NGAH 3GOVB 6ESTA 1GG6C 4KELA 3VXEH 2XBYA 1P03A 2VVVA 1O39A 4Y11E 2AS9A 2GP9B 5A8YA 3GYMA 1GJCB 1C5PA 1QB1A 5DO4H 2ZZUH 1GHZA 1HGTH 3BTTE 4ZXXH 2QV1A 1TBZH 4FUGA 3OYPA 1QQUA 1TPSA 1MKWH 1RTLA 2Y7XA 3SUFA 1AQ7A 1MD7A 4OS5A 1ESTA 3F9FA 4XBBA 4VGCB 1AN1E 1VITF 2UWOA 2P8OB 1F0TA 3SU4A 2FOAA 2A5KA 1TRYA 4BAMB 6CHAC 1O3FA 2J95A 2BXTH 1BCUH 1C1VH 2BHGA 1TALA 1GHBG 4CRFA 1V2WT 3BTME 4JZDH 1QL7A 2R0KA 2ZGHA 2O8WA 1K1JA 3PTBA 4HGCA 5A2MH 4ASHA 4UFGH 4X2VA 4X6MA 2P59A 3SGBE 1ELDE 3E91A 1C2FA 2A0QB 3MI4A 3Q3KA 4GLYA 1YPHE 4GAWA 1JWTA 1KIGH 5E0GA 3M5MA 1PQAA 3AAVA 2P95A 1O2SA 4YLUA 2CHAB 1P2NA 1QB9A 1S5SA 1NU9A 2D26C 1CSOE 1PPBH 1BHXF 1C5NH 4GUXA 3LPRA 1TE0A 4HFPB 1DOJA 1O5FH 2UUYA 1SGPE 1G3CA 1Y3VA 3SJIA 4AG2A 1P01A 1SMFE 1BB0B 3RXUA 4UONA 4TWWA 2PUQH 2FIRH 2PGBB 3NZIA 3SUDA 1HAOH 4IBLH 1AU8A 3BN9A 4UFDH 4HI3A 1OWIA 3BG8A 3RXBA 4XOJA 1DWDH 4I8LA 1W12U 3D49H 1TGTA 2XNIA 1RIWC 1O2TA 2C90B 1YC0A 2FESH 2Z6BD 3HKIB 1GI3A 3A8DA 1EOLA 1HAXB 4DCDA 2ZGXH 1V2NT 4FVDA 1KDQB 4ABEA 4IC6A 2EI7A 1F5RA 2Y82A 5BPEA 3SORA 2GD4B 4OGXA 4RKOB 5DP9A 4BAOB 1B0EA 2FYRA 4YOJA 3ITIA 4WXVA 4JZEH 3P92A 1L1NA 3RXHA 2ZC9H 4CBOA 3GCHC 2KAIA 2WINI 1OWEA 2DUCA 5AFZH 1MTWA 1E34B 1KTTB 4WXIA 2G52A 1WOFA 4IMQA 5JDUB 1T32A 2CHAC 2XCNA 1BTWA 3E1XB 3Q3XA 5A0BA 1ELBA 1MCTA 1D3PB 1DDJA 1V2PT 2GT7A 4HTCH 1JOUB 1CQQA 1P2QA 3A8AA 1WBGB 1NS3A 1O3NA 3OU0A 1HXEH 2GCHF 5FBEA 7GCHF 4Q7YA 1C9TA 1GI8B 2OC7A 5L2ZH 3LGYA 1HNEE 1TA2A 3E0PB 1OKXA 1LVOA 2V0BA 2Y81A 1GI9B 1U6QA 3QLPH 1YPHC 2ZP0H 2HVXA 2ZQ1A 1JRTA 2ZHDA 2BZ6H 2IJOB 3S0NA 3SV7A 1GBFA 3ELAH 1TA6A 4X1NU 3IG6B 1BRAA 1LKBA 3VB7A 1MTNC 3L3TA 1QQ4A 3V12A 9ESTA 4X1PU 4AX9H 4FUCA 5EOKA 4ABAA 1MBMA 1GI7B 2ZECA 3RMLH 1YKTA 4ZKOU 1EJNA 4U2WA 5TCCA 2XC4A 3DFJA 5EG4A 5HM9A 4NWKA 3BEFB 1EAIA 2WPKS 2F9BH 2OQUA 2ZG0H 1UK4A 4I32A 1EATA 1G9IE 1UTOA 1SBWA 1EPTA 4U32A 4Z0KA 3VXFH 5EGMA 1O35A 4DIIH 4BXWA 1GHAF 2P3UB 1E35B 3GY3A 1TOCB 2FI3E 3SNEA 2ZEBA 3ATWA 4CRCA 3FZDA 4H6TA 2XBWA 1KYNA 2WUCA 1GMDF 1PYTC 1G30B 4ZKNU 3PO1C 1C1OA 1W10U 2PKAA 2C4FH 4R0IA 2ZGJA 2BD5A 2Y7ZA 1HAIH 1BTHH 2R3UA 4IN2A 1EP5A 3KIDU 3SV8A 4MPXA 4DJZB 3AAUA 1A1RA 2WPIS 3UREA 3ZZ9A 5LPFA 2W7SA 2VVUA 4MNXA 3ZVAA 2NU3E 1K28D 2O8MA 3K6YA 4FUIA 5HXFA 1ZLRA 4IC5A 2R2WU 2ZDLA 5DK1A 4QT8C 1BTXA 2GZ9A 1C5YB 3W95A 2PHBA 2W26A 1OX1A 1GBTA 2VWMA 4X0WU 3OX7U 1C1RA 2R3YA 4DW2U 3P6ZB 2BQ6B 3TIUA 2WUBA 1DVAH 1L4DA 3M5OA 3U8RH 2FMJA 5LPEA 1INCA 3DT0H 5ABWA 1CGHA 5EXNA 1UCYK 4XSKU 2LNCA 5GCHG 2I6SA 2XC0A 3SU3A 2BM2A 2V35A 1C2HA 1AWHB 4AYVB 3SJOA 1LQDB 3LGVA 3H7OA 4DOQA 3A7ZA 2C8WB 3RC6A 2ANMH 4TY6A 1H9LB 5EQRA 2BYAX 1UK3A 2OC8A 1P2OA 3TGJE 1P2MA 2BX3A 5A8ZA 4LK4A 3D23A 3MFJA 1KDQA 1DSUA 1HB0B 1K21H 2ZHQH 3EA8A 3MNSA 1J14A 2PLXA 2QXJA 1SHYA 4JCNA 4WJG2 2EA3A 1B5GH 3RMMH 4B2BA 3U69H 2Q6FA 4Y0YE 3VFEA 3ZZ4A 3MH7A 1EASA 2RG3A 2FS9A 4DVAU 5AVDA 1BTUA 4JYTA 1LO6A 1DWEH 2CMYA 2ZCHP 3A7TA 1BJVA 2ZU4A 5L30H 1NFYA 1V2TT 3BTEE 3ZVBA 8ESTE 2XTTB 1TYNA 2B7DH 2JH5D 1QNJA 2BY6X 2BOKA 5F8TA 1CBWB 2J2UA 1UTQA 1C5RA 3ZVEA 2J94A 1O2ZA 3M35A 1VCPA 2FXRA 4CHAB 1GBKA 1AVWA 2A45B 3RC4A 4JYUH 5CE1A 3W94A 3RXAA 1HAVA 2ODYB 1DWBH 1TMTH 3RXRA 1EAUA 3QWCH 3CENA 2O8LA 4MNVA 2AIPA 1AGJA 5HMAA 2QN5T 1TNHA 2VNTA 3ZVFA 3S7HB 2F9PA 3FP6E 3P8NA 4CRGA 4F4OC 1OOKB 1X7AC 2BDIA 2ODPA 3RXJA 2H1UA 2F83A 4A1TA 1BZXE 4NA7A 3TGIE 2ZDKA 3O8DA 2JETB 1W2KH 1H1BA 5EPNA 4K69A 3OTJE 1NM6A 5FPSA 1IQNA 1FNIA 3ODFA 1OP2A 2CXVA 1BQYA 5F6MA 1TIOA 4NZLA 3FANA 8KME2 2W7UA 1GHVH 1O5BB 1H9HE 3AVZA 1L1JA 2VVCA 4Y79A 1ELCA 3ATLA 1EP6A 1GBLA 1AMHA 3H7TA 3PMHB 2H2ZA 1UTKA 3SU6A 2BZAA 1N6YA 4E7NA 1SG8B 4D7FA 1V3XA 1EZUC 2UUKB 5JB8S 3RXDA 4BAHB 1L2EA 1J8AA 1SGTA 2BXUH 1ZMLA 1T8NA 3QDZB 1KXDA 1C5MD 2Y5FA 2VINA 1A4WH 1GBIA 2G4TA 1SB1H 2ZKSA 2JH0D 2ZA5A 3SHCH 3A80A 3K6ZA 1NFWA 3RU4T 4SGBE 1EX3A 4B75A 3TH3H 2RA0A 3PMBB 4ABHA 1BRCE 3V3MA 3F68H 1V2LT 1GWAA 1YPMH 1G3BA 1RXPA 1ELTA 1QL9A 2BQ7B 3SU2A 3ZVCA 1A5GH 4KGAA 4O3UA 3M37A 1GJ6A 3D65E 1WAYB 2QXGA 3UFAA 1SLXB 1QIXB 1ESAA 2PR3A 1N6XA 3SN8A 1D3DB 3RM0H 1O3DA 3DD2H 3SHAH 3RXSA 5C5OA 1MTVA 1W7GH 5T3HA 2UWPA 5F03A 2ZI2H 1GVZA 3UNRA 1ELAA 2A4GA 4NWLA 4AGKA 2VIWA 1CGIE 3QTVH 1OPHB 2HOBA 1ESBA 3A82A 1GL0E 2QF3A 4ZKSU 1AI8H 1UMAH 1DPOA 1CT0E 4XE4A 3BSQA 1ZHRA 1TBQH 4WH6A 3FZZA 3GY6A 4AN7A 2TBSA 1N1LA 3NCLA 4TPYA 2A4QA 3ATKA 1GMHF 3BIUH 1O31A 5E0HA 8GCHF 3PROA 6GCHF 1LPKB 2WV4A 2VIVA 3BTHE 4TYDA 1GI0A 4BAKB 1QHRB 1O2NA 1DWCH 1FZZA 3DFLA 1SGNE 1ZJDA 3GY8A 1IAUA 4NSYA 2ZTXA 1KLIH 1P12E 2BDAA 2Q1JA 4CHAC 2JKHA 1JIMA 1XUJA 1PPFE 1LHFH 1QGFA 3ZZBA 1IHTH 3U1JB 4CR5A 1DLEA 2OLGA 2H5DA 3GDSA 3ZZAA 2PTCE 1PQ8A 2IN2A 2FOGA 3P70B 4JZFH 1O2RA 2AFQB 2BD7A 3TLOA 2ZU3A 3BIVH 1O2IA 1QRWA 2TGAA 3E8LA 3GY2A 4ZHAA 1GPZA 1NTPA 1WYKA 1O5AB 3GY4A 1C1MA 5DP8A 2Y5HA 2BD9A 1O37A 1MZDA 4B74A 3UOPA 1TNKA 1SQAA 2NU2E 1KLJH 3FP8E 2XW9A 4O3TA 3BV9B 3KCGH 1E37B 1UVSH 1UTJA 3M7UA 4AB8A 1NRRH 1GBAA 2STBE 3JZ2B 7GCHG 1CHOF 1TX7A 2A32A 2R9PA 1WCZA 2BX4A 2Z3CA 2GZ8A 5EQSA 1T7CA 4B2CA 1MTNB 2GDEH 4X8TH 2BLOA 1RD3B 1A46H 3DA9B 1L0ZA 1BITA 1GHXH 2FOEA 1AVGH 1FUJA 1BT7A 1K1IA 2QAAA 5T6DA 2BLWA 2VIDA 1RTFB 5HYOA 1DUAA 4IN1A 5FAHA 4LXBH 2VGCB 1Z6EA 4WMDA 2BD2A 1W0YH 4NSVA 2FOCA 2PKSB 2QXHA 3TJUA 4D9RA 1OYTH 1AUTC 1B7XB 3VPKA 1ABIH 1LTOA 1UHBA 3OSYA 3ATMA 2Z3EA 1C1PA 2OBOA 3ENSB 1PFXC 1OP8A 2AGEX 1HAHH 1P09A 1NRPH 3VEQB 1O0DH 4Y76A 2OUAA 2OQ5A 3TJOA 1RGQA 3C27B 3BF6H 1CA0C 1C5LH 2ZTYA 5SGAE 1O36A 4B1TA 1V2UT 1H9IE 3MO6A 1VITH 4SGAE 4X6PA 2WPHS 4FXGH 2BD8A 1QBOA 3BG4B 3FAOA 4BOHA 2K1QA 1G3EA 2H9TH 1G37A 4X6OA 1O3BA 1FIZA 2ZFPH 4YOGA 2ZTZA 1K1MA 2SGDE 2SGFE 3HGPA 1GCDA 1IQGA 7LPRA 2VWOA 4H42U 3QO6A 1GJDB 3QX5H 1C5OH 1ABJH 5PTPA 4DG4A 1Z8IB 1ZJKA 1QA0A 1Y8TA 2SFAA 4ISNA 1QURH 1OWKA 1O5EH 4B76A 2Y5GA 1WQVH 1W0ZU 3K65B 3T5FH 5H4IB 1NESE 1W3CA 1XVOA 3I77A 1EQ9A 4K8YA 1WTHD 1Y5AT 2HPQH 1D3QB 3PMJA 3RXGA 1Q31A 1JIRA 1HPGA 3LDXH 1DM4B 2RCEA 1UTMA 1LMWB 4GVUA 2VWNA 4U30A 1RFNA 2WV5A 3ZZ3A 1HIAA 1NC6A 2R0LA 3EA7A 4BXSA 1CA0B 1DY8A 1FY5A 1QL8A 1T8OA 4D7GA 1THRH 4K1EA 1IQKA 1GDNA 4Y8ZA 3E6PH 1BJUA 6LPRA 5JBBS 1VR1H 1YLCA 1AFQB 1UHBB 1AFQC 1QJ1B 4NA8A 1GMCG 1K22H 2Z7FE 2ZFFH 3Q76A 1DXWA 2PKSC 1IQMA 2OINA 1Z8GA 2SGPE 1YLDA 2AMQA 1C5WB 1O33A 3AW1A 1O5GH 1K2I1 1T8MA 5EXMA 3VGCC 3BTGE 1O34A 2I6QA 4ZUHA 1UVTH 1EPTB 1AUJA 1CHGA 1MQ6A 4NIVA 4DY7B 2GDDA 2ZPSA 3LGTA 4J1YA 4DIHH 4CRAA 4FUDA 2TPIZ 2NU0E 2J92A 4YESB 3RLWH 5TJXA 4DURA 3VB3A 2ZDMA 1AY6H 1Q2WA 1YBWA 1GGDC 3A84A 1C4Y2 2BLVA 2UWLA 1O3CA 1RIWB 1TABE 3QGJA 3RDZA 2O8UA 2Y80A 3F9GA 3IITA 3STJA 5GIBA 2H9HA 1TWXB 4NIWA 1WV7H 1C2JA 3LH3A 1IQIA 1O2YA 3GICB 1XUGA 3KNXA 1F0RA 1O38A 3DHKH 4NFEA 1C4U2 1BBRE 1WTGH 5EXLA 1HFDA 4NZQA 3SNCA 1TQ7B 2GKVE 4CRDA 4X1QU 1C2GA 3GCTF 1IQFA 2GCTC 3A89A 5A0CA 1O5DH 1WU1A 3TH2H 1LVBA 2QC2A 1CT2E 3OY5U 2XBVA 1UCYH 2XCFA 2XXLA 3L33A 1HAZB 4Y7AA 1O3EA 4UFFH 4CH2B 5LPRA 2FI4E 2HPPH 2BD4A 3TNSA 1ID5H 3BG4C 1HJAC 1Z7KA 1P06A 2B9LA 3A7XA 1NU7B 3HATH 4OS4A 3F9HA 1F7ZA 4FUFA 2NU1E 1XM1A 2ANYA 2VIOA 3GY7A 5K7RA 3RXEA 1TOMH 2C93B 1MKXK 4H6SB 3VGCB 1H8IH 2EI6A 2YNBA 1AO5A 2J34A 4VGCC 2ZHFH 4F49A 1SC8U
chains in the Genus database with same CATH superfamily
3F6UH 4YM9A 1GHYH 1GBDA 1O32A 3I29A 2QF0A 2FM2A 1YPJH 1TRNA 5I25A 3OAAD 2UUJB 3M36A 1SLWB 3AK5A 1VCWA 2J4IA 2RDLA 2JIZD 5K0HA 5L2YH 5GPIB 3LONA 2ZU5A 2H5CA 1XUKA 1A0HB 1ELFA 2LPRA 1MAXA 2ZFTA 4HZHA 5J4QA 5LH8A 2Y6TA 3BTKE 2AYWA 4MTBA 1O3HA 5C1XA 1Z6JH 1O2PA 3GDVA 4K8BA 1PQ5A 3PTNA 3LGUA 5EW1H 1KXEA 1QRXA 1NRQH 5J4SA 3SI4H 1DXPA 3M61U 3T28A 3T25A 1UK2A 1HAVB 3N7EA 2P3FH 1WXRA 4WVPE 3M3SA 2F4LA 1FAXA 3RXTA 3SV2H 1CA8B 1NZQH 1ZPCA 1YF4A 1IQJA 1NY22 5KGOA 1LHCH 1QRZA 4Y0ZE 4AZ2B 4A7IB 3UQOA 1EZSC 1ZHPA 1SGEE 2PSYA 1VGCB 3RU4E 3U8TH 2QCYA 1SGRE 2SNWA 3NKKA 3SGQE 3MU4A 1DS2E 4ZH8A 4KTUA 2XOKD 1AE8H 2L74A 4I8JA 1YCPK 1BTPA 3F2GA 1A2CH 4OS7A 5KECA 1EOJA 3VB5A 2WPMS 4Q4LA 2G4UA 1SLUB 3A88A 2VIPA 1L4ZA 3B8JA 1HJ9A 1VJAU 2C8ZB 4MQAA 3MU0A 1P8VC 3A7YA 1D6RA 1FPHH 1DY9A 2VWLA 3DUXH 5FX5A 1ZTJA 1Y3YA 1RRKA 2AMDA 1FY8E 1FN6A 1HAPH 2ZDAH 1VGCC 1DE7H 1GI2A 2J5UA 3TJNA 2FEQH 2WV9A 3VB4A 1C9PA 1E36B 1E0FD 3RP2A 3PRDA 4DT4A 1LPGB 1UO6A 4AFQA 3LU9B 5AHGH 3TGKE 1GJ9B 3FO8D 3VG8A 1FDPA 1ZGVA 1ZGIA 4E06H 4I31A 3PYHA 1YM0A 3M7TA 2TGPZ 3A81A 2A31A 1MMJN 1SPJA 1BUIA 3ESTA 1ANDA 1HBTH 1SSXA 3BEUA 3BTFE 3DSGA 1P3CA 1LHGH 4INLA 1TNJA 2ESTE 1PPZA 3RMOH 1YWUA 4RT1A 1AKSB 2VB0A 3ZZ8A 1O2QA 4MNWA 5DP3A 1AWFH 1MU8B 1AHTH 2QXIA 1C2KA 1ANCA 1SGYE 4MDSA 3LIWA 1BIOA 1CT4E 1G32B 1EAXA 1V2MT 4F48B 4B6EA 5ETXA 5G4BA 1PPHE 2W3KA 5C2ZA 1MABB 1ZRBA 1ZPBA 1ELEE 5C1YA 2Q6GA 2H6MA 1IOEA 1TBRH 1M9UA 3CS0A 1FJSA 1AD8H 1P2JA 3M5NA 2P3TB 1NO9H 2BLQA 2THFB 2Z94A 4LZ1H 1NRNH 1H8ED 1OXGA 2BY5X 1A7SA 1C1SA 1EPTC 1W0KD 2A2XH 2ASUB 4O9VA 3F0PA 2XRCA 1K9OE 1AE5A 1S81A 2BDBA 4ZXYH 3OEHD 4MVNA 2BVRH 1EUFA 4CREA 1BDAA 2FWWA 3P17H 2D2DA 4Q80A 5TCAA 4K1SA 3LGWA 1YPGH 2AH4X 2C8YB 2FLBH 8GCHG 2OTVA 1O3IA 1NT1A 1DT2A 2Z9KA 1XMNB 1V2RT 2HALA 1A0JA 2ZGBH 1C5XB 1GDQA 1GHWH 2ZDVH 1Y59T 5FPYA 2F91A 1DLKB 5HGGA 3FFGA 1AIXH 5AF9H 3KQDA 2IOTA 1O2JA 1GI5A 1P02A 1WQSA 1Y3WA 3UB0A 1SQOA 1E38B 2A4OA 1ANEA 3OEED 4BTUB 3QZRA 1ARBA 2P94A 3HKJB 3A7VA 2KAIB 3LOXA 5DP5A 3SO3A 4R8TB 3PWBA 4YLQH 4JYVH 3PLPA 3O8CA 2FX4A 3T29A 3QN7A 1GJ8B 1W13U 5T6FA 1AKSA 2C8XB 4O03A 5GDSH 1FIWA 4NIYA 3A86A 5A09A 1T4UH 3RLYH 2PV9B 2AGIX 4UEHH 5T1VA 3PLKA 2FDAA 2FOBA 3UR9A 3GYLB 1O2UA 2ZCKP 2PKAB 4WMFA 3RU4D 1O2HA 1O2GH 1BMAA 1K1LA 1KLTA 1C5SA 2V6NA 3AW0A 3KF2A 5C5NA 1V2OT 2B0FA 1V6DA 4ISOA 4ABDA 2WYJA 4Z6AH 3K2UA 1S82A 3W1EA 2CF9H 2QYIA 4OS6A 2CV3A 1G36A 1EJMA 3TK6A 3B23B 4GCHG 1FY3A 4E7RG 1QJ7B 1ZRKA 2P16A 3MNXA 1TNIA 5C1UA 3BTDE 1CGJE 1JXPA 2AERH 3SJKA 1T4VH 2YNAA 1W7XH 2GTBA 1TGCA 2M5TA 5FXLA 5C20A 1YPEH 4CRBA 2VU8E 5JBTA 2GV7A 2Z9IA 4ASUD 1ZMNA 5CHAB 1IQEA 1RTKA 1TPOA 3PWCA 3SZNA 1TNGA 2XWAA 1MU6B 1EXFA 2WPJS 2UUFB 1P10A 3LC5A 4Q2KA 1C2LA 1GHBF 3RXPA 2CGAA 3A83A 1F92A 3QUMP 2BDYA 3A8BA 1LHDH 4AORA 1ELVA 1P2IA 1SL3A 2Q6DA 3H5CB 4WH8A 1MCVA 2D1JA 3UWJH 4ZMAH 2IPHA 3MYWA 2XWBI 3QZQA 5JBCS 4YO9A 1V2ST 3PMAB 1BBRK 4J2YB 1TLDA 1FONA 2XBXA 2FS8A 4ABBA 3T27A 4TSFD 1A3BH 4I8KA 1N8OC 1MQ5A 1DSTA 3KQEA 2ZFQH 1OP0A 3T26A 1YCPM 2JETC 2PWXA 3MO3A 4NA9H 3TNTA 5L6NH 2BD3A 2A5AA 3U8OH 2ZPRA 1PYTD 1MD8A 2A1DB 2OCVB 2GT8A 4RSPA 1O2KA 1VJ9U 1UTLM 1RS0A 1XKBC 2B8OH 2TGTA 2Z9LA 4ISIH 1ZHMA 3P8OA 2SNVA 1OYQA 3MU5A 3E3TA 2A4RA 2NU4E 1D4PB 1Y3UA 5EODA 1OS8A 3T2NA 1DICA 1FQ3A 1EZQA 3EA9A 4MG3A 1CE5A 1OSSA 3SJ8A 1THSH 4K2YA 1BBRH 4K5ZA 1D3TB 2HGTH 4RI0A 4KP0A 1IQHA 9LPRA 2HNTE 4IGDA 1GCTB 3ZVDA 2TRMA 4INHA 3Q77A 3ODDA 3A87A 4UD9H 3ZIAD 1KSNA 1CVWH 3QGNB 1K0HA 5B6OA 5GJ4B 4A6LA 1LVMA 3MTYA 1S0RA 3N7OA 1FY1A 1NBME 3UPEA 3MNCA 1THPB 3UNSA 1QZ8A 2M2AA 4AYYB 3V7TA 3TJVA 4MPVA 2O9QA 1Y5UT 1ACBE 3A7WA 5E0JA 2OXSA 2PTNA 1Z71A 6CHAB 1NFUA 1SGFA 4P02A 4KTSA 1C1UH 3LT3A 1RJXB 2FOHA 2HLCA 2HRVA 1Q3XA 2BVSH 3ZZ5A 1AVXA 4ZAEA 3RXLA 3UQVA 2SGQE 1IQLA 3MHWU 1XVMA 3LJJA 1O3OA 2ULLA 3GISB 1FLEE 1LDTT 3HPTB 2FOMB 2W6JD 1ZZZA 4FUBA 3SNBA 2FPZA 3M7QA 4TY7A 4UFEH 1EAWA 1ZPZA 1GJAB 2WPDD 2ZWLH 4INKA 4WY3A 4PROA 4AGJA 2BVXH 1JRSA 5C94A 3MU8A 3F1SB 2FODA 1MTSA 2FI5E 2EEKA 4ZKRU 1TX6A 1DANH 4DT7B 2L6OA 1GL1A 2HWLB 3SU0A 3RC5A 1SVPA 1O2LA 2ZF0H 4OGYA 2F9OA 1ZR0A 4FUHA 3TITA 1NROH 1JMOH 3AASA 2AMPA 1UJ1A 3MQKC 1A3EH 2ZHWH 4Q7ZA 4K3JA 1GBMA 5GXPA 3O8BA 4H4FA 1SGIB 1SGQE 1GVKB 3RMNH 1KXCA 2C3SA 3MOCA 2TIOA 1O2WA 1SGCA 4OS2A 2G8TA 2SGAA 2ZDNA 1E1RD 2QIQA 5C3NA 2KFWA 3KGPA 1MKWK 1MH0A 2QF4A 4YT7H 1OWDA 1KXBA 5DG6A 1XXFA 4X2XA 2F9NA 4GSOA 5ESBA 1W8BH 1YPKH 1F5KU 4X1RU 1DITH 1A5HA 1MKXH 4AFSA 4O97A 2ANKH 2H9EH 1SLVB 3LC3A 5HM2A 5DP4A 4B73A 2AGGX 4I8HA 4XFQA 2JDID 1TONA 1C2MA 3LH1A 3UY9A 1CU1A 2BMGB 2ZFSA 1YGCH 2OP9A 3KHVA 1UCYE 1ORFA 3RXOA 1AB9C 1S6HA 2PFEA 3L6PA 3UIRA 1GVLA 2G81E 3UOUA 2KR7A 4Y71A 1Z1IA 4GCHF 1GGDB 1G2MA 2ZFRH 3KQBA 1W11U 4A1VA 3OFND 4X8VH 4D76A 2XYAA 1GJ7B 1V2JT 1J15A 3GCNA 2A7CA 1V2QT 2BQWB 4NFFA 6GCHG 4M7GA 4GHQA 2ANWA 4Q7XA 2B5TB 2RA3A 1YY3A 2XNDD 1LPZB 1C5ZB 4TWYA 4BTIB 2FZZA 3ZZCA 1TAWA 2J9NA 1GJ4H 2WPLS 3F2HA 4ISLA 2ZQ2A 4KKDA 5EQQA 3PM3A 4WWYA 3PV2A 1TGSZ 1UTPA 1QTFA 1GI1A 5CHAC 2FOFA 4AB9A 4ISHH 4IMZA 5F8ZA 2YOLA 1H8DH 2VGCC 3SU5A 1SHHB 1D9IA 2OD3B 1K1NA 1W14U 4MPUA 2A2QH 2BTCE 2ALPA 3R0FA 5CMXH 1ZSJA 2QGRA 4B71A 4BTTB 3S9BA 3SU1A 3RUOA 4AFUA 1PJPA 1Z1JA 1EKBB 2VJ1A 3F3BA 1PPCE 3O8RA 1GG6B 1ETSH 3IWMA 5IYTA 1W0JD 1HJ8A 1Z8RA 4D8NA 1T8LA 2P8OC 3KL6A 3U98H 1ZYOA 5A8XA 1QBVH 1SQRA 4GPGA 1TGNA 2HNTF 1MUEB 2Z9GA 1C1QA 1GBEA 1PPGE 3GCOA 4CR9A 4OM9A 4XBCA 4JZ1A 2FTLE 1TNLA 2FO9A 5C0TA 2O8TA 4X2YA 1GMDG 4ZROA 1GMHG 5ESTE 1C1TA 1C5UA 3M3TA 1XXDA 3F9EA 3BTQE 5JYIA 3SI3H 4ABIA 5DP6A 2YMSB 1WUNH 1GBCA 5BRRE 3ZYEA 1P57B 2GCTB 1B0FA 1FN8A 3P8FA 3Q00A 2OBQA 4U01A 3S9AA 2P93A 3GDUA 3SJ9A 1HXFH 5IDKA 1S83A 2BDGA 3SBKA 3G01A 5FCKA 1UVPA 4XBDA 2GZ7A 1C5TA 4KTCA 2J98A 4ZHMU 2EI8A 3FVFB 1V2KT 1BA8B 3TH4H 1YP9A 2OK5A 1G3DA 1XUIA 5KEDA 2OC0A 1QBNA 3E0NB 5EPYA 2ZGCA 2QF5A 1PQ7A 1QJ6B 2ZCLP 1K1PA 2ZU2A 3RXIA 1ZOMA 2ZIQH 1GI6A 4Z1MD 1P9UA 4DGJA 1ETTH 2OC1A 1FPCH 1Y5BT 2PP6A 2WYGA 3ZZ6A 1ARCA 2GX4A 4Y6DA 2JH6D 4LOYH 1FI8A 3KN2A 2F3CE 5A0AE 1O3AA 1TMBH 1TRMA 1LVYA 1HDTH 3M5LA 1SI5H 2BY8X 1FMGA 1O3MA 4A5TS 8LPRA 3LJOA 4Y7BA 4X1SU 3RXFA 1HAGE 1A5IA 1TQ0B 3MWIU 3TK5A 1SQTA 1O30A 2BOHB 2FYQA 2FX6A 2QY0B 3CP7A 3KQCA 1HUTH 3U1IB 5EW2H 4IS5A 3S69A 1YPLH 1QFKH 1A61H 3MMGA 2G5NA 3M3VA 3WY8A 1OWJA 3SW2B 1GMCF 2Z3DA 2BDHA 3FP7E 1J16A 5FHTA 1C2EA 3SUGA 3EE7A 4RKJB 1GBJA 1GDUA 1TFXA 3ZYDA 3V13A 1NRSH 5EJZA 1F0SA 3NXPA 2FTMA 3NUMA 4AG1A 4NIXA 1NFXA 4YZUA 1C4V2 1SGDE 3EDXB 3HK6B 1LQEA 4THNH 1J17T 4CBNA 4P00A 5JBAS 2Z9JA 4YT6H 5DJ7A 1SOZA 1XUHA 2J97A 4Y10E 2NWNA 2BB4A 4RN6A 1KXAA 1HIAB 1TPAE 1VCQA 3FOAA 2GGVB 2GMTC 1ZSKA 3RM2H 3SQHE 3P8GA 2VH0A 3NPSA 1AZZA 2AIQA 2EC9H 2R2MB 2G51A 4MPWA 2F43B 2FP7B 3LGIA 2YMSD 3QTOH 1K1OA 1GCTC 1NN6A 1S85A 1F2SE 2DE8A 4ABGA 3STIA 5JB9S 2JJ2D 2W3IA 4AOQA 3ATIA 3BTWE 1PPEE 3PB1E 4I7YH 3RXVA 1ELGA 1TPPA 1MBQA 4RT0A 1ZTLA 1O3LA 3HK3B 3MU1A 1C1WH 2J38A 1UVUH 4I33A 5DP7A 1LKAA 3UUZA 2ZNKH 1XUFA 2ILNA 1HCGA 1P9SA 2QA9E 4FVBA 3Q3YA 1G2LA 1QR3E 1O3GA 1VITG 4WMEA 2V3OH 1S6FA 2PW8H 1YYY1 1BHXB 3H09A 5LGOA 1J9CH 5FPTA 4WF8A 1MTUA 2GCHG 2DE9A 7ESTE 3TU7H 4YOIA 1O3PB 1S84A 2G00A 3TPIZ 3ZZ7A 5C67A 4FUEA 4MLFB 1ZSLA 1O5CB 1DUEA 3E16B 3HGNA 1AFEH 3MH6A 4CH8B 4FU8A 1WDIA 5I46H 4ABFA 4B2AA 1DX5M 1EJAA 1LHEH 1P11E 3GCHB 5DKMA 2F9VA 2F9UA 2VBCA 1BRUP 3SV6A 1P3EA 4A92A 1Y3XA 1BRBE 1P05A 1O2MA 3B9FH 1O2XA 3DCLA 3RXMA 1WSSH 1N8OB 1Z8JB 3GY5A 5GWZA 4Y8YA 3LKWA 5DGJA 2LP6A 3E90B 4XDEA 3PLBA 1HJAB 1KMHB 2A7HA 5T6GA 5FX6A 2CN0H 1KTSB 2G5VA 2IJD1 4NG9H 4TPIZ 3I78A 2PGQB 3MH5A 3GCTG 2STAE 5E8EH 4BANB 5F8XA 4FU7A 1VZQH 1CO7E 3S7KB 3EE0B 1C2IA 3SNDA 1FY4A 3MNBA 1CBWC 2V3HH 4BAQB 4JMYA 4E05H 3ZV8A 3URCA 1GBBA 3KEEA 2GVFA 3PV4A 2ZPQA 1ZTKA 2A7JA 3WWFA 2K8IA 4OS1A 3UNQA 4MNYA 2KZ4A 3A85A 3S9CA 1T31A 5AFYH 4ESTE 4ACBA 2GMTB 2AEIH 3C1KA 4X2WA 5E2OA 1QCPA 2XC5A 2D8WA 2CF8H 3CS7A 1F0UA 1O2VA 2ZU1A 1BMLA 1SGFG 1P04A 3SOSA 1TMUH 4X8SH 4JK5A 3VB6A 2PUXB 3ZVGA 4IW4E 1HYLA 3EAJA 4UDWH 1NPMA 4GHTA 1FXYA 2VH6A 1BOQA 1ZMJA 1EZXC 1XX9A 1E79D 3MH4A 2FLRH 1QY6A 1O2OA 2ZHEH 3MO9A 2TGDA 1SFIA 5B6LA 1MAYA 4Y8XA 1TB6H 3RXQA 1UTNA 3A8CA 4LZ4B 1YCPH 3UWIA 4AFZA 1ETRH 3RXKA 2EY4C 2BDCA 4FU9A 1GBHA 3SV9A 3JZ1B 3T62A 1SOTA 5GCHF 3RXCA 1D6WA 5JPMH 2W5EA 1KY9A 1O3JA 2A5IA 3R3GB 2KCPA 2ALVA 4NCYA 3D62A 3EGKH 1HAYB 3NWUA 1QA7A 5EU8A 3TVJB 3V0XA 4JZIA 1HV7A 7KMEH 2ODQA 3EYDA 1O3KA 2G55A 4K60A 1C2DA 4I8GA 3PO1B 4D9QA 1BTZA 2BY7X 5FBIA 2ZO3H 3URDA 2BY9X 1GJ5H 1FV9A 1GJBB 1UVOA 3OY6U 4UE7H 1V2VT 3U9AH 5E2PA 3SUEA 1S0QA 1MZAA 4X8UH 1ANBA 4YTAA 1AB9B 3SQEE 5HKKD 1SFQB 1GHAG 5FCRA 3OE7D 5CDFE 1LCYA 1XKAC 4JK6A 4X6NA 1QB6A 2WHXA 1C1NA 3SGAE 1P0SH 1IHSH 1TGBA 3P95A 1DFPA 2SGEE 2VIQA 4ZHLU 1HLTH 1C5QA 3SNAA 5DSFA 2PSXA 1KXFA 1L1GA 1EB1H 3TK9A 3EQ0H 1OWHA 1NBMD 4BNRA 3UTUH 1BMNH 1EB2A 1CHOG 1JBUH 4FUJA 3ZZDA 4A1XA 4ZCNA 1A0LA 1BTYA 2HNTC 4K1TA 1HRTH 1TX8A 3BEIB 1BMMH 1FAKH 3ZV9A 2WZQA 1AZ8A 2YMSC 1C5VA 5DPAA 1F5LA 4ABJA 3NK8A 2GV6A 2QE7D 1P2KA 3K9XB 3UR6A 2CJIA 4HG6A 1SR5C 3QK1A 1GI4A 1H4WA 4NGAH 3GOVB 6ESTA 1GG6C 4KELA 3VXEH 2XBYA 1P03A 2VVVA 1O39A 4Y11E 2AS9A 2GP9B 5A8YA 3GYMA 1GJCB 1C5PA 1QB1A 5DO4H 2ZZUH 1GHZA 1HGTH 3BTTE 4ZXXH 2QV1A 1TBZH 4FUGA 3OYPA 1QQUA 1TPSA 5EIYA 1MKWH 1RTLA 2Y7XA 3OTPA 3SUFA 1AQ7A 1MD7A 4OS5A 1ESTA 3F9FA 3GS9A 4XBBA 4VGCB 1AN1E 1VITF 2UWOA 2P8OB 1F0TA 3SU4A 2FOAA 2A5KA 1TRYA 3WWBA 4BAMB 6CHAC 1O3FA 2J95A 2BXTH 1BCUH 1C1VH 2BHGA 2HVYB 1TALA 1GHBG 4CRFA 1V2WT 3BTME 4JZDH 1QL7A 2R0KA 2ZGHA 2O8WA 1K1JA 3PTBA 4HGCA 5A2MH 4ASHA 4UFGH 4X2VA 4X6MA 2P59A 3SGBE 1ELDE 3E91A 1C2FA 2A0QB 3MI4A 3Q3KA 4GLYA 1YPHE 4GAWA 1JWTA 1KIGH 5E0GA 3M5MA 1PQAA 3AAVA 2P95A 1O2SA 4YLUA 2CHAB 1P2NA 1QB9A 1S5SA 1NU9A 2D26C 2WSSD 1CSOE 1PPBH 1BHXF 1C5NH 4GUXA 3LPRA 1TE0A 4HFPB 5FL7D 1DOJA 1O5FH 2UUYA 1SGPE 1G3CA 1Y3VA 3SJIA 4AG2A 1P01A 1SMFE 1BB0B 3RXUA 4UONA 4TWWA 2PUQH 2FIRH 2PGBB 3NZIA 3SUDA 1HAOH 5HIYA 4IBLH 1AU8A 3DSOA 3BN9A 4UFDH 4HI3A 1OWIA 3BG8A 3RXBA 4XOJA 3SYJA 1DWDH 4I8LA 1W12U 3D49H 1TGTA 2XNIA 1RIWC 1O2TA 2C90B 1YC0A 2FESH 2Z6BD 3HKIB 1GI3A 2KX4A 1E1QD 1EOLA 3A8DA 1HAXB 4DCDA 2ZGXH 1V2NT 4FVDA 1KDQB 4ABEA 4IC6A 2EI7A 1F5RA 2Y82A 5BPEA 3SORA 2GD4B 4OGXA 4RKOB 5DP9A 4BAOB 1B0EA 2FYRA 4YOJA 3ITIA 4WXVA 4JZEH 3P92A 1L1NA 3RXHA 2ZC9H 4CBOA 3GCHC 2KAIA 2WINI 1OWEA 1EFRD 2DUCA 5AFZH 1MTWA 1BMFD 1E34B 1KTTB 4WXIA 2G52A 1WOFA 4IMQA 5JDUB 1T32A 2CHAC 2XCNA 1BTWA 3E1XB 3Q3XA 5A0BA 1ELBA 1MCTA 1D3PB 1DDJA 1V2PT 2GT7A 4HTCH 1JOUB 1CQQA 1P2QA 3A8AA 1WBGB 1NS3A 1O3NA 3OU0A 1HXEH 2GCHF 5FBEA 7GCHF 4Q7YA 1C9TA 1GI8B 2OC7A 5L2ZH 3LGYA 1HNEE 1TA2A 3E0PB 1OKXA 1LVOA 2V0BA 2Y81A 1GI9B 1U6QA 3QLPH 1YPHC 2ZP0H 2HVXA 2ZQ1A 1JRTA 2ZHDA 2BZ6H 2IJOB 3S0NA 3SV7A 1GBFA 3ELAH 1TA6A 4X1NU 3IG6B 1BRAA 1LKBA 4I86A 5IK2D 3VB7A 1MTNC 3L3TA 1QQ4A 3V12A 9ESTA 4X1PU 4AX9H 4FUCA 5EOKA 4ABAA 2J98B 1MBMA 1GI7B 2W6ID 2ZECA 1YKTA 3RMLH 4ZKOU 1EJNA 4U2WA 5TCCA 2XC4A 4M9FA 3DFJA 5EG4A 5HM9A 4NWKA 3BEFB 1EAIA 2WPKS 2F9BH 2OQUA 2ZG0H 1UK4A 3PRBA 4I32A 1VKYA 1EATA 1G9IE 1UTOA 1SBWA 1EPTA 4U32A 4Z0KA 3VXFH 5EGMA 1O35A 4DIIH 4F55A 2HLDD 4BXWA 1GHAF 2P3UB 1E35B 3N99A 3GY3A 1TOCB 2FI3E 3SNEA 2ZEBA 3ATWA 4CRCA 3FZDA 4H6TA 2XBWA 1KYNA 1UW7A 2WUCA 2EQNA 1GMDF 1PYTC 1G30B 4ZKNU 3PO1C 4Q63A 1C1OA 1W10U 2PKAA 2C4FH 4R0IA 2ZGJA 2BD5A 2Y7ZA 1HAIH 1BTHH 2R3UA 4IN2A 1EP5A 3KIDU 3SV8A 4MPXA 4DJZB 3AAUA 1A1RA 2WPIS 3UREA 3ZZ9A 5LPFA 2W7SA 2VVUA 4MNXA 3ZVAA 2NU3E 1K28D 2O8MA 3K6YA 4FUIA 5HXFA 1ZLRA 4IC5A 2R2WU 2ZDLA 5DK1A 4QT8C 1BTXA 2GZ9A 1C5YB 3W95A 2PHBA 2W26A 1OX1A 1GBTA 2VWMA 4X0WU 3OX7U 1C1RA 2R3YA 4DW2U 3P6ZB 2BQ6B 3TIUA 2WUBA 1DVAH 1L4DA 3M5OA 3U8RH 2FMJA 5LPEA 1INCA 3DT0H 5DN6D 5ABWA 1CGHA 5EXNA 1UCYK 4XSKU 2K0QA 2LNCA 5GCHG 2I6SA 2XC0A 3SU3A 2BM2A 2V35A 5HIZA 1C2HA 3FN8A 4ACAA 1AWHB 4AYVB 3SJOA 1LQDB 3LGVA 3H7OA 4DOQA 3A7ZA 2C8WB 3RC6A 2ANMH 4TY6A 1H9LB 5F53A 5EQRA 2BYAX 1UK3A 2JJ1D 2OC8A 1P2OA 3TGJE 1P2MA 2BX3A 5A8ZA 4LK4A 3D23A 3MFJA 1KDQA 1DSUA 1HB0B 1K21H 2ZHQH 3EA8A 3MNSA 1J14A 2PLXA 2QXJA 1SHYA 4JCNA 4WJG2 2EA3A 1B5GH 3RMMH 4B2BA 3U69H 2Q6FA 4Y0YE 3VFEA 3ZZ4A 3MH7A 1EASA 2RG3A 2FS9A 4DVAU 5AVDA 1BTUA 4JYTA 1LO6A 1DWEH 2CMYA 2ZCHP 3A7TA 5EJLA 1BJVA 2ZU4A 5L30H 1NFYA 1V2TT 3BTEE 3ZVBA 8ESTE 2XTTB 1TYNA 2B7DH 2JH5D 1QNJA 2BY6X 2BOKA 5F8TA 1CBWB 2J2UA 1UTQA 1C5RA 3ZVEA 2J94A 1O2ZA 3M35A 1VCPA 2FXRA 4CHAB 1GBKA 1AVWA 2A45B 3RC4A 4AC9A 4JYUH 5CE1A 3W94A 3RXAA 1HAVA 2ODYB 1DWBH 1TMTH 3RXRA 1EAUA 3QWCH 3CENA 2O8LA 4MNVA 2AIPA 1AGJA 1COWD 5HMAA 2QN5T 1TNHA 2VNTA 3ZVFA 3S7HB 2F9PA 3FP6E 3P8NA 4CRGA 4F4OC 1OOKB 1X7AC 2BDIA 2ODPA 3RXJA 2H1UA 2F83A 4A1TA 1BZXE 4NA7A 3TGIE 2ZDKA 3O8DA 2JETB 1W2KH 1H1BA 5EPNA 4K69A 3OTJE 1NM6A 5FPSA 1IQNA 1FNIA 3ODFA 1OP2A 2CXVA 1BQYA 5F6MA 1TIOA 4NZLA 4YXWD 3FANA 8KME2 2W7UA 1GHVH 1O5BB 1H9HE 3AVZA 1L1JA 2VVCA 2V7QD 4Y79A 1ELCA 3ATLA 3KYFA 1EP6A 1GBLA 1AMHA 3H7TA 3PMHB 2H2ZA 1UTKA 3SU6A 2BZAA 1N6YA 4E7NA 1SG8B 4D7FA 1V3XA 1EZUC 2KCAA 2UUKB 5JB8S 3RXDA 4BAHB 1H8HD 1L2EA 1J8AA 1SGTA 2BXUH 1ZMLA 1T8NA 3QDZB 1KXDA 2CK3D 1C5MD 2VINA 2Y5FA 1A4WH 1GBIA 2G4TA 1SB1H 2ZKSA 2JH0D 2ZA5A 3SHCH 3A80A 3K6ZA 1NFWA 3RU4T 4SGBE 1EX3A 4B75A 3TH3H 2RA0A 3PMBB 4ABHA 1BRCE 3V3MA 3F68H 1V2LT 1GWAA 1YPMH 1G3BA 1RXPA 1ELTA 1QL9A 2BQ7B 3SU2A 3ZVCA 1A5GH 4KGAA 4O3UA 3M37A 1GJ6A 3D65E 1WAYB 2QXGA 3UFAA 1SLXB 1QIXB 1ESAA 2PR3A 1N6XA 3SN8A 1D3DB 3RM0H 1O3DA 3DD2H 3SHAH 3RXSA 5C5OA 1MTVA 1W7GH 5T3HA 2UWPA 5F03A 2ZI2H 1GVZA 3UNRA 1ELAA 2A4GA 4NWLA 4AGKA 2VIWA 1CGIE 3QTVH 1OPHB 2HOBA 1ESBA 3A82A 3SZEA 1GL0E 2QF3A 4ZKSU 1AI8H 1UMAH 1DPOA 2KM0A 1CT0E 1OHHD 4XE4A 3BSQA 1ZHRA 1TBQH 4WH6A 3FZZA 3GY6A 4AN7A 2TBSA 1N1LA 3NCLA 4TPYA 1YLNA 2A4QA 3ATKA 1GMHF 3BIUH 1O31A 5E0HA 8GCHF 3PROA 6GCHF 1LPKB 2WV4A 2VIVA 3BTHE 4TYDA 1GI0A 4BAKB 1QHRB 2KCYA 1O2NA 1DWCH 1FZZA 3DFLA 1SGNE 1ZJDA 3GY8A 1IAUA 4NSYA 2ZTXA 1KLIH 1P12E 2BDAA 2Q1JA 4CHAC 2JKHA 1JIMA 1XUJA 1PPFE 1LHFH 1QGFA 3ZZBA 1IHTH 3U1JB 4CR5A 1DLEA 2OLGA 2H5DA 3GDSA 3ZZAA 2PTCE 1PQ8A 2IN2A 2FOGA 3P70B 4JZFH 1O2RA 2AFQB 2BD7A 3TLOA 2ZU3A 3BIVH 1O2IA 1QRWA 2TGAA 3E8LA 3GY2A 4ZHAA 1GPZA 1NTPA 1WYKA 1O5AB 3GY4A 1C1MA 5DP8A 2Y5HA 2BD9A 1O37A 1MZDA 4B74A 5CHBA 3UOPA 1TNKA 1SQAA 2NU2E 1KLJH 3FP8E 2XW9A 4O3TA 3BV9B 3KCGH 1E37B 1UVSH 1UTJA 3M7UA 4AB8A 1NRRH 1GBAA 2STBE 3JZ2B 7GCHG 1CHOF 1TX7A 2A32A 2R9PA 1WCZA 2BX4A 2Z3CA 4FETA 2GZ8A 5EQSA 1T7CA 4B2CA 1MTNB 3CNRA 2GDEH 4X8TH 1SKYE 2BLOA 3N7DA 1RD3B 1A46H 3DA9B 1L0ZA 1BITA 1GHXH 2FOEA 1AVGH 1FUJA 1BT7A 1K1IA 2IPQX 2QAAA 5T6DA 2BLWA 2VIDA 1RTFB 5HYOA 1DUAA 4IN1A 5FAHA 4LXBH 5C17A 2VGCB 1Z6EA 3KYGA 4WMDA 2BD2A 1W0YH 4NSVA 2FOCA 2PKSB 2QXHA 3TJUA 4D9RA 1OYTH 1AUTC 1B7XB 3VPKA 1ABIH 1LTOA 1UHBA 3OSYA 3ATMA 2Z3EA 1C1PA 2OBOA 3ENSB 1PFXC 1OP8A 2AGEX 3U28C 1HAHH 1P09A 1NRPH 3VEQB 1O0DH 4Y76A 2OUAA 2OQ5A 3TJOA 1RGQA 3C27B 3BF6H 1CA0C 1C5LH 2ZTYA 5SGAE 1O36A 4B1TA 1V2UT 1H9IE 3MO6A 1VITH 4SGAE 4X6PA 2WPHS 4FXGH 2BD8A 1QBOA 3BG4B 3FAOA 4BOHA 2K1QA 1G3EA 2LELA 2H9TH 1G37A 2GJGA 4X6OA 1O3BA 1FIZA 2ZFPH 4YOGA 2ZTZA 1K1MA 2SGDE 2AHME 2SGFE 3HGPA 1GCDA 1IQGA 7LPRA 2VWOA 4H42U 3QO6A 1GJDB 3QX5H 1C5OH 1ABJH 5PTPA 4DG4A 1Z8IB 1ZJKA 1QA0A 1Y8TA 2SFAA 4ISNA 3KQ5A 1QURH 1OWKA 1O5EH 4B76A 2Y5GA 1WQVH 1W0ZU 3K65B 3T5FH 5H4IB 1NESE 1W3CA 1XVOA 3I77A 1EQ9A 4K8YA 3WW7A 1WTHD 1Y5AT 2RDEA 2HPQH 1D3QB 3PMJA 3PV5A 3RXGA 1Q31A 1JIRA 1HPGA 3LDXH 3F0OA 5C0UA 1DM4B 2RCEA 1UTMA 5GNDA 1LMWB 1S6LA 4GVUA 2VWNA 4U30A 1RFNA 5EJ1A 2WV5A 3ZZ3A 1HIAA 1NC6A 2R0LA 3EA7A 4BXSA 1CA0B 1DY8A 1FY5A 1QL8A 1T8OA 4D7GA 1THRH 4K1EA 1IQKA 1GDNA 3F2FA 4Y8ZA 3E6PH 1BJUA 6LPRA 5JBBS 1VR1H 1YLCA 1AFQB 1UHBB 1AFQC 1QJ1B 4NA8A 1GMCG 1K22H 2Z7FE 2ZFFH 3Q76A 4B6FA 1DXWA 2PKSC 1IQMA 2OINA 1Z8GA 2SGPE 4XD7D 1YLDA 2AMQA 1C5WB 4TT3D 1O33A 3AW1A 1O5GH 1K2I1 1T8MA 5EXMA 4FOUC 3VGCC 3BTGE 3FKSD 1O34A 2I6QA 4ZUHA 1UVTH 1EPTB 1AUJA 1CHGA 1MQ6A 4NIVA 4DY7B 2GDDA 2ZPSA 2RFKC 3LGTA 4J1YA 4DIHH 4CRAA 4FUDA 2TPIZ 2NU0E 2J92A 4YESB 3RLWH 5TJXA 4DURA 3VB3A 2ZDMA 1AY6H 1Q2WA 1YBWA 1GGDC 3A84A 3DSPA 1C4Y2 2BLVA 2UWLA 1O3CA 1RIWB 1TABE 3QGJA 3RDZA 2O8UA 2Y80A 3F9GA 3IITA 3STJA 5GIBA 2H9HA 1TWXB 4NIWA 2KCOA 1WV7H 1C2JA 3LH3A 1IQIA 1O2YA 3GICB 1XUGA 3KNXA 1F0RA 1O38A 3DHKH 4NFEA 1C4U2 1BBRE 1WTGH 3NRLA 5EXLA 1HFDA 4NZQA 3SNCA 1TQ7B 2GKVE 4CRDA 4X1QU 1C2GA 3GCTF 1IQFA 2GCTC 3A89A 5A0CA 1O5DH 1WU1A 3TH2H 1LVBA 2QC2A 1CT2E 3OY5U 2XBVA 1UCYH 2XCFA 2XXLA 3L33A 1HAZB 4Y7AA 1O3EA 4UFFH 4CH2B 5LPRA 4XRNA 2FI4E 2HPPH 2BD4A 3TNSA 1ID5H 3BG4C 1HJAC 1Z7KA 1P06A 2B9LA 3A7XA 1NU7B 3HATH 4OS4A 3UAIC 3F9HA 1F7ZA 4FUFA 2NU1E 1XM1A 2ANYA 2VIOA 3GY7A 1FX0B 5K7RA 3RXEA 1TOMH 2C93B 1MKXK 2V3MA 4H6SB 3VGCB 1H8IH 2EI6A 2YNBA 1AO5A 2J34A 4VGCC 2ZHFH 4F49A 1SC8U
chains in the Genus database with same CATH topology
3F6UH 4YM9A 1GHYH 1GBDA 1O32A 3I29A 2QF0A 2FM2A 1YPJH 1TRNA 5I25A 2UUJB 3M36A 1SLWB 1VCWA 2J4IA 2RDLA 5K0HA 5L2YH 5GPIB 3LONA 2ZU5A 2H5CA 1XUKA 1A0HB 1ELFA 2LPRA 1MAXA 2ZFTA 4HZHA 5J4QA 5LH8A 2Y6TA 3BTKE 2AYWA 4MTBA 1O3HA 5C1XA 1Z6JH 1O2PA 3GDVA 4K8BA 1PQ5A 3PTNA 3LGUA 5EW1H 1KXEA 1QRXA 1NRQH 5J4SA 3SI4H 1DXPA 3M61U 3T28A 3T25A 1UK2A 1HAVB 2P3FH 4WVPE 3M3SA 1FAXA 3RXTA 3SV2H 1CA8B 1NZQH 1ZPCA 1YF4A 1IQJA 1NY22 4AZ2B 1LHCH 1QRZA 4Y0ZE 4A7IB 3UQOA 1EZSC 1ZHPA 1SGEE 2PSYA 1VGCB 3RU4E 3U8TH 2QCYA 1SGRE 2SNWA 3NKKA 3SGQE 3MU4A 1DS2E 4ZH8A 4KTUA 1AE8H 4I8JA 1YCPK 1BTPA 1A2CH 4OS7A 1EOJA 3VB5A 2WPMS 2G4UA 1SLUB 3A88A 2VIPA 1L4ZA 3B8JA 1HJ9A 1VJAU 2C8ZB 4MQAA 3MU0A 1P8VC 3A7YA 1D6RA 1FPHH 1DY9A 2VWLA 3DUXH 5FX5A 1ZTJA 1Y3YA 1RRKA 2AMDA 1FY8E 1FN6A 1HAPH 2ZDAH 1VGCC 1DE7H 1GI2A 3TJNA 2FEQH 3VB4A 1C9PA 1E36B 1E0FD 3RP2A 1LPGB 1UO6A 4AFQA 3LU9B 5AHGH 3TGKE 1GJ9B 1FDPA 1ZGVA 1ZGIA 4E06H 4I31A 3PYHA 1YM0A 3M7TA 2TGPZ 3A81A 2A31A 1MMJN 1SPJA 1BUIA 3ESTA 1ANDA 1HBTH 1SSXA 3BEUA 3BTFE 1P3CA 1LHGH 4INLA 1TNJA 2ESTE 1PPZA 3RMOH 1AKSB 2VB0A 3ZZ8A 1O2QA 4MNWA 5DP3A 1AWFH 1MU8B 1AHTH 2QXIA 1C2KA 1ANCA 1SGYE 4MDSA 3LIWA 1BIOA 1CT4E 1G32B 1EAXA 1V2MT 5ETXA 5G4BA 1PPHE 2W3KA 5C2ZA 1ZRBA 1ZPBA 1ELEE 5C1YA 2Q6GA 2H6MA 1IOEA 1TBRH 1M9UA 3CS0A 1FJSA 1AD8H 1P2JA 3M5NA 2P3TB 1NO9H 2BLQA 2THFB 2Z94A 4LZ1H 1NRNH 1OXGA 2BY5X 1A7SA 1C1SA 1EPTC 2A2XH 2ASUB 4O9VA 2XRCA 1K9OE 1AE5A 1S81A 2BDBA 4ZXYH 4MVNA 2BVRH 1EUFA 4CREA 1BDAA 2FWWA 3P17H 2D2DA 4Q80A 5TCAA 4K1SA 3LGWA 1YPGH 2AH4X 2C8YB 2FLBH 8GCHG 2OTVA 1O3IA 1NT1A 1DT2A 2Z9KA 1XMNB 1V2RT 2HALA 1A0JA 2ZGBH 1C5XB 1GDQA 1GHWH 2ZDVH 1Y59T 5FPYA 2F91A 1DLKB 5HGGA 3FFGA 1AIXH 5AF9H 3KQDA 2IOTA 1O2JA 1GI5A 1P02A 1WQSA 1Y3WA 1SQOA 1E38B 2A4OA 1ANEA 4BTUB 3QZRA 1ARBA 2P94A 3HKJB 3A7VA 2KAIB 3LOXA 5DP5A 3SO3A 4R8TB 3PWBA 4YLQH 4JYVH 3PLPA 3O8CA 2FX4A 3T29A 3QN7A 1GJ8B 1W13U 5T6FA 1AKSA 2C8XB 4O03A 5GDSH 1FIWA 4NIYA 3A86A 5A09A 1T4UH 3RLYH 2PV9B 2AGIX 4UEHH 3PLKA 2FDAA 2FOBA 3UR9A 3GYLB 1O2UA 2ZCKP 2PKAB 4WMFA 3RU4D 1O2HA 1O2GH 1BMAA 1K1LA 1KLTA 1C5SA 2V6NA 3AW0A 3KF2A 5C5NA 1V2OT 2B0FA 1V6DA 4ISOA 4ABDA 2WYJA 4Z6AH 3K2UA 1S82A 2CF9H 2QYIA 4OS6A 2CV3A 1G36A 1EJMA 3TK6A 3B23B 4GCHG 1FY3A 4E7RG 1QJ7B 1ZRKA 2P16A 3MNXA 1TNIA 5C1UA 3BTDE 1CGJE 1JXPA 2AERH 3SJKA 1T4VH 2YNAA 1W7XH 2GTBA 1TGCA 2M5TA 5FXLA 5C20A 1YPEH 4CRBA 2VU8E 5JBTA 2GV7A 2Z9IA 1ZMNA 5CHAB 1IQEA 1RTKA 1TPOA 3PWCA 3SZNA 1TNGA 2XWAA 1MU6B 1EXFA 2WPJS 2UUFB 1P10A 3LC5A 4Q2KA 1C2LA 1GHBF 3RXPA 2CGAA 3A83A 1F92A 3QUMP 2BDYA 3A8BA 1LHDH 4AORA 1ELVA 1P2IA 1SL3A 2Q6DA 3H5CB 4WH8A 1MCVA 2D1JA 3UWJH 4ZMAH 2IPHA 3MYWA 2XWBI 3QZQA 5JBCS 4YO9A 1V2ST 3PMAB 1BBRK 4J2YB 1TLDA 1FONA 2XBXA 2FS8A 4ABBA 3T27A 1A3BH 4I8KA 1N8OC 1MQ5A 1DSTA 3KQEA 2ZFQH 1OP0A 3T26A 1YCPM 2JETC 2PWXA 3MO3A 4NA9H 3TNTA 5L6NH 2BD3A 2A5AA 3U8OH 2ZPRA 1PYTD 1MD8A 2A1DB 2OCVB 2GT8A 4RSPA 1O2KA 1VJ9U 1UTLM 1RS0A 1XKBC 2B8OH 2TGTA 2Z9LA 4ISIH 1ZHMA 3P8OA 2SNVA 1OYQA 3MU5A 3E3TA 2A4RA 2NU4E 1D4PB 1Y3UA 5EODA 1OS8A 3T2NA 1DICA 1FQ3A 1EZQA 3EA9A 4MG3A 1CE5A 1OSSA 3SJ8A 1THSH 4K2YA 1BBRH 4K5ZA 1D3TB 2HGTH 4KP0A 1IQHA 9LPRA 2HNTE 4IGDA 1GCTB 3ZVDA 2TRMA 4INHA 3Q77A 3ODDA 3A87A 4UD9H 1KSNA 1CVWH 3QGNB 5B6OA 5GJ4B 4A6LA 1LVMA 3MTYA 1S0RA 3N7OA 1FY1A 3UPEA 3MNCA 1THPB 3UNSA 4AYYB 3V7TA 3TJVA 4MPVA 2O9QA 1Y5UT 1ACBE 3A7WA 5E0JA 2OXSA 2PTNA 1Z71A 6CHAB 1NFUA 1SGFA 4KTSA 1C1UH 3LT3A 1RJXB 2FOHA 2HLCA 2HRVA 1Q3XA 2BVSH 3ZZ5A 1AVXA 4ZAEA 3RXLA 3UQVA 2SGQE 1IQLA 3MHWU 1XVMA 3LJJA 1O3OA 2ULLA 3GISB 1FLEE 1LDTT 3HPTB 2FOMB 1ZZZA 4FUBA 3SNBA 2FPZA 3M7QA 4TY7A 4UFEH 1EAWA 1ZPZA 1GJAB 4INKA 2ZWLH 4WY3A 4PROA 4AGJA 2BVXH 1JRSA 3MU8A 3F1SB 2FODA 1MTSA 2FI5E 2EEKA 4ZKRU 1TX6A 1DANH 4DT7B 1GL1A 2HWLB 3SU0A 3RC5A 1SVPA 1O2LA 2ZF0H 4OGYA 2F9OA 1ZR0A 4FUHA 3TITA 1NROH 1JMOH 3AASA 2AMPA 1UJ1A 1A3EH 2ZHWH 4Q7ZA 4K3JA 1GBMA 5GXPA 3O8BA 4H4FA 1SGIB 1SGQE 1GVKB 3RMNH 1KXCA 2C3SA 3MOCA 2TIOA 1O2WA 1SGCA 4OS2A 2G8TA 2SGAA 2ZDNA 2QIQA 5C3NA 3KGPA 1MKWK 1MH0A 4YT7H 1OWDA 1KXBA 5DG6A 1XXFA 4X2XA 2F9NA 4GSOA 5ESBA 1W8BH 1YPKH 1F5KU 4X1RU 1DITH 1A5HA 1MKXH 4AFSA 4O97A 2ANKH 2H9EH 1SLVB 3LC3A 5HM2A 5DP4A 4B73A 2AGGX 4I8HA 4XFQA 1TONA 1C2MA 3LH1A 3UY9A 1CU1A 2BMGB 2ZFSA 1YGCH 2OP9A 3KHVA 1UCYE 1ORFA 3RXOA 1AB9C 1S6HA 2PFEA 3L6PA 3UIRA 1GVLA 2G81E 3UOUA 4Y71A 1Z1IA 4GCHF 1GGDB 1G2MA 2ZFRH 3KQBA 1W11U 4A1VA 4X8VH 4D76A 2XYAA 1GJ7B 1V2JT 1J15A 3GCNA 2A7CA 1V2QT 2BQWB 4NFFA 6GCHG 4M7GA 4GHQA 2ANWA 4Q7XA 2B5TB 2RA3A 1LPZB 1C5ZB 4TWYA 4BTIB 2FZZA 3ZZCA 1TAWA 2J9NA 1GJ4H 2WPLS 4ISLA 4KKDA 2ZQ2A 5EQQA 3PM3A 4WWYA 1TGSZ 1UTPA 1QTFA 1GI1A 5CHAC 2FOFA 4AB9A 4ISHH 4IMZA 5F8ZA 2YOLA 1H8DH 2VGCC 3SU5A 1SHHB 1D9IA 2OD3B 1K1NA 1W14U 4MPUA 2A2QH 2BTCE 2ALPA 3R0FA 5CMXH 1ZSJA 2QGRA 4B71A 4BTTB 3S9BA 3SU1A 3RUOA 4AFUA 1PJPA 1Z1JA 1EKBB 2VJ1A 1PPCE 3O8RA 1GG6B 1ETSH 3IWMA 5IYTA 1HJ8A 1Z8RA 4D8NA 1T8LA 2P8OC 3KL6A 3U98H 1ZYOA 5A8XA 1QBVH 4GPGA 1TGNA 2HNTF 1MUEB 2Z9GA 1C1QA 1GBEA 1PPGE 3GCOA 4CR9A 4XBCA 4JZ1A 2FTLE 1TNLA 2FO9A 2O8TA 4X2YA 1GMDG 4ZROA 1GMHG 5ESTE 1C1TA 1C5UA 3M3TA 1XXDA 3F9EA 3BTQE 5JYIA 3SI3H 4ABIA 5DP6A 1WUNH 1GBCA 5BRRE 3ZYEA 1P57B 2GCTB 1B0FA 1FN8A 3P8FA 3Q00A 2OBQA 4U01A 3S9AA 2P93A 3GDUA 3SJ9A 1HXFH 5IDKA 1S83A 2BDGA 3SBKA 3G01A 5FCKA 1UVPA 4XBDA 2GZ7A 1C5TA 4KTCA 4ZHMU 2EI8A 3FVFB 1V2KT 1BA8B 3TH4H 1YP9A 1G3DA 1XUIA 2OC0A 1QBNA 3E0NB 5EPYA 2ZGCA 1PQ7A 1QJ6B 2ZCLP 1K1PA 2ZU2A 3RXIA 1ZOMA 2ZIQH 1GI6A 1P9UA 4DGJA 1ETTH 2OC1A 1FPCH 1Y5BT 3ZZ6A 2WYGA 1ARCA 2GX4A 4Y6DA 2JH6D 4LOYH 1FI8A 3KN2A 2F3CE 5A0AE 1O3AA 1TMBH 1TRMA 1LVYA 1HDTH 3M5LA 1SI5H 2BY8X 1FMGA 1O3MA 4A5TS 8LPRA 3LJOA 4Y7BA 4X1SU 3RXFA 1HAGE 1A5IA 1TQ0B 3MWIU 3TK5A 1SQTA 1O30A 2BOHB 2FYQA 2FX6A 2QY0B 3CP7A 3KQCA 1HUTH 3U1IB 5EW2H 4IS5A 3S69A 1YPLH 1QFKH 1A61H 3MMGA 2G5NA 3M3VA 3WY8A 1OWJA 3SW2B 1GMCF 2Z3DA 2BDHA 3FP7E 1J16A 5FHTA 1C2EA 3SUGA 4RKJB 1GBJA 1GDUA 1TFXA 3ZYDA 3V13A 1NRSH 1F0SA 3NXPA 2FTMA 3NUMA 4AG1A 4NIXA 1NFXA 4YZUA 1C4V2 1SGDE 3EDXB 3HK6B 1LQEA 4THNH 1J17T 4CBNA 5JBAS 2Z9JA 4YT6H 5DJ7A 1SOZA 1XUHA 4Y10E 2NWNA 2BB4A 4RN6A 1KXAA 1HIAB 1TPAE 1VCQA 3RM2H 2GGVB 2GMTC 1ZSKA 3SQHE 3P8GA 2VH0A 3NPSA 1AZZA 2AIQA 2EC9H 2R2MB 2G51A 4MPWA 3LGIA 2FP7B 3QTOH 1K1OA 1GCTC 1NN6A 1S85A 1F2SE 2DE8A 4ABGA 3STIA 5JB9S 2W3IA 4AOQA 3ATIA 3BTWE 1PPEE 3PB1E 4I7YH 3RXVA 1ELGA 1TPPA 1MBQA 1ZTLA 1O3LA 3HK3B 3MU1A 1C1WH 2J38A 1UVUH 4I33A 5DP7A 1LKAA 3UUZA 2ZNKH 1XUFA 2ILNA 1HCGA 1P9SA 2QA9E 4FVBA 3Q3YA 1G2LA 1QR3E 1O3GA 1VITG 4WMEA 2V3OH 1S6FA 2PW8H 1YYY1 1BHXB 5LGOA 1J9CH 5FPTA 4WF8A 1MTUA 2GCHG 2DE9A 7ESTE 3TU7H 4YOIA 1O3PB 1S84A 2G00A 3TPIZ 3ZZ7A 5C67A 4FUEA 4MLFB 1ZSLA 1O5CB 1DUEA 3E16B 3HGNA 1AFEH 3MH6A 4CH8B 4FU8A 5I46H 4ABFA 4B2AA 1DX5M 1EJAA 1LHEH 1P11E 3GCHB 5DKMA 2F9VA 2F9UA 1BRUP 3SV6A 1P3EA 4A92A 1Y3XA 1BRBE 1P05A 1O2MA 3B9FH 1O2XA 3RXMA 1WSSH 1N8OB 1Z8JB 3GY5A 5GWZA 4Y8YA 3LKWA 5DGJA 3E90B 4XDEA 3PLBA 1HJAB 2A7HA 5T6GA 5FX6A 2CN0H 1KTSB 2G5VA 4NG9H 4TPIZ 3I78A 2PGQB 3MH5A 3GCTG 2STAE 5E8EH 4BANB 5F8XA 4FU7A 1VZQH 1CO7E 3S7KB 3EE0B 1C2IA 3SNDA 1FY4A 3MNBA 1CBWC 2V3HH 4BAQB 4JMYA 4E05H 3ZV8A 3URCA 1GBBA 3KEEA 2GVFA 3PV4A 2ZPQA 1ZTKA 2A7JA 4OS1A 3UNQA 4MNYA 3A85A 3S9CA 1T31A 5AFYH 4ESTE 2GMTB 2AEIH 3C1KA 4X2WA 5E2OA 1QCPA 2XC5A 2D8WA 2CF8H 3CS7A 1F0UA 1O2VA 2ZU1A 1BMLA 1SGFG 1P04A 3SOSA 1TMUH 4X8SH 4JK5A 3VB6A 2PUXB 3ZVGA 4IW4E 1HYLA 3EAJA 4UDWH 1NPMA 4GHTA 2VH6A 1FXYA 1BOQA 1ZMJA 1EZXC 1XX9A 3MH4A 2FLRH 1QY6A 1O2OA 2ZHEH 3MO9A 2TGDA 1SFIA 1MAYA 4Y8XA 1TB6H 3RXQA 1UTNA 3A8CA 4LZ4B 1YCPH 3UWIA 4AFZA 1ETRH 3RXKA 2BDCA 4FU9A 1GBHA 3SV9A 3JZ1B 3T62A 1SOTA 5GCHF 3RXCA 1D6WA 5JPMH 2W5EA 1KY9A 1O3JA 2A5IA 3R3GB 2ALVA 4NCYA 3D62A 3EGKH 1HAYB 3NWUA 1QA7A 5EU8A 3TVJB 3V0XA 4JZIA 1HV7A 7KMEH 2ODQA 3EYDA 1O3KA 2G55A 4K60A 1C2DA 4I8GA 3PO1B 4D9QA 1BTZA 2BY7X 5FBIA 2ZO3H 3URDA 2BY9X 1GJ5H 1FV9A 1GJBB 1UVOA 3OY6U