1C9TA

Complex of bdellastasin with bovine trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of the antistasin-type inhibitor bdellastasin with trypsin and modelling of the bdellastasin-microplasmin system.
pubmed doi rcsb
source organism Hirudo medicinalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 53
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c9tA02
2FPZA 3SU4A 4DW2U 4IW4E 4CBNA 1DUEA 4NZLA 1S84A 4O3TA 1SGFA 1C5UA 2BDYA 1C4U2 2A4RA 1THSH 3NXPA 3LGYA 2AEIH 5A2MH 4U30A 3OY5U 2AMDA 1AKSA 4XFQA 1T31A 4CR5A 3SUGA 2H9HA 8GCHF 1OPHB 2OC0A 2XNIA 3L3TA 1UTLM 2BDBA 2A5KA 1CBWB 4BNRA 3OU0A 1MQ6A 1TABE 1TBRH 2B8OH 3MFJA 4CR9A 2VVUA 3H5CB 1O2KA 1BBRK 2GDEH 5H4IB 1UTJA 1LKBA 1IQMA 1KTSB 1PPZA 5DJ7A 3V13A 5HM9A 1XUJA 2Z3DA 2ZEBA 4YZUA 1Y3XA 3QZRA 2BVRH 3O8CA 2R3UA 5E8EH 1ELAA 1W0ZU 3KF2A 4GLYA 3T26A 3T29A 5K7RA 2BM2A 3BEFB 1SGPE 3R3GB 2RCEA 2Z9JA 3A87A 2ZHFH 4XE4A 3TGJE 1QRXA 2NU0E 3QTVH 1O38A 1C2JA 3O8RA 3EQ0H 3M7UA 1ZJDA 2ZDMA 1O2ZA 5AVDA 3A7WA 3S7HB 1EAIA 1EAWA 1TNJA 2BD7A 4CREA 3NZIA 1GMHG 2A31A 2P16A 3MNXA 4GVUA 4CH2B 4ISIH 2P95A 1GBAA 1P06A 3QDZB 4I31A 3M5OA 2CHAB 2OQUA 4INKA 5L2ZH 6ESTA 4NZQA 4WWYA 4FU8A 2OBOA 3QGNB 3BTKE 1MBMA 1HAPH 2V6NA 1Y8TA 3VB3A 1C1QA 2H9TH 2VIDA 1TONA 3D62A 2VH0A 5EQSA 6GCHG 2Q6GA 2ZFSA 4ZAEA 1MTUA 2QY0B 3UR9A 2BY7X 1SLVB 1TGNA 1OP0A 4X1QU 1IHTH 2GGVB 1EPTC 3SUFA 1O2VA 1BBRH 1D3TB 1L4ZA 2JETC 3TLOA 5FBIA 1TNIA 3SNCA 3SV6A 3Q3YA 4D7FA 3RXUA 1YC0A 1GBFA 4A5TS 1P3CA 4YOGA 3V0XA 2H5DA 1S81A 1NRNH 2ZIQH 1BCUH 1HPGA 1H4WA 1A1RA 2PUXB 1ELEE 1ELBA 1O0DH 2BLWA 1BITA 1HAVB 3A8AA 5F8ZA 3A7YA 4UDWH 3SHCH 1WQVH 1V2MT 1PPGE 1XM1A 1Z8GA 4MPWA 1RGQA 4SGBE 4IC6A 3UQOA 1C2KA 1KLJH 1TAWA 1RIWC 3KN2A 3BF6H 4X6OA 1NROH 2ANYA 3PMHB 2VB0A 1GJBB 4I33A 2ZGBH 3A8DA 2PKAB 1FIWA 4ABEA 1C1VH 4Z0KA 1MKWH 3U1JB 3TK6A 3B8JA 1DANH 2EI6A 5A09A 1G2LA 2FS8A 4FUIA 4ZMAH 1MUEB 1Z71A 1T8OA 1SL3A 4NCYA 1C4V2 1EAXA 3LT3A 1AB9C 1MZDA 3DT0H 1BTZA 1ZMNA 3IG6B 4I8JA 4IS5A 1EKBB 4K8YA 4YLUA 1LVYA 3E8LA 2VIQA 1O3AA 2Z3EA 3P95A 2P59A 5LPRA 1UK2A 3VB4A 3RXCA 3GY5A 5IDKA 4RN6A 4JZDH 1SHYA 2BY6X 2AGEX 3M3TA 3GCNA 4OS5A 4X0WU 3T25A 2GCHF 3BSQA 4RKJB 1AHTH 1P02A 3D65E 1N6YA 2ALPA 3PTBA 3LGIA 1W10U 1O3MA 3MNSA 1GI4A 1GBIA 5T6DA 1LQEA 3P70B 2HNTE 3RXOA 5EXNA 4D8NA 5E2OA 1TIOA 1DITH 2J38A 1K28D 1EP5A 1GI3A 1KXCA 1UVUH 1QCPA 1VGCB 1Y5UT 3RXDA 1AWHB 1HDTH 1BUIA 3MI4A 1BMMH 1V2TT 1YKTA 4IMZA 4J2YB 3T5FH 1CT4E 2H5CA 4X8VH 3RLWH 1FY5A 3RMNH 9ESTA 1DVAH 1GHZA 1TBZH 4YOIA 3UREA 1GBKA 1FNIA 1O2SA 4NIYA 1SHHB 3GDVA 2VWMA 1GBHA 3O8DA 1EQ9A 4I8LA 1K1LA 3VB6A 1O3NA 1TFXA 4Y0YE 4AGJA 3RMLH 3PMBB 2NU2E 4YM9A 1YPEH 2V0BA 1PPHE 2FTLE 3BTME 3DD2H 3NPSA 1TBQH 1BBRE 1GI9B 4AFQA 2F3CE 3DFJA 1LHCH 1LMWB 2FYQA 5L6NH 1C1MA 2H1UA 2OC1A 4ASHA 3TVJB 3ENSB 2NU1E 1UMAH 1O2OA 4J1YA 1UTQA 1PPCE 2ZHDA 4LXBH 2QN5T 2XBYA 3VXEH 2ZTXA 2QA9E 1OWJA 5G4BA 1VITF 4OS6A 4SGAE 1FLEE 1P8VC 1CHOF 1PQ7A 2BXTH 2G8TA 2O8TA 1DM4B 5JBCS 3E0NB 2GV7A 1O2HA 2ZU2A 4K8BA 2ZECA 5GIBA 2G51A 2CXVA 1S82A 1UTPA 2G55A 5C1YA 1MTVA 4JYTA 3TNTA 3AAUA 2OTVA 3PLKA 1RTKA 1P0SH 4GPGA 1AFQC 1TRYA 1L1GA 2W3IA 1S83A 2QGRA 5BPEA 1W0YH 1AFQB 1GMDG 3RDZA 1V3XA 1MMJN 1AO5A 1WQSA 3BTEE 1CGJE 2V3OH 4OGXA 2PSXA 1GI8B 4ZXYH 1BOQA 1ZRBA 1ZGVA 1A0JA 3SW2B 3VXFH 2ZDAH 1DWDH 2EC9H 1GI0A 4A1XA 4A92A 5EXLA 2Y5GA 3MNCA 1O2LA 3WY8A 1NY22 2ZDLA 5DK1A 4Y8ZA 3QGJA 4CRGA 3SU3A 5AHGH 3ZV9A 2K1QA 5DP6A 3U8RH 1ZZZA 4K2YA 3DUXH 1A5HA 1BRCE 3ZVBA 3F9FA 1TYNA 3PLPA 1ZYOA 1ETRH 3DA9B 3KGPA 3QTOH 3BTGE 1EZSC 1O2UA 2BZAA 1AI8H 2NWNA 2WYJA 1EZUC 3GCTF 4RKOB 4ZKRU 2SGDE 2BZ6H 2R2WU 3M7TA 3K65B 3SUDA 4CRAA 4LZ1H 5C1UA 2Q6DA 3ESTA 3BN9A 2BLVA 3PLBA 1LKAA 3A85A 1F0RA 3A7VA 3LGTA 1IQKA 1LO6A 1YPGH 3BTQE 1O2NA 3BG4B 4AFZA 4BXSA 2H2ZA 1QFKH 1W7GH 2BHGA 1MKWK 3ATMA 1V2LT 1AVXA 2AMQA 2NU4E 4E7RG 8LPRA 3ZVCA 3EE0B 3NK8A 1ACBE 1LPKB 1DT2A 4MDSA 4NA7A 3RXIA 2J94A 1C1NA 1FPHH 1FV9A 3UOPA 4NA9H 4YT7H 2A1DB 4H6SB 1QBOA 2RDLA 2AMPA 1AFEH 3LOXA 3Q3KA 2FYRA 3K6ZA 3A82A 5GCHF 1NRPH 4FUBA 5SGAE 4NG9H 5EODA 1VZQH 2O8MA 1LHFH 4MNXA 1QL7A 3M61U 1ZTLA 1C1UH 1LPGB 1ZSKA 3KQCA 1BJUA 3FZZA 3A89A 3UQVA 2CMYA 3SU6A 3OSYA 3FP7E 1YPLH 3LKWA 3F6UH 1O2GH 3UNSA 1ARCA 1GCDA 1IAUA 2B9LA 2R3YA 1O3KA 1BJVA 4UFDH 1FIZA 1MZAA 4TWWA 4ZKNU 1D9IA 3A84A 1HJ9A 1P57B 4K1TA 5LPEA 3TU7H 2HALA 1MCTA 1HJAB 1N8OC 1QNJA 3E1XB 2Q1JA 2UUKB 1IQGA 3ZZDA 4FUDA 1L2EA 1GJ9B 3RC6A 1C1SA 3EDXB 4O97A 1PQAA 2ZTYA 2ZHEH 1CA0B 8ESTE 1O2YA 1YLDA 1FAXA 2FP7B 1MTWA 4DY7B 1BMNH 4MPXA 1O5DH 1Z8IB 3GCHB 5C1XA 2QCYA 1EP6A 1BB0B 1EXFA 1Z8RA 2VU8E 1IQJA 1O2PA 4YT6H 7ESTE 2F9OA 3GY4A 4NIVA 2OC7A 4UE7H 5HM2A 1HRTH 3U69H 1V2QT 1O3EA 2JH5D 2YNBA 1O35A 2KAIB 2BX4A 4AGKA 1FN8A 1SGDE 2B0FA 2CN0H 5DP7A 1IQIA 3EAJA 1RJXB 5FPYA 4BTIB 1FAKH 2WPKS 4M7GA 2SGQE 3SU5A 1V2WT 2BLQA 4E06H 1HIAA 1C9TA 3ODFA 3UWJH 2CV3A 1FZZA 2VIVA 2WPLS 1UTKA 4INLA 2CGAA 1HAIH 3RXVA 1SGRE 2O9QA 4MNYA 2FXRA 4CH8B 2TBSA 1FUJA 3E16B 1EOJA 1ABJH 2ZA5A 3RM0H 4I8GA 3T62A 4JZ1A 5DG6A 4I8HA 2HPPH 2W3KA 3BG8A 4ZUHA 1ESAA 1C2FA 3BG4C 1P2NA 2FODA 1MQ5A 1GBTA 1EUFA 1CVWH 4IMQA 1GBDA 4JK6A 1KXBA 3SV7A 3SNDA 1AN1E 1HAOH 1JRSA 1FY3A 1TWXB 4TPIZ 1EATA 2XWBI 4FUGA 4TYDA 1G36A 1XMNB 2ZF0H 2CHAC 3M3VA 3OX7U 3ZVDA 1C5RA 1GJ6A 4MQAA 1GBCA 2XTTB 3CP7A 3QLPH 1GJDB 1WUNH 1IOEA 1K1JA 1SPJA 1NFYA 1PPBH 1DX5M 1YPHE 4OS1A 1HJ8A 1O34A 2ODQA 3RXQA 4I32A 4KTSA 4CRBA 3HGNA 1NRRH 4UFFH 2BX3A 1VITG 1T8LA 4XBCA 5EU8A 4KTCA 2SFAA 2ZU3A 1W2KH 2GKVE 1QJ1B 4LK4A 1UCYE 2TRMA 4HI3A 1VCPA 2TGTA 3RXKA 3ZZ5A 1HFDA 1O5AB 4O9VA 3BEIB 1GI7B 2Y6TA 4AG1A 1TGBA 3SU2A 1JBUH 3UIRA 3QZQA 1V6DA 4TWYA 2A4OA 3UTUH 5E0HA 4B1TA 5C67A 1GHWH 3I78A 3M5LA 4JZFH 1EPTA 4Y71A 5HGGA 1C1PA 2PWXA 5A8YA 1OWEA 1AU8A 4FUFA 2ZFTA 2BVXH 1O3CA 4NSVA 1SFIA 2AIQA 5FAHA 1KY9A 4IN2A 4OGYA 1BMAA 3BEUA 5FCRA 5IYTA 1C1WH 1IQLA 5AFZH 1WCZA 2GCTC 2F91A 3TNSA 1C2IA 4YLQH 2W7UA 2EEKA 5GWZA 4Y8YA 2FIRH 2A45B 2PKAA 1SSXA 1HXEH 1C2DA 1C1TA 4NFEA 2VIWA 4DOQA 1NESE 4GSOA 3V12A 5BRRE 1W11U 4A6LA 2QXJA 4AORA 2C8YB 3ZVFA 3QX5H 1SC8U 3AVZA 2F9PA 4MNWA 8GCHG 5JDUB 2ZPQA 3SV9A 2TGPZ 4MNVA 1RIWB 2DUCA 3SU1A 5HMAA 2FOEA 2O8LA 5C20A 1SFQB 3UPEA 3UFAA 2ZGXH 4ISLA 3ODDA 2Z9LA 1PQ8A 3F1SB 5E0GA 3BTTE 5T6FA 1D3QB 1GI2A 1DWCH 1TE0A 4GHQA 1UVTH 2OQ5A 3QK1A 1HIAB 1QQ4A 2OCVB 3HATH 4FVDA 1XUGA 4MTBA 2BD5A 1SGCA 3GY8A 4X1RU 2GP9B 2GMTC 1OX1A 1O2QA 3O8BA 4HFPB 3TITA 2BDGA 1MCVA 2A5IA 2P3UB 1QGFA 4ABFA 4IN1A 5EOKA 7GCHF 3RXPA 1T7CA 1OOKB 1C1OA 4OS7A 1MD8A 2P3TB 1H9IE 3E0PB 2VIPA 3PM3A 1UHBB 4WVPE 3SJOA 1GJCB 3SORA 4B74A 1QRZA 2EI7A 5ETXA 2BY9X 1CBWC 1HAVA 5PTPA 2J9NA 4BANB 4K1EA 2QAAA 4Q2KA 1UK4A 2BDHA 3LJOA 3FAOA 3MU8A 1ZJKA 1XVOA 4K69A 1QB6A 1EJMA 4KP0A 3S9AA 5JB8S 2XBVA 3D49H 3L6PA 3MU1A 1HGTH 1GHVH 4TY7A 1Q31A 1TB6H 2AGIX 4OS4A 2BTCE 3CS7A 2XWAA 1GI5A 1O36A 1GBEA 1PQ5A 1O3FA 3FZDA 4HGCA 4YTAA 5T3HA 2ILNA 3SUEA 2VINA 5ESTE 2ZPRA 1BTWA 3DFLA 4H42U 3SOSA 1D3PB 3SHAH 1C5LH 1O3HA 1OP8A 1MKXH 2A4GA 3VGCC 2THFB 1CU1A 2FI3E 2FI5E 3SNEA 1K21H 1LPZB 1ZSJA 2GZ9A 3PMAB 1FDPA 3TIUA 1AGJA 2A5AA 4LZ4B 3OTJE 1KDQB 1SBWA 1DXPA 2AYWA 2ANWA 5TJXA 3ITIA 3KHVA 5JYIA 2F9NA 1GPZA 2BYAX 2Z94A 4ZKSU 2AH4X 3ZZCA 1O2IA 4Y10E 3VB7A 2CF8H 4E05H 3PV4A 2O8UA 1ELDE 2I6SA 2OLGA 3GICB 1AKSB 5FX5A 5FPSA 1NZQH 1H9LB 1HBTH 3PB1E 1XVMA 1HV7A 4AN7A 5A8ZA 1MTSA 3UOUA 3SGQE 1YLCA 2FM2A 1QHRB 1O3OA 5EW1H 1Y3UA 2ZCHP 1DLEA 1E34B 4K1SA 5DO4H 3LPRA 4DIIH 6CHAB 4FVBA 4Q7ZA 3UWIA 3HK6B 1XUKA 4MPUA 1CT2E 1TMTH 1K2I1 1AUTC 1O2JA 3PROA 5A0CA 1B0EA 1S6FA 3HK3B 4B76A 2ZU1A 1HCGA 4ZXXH 3M35A 3GCOA 1EJAA 2OC8A 1SR5C 1AE5A 1QBNA 1UCYK 1GHAG 1W3CA 2XC0A 1GI6A 3ZV8A 3QUMP 1ANCA 3Q77A 1AWFH 2NU3E 3LJJA 2AERH 1G3EA 1EAUA 1GCTB 5C5OA 1L1JA 1ELFA 2XCNA 1TOCB 1UTOA 3LU9B 3TH4H 2ZU5A 1JIMA 1QURH 2Y7XA 3URDA 4QT8C 1J8AA 1QB9A 1SQTA 3LDXH 3P8FA 4YO9A 1O2MA 1O37A 1IQHA 1C5NH 2FOCA 2PGBB 3RXJA 1TLDA 4BAHB 3KIDU 5DP9A 9LPRA 4K3JA 2HWLB 1GL0E 2C4FH 3ATWA 3T28A 1VR1H 2XCFA 1H8IH 4H4FA 1G32B 1QA0A 4Y11E 4PROA 5K0HA 3VB5A 1FJSA 2AIPA 3NUMA 1TQ0B 3MYWA 2P8OC 1K1MA 5FXLA 1NC6A 3MHWU 2FTMA 3T2NA 2QIQA 1BRUP 1CGHA 3LGWA 3LIWA 1O3GA 3RU4D 4JZEH 5L30H 1P3EA 2PHBA 1KLTA 3C1KA 3W94A 2KAIA 1CA8B 1ETTH 1ETSH 1WAYB 1GBBA 2QXGA 3MU5A 1MBQA 2BY8X 1E36B 2J92A 4H6TA 3EYDA 2QXIA 1F2SE 1C5OH 2PTCE 1ZHPA 3U9AH 1XKBC 1P10A 5F6MA 2ZFRH 4FUCA 5C2ZA 1HAZB 1GHBF 3MNBA 3B9FH 1TA6A 3DHKH 5ABWA 1BRAA 5DGJA 4DG4A 1T8NA 2ZDNA 1BT7A 2GT7A 5JB9S 4JMYA 1EJNA 1BMLA 4U2WA 2WINI 1THRH 4E7NA 1GMHF 1FY8E 1FN6A 3F9EA 1A7SA 1TA2A 3ZVAA 2G5NA 2UWLA 1WYKA 2VGCB 1G30B 1TOMH 4NIXA 2A7JA 4XSKU 3ZZ3A 1GL1A 1CGIE 3IWMA 2HLCA 1C5WB 2TGAA 3A80A 2G00A 1NFUA 5B6OA 1AZZA 2FWWA 2WUBA 1TPOA 1SGFG 4Y79A 4I8KA 3ATLA 3FP6E 4INHA 4MLFB 3M37A 3UR6A 1AUJA 4LOYH 1TX6A 4R8TB 5GXPA 5DP8A 3F9GA 1JWTA 1H1BA 2QYIA 4FXGH 4WXVA 2P8OB 5J4SA 2SGEE 2TGDA 3U98H 3RU4T 2Z3CA 2VVCA 5E0JA 1P2KA 4UFEH 3UY9A 2UWOA 2STAE 5EQQA 1S85A 4ZHLU 3EA7A 1ID5H 1SQAA 1QQUA 4WF8A 2RG3A 4DURA 1IQEA 1YPHC 1W12U 1GGDB 2FESH 2VWOA 3JZ1B 3NWUA 1HUTH 1XUHA 1V2NT 5JBAS 3GCTG 3HGPA 2R9PA 4AYYB 3A7TA 2FLBH 1HXFH 1VITH 3F9HA 1UVPA 2PSYA 1CSOE 1GCTC 3TH2H 1INCA 3BIVH 1D6RA 1ZMLA 3GYLB 4AB8A 1X7AC 1ZPCA 5EG4A 4RSPA 1LHEH 1WV7H 1PJPA 4X2YA 1Y3VA 1YCPH 4BXWA 1KSNA 3RXMA 2UUFB 2Z9KA 1NRQH 3A7XA 2FEQH 1ZSLA 1KXFA 1UCYH 1AD8H 3RXHA 4CRCA 2GX4A 1ZTKA 2HPQH 3S9CA 1NTPA 1SGYE 2ZDKA 2EA3A 3U8OH 5GDSH 2C93B 4JYVH 1YGCH 2ZDVH 1GDQA 1C5XB 2BQ7B 1LVBA 3IITA 1P9SA 5J4QA 2Y5HA 3MU4A 2BQWB 1CT0E 2QF0A 5FCKA 1H8DH 2GCHG 1TX8A 1EB1H 3KNXA 3RXLA 4NFFA 5CMXH 4AX9H 1SGTA 3ZYEA 2SGFE 1ESBA 2GZ8A 2IN2A 4BOHA 3A8CA 4IBLH 1FY1A 4B2CA 1S6HA 1DWEH 1EZQA 1OWKA 2FOBA 1T4VH 1O5EH 3FFGA 3HKJB 4X2XA 1CO7E 1VJ9U 1JOUB 1LVMA 2D1JA 5I25A 2ZTZA 1Y5BT 1BHXB 4NGAH 3ELAH 1DDJA 3KQDA 4K60A 3SV2H 1A5IA 1IQNA 2A7CA 1RS0A 2ZG0H 1V2RT 4FUEA 3GY6A 4Y7BA 5FBEA 2GMTB 1UVOA 2ASUB 1UO6A 1V2VT 4WMDA 5CHAC 3MWIU 2YNAA 4HTCH 5C3NA 1ELVA 2Q6FA 1UHBA 2UUJB 1LHDH 1BQYA 2ANKH 3E3TA 3A88A 1F0SA 3G01A 5EPNA 3RXEA 1SGNE 1DICA 1DY9A 3TK5A 4WMEA 4AYVB 2F9VA 2JH6D 1MTNB 4F4OC 1QTFA 3VPKA 2QXHA 3ZZAA 1P05A 4JK5A 4UFGH 4ABHA 3P8OA 4ISHH 2WYGA 1SB1H 3OY6U 1DUAA 3S0NA 4DGJA 2W5EA 4GHTA 1VCQA 2A32A 1TRMA 2OUAA 1Z7KA 2B5TB 2C8XB 1G2MA 1AQ7A 1NM6A 2G5VA 2C8ZB 2Y80A 1RTLA 1GBMA 5JPMH 1YF4A 2GVFA 1CA0C 1K1OA 1HLTH 2PUQH 3LONA 1D6WA 3KEEA 4X2VA 1TGCA 2ZQ1A 1K1IA 2FDAA 4FU9A 5EQRA 1P2OA 5DKMA 3ZZ9A 1JMOH 1T32A 2GCTB 2Z9IA 1CHGA 3LC5A 4VGCC 1GWAA 3RXTA 3A83A 3AASA 1HNEE 2ZC9H 3M7QA 1K9OE 1OYQA 2VGCC 2CF9H 3AW0A 1ZHMA 1YCPM 1AY6H 4NA8A 4DJZB 4UONA 1PPFE 2BY5X 5LGOA 1WSSH 1TMBH 3ZVEA 4CBOA 3SN8A 2LPRA 4D9RA 1RFNA 5I46H 1P2IA 3ATKA 4AFSA 2PFEA 1ZTJA 2UWPA 2FI4E 4JYUH 1XXDA 4JZIA 2HRVA 3Q00A 2BD3A 3RC5A 3TJOA 2V3HH 1VCWA 1SQOA 2J95A 1WTHD 4NSYA 3LGUA 2WPHS 1UTNA 4GAWA 5EW2H 3MO6A 4O03A 1XX9A 3A7ZA 3KQEA 1SMFE 4X1PU 2ZFFH 4CRDA 2TPIZ 3KCGH 1QJ7B 1SLXB 4AZ2B 1GJ5H 1CQQA 3K6YA 2Z7FE 2IPHA 4F49A 1O3IA 2JETB 1YM0A 2V35A 3SV8A 4Y0ZE 2PTNA 4X6MA 1ANDA 1EPTB 1TGSZ 2VWLA 5GJ4B 3BTFE 2OXSA 1ZMJA 1F5LA 3PYHA 2IJOB 2SNVA 2GZ7A 1A2CH 1P03A 3TH3H 1E37B 2ULLA 3STJA 2ZWLH 1ELTA 2I6QA 1Y5AT 2ZZUH 3P17H 3TJVA 3F68H 1C5SA 1J17T 1AVGH 1P04A 3A86A 2A2QH 3P8GA 3URCA 1DXWA 1G3CA 2FOHA 4YESB 1RXPA 1C2EA 1GJ4H 1YCPK 2PKSB 4Y76A 1CHOG 1Y3WA 4GCHF 2H9EH 4B75A 1LQDB 1SOZA 2ZHQH 1YPJH 3PO1C 5GCHG 3UNQA 4ISNA 3TK9A 2BMGB 5A0BA 1AZ8A 1JIRA 1YP9A 1TRNA 3Q76A 1TPPA 5EPYA 1C2MA 1TALA 2ANMH 1HAHH 2Z9GA 4ESTE 3SO3A 4BAOB 4KGAA 5TCAA 3LH1A 1SGIB 1BA8B 1GGDC 2W26A 1ZOMA 3ZVGA 1LHGH 2JH0D 2ZGHA 3SQEE 1OS8A 5JBTA 1J14A 3M3SA 3H7OA 1L1NA 1GMCG 3T27A 4FU7A 5FPTA 2AFQB 3CENA 4Q80A 3FVFB 3GISB 3SJ9A 2ZNKH 1Z8JB 2A0QB 4WMFA 5AFYH 3TPIZ 3GCHC 1GDNA 1MH0A 3ZZ4A 2R0LA 3RXFA 3LGVA 1T4UH 2PLXA 1EASA 1KYNA 3NCLA 1V2PT 3C27B 5A0AE 1WU1A 2C8WB 4WH8A 3GOVB 2BD9A 2FOAA 4FUJA 1TGTA 1A3EH 4KELA 1AB9B 1ELCA 4KKDA 4WH6A 2ZCKP 3E6PH 3S7KB 2HNTC 5FHTA 1TNGA 1C5VA 1RRKA 1HJAC 1N8OB 1C9PA 1F92A 1L4DA 3GDSA 2BB4A 1HAYB 2BD2A 1OKXA 4HZHA 3VGCB 2A7HA 1HAGE 5CHAB 2XYAA 1S0QA 1DFPA 1N6XA 1P2MA 4ZH8A 2FOMB 4CHAC 3ZZBA 1PPEE 2D8WA 2ZP0H 2SGAA 3E90B 2XXLA 3TJUA 3PO1B 1GMCF 4ZHAA 3RM2H 1FQ3A 3MU0A 3I77A 5F8XA 1E35B 1YPMH 1NRSH 4B71A 1XUFA 1E38B 1K22H 3ZZ6A 5AF9H 4JCNA 5DP5A 1AE8H 1AVWA 1A4WH 2P93A 2PV9B 4ABIA 4U01A 4MG3A 5EGMA 2C90B 1DY8A 1O5FH 4TY6A 1Z6EA 2Z6BD 4ZKOU 1P11E 2VVVA 1ZGIA 1QJ6B 4CHAB 3EGKH 2ZU4A 4X1SU 1F7ZA 3ATIA 5GPIB 2OINA 2ALVA 3FP8E 2GTBA 1O2RA 3SJKA 1F0UA 1TNHA 1JXPA 3QN7A 3MH5A 1S5SA 1WTGH 2FS9A 3MO9A 1KLIH 2H6MA 3A8BA 2QF3A 2ZQ2A 1O39A 3U8TH 2QC2A 1GBLA 1B7XB 2Y81A 1P01A 1A46H 2WPIS 4B2BA 3BTWE 2ODPA 3RLYH 4YOJA 4DIHH 2CJIA 4BAQB 3GY3A 3VEQB 1C5QA 1SGEE 3ZZ8A 5LH8A 2GT8A 1Y3YA 1MAYA 1V2UT 8KME2 3FANA 1D4PB 1J9CH 1XKAC 2BD8A 3BTDE 1A5GH 3PTNA 3PWBA 1O5CB 2BOHB 4A7IB 1MTNC 2ZKSA 1C5TA 3QO6A 5DP3A 3RXGA 4A1VA 3S69A 1IHSH 3GYMA 1B5GH 1J16A 1DSUA 4VGCB 3SQHE 1OWDA 1DPOA 1BZXE 1PYTD 2BOKA 1EZXC 1RTFB 4R0IA 5A8XA 2XBXA 1ZLRA 2JKHA 3A81A 2J4IA 3PMJA 1F5RA 3SGAE 2HVXA 4I7YH 1BDAA 3SGBE 1ARBA 1OSSA 3N7OA 5E2PA 2Y7ZA 1FXYA 2ZFPH 1C2GA 1BTYA 1GVKB 3SNAA 4BTUB 1M9UA 2R2MB 1NU7B 1DWBH 2A4QA 4X8SH 1DSTA 1QY6A 3OYPA 1ESTA 3MH6A 1N1LA 2RA0A 4D7GA 3UUZA 1DE7H 1ZHRA 2WV4A 1T8MA 1A3BH 1OYTH 1GVLA 1QRWA 2P94A 4THNH 2FZZA 2GD4B 1GBJA 2GDDA 4AB9A 5DPAA 3BV9B 4NIWA 2BDCA 2ODYB 3MH7A 1WBGB 4O3UA 3TJNA 5F03A 1CE5A 4D9QA 3RMMH 1UJ1A 2AS9A 2OD3B 4U32A 1GMDF 1V2OT 2VJ1A 1GDUA 4DVAU 1GVZA 4XBDA 3V3MA 1O3BA 4ABJA 2QV1A 3E91A 1C2LA 3RU4E 4WJG2 2FO9A 2XC4A 1G3DA 2ZGJA 1PYTC 4DCDA 1BTXA 5TCCA 2VIOA 3SJ8A 2VH6A 1DLKB 3SI3H 3D23A 1HYLA 1TNLA 3VFEA 3B23B 4ZHMU 1GJ7B 2F83A 4AG2A 1P2QA 2DE9A 4X1NU 3LC3A 1C5ZB 4Q7YA 1G37A 4GCHG 1FY4A 2VWNA 4ZROA 1IQFA 3KL6A 1YYY1 5T6GA 7GCHG 2J34A 2FOGA 2XBWA 2PR3A 2FX4A 2G52A 4A1TA 4OS2A 4DT7B 1NT1A 3MTYA 3Q3XA 1BIOA 4MPVA 7KMEH 2XRCA 1JRTA 1VGCC 1VJAU 2D2DA 2J2UA 3UNRA 1QL9A 4XBBA 3M5MA 1O3LA 4AFUA 5HXFA 3U1IB 3RMOH 2ZI2H 1ELGA 1LVOA 2SNWA 3RXAA 3SI4H 1B0FA 1EB2A 1ZR0A 2ZCLP 4K5ZA 4MVNA 2ESTE 2WV5A 1O5GH 2WPJS 3K9XB 4NWLA 2PW8H 1MU8B 1BHXF 2VNTA 4ABAA 4D76A 1UTMA 3M36A 1O2TA 2BVSH 1NU9A 1UVSH 1ANBA 4Q7XA 3TGKE 1GG6B 1W14U 3GY7A 4IC5A 1J15A 1KTTB 1LCYA 2OP9A 1ZPZA 3SBKA 1D3DB 1V2KT 2D26C 1O3JA 4UEHH 1YBWA 4Z6AH 3MH4A 2WUCA 2XW9A 1SI5H 1QR3E 3GY2A 1MKXK 4BAKB 1KXAA 1BTPA 1L0ZA 3MMGA 1HAXB 2M5TA 4IGDA 1E0FD 1V2ST 1C2HA 4X6NA 3SU0A 1RD3B 3KQBA 2LNCA 1TNKA 4ISOA 1P09A 1O33A 1GHXH 4B2AA 1EOLA 3R0FA 2BQ6B 7LPRA 3RC4A 6CHAC 3M5NA 6GCHF 1FONA 1KDQA 2B7DH 5FX6A 3BTHE 1Y59T 4WXIA 3ZYDA 4KTUA 1SG8B 2PKSC 2FMJA 3LH3A 4Y8XA 2OBQA 5JBBS 3ZZ7A 2HGTH 1Q2WA 1C4Y2 1LDTT 3I29A 4UD9H 3AW1A 5CE1A 1K1NA 1THPB 3AAVA 4X8TH 1NFWA 1A0HB 1AIXH 2P3FH 3RP2A 1MD7A 1O30A 1TPSA 4NWKA 4GUXA 6LPRA 4XOJA 4AOQA 1XUIA 3P6ZB 1Z6JH 2Y82A 1NO9H 1FPCH 1EX3A 5ESBA 3K2UA 3BIUH 2AGGX 2ZHWH 3RXRA 2O8WA 1O32A 1H9HE 1FI8A 1C5PA 4Y6DA 3P8NA 1W7XH 1TX7A 1HB0B 4X8UH 5HYOA 5DP4A 2XC5A 1GHAF 2ZO3H 1AMHA 1SOTA 3S9BA 1A0LA 2ZPSA 5LPFA 1QL8A 3W95A 1GI1A 4Y7AA 3PWCA 1ANEA 1MU6B 2G81E 2IOTA 3HPTB 1GHYH 5EXMA 3RXSA 1QIXB 3QWCH 1W13U 1O3DA 3P92A 1NN6A 4WY3A 4ABGA 4X6PA 1DS2E 4FUHA 1C1RA 2UUYA 2BD4A 2PGQB 2HOBA 3HKIB 1S0RA 2BDAA 1W8BH 2ZFQH 4XDEA 2TIOA 3STIA 2GV6A 1SLUB 4CRFA 2G4UA 1QB1A 1F0TA 2SGPE 1A61H 4BAMB 1FMGA 1OXGA 1G3BA 1UK3A 1NS3A 2F9UA 1C5YB 1U6QA 5F8TA 1GG6C 2C3SA 4TPYA 2Y5FA 3SJIA 3L33A 3SNBA 1PFXC 2A2XH 2G4TA 1XXFA 1Z1JA 1GJAB 1TMUH 1BTUA 3TGIE 1O31A 1Z1IA 2W7SA 1WOFA 2RA3A 2FLRH 1KXDA 1K1PA 1NPMA 5C5NA 1ZRKA 1O5BB 2WPMS 3EA8A 1LTOA 3RXBA 1GHBG 3MOCA 1KXEA 4BTTB 3H7TA 2EI8A 1GJ8B 3EA9A 4X2WA 4ABDA 2BLOA 1YPKH 1C5MD 1O2WA 4B73A 1QBVH 2YOLA 1F5KU 3NKKA 1O3PB 1SVPA 2DE8A 1KIGH 1OWIA 2BDIA 1BTHH 1BRBE 2STBE 3V7TA 3GDUA 1Q3XA 1SGQE 1ABIH 1DOJA 1ZPBA 1SLWB 1TQ7B 2BXUH 1QA7A 1TPAE 2R0KA 1P12E 1MAXA 2FX6A 2ZGCA 5L2YH 3RUOA 1O2XA 1G9IE 3CS0A 1P9UA 4ABBA 2HNTF 3SZNA 2FOFA 1V2JT 1NFXA 3MO3A 1P2JA 3JZ2B 2F9BH 1OP2A 1OWHA 1ORFA
chains in the Genus database with same CATH superfamily
2FPZA 3SU4A 4DW2U 4IW4E 4CBNA 1DUEA 4NZLA 1S84A 4O3TA 1SGFA 2F43B 1C5UA 2BDYA 1C4U2 2A4RA 1THSH 3NXPA 3LGYA 2AEIH 5A2MH 1FX0B 4U30A 3OY5U 2AMDA 1AKSA 4XFQA 1T31A 4CR5A 3SUGA 2H9HA 8GCHF 1OPHB 2OC0A 2XNIA 3L3TA 1UTLM 2BDBA 2A5KA 1CBWB 4BNRA 3OU0A 1MQ6A 1TABE 1TBRH 2B8OH 3MFJA 4CR9A 2VVUA 3H5CB 1O2KA 1BBRK 2GDEH 5H4IB 1UTJA 5KEDA 1LKBA 1IQMA 1KTSB 1PPZA 5DJ7A 3V13A 5HM9A 1XUJA 2Z3DA 2ZEBA 4YZUA 1Y3XA 3QZRA 2BVRH 3O8CA 2R3UA 5E8EH 1ELAA 1W0ZU 3KF2A 4GLYA 3T26A 3T29A 5K7RA 2BM2A 3BEFB 1SGPE 3R3GB 2RCEA 2Z9JA 3A87A 2ZHFH 4XE4A 3TGJE 1QRXA 2NU0E 3QTVH 1O38A 1C2JA 3O8RA 3EQ0H 3M7UA 1ZJDA 3DSOA 2ZDMA 1O2ZA 5AVDA 3A7WA 3S7HB 1EAIA 1EAWA 1TNJA 2BD7A 4CREA 3NZIA 1GMHG 2A31A 2P16A 3MNXA 4GVUA 4CH2B 4ISIH 2P95A 1GBAA 1P06A 3QDZB 4I31A 3M5OA 2CHAB 2OQUA 4INKA 4AC9A 5L2ZH 6ESTA 4NZQA 4WWYA 4FU8A 2OBOA 2PP6A 3QGNB 3BTKE 1MBMA 1HAPH 2V6NA 1Y8TA 3VB3A 1C1QA 2H9TH 2VIDA 1TONA 3D62A 2VH0A 1S6LA 5EQSA 2KCOA 6GCHG 2Q6GA 2ZFSA 4ZAEA 1MTUA 2QY0B 3UR9A 2BY7X 1SLVB 1TGNA 1OP0A 4X1QU 1IHTH 2GGVB 1KMHB 1EPTC 3SUFA 1O2VA 1BBRH 1D3TB 1L4ZA 2JETC 3TLOA 5FBIA 1TNIA 3SNCA 5EIYA 3SV6A 3Q3YA 4D7FA 3RXUA 1YC0A 1GBFA 4A5TS 1P3CA 4YOGA 2V3MA 3V0XA 2H5DA 1S81A 1NRNH 2ZIQH 1BCUH 1HPGA 1H4WA 1A1RA 2PUXB 1ELEE 1ELBA 1O0DH 2BLWA 1BITA 1HAVB 2YMSB 3A8AA 5F8ZA 3A7YA 3SZEA 4UDWH 3SHCH 1WQVH 1V2MT 1PPGE 1XM1A 1Z8GA 4MPWA 1RGQA 4SGBE 4IC6A 3UQOA 1C2KA 1KLJH 1TAWA 1RIWC 3KN2A 3BF6H 4X6OA 1NROH 2ANYA 3PMHB 2VB0A 1GJBB 4I33A 2ZGBH 3A8DA 2PKAB 1FIWA 4ABEA 1C1VH 4Z0KA 1MKWH 3U1JB 3TK6A 3B8JA 1DANH 2EI6A 5A09A 1G2LA 2FS8A 4FUIA 4ZMAH 1MUEB 1Z71A 1T8OA 5HKKD 1SL3A 4NCYA 1C4V2 1EAXA 3LT3A 1AB9C 1MZDA 3DT0H 1BTZA 2KM0A 1ZMNA 3IG6B 4I8JA 4IS5A 1EKBB 4K8YA 4YLUA 1LVYA 3E8LA 2VIQA 1O3AA 2Z3EA 3P95A 2P59A 5LPRA 1UK2A 3VB4A 3RXCA 3GY5A 5IDKA 4RN6A 4JZDH 1SHYA 2BY6X 2AGEX 3M3TA 3GCNA 4OS5A 4X0WU 3T25A 2GCHF 3BSQA 4RKJB 1AHTH 1P02A 3D65E 1N6YA 2ALPA 3PTBA 3LGIA 1W10U 1O3MA 3MNSA 1GI4A 1GBIA 5T6DA 1LQEA 3P70B 2HNTE 3RXOA 5EXNA 2RDEA 2WSSD 5E2OA 4D8NA 1TIOA 1DITH 2J38A 1K28D 3OTPA 1EP5A 1GI3A 1KXCA 1UVUH 1QCPA 1VGCB 1Y5UT 3RXDA 1AWHB 1HDTH 1BUIA 3MI4A 1BMMH 1V2TT 1YKTA 2OK5A 4IMZA 4J2YB 3T5FH 1CT4E 2H5CA 4X8VH 3RLWH 1FY5A 3RMNH 9ESTA 1DVAH 1GHZA 1TBZH 4YOIA 3UREA 1GBKA 1FNIA 1O2SA 4NIYA 1SHHB 3GDVA 2VWMA 1GBHA 3O8DA 1EQ9A 4I8LA 1K1LA 3VB6A 1O3NA 1TFXA 4Y0YE 4AGJA 3RMLH 3PMBB 2NU2E 4YM9A 1YPEH 2V0BA 1PPHE 2FTLE 3BTME 3DD2H 3NPSA 1TBQH 1BBRE 1GI9B 4AFQA 2F3CE 3DFJA 1LHCH 1LMWB 2FYQA 4ASUD 5L6NH 1C1MA 2H1UA 2OC1A 4ASHA 3TVJB 3ENSB 2NU1E 1UMAH 1O2OA 4J1YA 1UTQA 1PPCE 2ZHDA 4LXBH 2QN5T 2XBYA 3VXEH 2ZTXA 2QA9E 1OWJA 5G4BA 1VITF 4OS6A 4SGAE 1FLEE 1E1QD 1P8VC 1CHOF 1PQ7A 2BXTH 2G8TA 2O8TA 1DM4B 5JBCS 3E0NB 2GV7A 1O2HA 2ZU2A 4K8BA 2ZECA 5GIBA 2JDID 2G51A 2CXVA 1S82A 1UTPA 2G55A 4I86A 5C1YA 1MTVA 4JYTA 3TNTA 3AAUA 2OTVA 3PLKA 1RTKA 1P0SH 4M9FA 4GPGA 1AFQC 1TRYA 1L1GA 2W3IA 1S83A 2QGRA 5BPEA 1W0YH 1AFQB 1GMDG 3RDZA 1V3XA 1MMJN 1AO5A 2F4LA 1WQSA 3BTEE 1CGJE 2V3OH 4OGXA 2PSXA 3N7DA 1GI8B 4ZXYH 1BOQA 1ZRBA 1ZGVA 1A0JA 3SW2B 3VXFH 2ZDAH 1DWDH 2EC9H 1GI0A 4A1XA 4A92A 5EXLA 2Y5GA 3MNCA 1O2LA 3WY8A 1SKYE 1NY22 2ZDLA 5DK1A 4Y8ZA 3QGJA 4CRGA 3SU3A 5AHGH 3ZV9A 2K1QA 5DP6A 3U8RH 1ZZZA 2W6ID 4K2YA 3DUXH 1A5HA 1BRCE 3ZVBA 3F9FA 1TYNA 3PLPA 1ZYOA 1ETRH 3DA9B 3KGPA 3QTOH 3BTGE 1EZSC 1O2UA 2BZAA 1AI8H 2NWNA 2WYJA 1EZUC 3GCTF 4RKOB 4ZKRU 2SGDE 2BZ6H 2R2WU 3M7TA 3K65B 5HIZA 3SUDA 4CRAA 5C1UA 3PV2A 2Q6DA 3ESTA 4LZ1H 1K0HA 3BN9A 2BLVA 3PLBA 3PRDA 1LKAA 3A85A 1F0RA 3A7VA 3LGTA 1IQKA 1LO6A 1W0KD 1YPGH 3BTQE 1O2NA 3BG4B 4Q4LA 4AFZA 4BXSA 2H2ZA 1QFKH 1W7GH 3U28C 3PV5A 2BHGA 1MKWK 3ATMA 1V2LT 1AVXA 2AMQA 2NU4E 4E7RG 8LPRA 3ZVCA 3EE0B 3NK8A 1ACBE 1LPKB 1DT2A 4MDSA 4NA7A 3RXIA 2J94A 1C1NA 1FPHH 1FV9A 3UOPA 4NA9H 4YT7H 2A1DB 4H6SB 1QBOA 2RDLA 2WPDD 2AMPA 1AFEH 3LOXA 3Q3KA 2FYRA 3K6ZA 3A82A 5GCHF 1NRPH 4FUBA 5SGAE 4NG9H 5EODA 4Z1MD 1VZQH 2O8MA 1LHFH 4MNXA 1QL7A 3M61U 1ZTLA 1C1UH 1LPGB 1ZSKA 3KQCA 1BJUA 3FZZA 3A89A 3UQVA 2CMYA 3SU6A 3OSYA 3F3BA 3FP7E 1YPLH 3LKWA 3F6UH 1O2GH 3UNSA 1ARCA 1GCDA 1IAUA 2B9LA 2R3YA 1O3KA 1BJVA 4UFDH 2J98A 1FIZA 1MZAA 4TWWA 4ZKNU 1D9IA 3A84A 1HJ9A 1YLNA 1P57B 4K1TA 5LPEA 3TU7H 2HALA 1MCTA 1HJAB 1N8OC 1QNJA 3E1XB 2Q1JA 2UUKB 1IQGA 3ZZDA 4FUDA 1L2EA 1GJ9B 3RC6A 1C1SA 3EDXB 4O97A 1PQAA 2ZTYA 4RI0A 2ZHEH 1CA0B 8ESTE 1O2YA 1YLDA 1FAXA 2FP7B 1MTWA 4DY7B 1BMNH 4MPXA 1O5DH 1Z8IB 3GCHB 5C1XA 2QCYA 1EP6A 1BB0B 1EXFA 1Z8RA 2VU8E 1IQJA 1O2PA 4YT6H 7ESTE 2F9OA 3GY4A 4NIVA 2OC7A 4UE7H 5HM2A 1HRTH 3U69H 1V2QT 1O3EA 2JH5D 2YNBA 1O35A 2KAIB 2BX4A 4AGKA 1FN8A 1SGDE 2B0FA 2CN0H 5DP7A 1IQIA 3EAJA 1RJXB 5FPYA 4BTIB 1FAKH 2WPKS 4M7GA 2SGQE 3SU5A 1V2WT 2BLQA 3ZIAD 4E06H 1HIAA 1C9TA 3ODFA 3UWJH 2CV3A 1FZZA 2VIVA 2WPLS 1UTKA 4INLA 2CGAA 1HAIH 3RXVA 1SGRE 2O9QA 4MNYA 4XRNA 2FXRA 4CH8B 2TBSA 1FUJA 3E16B 1EOJA 1ABJH 2ZA5A 3RM0H 4I8GA 3T62A 4JZ1A 5DG6A 4I8HA 2HPPH 2W3KA 3BG8A 4ZUHA 1ESAA 1C2FA 3BG4C 1P2NA 2FODA 1MQ5A 1GBTA 1EUFA 1CVWH 4IMQA 1GBDA 4JK6A 1KXBA 3SV7A 3SNDA 1AN1E 3WWFA 1HAOH 1JRSA 1FY3A 1TWXB 4TPIZ 1EATA 2XWBI 4FUGA 4TYDA 1G36A 2QF4A 3F2FA 1XMNB 2ZF0H 3AK5A 2CHAC 1UW7A 3M3VA 3OX7U 3ZVDA 1C5RA 1GJ6A 4MQAA 3OFND 1GBCA 2XTTB 3CP7A 3QLPH 1GJDB 1WUNH 1IOEA 3WWBA 1K1JA 1SPJA 1NFYA 1PPBH 1DX5M 1YPHE 4OS1A 1HJ8A 1O34A 2ODQA 3RXQA 4I32A 4KTSA 4CRBA 3HGNA 1NRRH 4UFFH 2BX3A 1VITG 1T8LA 4XBCA 5EU8A 4KTCA 2SFAA 2ZU3A 1W2KH 2GKVE 1QJ1B 4LK4A 1UCYE 2TRMA 2WZQA 4HI3A 1VCPA 2TGTA 3RXKA 3ZZ5A 1HFDA 1O5AB 4O9VA 3BEIB 1GI7B 2Y6TA 4AG1A 1TGBA 3SU2A 1JBUH 3UIRA 3QZQA 1V6DA 4TWYA 2A4OA 3UTUH 5E0HA 1BMFD 3F0PA 4B1TA 5C67A 1GHWH 3I78A 3M5LA 4JZFH 1EPTA 3FN8A 4Y71A 5HGGA 1C1PA 2PWXA 5A8YA 1OWEA 1AU8A 3CNRA 4FUFA 2ZFTA 2BVXH 3EE7A 1O3CA 4NSVA 1SFIA 2AIQA 5FAHA 1KY9A 4IN2A 4OGYA 1BMAA 3BEUA 5FCRA 5IYTA 1C1WH 1IQLA 5AFZH 1WCZA 2GCTC 2F91A 3TNSA 1C2IA 4YLQH 2W7UA 2EEKA 5GWZA 4Y8YA 2FIRH 2A45B 3F2GA 2PKAA 1E1RD 1SSXA 1HXEH 1C2DA 1C1TA 4NFEA 2VIWA 4DOQA 1NESE 4GSOA 3V12A 5BRRE 1W11U 4A6LA 2QXJA 2VBCA 4AORA 2C8YB 3ZVFA 3QX5H 1SC8U 3AVZA 2F9PA 4MNWA 8GCHG 5JDUB 2ZPQA 3SV9A 2TGPZ 4MNVA 1RIWB 2KCPA 2DUCA 3SU1A 5HMAA 2FOEA 5GNDA 2O8LA 5C20A 1SFQB 3UPEA 3UFAA 2ZGXH 4ISLA 3ODDA 2Z9LA 5KGOA 1PQ8A 3F1SB 2YMSC 5E0GA 3BTTE 5T6FA 1D3QB 1GI2A 1DWCH 1TE0A 4GHQA 1UVTH 2OQ5A 3QK1A 1HIAB 1QQ4A 2OCVB 3HATH 4FVDA 1XUGA 4MTBA 2BD5A 1SGCA 3GY8A 4X1RU 5B6LA 2GP9B 2GMTC 1OX1A 1O2QA 3O8BA 4HFPB 3TITA 2BDGA 1MCVA 2A5IA 1WXRA 2P3UB 1QGFA 4ABFA 4IN1A 5EOKA 7GCHF 3RXPA 1T7CA 1OOKB 1C1OA 4OS7A 1MD8A 2P3TB 1H9IE 3E0PB 2VIPA 3PM3A 1UHBB 4WVPE 3SJOA 1GJCB 3SORA 4B74A 1QRZA 2EI7A 5ETXA 2BY9X 2L6OA 1CBWC 1HAVA 5PTPA 2J9NA 4BANB 4K1EA 2QAAA 4Q2KA 1UK4A 2BDHA 3LJOA 3FAOA 3MU8A 1ZJKA 1XVOA 4K69A 1QB6A 1EJMA 4KP0A 3S9AA 5JB8S 2XBVA 3D49H 3L6PA 3MU1A 1HGTH 1GHVH 4F48B 4TY7A 1Q31A 1TB6H 2AGIX 4OS4A 2BTCE 3CS7A 2XWAA 1GI5A 1O36A 1GBEA 3DSGA 1PQ5A 1O3FA 2KFWA 3FZDA 4HGCA 4YTAA 5T3HA 2ILNA 3SUEA 2VINA 5ESTE 2ZPRA 1BTWA 3DFLA 2WV9A 4H42U 2AHME 3SOSA 1D3PB 3SHAH 1C5LH 1O3HA 1OP8A 1MKXH 2A4GA 3VGCC 2THFB 1CU1A 2FI3E 2FI5E 3SNEA 1K21H 1LPZB 1ZSJA 2GZ9A 3PMAB 1FDPA 3TIUA 1AGJA 2A5AA 3DCLA 1WDIA 4LZ4B 3OTJE 1KDQB 1SBWA 1DXPA 2AYWA 2ANWA 5TJXA 3ITIA 3SYJA 3W1EA 3KHVA 2EQNA 5JYIA 2F9NA 1GPZA 2BYAX 2Z94A 4ZKSU 2AH4X 3ZZCA 1O2IA 4Y10E 3VB7A 2CF8H 4E05H 3PV4A 2O8UA 1ELDE 2I6SA 2OLGA 3GICB 1AKSB 5FX5A 5FPSA 1NZQH 1H9LB 1HBTH 3PB1E 1XVMA 1HV7A 4AN7A 5A8ZA 1MTSA 3UOUA 3SGQE 1YLCA 2FM2A 1QHRB 1O3OA 5EW1H 1Y3UA 2ZCHP 1DLEA 1E34B 4K1SA 5DO4H 3LPRA 4DIIH 6CHAB 4FVBA 4Q7ZA 3UWIA 3HK6B 1XUKA 4MPUA 4P02A 1CT2E 1TMTH 3KYFA 1K2I1 1AUTC 4P00A 1O2JA 3PROA 1NBME 5A0CA 1B0EA 1S6FA 3HK3B 4B76A 2ZU1A 1HCGA 4ZXXH 3M35A 3GCOA 1EJAA 2OC8A 1SR5C 1AE5A 1QBNA 1UCYK 1GHAG 1W3CA 2XC0A 1GI6A 3ZV8A 3QUMP 1ANCA 3Q77A 1AWFH 2NU3E 3LJJA 4DT4A 2AERH 1G3EA 1EAUA 1GCTB 5C5OA 1L1JA 1ELFA 2XCNA 1TOCB 1UTOA 3LU9B 3TH4H 2ZU5A 1JIMA 1QURH 2Y7XA 3URDA 4QT8C 1J8AA 1QB9A 1SQTA 3LDXH 3P8FA 4YO9A 1MABB 1O2MA 1O37A 1IQHA 1C5NH 2FOCA 2PGBB 3RXJA 1TLDA 4BAHB 3KIDU 5DP9A 9LPRA 4K3JA 2HWLB 1GL0E 2C4FH 3ATWA 3T28A 1VR1H 2XCFA 1H8IH 4H4FA 1G32B 1QA0A 4F55A 4Y11E 4PROA 5K0HA 3VB5A 1FJSA 2AIPA 3NUMA 1TQ0B 3MYWA 2P8OC 1K1MA 5FXLA 1NC6A 3MHWU 2FTMA 3T2NA 2QIQA 1BRUP 1CGHA 3LGWA 3LIWA 1O3GA 3RU4D 4JZEH 5L30H 1P3EA 2PHBA 1KLTA 3C1KA 3W94A 2KAIA 1CA8B 1ETTH 1ETSH 1WAYB 1GBBA 2QXGA 3MU5A 1MBQA 2BY8X 1E36B 2J92A 4H6TA 3EYDA 2QXIA 1F2SE 1C5OH 2PTCE 1ZHPA 3U9AH 1XKBC 1P10A 5F6MA 3H09A 2ZFRH 4FUCA 5C2ZA 1HAZB 1GHBF 3MNBA 3B9FH 1TA6A 3DHKH 5ABWA 2QE7D 1BRAA 5DGJA 4DG4A 1T8NA 2ZDNA 1BT7A 2GT7A 5JB9S 4JMYA 1EJNA 1BMLA 4U2WA 2WINI 1THRH 4E7NA 1GMHF 1FY8E 1FN6A 3F9EA 1A7SA 1TA2A 3ZVAA 2G5NA 2UWLA 1WYKA 2VGCB 1G30B 1TOMH 4NIXA 2A7JA 5C0UA 4XSKU 3ZZ3A 1GL1A 1CGIE 3IWMA 2HLCA 1C5WB 2TGAA 3A80A 2G00A 1NFUA 5B6OA 1VKYA 1AZZA 2FWWA 2WUBA 2M2AA 3FOAA 1TPOA 1SGFG 4Y79A 4I8KA 3ATLA 3FP6E 4INHA 4MLFB 4XD7D 3M37A 5IK2D 3UR6A 3FKSD 1AUJA 4LOYH 1TX6A 4R8TB 5GXPA 5DP8A 3F9GA 2WHXA 1JWTA 1H1BA 2QYIA 4FXGH 4WXVA 2P8OB 5J4SA 2SGEE 2TGDA 3U98H 3RU4T 5EJLA 2Z3CA 2VVCA 5E0JA 1P2KA 4UFEH 3UY9A 2UWOA 2STAE 5EQQA 1S85A 4ZHLU 3EA7A 1ID5H 2RFKC 1SQAA 1QQUA 4WF8A 2RG3A 4DURA 1IQEA 1YPHC 1W12U 1GGDB 2FESH 2VWOA 3JZ1B 3NWUA 1HUTH 1XUHA 1V2NT 5JBAS 3GCTG 3HGPA 2R9PA 4AYYB 3A7TA 2FLBH 1HXFH 1VITH 3F9HA 1UVPA 2PSYA 1CSOE 1GCTC 3TH2H 1INCA 3BIVH 1D6RA 1ZMLA 3GYLB 4AB8A 1X7AC 1ZPCA 5EG4A 4RSPA 1LHEH 1WV7H 1PJPA 4X2YA 1Y3VA 1YCPH 4BXWA 1KSNA 3RXMA 2UUFB 2Z9KA 1NRQH 3A7XA 2FEQH 1ZSLA 1KXFA 1UCYH 1AD8H 3RXHA 4CRCA 2GX4A 1ZTKA 2HPQH 3S9CA 1NTPA 1SGYE 2ZDKA 2EA3A 3U8OH 5GDSH 2C93B 4JYVH 1YGCH 2ZDVH 1GDQA 1C5XB 2BQ7B 1LVBA 3IITA 1P9SA 5J4QA 2Y5HA 4B6EA 3MU4A 2BQWB 3UAIC 1CT0E 2QF0A 5FCKA 1H8DH 2GCHG 1TX8A 1EB1H 3NRLA 3KNXA 2QF5A 3RXLA 4NFFA 5CMXH 4AX9H 1SGTA 3ZYEA 2SGFE 1ESBA 2GZ8A 2IN2A 4BOHA 3A8CA 4IBLH 1FY1A 4B2CA 1S6HA 1DWEH 1EZQA 1OWKA 2FOBA 1T4VH 1O5EH 5EJZA 3FFGA 3HKJB 5T1VA 4X2XA 1CO7E 1VJ9U 1JOUB 1LVMA 2D1JA 1YWUA 5I25A 2ZTZA 1Y5BT 1BHXB 4NGAH 3ELAH 1DDJA 3KQDA 4K60A 3SV2H 1A5IA 1IQNA 2A7CA 1RS0A 2ZG0H 1V2RT 4FUEA 3GY6A 4Y7BA 5FBEA 2GMTB 1UVOA 2ASUB 1UO6A 1V2VT 4WMDA 5CHAC 3MWIU 2YNAA 4HTCH 5C3NA 1ELVA 2Q6FA 1UHBA 2UUJB 1LHDH 1BQYA 2ANKH 3E3TA 3A88A 1F0SA 3G01A 5EPNA 3RXEA 1SGNE 1DICA 3N7EA 1DY9A 3TK5A 4WMEA 4AYVB 2F9VA 2JH6D 4RT1A 1MTNB 4F4OC 1QTFA 3VPKA 2QXHA 3ZZAA 1P05A 4JK5A 4UFGH 4ABHA 3P8OA 4ISHH 2WYGA 1SB1H 3OY6U 1DUAA 3S0NA 4DGJA 2W5EA 4GHTA 1VCQA 2A32A 1TRMA 2JJ1D 2OUAA 1Z7KA 2B5TB 2C8XB 1G2MA 1AQ7A 1NM6A 2G5VA 2C8ZB 2Y80A 1RTLA 1GBMA 5JPMH 1YF4A 2GVFA 1CA0C 3PRBA 1K1OA 1HLTH 2PUQH 3LONA 1D6WA 3KEEA 4X2VA 5CHBA 1TGCA 2ZQ1A 1K1IA 2FDAA 4FU9A 5EQRA 2KX4A 1P2OA 5DKMA 3ZZ9A 1JMOH 1T32A 2GCTB 2Z9IA 1CHGA 3LC5A 4VGCC 1GWAA 3RXTA 3A83A 3AASA 1HNEE 2ZC9H 3M7QA 1K9OE 1OYQA 2VGCC 2CF9H 3AW0A 1ZHMA 1YCPM 1AY6H 4NA8A 4DJZB 4UONA 1PPFE 2BY5X 5LGOA 1WSSH 1TMBH 2K8IA 3ZVEA 4CBOA 2LP6A 3SN8A 2LPRA 4D9RA 1RFNA 5I46H 1P2IA 3ATKA 4AFSA 2PFEA 1ZTJA 2UWPA 2FI4E 4JYUH 1XXDA 4JZIA 2HRVA 3Q00A 2BD3A 3RC5A 3TJOA 2V3HH 1VCWA 1SQOA 2J95A 1WTHD 4NSYA 3LGUA 2WPHS 1UTNA 4GAWA 5EW2H 3MO6A 4O03A 1XX9A 3A7ZA 3KQEA 1SMFE 4X1PU 2ZFFH 4CRDA 2TPIZ 3KCGH 1QJ7B 1SLXB 4AZ2B 1GJ5H 1CQQA 3K6YA 2Z7FE 2IPHA 4F49A 1O3IA 2JETB 1YM0A 2V35A 3SV8A 4Y0ZE 2PTNA 1H8ED 4X6MA 3N99A 1ANDA 1EPTB 1TGSZ 2VWLA 5GJ4B 3BTFE 2OXSA 1ZMJA 1F5LA 3PYHA 2IJOB 2SNVA 5CDFE 2GZ7A 1A2CH 1P03A 3TH3H 1E37B 2ULLA 3STJA 2ZWLH 1ELTA 2I6QA 1Y5AT 2ZZUH 3P17H 3TJVA 3F68H 1C5SA 1J17T 1AVGH 1P04A 3A86A 2A2QH 3P8GA 3URCA 1DXWA 1G3CA 2FOHA 4YESB 1RXPA 1C2EA 1GJ4H 1YCPK 2PKSB 2YMSD 1CHOG 4Y76A 1Y3WA 4GCHF 2H9EH 4HG6A 4B75A 1LQDB 1SOZA 2ZHQH 1YPJH 3PO1C 5GCHG 3UNQA 4ISNA 3TK9A 2BMGB 2JJ2D 5A0BA 1AZ8A 1JIRA 1YP9A 1TRNA 3Q76A 3UB0A 1TPPA 5EPYA 1C2MA 1TALA 2ANMH 1HAHH 2Z9GA 4ESTE 3SO3A 4BAOB 4KGAA 5TCAA 3LH1A 1SGIB 1BA8B 1GGDC 2W26A 1ZOMA 3ZVGA 1LHGH 2JH0D 2ZGHA 3SQEE 3GS9A 1OS8A 5JBTA 1J14A 3M3SA 2J98B 3H7OA 1L1NA 1GMCG 2IJD1 3T27A 4FU7A 5FPTA 2AFQB 3CENA 4Q80A 3FVFB 3GISB 3SJ9A 2ZNKH 1Z8JB 2A0QB 4WMFA 5AFYH 3TPIZ 3GCHC 1GDNA 1MH0A 3ZZ4A 2L74A 2R0LA 3RXFA 3LGVA 1T4UH 2PLXA 1EASA 1KYNA 3NCLA 1V2PT 3C27B 5A0AE 1WU1A 2C8WB 3F2HA 3GOVB 4WH8A 5F53A 2BD9A 2FOAA 4FUJA 1TGTA 1A3EH 4KELA 1AB9B 1ELCA 4KKDA 4WH6A 4YXWD 2ZCKP 3E6PH 3S7KB 2HNTC 5HIYA 5FHTA 1TNGA 1C5VA 1RRKA 1HJAC 1N8OB 1C9PA 1F92A 1L4DA 3GDSA 2BB4A 1HAYB 2BD2A 1OKXA 4HZHA 3VGCB 2A7HA 1HAGE 5CHAB 2XYAA 1S0QA 1DFPA 1N6XA 1P2MA 4ZH8A 2FOMB 4CHAC 3ZZBA 1PPEE 2D8WA 2ZP0H 2SGAA 3FO8D 3E90B 2XXLA 3TJUA 3PO1B 1GMCF 4ZHAA 3DSPA 3RM2H 1FQ3A 3MU0A 3I77A 5F8XA 1E35B 1YPMH 1NRSH 4B71A 1XUFA 1E38B 1K22H 3ZZ6A 5AF9H 4JCNA 5DP5A 1AE8H 1AVWA 1A4WH 2P93A 2PV9B 4ABIA 4U01A 4MG3A 5EGMA 2C90B 1DY8A 1O5FH 4TY6A 1Z6EA 2Z6BD 4ZKOU 1P11E 2VVVA 1ZGIA 1QJ6B 4CHAB 5C0TA 3EGKH 2ZU4A 4X1SU 1F7ZA 2CK3D 3ATIA 5GPIB 2OINA 2EY4C 2ALVA 3FP8E 2GTBA 1O2RA 3SJKA 1F0UA 1TNHA 1JXPA 3QN7A 3MH5A 1S5SA 2XNDD 1YY3A 1SQRA 1WTGH 2FS9A 3MO9A 1KLIH 2H6MA 3A8BA 2QF3A 2ZQ2A 1O39A 3U8TH 2QC2A 1GBLA 1B7XB 2Y81A 1P01A 1A46H 2WPIS 4B2BA 3BTWE 2HVYB 2ODPA 3RLYH 4YOJA 4DIHH 2CJIA 4BAQB 3GY3A 3VEQB 1C5QA 1SGEE 3ZZ8A 5LH8A 2GT8A 3KQ5A 1Y3YA 1MAYA 1V2UT 8KME2 3FANA 1D4PB 1J9CH 1XKAC 2BD8A 3BTDE 1A5GH 3PTNA 2V7QD 3PWBA 1O5CB 2BOHB 4A7IB 1MTNC 2ZKSA 1W0JD 1C5TA 3QO6A 5DP3A 3RXGA 4A1VA 3S69A 4FOUC 1IHSH 3GYMA 1B5GH 1J16A 1DSUA 4VGCB 2HLDD 3SQHE 3WW7A 1OWDA 1DPOA 1BZXE 1PYTD 2BOKA 4Q63A 1EZXC 1RTFB 4R0IA 5A8XA 2XBXA 1ZLRA 2JKHA 3A81A 2J4IA 3PMJA 1F5RA 3SGAE 2HVXA 4I7YH 1BDAA 3SGBE 1ARBA 1OSSA 3N7OA 5E2PA 2Y7ZA 1FXYA 2ZFPH 1C2GA 1BTYA 1GVKB 3SNAA 4BTUB 1M9UA 2R2MB 1NU7B 1DWBH 2A4QA 4X8SH 1DSTA 1QY6A 3OYPA 1ESTA 3MH6A 1N1LA 5C94A 2RA0A 4D7GA 3UUZA 1DE7H 3MQKC 1ZHRA 2WV4A 2IPQX 1T8MA 1A3BH 1OYTH 1GVLA 1QRWA 2P94A 4THNH 2FZZA 2XOKD 2GD4B 1GBJA 2GDDA 4AB9A 5DPAA 3BV9B 4NIWA 2BDCA 2J5UA 2ODYB 3MH7A 1WBGB 4O3UA 3TJNA 5F03A 1CE5A 4D9QA 3RMMH 1UJ1A 2AS9A 2OD3B 4U32A 1GMDF 1V2OT 2VJ1A 1GDUA 4DVAU 1GVZA 2W6JD 1EFRD 4XBDA 3V3MA 1QZ8A 1O3BA 4ABJA 2QV1A 3E91A 1C2LA 3OEHD 3RU4E 4WJG2 2FO9A 2XC4A 1G3DA 2ZGJA 1PYTC 4DCDA 1BTXA 5TCCA 2VIOA 3SJ8A 2VH6A 1DLKB 3SI3H 3D23A 1HYLA 1TNLA 3VFEA 3B23B 4ZHMU 1GJ7B 2F83A 4AG2A 1P2QA 2DE9A 4X1NU 3LC3A 1C5ZB 4Q7YA 1G37A 4GCHG 1FY4A 2VWNA 4ZROA 1NBMD 1IQFA 3F0OA 3KL6A 1YYY1 5T6GA 7GCHG 2J34A 2FOGA 2XBWA 2PR3A 2FX4A 2G52A 4A1TA 4OS2A 4DT7B 1NT1A 3MTYA 3Q3XA 1BIOA 4MPVA 7KMEH 2XRCA 1JRTA 1VGCC 1VJAU 2D2DA 2J2UA 2LELA 1QL9A 4XBBA 3UNRA 3M5MA 1O3LA 4ACBA 4AFUA 5HXFA 3U1IB 3RMOH 2ZI2H 5FL7D 1ELGA 1LVOA 2SNWA 3RXAA 3SI4H 1B0FA 1EB2A 1ZR0A 2ZCLP 2KR7A 4K5ZA 4MVNA 1H8HD 2ESTE 2WV5A 1O5GH 2WPJS 3K9XB 4NWLA 2GJGA 2PW8H 1MU8B 1BHXF 2VNTA 4ABAA 4D76A 1UTMA 3M36A 1O2TA 2BVSH 1NU9A 1UVSH 1ANBA 4Q7XA 4RT0A 3TGKE 1GG6B 1W14U 4TT3D 3GY7A 4IC5A 1J15A 1KTTB 1LCYA 2OP9A 1ZPZA 3SBKA 1D3DB 1OHHD 1V2KT 2D26C 1O3JA 4UEHH 1YBWA 4Z6AH 3MH4A 2WUCA 2XW9A 1E79D 1SI5H 1QR3E 3GY2A 1MKXK 4BAKB 1KXAA 1BTPA 1L0ZA 3MMGA 2KCYA 1HAXB 2M5TA 4IGDA 1E0FD 1V2ST 1C2HA 4X6NA 3SU0A 1RD3B 3KQBA 4ZCNA 2LNCA 1TNKA 4ISOA 1P09A 1O33A 1GHXH 4B2AA 1EOLA 3R0FA 2BQ6B 7LPRA 3RC4A 6CHAC 3M5NA 6GCHF 5DSFA 1FONA 4FETA 1KDQA 2B7DH 5FX6A 3BTHE 1Y59T 4WXIA 3ZYDA 4KTUA 1SG8B 2PKSC 2FMJA 3LH3A 4Y8XA 2OBQA 4TSFD 5JBBS 3ZZ7A 5C17A 2HGTH 1Q2WA 1C4Y2 1LDTT 3I29A 4UD9H 3AW1A 5CE1A 1K1NA 1THPB 5KECA 3AAVA 4X8TH 1NFWA 1A0HB 1AIXH 2P3FH 3RP2A 3VG8A 1MD7A 1O30A 1TPSA 4NWKA 4GUXA 6LPRA 4XOJA 4AOQA 1XUIA 3P6ZB 1Z6JH 2Y82A 1NO9H 1FPCH 1EX3A 5ESBA 3K2UA 3BIUH 2AGGX 2ZHWH 3RXRA 2O8WA 1O32A 1H9HE 1FI8A 1C5PA 4Y6DA 3P8NA 1W7XH 1TX7A 1HB0B 4X8UH 5HYOA 5DP4A 2XC5A 1GHAF 2ZO3H 1AMHA 1SOTA 3S9BA 1A0LA 2ZPSA 5LPFA 1QL8A 3W95A 2KCAA 1GI1A 4Y7AA 3PWCA 1ANEA 1MU6B 2G81E 2IOTA 3HPTB 1GHYH 5EXMA 3RXSA 1QIXB 3QWCH 1W13U 1O3DA 3P92A 1NN6A 4WY3A 4ABGA 4X6PA 1DS2E 4FUHA 1C1RA 2UUYA 2BD4A 2PGQB 2HOBA 3HKIB 1COWD 1S0RA 2BDAA 1W8BH 2ZFQH 4XDEA 2TIOA 3OE7D 3STIA 2GV6A 1SLUB 4CRFA 2G4UA 1QB1A 1F0TA 2SGPE 1A61H 4BAMB 1FMGA 1OXGA 1G3BA 1UK3A 1NS3A 2F9UA 1C5YB 1U6QA 5F8TA 1GG6C 2JIZD 2C3SA 4TPYA 2Y5FA 3SJIA 3L33A 3SNBA 4B6FA 1PFXC 2A2XH 2G4TA 1XXFA 1Z1JA 1GJAB 1TMUH 1BTUA 3TGIE 1O31A 1Z1IA 2W7SA 1WOFA 2RA3A 2FLRH 1KXDA 1K1PA 1NPMA 5C5NA 1ZRKA 1O5BB 2WPMS 3EA8A 1LTOA 3RXBA 1GHBG 3MOCA 1KXEA 4BTTB 3H7TA 2EI8A 1GJ8B 5EJ1A 3EA9A 4X2WA 4ABDA 2BLOA 1YPKH 1C5MD 1O2WA 4B73A 1QBVH 2YOLA 1F5KU 3NKKA 4OM9A 1O3PB 1SVPA 2DE8A 1KIGH 1OWIA 2BDIA 1BTHH 1BRBE 2STBE 3V7TA 3GDUA 1Q3XA 1SGQE 3KYGA 1ABIH 5DN6D 1DOJA 1ZPBA 1SLWB 1TQ7B 2BXUH 4ACAA 1QA7A 1TPAE 2R0KA 1P12E 1MAXA 2FX6A 2ZGCA 5L2YH 3RUOA 2J97A 1O2XA 1G9IE 3CS0A 1P9UA 4ABBA 2HNTF 3SZNA 2FOFA 1V2JT 1NFXA 3MO3A 3OAAD 1P2JA 3JZ2B 2F9BH 1OP2A 2K0QA 2KZ4A 1OWHA 3OEED 1ORFA
chains in the Genus database with same CATH topology
2FPZA 3SU4A 4DW2U 4IW4E 4CBNA 1DUEA 4NZLA 1S84A 4O3TA 1SGFA 1C5UA 2BDYA 1C4U2 2A4RA 1THSH 3NXPA 3LGYA 2AEIH 5A2MH 4U30A 3OY5U 2AMDA 1AKSA 4XFQA 1T31A 4CR5A 3SUGA 2H9HA 8GCHF 1OPHB 2OC0A 2XNIA 3L3TA 1UTLM 2BDBA 2A5KA 1CBWB 4BNRA 3OU0A 1MQ6A 1TABE 1TBRH 2B8OH 3MFJA 4CR9A 2VVUA 3H5CB 1O2KA 1BBRK 2GDEH 5H4IB 1UTJA 1LKBA 1IQMA 1KTSB 1PPZA 5DJ7A 3V13A 5HM9A 1XUJA 2Z3DA 2ZEBA 4YZUA 1Y3XA 3QZRA 2BVRH 3O8CA 2R3UA 5E8EH 1ELAA 1W0ZU 3KF2A 4GLYA 3T26A 3T29A 5K7RA 2BM2A 3BEFB 1SGPE 3R3GB 2RCEA 2Z9JA 3A87A 2ZHFH 4XE4A 3TGJE 1QRXA 2NU0E 3QTVH 1O38A 1C2JA 3O8RA 3EQ0H 3M7UA 1ZJDA 2ZDMA 1O2ZA 5AVDA 3A7WA 3S7HB 1EAIA 1EAWA 1TNJA 2BD7A 4CREA 3NZIA 1GMHG 2A31A 2P16A 3MNXA 4GVUA 4CH2B 4ISIH 2P95A 1GBAA 1P06A 3QDZB 4I31A 3M5OA 2CHAB 2OQUA 4INKA 5L2ZH 6ESTA 4NZQA 4WWYA 4FU8A 2OBOA 3QGNB 3BTKE 1MBMA 1HAPH 2V6NA 1Y8TA 3VB3A 1C1QA 2H9TH 2VIDA 1TONA 3D62A 2VH0A 5EQSA 6GCHG 2Q6GA 2ZFSA 4ZAEA 1MTUA 2QY0B 3UR9A 2BY7X 1SLVB 1TGNA 1OP0A 4X1QU 1IHTH 2GGVB 1EPTC 3SUFA 1O2VA 1BBRH 1D3TB 1L4ZA 2JETC 3TLOA 5FBIA 1TNIA 3SNCA 3SV6A 3Q3YA 4D7FA 3RXUA 1YC0A 1GBFA 4A5TS 1P3CA 4YOGA 3V0XA 2H5DA 1S81A 1NRNH 2ZIQH 1BCUH 1HPGA 1H4WA 1A1RA 2PUXB 1ELEE 1ELBA 1O0DH 2BLWA 1BITA 1HAVB 3A8AA 5F8ZA 3A7YA 4UDWH 3SHCH 1WQVH 1V2MT 1PPGE 1XM1A 1Z8GA 4MPWA 1RGQA 4SGBE 4IC6A 3UQOA 1C2KA 1KLJH 1TAWA 1RIWC 3KN2A 3BF6H 4X6OA 1NROH 2ANYA 3PMHB 2VB0A 1GJBB 4I33A 2ZGBH 3A8DA 2PKAB 1FIWA 4ABEA 1C1VH 4Z0KA 1MKWH 3U1JB 3TK6A 3B8JA 1DANH 2EI6A 5A09A 1G2LA 2FS8A 4FUIA 4ZMAH 1MUEB 1Z71A 1T8OA 1SL3A 4NCYA 1C4V2 1EAXA 3LT3A 1AB9C 1MZDA 3DT0H 1BTZA 1ZMNA 3IG6B 4I8JA 4IS5A 1EKBB 4K8YA 4YLUA 1LVYA 3E8LA 2VIQA 1O3AA 2Z3EA 3P95A 2P59A 5LPRA 1UK2A 3VB4A 3RXCA 3GY5A 5IDKA 4RN6A 4JZDH 1SHYA 2BY6X 2AGEX 3M3TA 3GCNA 4OS5A 4X0WU 3T25A 2GCHF 3BSQA 4RKJB 1AHTH 1P02A 3D65E 1N6YA 2ALPA 3PTBA 3LGIA 1W10U 1O3MA 3MNSA 1GI4A 1GBIA 5T6DA 1LQEA 3P70B 2HNTE 3RXOA 5EXNA 4D8NA 5E2OA 1TIOA 1DITH 2J38A 1K28D 1EP5A 1GI3A 1KXCA 1UVUH 1QCPA 1VGCB 1Y5UT 3RXDA 1AWHB 1HDTH 1BUIA 3MI4A 1BMMH 1V2TT 1YKTA 4IMZA 4J2YB 3T5FH 1CT4E 2H5CA 4X8VH 3RLWH 1FY5A 3RMNH 9ESTA 1DVAH 1GHZA 1TBZH 4YOIA 3UREA 1GBKA 1FNIA 1O2SA 4NIYA 1SHHB 3GDVA 2VWMA 1GBHA 3O8DA 1EQ9A 4I8LA 1K1LA 3VB6A 1O3NA 1TFXA 4Y0YE 4AGJA 3RMLH 3PMBB 2NU2E 4YM9A 1YPEH 2V0BA 1PPHE 2FTLE 3BTME 3DD2H 3NPSA 1TBQH 1BBRE 1GI9B 4AFQA 2F3CE 3DFJA 1LHCH 1LMWB 2FYQA 5L6NH 1C1MA 2H1UA 2OC1A 4ASHA 3TVJB 3ENSB 2NU1E 1UMAH 1O2OA 4J1YA 1UTQA 1PPCE 2ZHDA 4LXBH 2QN5T 2XBYA 3VXEH 2ZTXA 2QA9E 1OWJA 5G4BA 1VITF 4OS6A 4SGAE 1FLEE 1P8VC 1CHOF 1PQ7A 2BXTH 2G8TA 2O8TA 1DM4B 5JBCS 3E0NB 2GV7A 1O2HA 2ZU2A 4K8BA 2ZECA 5GIBA 2G51A 2CXVA 1S82A 1UTPA 2G55A 5C1YA 1MTVA 4JYTA 3TNTA 3AAUA 2OTVA 3PLKA 1RTKA 1P0SH 4GPGA 1AFQC 1TRYA 1L1GA 2W3IA 1S83A 2QGRA 5BPEA 1W0YH 1AFQB 1GMDG 3RDZA 1V3XA 1MMJN 1AO5A 1WQSA 3BTEE 1CGJE 2V3OH 4OGXA 2PSXA 1GI8B 4ZXYH 1BOQA 1ZRBA 1ZGVA 1A0JA 3SW2B 3VXFH 2ZDAH 1DWDH 2EC9H 1GI0A 4A1XA 4A92A 5EXLA 2Y5GA 3MNCA 1O2LA 3WY8A 1NY22 2ZDLA 5DK1A 4Y8ZA 3QGJA 4CRGA 3SU3A 5AHGH 3ZV9A 2K1QA 5DP6A 3U8RH 1ZZZA 4K2YA 3DUXH 1A5HA 1BRCE 3ZVBA 3F9FA 1TYNA 3PLPA 1ZYOA 1ETRH 3DA9B 3KGPA 3QTOH 3BTGE 1EZSC 1O2UA 2BZAA 1AI8H 2NWNA 2WYJA 1EZUC 3GCTF 4RKOB 4ZKRU 2SGDE 2BZ6H 2R2WU 3M7TA 3K65B 3SUDA 4CRAA 4LZ1H 5C1UA 2Q6DA 3ESTA 3BN9A 2BLVA 3PLBA 1LKAA 3A85A 1F0RA 3A7VA 3LGTA 1IQKA 1LO6A 1YPGH 3BTQE 1O2NA 3BG4B 4AFZA 4BXSA 2H2ZA 1QFKH 1W7GH 2BHGA 1MKWK 3ATMA 1V2LT 1AVXA 2AMQA 2NU4E 4E7RG 8LPRA 3ZVCA 3EE0B 3NK8A 1ACBE 1LPKB 1DT2A 4MDSA 4NA7A 3RXIA 2J94A 1C1NA 1FPHH 1FV9A 3UOPA 4NA9H 4YT7H 2A1DB 4H6SB 1QBOA 2RDLA 2AMPA 1AFEH 3LOXA 3Q3KA 2FYRA 3K6ZA 3A82A 5GCHF 1NRPH 4FUBA 5SGAE 4NG9H 5EODA 1VZQH 2O8MA 1LHFH 4MNXA 1QL7A 3M61U 1ZTLA 1C1UH 1LPGB 1ZSKA 3KQCA 1BJUA 3FZZA 3A89A 3UQVA 2CMYA 3SU6A 3OSYA 3FP7E 1YPLH 3LKWA 3F6UH 1O2GH 3UNSA 1ARCA 1GCDA 1IAUA 2B9LA 2R3YA 1O3KA 1BJVA 4UFDH 1FIZA 1MZAA 4TWWA 4ZKNU 1D9IA 3A84A 1HJ9A 1P57B 4K1TA 5LPEA 3TU7H 2HALA 1MCTA 1HJAB 1N8OC 1QNJA 3E1XB 2Q1JA 2UUKB 1IQGA 3ZZDA 4FUDA 1L2EA 1GJ9B 3RC6A 1C1SA 3EDXB 4O97A 1PQAA 2ZTYA 2ZHEH 1CA0B 8ESTE 1O2YA 1YLDA 1FAXA 2FP7B 1MTWA 4DY7B 1BMNH 4MPXA 1O5DH 1Z8IB 3GCHB 5C1XA 2QCYA 1EP6A 1BB0B 1EXFA 1Z8RA 2VU8E 1IQJA 1O2PA 4YT6H 7ESTE 2F9OA 3GY4A 4NIVA 2OC7A 4UE7H 5HM2A 1HRTH 3U69H 1V2QT 1O3EA 2JH5D 2YNBA 1O35A 2KAIB 2BX4A 4AGKA 1FN8A 1SGDE 2B0FA 2CN0H 5DP7A 1IQIA 3EAJA 1RJXB 5FPYA 4BTIB 1FAKH 2WPKS 4M7GA 2SGQE 3SU5A 1V2WT 2BLQA 4E06H 1HIAA 1C9TA 3ODFA 3UWJH 2CV3A 1FZZA 2VIVA 2WPLS 1UTKA 4INLA 2CGAA 1HAIH 3RXVA 1SGRE 2O9QA 4MNYA 2FXRA 4CH8B 2TBSA 1FUJA 3E16B 1EOJA 1ABJH 2ZA5A 3RM0H 4I8GA 3T62A 4JZ1A 5DG6A 4I8HA 2HPPH 2W3KA 3BG8A 4ZUHA 1ESAA 1C2FA 3BG4C 1P2NA 2FODA 1MQ5A 1GBTA 1EUFA 1CVWH 4IMQA 1GBDA 4JK6A 1KXBA 3SV7A 3SNDA 1AN1E 1HAOH 1JRSA 1FY3A 1TWXB 4TPIZ 1EATA 2XWBI 4FUGA 4TYDA 1G36A 1XMNB 2ZF0H 2CHAC 3M3VA 3OX7U 3ZVDA 1C5RA 1GJ6A 4MQAA 1GBCA 2XTTB 3CP7A 3QLPH 1GJDB 1WUNH 1IOEA 1K1JA 1SPJA 1NFYA 1PPBH 1DX5M 1YPHE 4OS1A 1HJ8A 1O34A 2ODQA 3RXQA 4I32A 4KTSA 4CRBA 3HGNA 1NRRH 4UFFH 2BX3A 1VITG 1T8LA 4XBCA 5EU8A 4KTCA 2SFAA 2ZU3A 1W2KH 2GKVE 1QJ1B 4LK4A 1UCYE 2TRMA 4HI3A 1VCPA 2TGTA 3RXKA 3ZZ5A 1HFDA 1O5AB 4O9VA 3BEIB 1GI7B 2Y6TA 4AG1A 1TGBA 3SU2A 1JBUH 3UIRA 3QZQA 1V6DA 4TWYA 2A4OA 3UTUH 5E0HA 4B1TA 5C67A 1GHWH 3I78A 3M5LA 4JZFH 1EPTA 4Y71A 5HGGA 1C1PA 2PWXA 5A8YA 1OWEA 1AU8A 4FUFA 2ZFTA 2BVXH 1O3CA 4NSVA 1SFIA 2AIQA 5FAHA 1KY9A 4IN2A 4OGYA 1BMAA 3BEUA 5FCRA 5IYTA 1C1WH 1IQLA 5AFZH 1WCZA 2GCTC 2F91A 3TNSA 1C2IA 4YLQH 2W7UA 2EEKA 5GWZA 4Y8YA 2FIRH 2A45B 2PKAA 1SSXA 1HXEH 1C2DA 1C1TA 4NFEA 2VIWA 4DOQA 1NESE 4GSOA 3V12A 5BRRE 1W11U 4A6LA 2QXJA 4AORA 2C8YB 3ZVFA 3QX5H 1SC8U 3AVZA 2F9PA 4MNWA 8GCHG 5JDUB 2ZPQA 3SV9A 2TGPZ 4MNVA 1RIWB 2DUCA 3SU1A 5HMAA 2FOEA 2O8LA 5C20A 1SFQB 3UPEA 3UFAA 2ZGXH 4ISLA 3ODDA 2Z9LA 1PQ8A 3F1SB 5E0GA 3BTTE 5T6FA 1D3QB 1GI2A 1DWCH 1TE0A 4GHQA 1UVTH 2OQ5A 3QK1A 1HIAB 1QQ4A 2OCVB 3HATH 4FVDA 1XUGA 4MTBA 2BD5A 1SGCA 3GY8A 4X1RU 2GP9B 2GMTC 1OX1A 1O2QA 3O8BA 4HFPB 3TITA 2BDGA 1MCVA 2A5IA 2P3UB 1QGFA 4ABFA 4IN1A 5EOKA 7GCHF 3RXPA 1T7CA 1OOKB 1C1OA 4OS7A 1MD8A 2P3TB 1H9IE 3E0PB 2VIPA 3PM3A 1UHBB 4WVPE 3SJOA 1GJCB 3SORA 4B74A 1QRZA 2EI7A 5ETXA 2BY9X 1CBWC 1HAVA 5PTPA 2J9NA 4BANB 4K1EA 2QAAA 4Q2KA 1UK4A 2BDHA 3LJOA 3FAOA 3MU8A 1ZJKA 1XVOA 4K69A 1QB6A 1EJMA 4KP0A 3S9AA 5JB8S 2XBVA 3D49H 3L6PA 3MU1A 1HGTH 1GHVH 4TY7A 1Q31A 1TB6H 2AGIX 4OS4A 2BTCE 3CS7A 2XWAA 1GI5A 1O36A 1GBEA 1PQ5A 1O3FA 3FZDA 4HGCA 4YTAA 5T3HA 2ILNA 3SUEA 2VINA 5ESTE 2ZPRA 1BTWA 3DFLA 4H42U 3SOSA 1D3PB 3SHAH 1C5LH 1O3HA 1OP8A 1MKXH 2A4GA 3VGCC 2THFB 1CU1A 2FI3E 2FI5E 3SNEA 1K21H 1LPZB 1ZSJA 2GZ9A 3PMAB 1FDPA 3TIUA 1AGJA 2A5AA 4LZ4B 3OTJE 1KDQB 1SBWA 1DXPA 2AYWA 2ANWA 5TJXA 3ITIA 3KHVA 5JYIA 2F9NA 1GPZA 2BYAX 2Z94A 4ZKSU 2AH4X 3ZZCA 1O2IA 4Y10E 3VB7A 2CF8H 4E05H 3PV4A 2O8UA 1ELDE 2I6SA 2OLGA 3GICB 1AKSB 5FX5A 5FPSA 1NZQH 1H9LB 1HBTH 3PB1E 1XVMA 1HV7A 4AN7A 5A8ZA 1MTSA 3UOUA 3SGQE 1YLCA 2FM2A 1QHRB 1O3OA 5EW1H 1Y3UA 2ZCHP 1DLEA 1E34B 4K1SA 5DO4H 3LPRA 4DIIH 6CHAB 4FVBA 4Q7ZA 3UWIA 3HK6B 1XUKA 4MPUA 1CT2E 1TMTH 1K2I1 1AUTC 1O2JA 3PROA 5A0CA 1B0EA 1S6FA 3HK3B 4B76A 2ZU1A 1HCGA 4ZXXH 3M35A 3GCOA 1EJAA 2OC8A 1SR5C 1AE5A 1QBNA 1UCYK 1GHAG 1W3CA 2XC0A 1GI6A 3ZV8A 3QUMP 1ANCA 3Q77A 1AWFH 2NU3E 3LJJA 2AERH 1G3EA 1EAUA 1GCTB 5C5OA 1L1JA 1ELFA 2XCNA 1TOCB 1UTOA 3LU9B 3TH4H 2ZU5A 1JIMA 1QURH 2Y7XA 3URDA 4QT8C 1J8AA 1QB9A 1SQTA 3LDXH 3P8FA 4YO9A 1O2MA 1O37A 1IQHA 1C5NH 2FOCA 2PGBB 3RXJA 1TLDA 4BAHB 3KIDU 5DP9A 9LPRA 4K3JA 2HWLB 1GL0E 2C4FH 3ATWA 3T28A 1VR1H 2XCFA 1H8IH 4H4FA 1G32B 1QA0A 4Y11E 4PROA 5K0HA 3VB5A 1FJSA 2AIPA 3NUMA 1TQ0B 3MYWA 2P8OC 1K1MA 5FXLA 1NC6A 3MHWU 2FTMA 3T2NA 2QIQA 1BRUP 1CGHA 3LGWA 3LIWA 1O3GA 3RU4D 4JZEH 5L30H 1P3EA 2PHBA 1KLTA 3C1KA 3W94A 2KAIA 1CA8B 1ETTH 1ETSH 1WAYB 1GBBA 2QXGA 3MU5A 1MBQA 2BY8X 1E36B 2J92A 4H6TA 3EYDA 2QXIA 1F2SE 1C5OH 2PTCE 1ZHPA 3U9AH 1XKBC