1CAUA

Determination of three crystal structures of canavalin by molecular replacement
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
AQNNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CANAVALIN
publication title Determination of three crystal structures of canavalin by molecular replacement.
pubmed doi rcsb
source organism Canavalia ensiformis
molecule tags Seed storage protein
total genus 37
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cauA00
4XFHA 5I8SA 3RNSA 5J48A 4KWJA 3HT2A 4EWDA 2GH2A 3QACA 1EY2A 4LLOA 2IXLA 1O3TA 3OD0A 1ZZ9A 4HLTA 1DZTA 4UBHA 1IPJA 4EROA 5KHGA 2QCSB 3H3UA 4XFAA 3H3ZA 3N4MA 3I59B 3DKWA 3PVBB 4Z07A 1VR3A 3USSA 5I8YA 1SFNA 4YSFA 3CO2A 1EYBA 2UY8A 3E97A 4MV2A 2D93A 1LB2A 3B02A 3DV8A 4AVBA 3HIFA 3FX3A 2EVXA 5I0RA 1NYWA 2ZCWA 4X6QB 3IDCB 5FDBA 5F1RA 5KBFA 4WVZA 3D0JA 1CAXA 4JTNA 2QVSB 4I3PA 5EFUA 1CAWA 2Q1ZB 2PHDA 3D82A 2PYTA 2Q4SA 3MZHA 5I0TA 4QGMA 3H1MA 3OGJA 4L2NA 3BCWA 3VHRA 4MGYE 4B29A 3LA2A 4EV0A 3QOPA 3E5UA 1VJ2A 4E2SA 1LRHA 2K9ZA 1U12A 5BY5A 1O5LA 4YARA 4XF4A 2GC2A 3H9AA 2PAKA 4IEXA 5JSOA 3MYXA 1J1LA 1ZZBA 1J3PA 4QGNA 3E5QA 1ZZ7A 2CGPA 4HVRA 1UIJA 3FHIB 5FPZA 5JSRA 4BIFA 3OTFA 4KU7A 1H1IA 4HMZA 2XGXA 5BV6A 2DCTA 2KXLA 3E6CC 1O7FA 3NW4A 3O14A 4FBFA 5J3UA 5I0UA 4LTAA 2IXIA 4MZUA 4LUMA 3CL1A 5FLIA 5JR7B 3CEWA 1YHFA 4YYOA 1ZZ6A 2OZJA 3ACLA 4N9HA 2WFPA 5C8WA 4KWKA 5LEJA 3CJXA 1EP0A 3BALA 1CAXB 2I45A 4IEUA 4PIXA 1OFNA 3EBRA 1QY4A 3EO6A 1CAWB 1DZRA 3SCHA 4F8AA 3I7DA 2HKXA 4QX5A 2ATFA 3E5XA 1O3RA 4L11A 3KSCA 4LEJA 3U11A 2Q0AA 5I0SA 2PQQA 2IXHA 4XF1A 3RYRA 3SHRA 5LRRA 5LEKA 1RUNA 3DN7A 3GYDA 4HSJA 3ROUA 4AVCA 1EPZA 3SCGA 3C3VA 3LA7A 4XF3A 3IIAA 3ES1A 2VQAA 1TQ5A 4QM8A 1ZREA 4OLLA 2MNGA 4EWAA 4QGLA 5AVPA 2BEOA 5C6CA 1NE4A 4O9GA 1J3QA 3M70A 4HVQA 5JAXA 4Q0QA 4IEYA 2MHFA 3TNPB 4F7ZA 3UKNA 2QJVA 1X7NA 4JTOA 3RPQA 2XHKA 2GC0A 4MH0E 3S7IA 4P9GA 4E2GA 5KHIA 1O5UA 2PAEA 4MX3A 1CAUA 1QWRA 5JCTA 4HZFA 4IEWA 2PFWA 2BYVE 3WW1A 3U0ZA 1UW8A 3S0MA 1RTVA 2OA2A 1YLLA 1CAVA 1XE8A 4XFBA 2XLGA 5BUVA 1DGRA 2PHLA 3SCFA 4IEPA 1L3JA 2UYAA 4ZU7A 3SXWA 4DINB 2VECA 1Q3EA 4KU8A 3ELNA 3CF6E 4I0BA 1SQ4A 3RDIA 3D0SA 2K0GA 4XF0A 4FAGA 2GU9A 1LKNA 4R8HA 1FT9A 3I54A 1X82A 3LWCA 2ET7A 1SEFA 2GC1A 2WC2A 3BU7A 1GQGA 3NL1A 3ETQA 2XL7A 4MUVA 2FQPA 2Q30A 4PJYA 3E6DA 3WW2A 1OMIA 3FWEA 4OFGA 4QM9A 4YNIA 2D5HA 1PM7A 4YRDA 4HVOA 4R52A 5I8TA 1ZRDA 1Q5OA 1RL3A 5FQ0A 2H6CA 2ET1A 3OF1A 2B5HA 3H7JA 4XFGA 3I59A 3MDPA 3IWZA 2CAVA 5KHHA 1I5ZA 3FE5A 3FFQA 2CAUA 4UBGA 4UXAA 2EAAA 3CLPA 4I0AA 4Q0VA 2Z69A 1NZCA 4LUKA 4KL1A 1WLTA 4Q0SA 3NJZA 2H6BA 5D1IA 1CAUB 4Q0PA 1VP6A 1YFXA 5CVRA 4K8FA 1G6NA 4QMAA 3H7YA 2XLAA 5HI0A 3H1YA 1CAVB 4EWEA 4I02A 3ST7A 3IDBB 2Y0OA 1RC6A 4X6RB 1J59A 3R6SA 1UIKA 4XEZA 1X8EA 3BPZA 1ZNPA 4IEQA 5E1RA 1NXMA 3UKTA 3WW4A 3S7EA 3WW3A 2VPVA 3JZVA 3TNQA 2MPFA 4HBNA 1O3SA 4IESA 1UD1A 4HSLA 1Y9QA 2ETEA 2GZWA 2BNOA 1O3QA 2P17A 1YWKA 2BNMA 3U10A 4HN0A 2Z2SB 4WZCA 2OYZA 2IC1A 4MGIE 3UKVA 2XKOA 4N9IA 1O4TA 4BHPA 3G7DA 5LRSA 1QXRA 2D40A 4GULA 2UY9A 5FQ0B 3EQEA 3E6BA 4LULA 1J3RA 4Q0UA 1GQHA 2IXKA 3KGZA 4I2OA 1CX4A 2OPKA 4ORFA 1LR5A 2XKPA 2OZ6A 3NKTA 4PIYA 3L2HA 4E2QA 4JVAA 5CU1A 5CADA 2B8MA 4IEZA 1WGPA 1DGWA 5BXXA 2GC3A 3PNAA 4IEOA 4KWLA 5FLJA 1ZZ8A 3FJSA 4I01A 4WBBA 3PLQA 5E16A 5FCCA 4D7TA 3FZ3A 2IXCA 3KCCA 3NSTA 1ZVFA 2E9QA 3LZZA 2H0VA 1FXZA 4J1XA 5JSPA 1HW5A 4CYDA 4J1WA 4NVPA 3ZDSA 1V70A 4META 4IETA 4LA3A 1ZRRA 4O9EA 4XFFA 1RGSA 4BH9A 4MGKE 4A2UA 4H7LA 4JV4A 2UYBA 4AVAA 2QDRA 4Q29A 5EZWA 4XETA 4AQ6A 5K8SA 3EJKA 3SMHA 2N7GA 3MPBA 2PTMA 3BB6A 1YFWA 4ONUA 2PA7A 1Y3TA 2CV6A 2BNNA 1UPIA 3M3IA 5J7MA 2FMYA 2F4PA 3RYPA 3EHKA 2HJIA 2GAUA 3H8UA 5I91A 5KHJA 2PAMA 4AQ2A 1ZX5A 4XFIA 3GBFA 4D7SA 1J58A 1I6XA 4RD7A 2QNKA 4TLFA 1OD5A 4FT8A 5BPXA 3RYKA 4BYYA 1FI2A 3KMHA 4ZU4A 2C0ZA 4MGZE 1RUOA 3LA3A 3RZZA 2XLFA 3ES4A 4FAHA 1XRUA 2ZKLA 4AXOA 5KHKA 4IEVA 4ZU5A 1NE6A 1YFUA 4Z82A 5I93A 2EA7A 2O1QA 1CGPA 4LA2A 1WA4A 3LOIA 5FPXA 2XL9A 3H1WA 1X8MA 2V09A 3HQXA 4XF9A 1PMIA 3NVCA 3KGLA 3OCPA 1ZRCA 3LAGA 1YFYA 2D5FA 1ZRFA 3H50A 5T3NA 1Q43A 4PIZA 1UCXA 2BGCA 4I09A 1ZZCA 3DL3A 1OI6A 2O8QA 2B9UA 1XE7A 1QXJA 1YUDA 4XFCA 4HN1A 1IPKA 1H1MA 5FLHA 3HT1A 2IXJA 4IERA 4QXKA 1JUHA 3IBMA
chains in the Genus database with same CATH superfamily
5DMYA 2JE7A 2RR12 4QX2A 5KXEA 3MFAA 3ZSLA 3RNSA 1R091 4W50A 1R64A 1TZOA 4MYEA 2Y6KA 2WS92 1RUJ2 4L97A 1L7RA 1W6NA 1UNBA 1ONAA 1W8WA 5FZDA 5IJRA 2JD9A 2WO7A 5A7SA 4B8EA 1FV3A 1H6YA 1RUC3 2IXLA 2CHHA 3HAGA 1PMHX 5F39A 5FZOA 3AKRA 3OD0A 4M0HA 4HLTA 4RR3C 1DZTA 4UBHA 2Q8DA 4LO7A 1EPWA 1WBFA 4EROA 5C3RA 1NCRA 5KHGA 4XFAA 3VBOC 2XH6A 1V6KA 3H3ZA 4DEQA 3N4MA 1TG7A 1RUI3 1OPOA 3ZX7A 3ZIWA 2VMEA 3KF5A 1DLLA 2ES3A 2W0XA 2RJ2A 1SFNA 4EN6B 3AXEA 2BOIA 1QDOA 3CO2A 2UY8A 5A1LA 2A1XA 2JDKA 1SCRA 2D93A 4G3YC 4YW6A 4BLIA 4XYXA 2C9KA 3LDKA 4BXSV 4ET7A 3INAA 5A6YA 1S2KA 3AP4A 4W4ZA 3SC7X 3CZUA 3FX3A 4XZPA 3I4IA 3PUHA 3IDCB 1SBEA 5DUUA 3T4HB 1XNKA 3WNOA 4AZZA 2J22A 2AACA 2FDJA 4GWMA 3WINE 4AFBA 5C9AA 3OPTA 4CCOA 1LHNA 1CQ9A 4DRRA 1CAWA 5T54A 4OHZA 2Q1ZB 4AWDA 1S0BA 4M3CA 1UY3A 4D6RA 5IVJA 1V0AA 2A6ZA 5I0TA 5JPMB 4E4ZA 3CBNA 3H1MA 5FBJA 4L2NA 4W6XA 5GM0A 3VHRA 1BHGA 2AENA 3EB7A 3BU0A 2RS51 4QDSA 1LRHA 1NG0A 2K9ZA 3P3NA 4EN0A 2QTWB 5CFDC 4YW5A 4K40A 4XF4A 2GC2A 1RVF3 3H9AA 2PAKA 3N9NA 1C5HA 3J7NA 3RI8A 5GZFA 4FSJA 1J1LA 3I2FA 1TME3 2EIDA 5LASA 2XVGA 5DZFA 5ISLA 1D4VB 1J3PA 1NAEA 5LK7B 1HRV1 3K46A 3LFMA 3N9QA 3ACFA 2D6MA 4D6SA 3M2MA 5F8PA 3T0BA 2Y33A 3TN91 1NLSA 1COV2 1DQ1A 4Q4W3 1SPPB 5EWSA 4KU7A 2A3XA 2CDOA 1V6MA 4XUNA 3WR0A 1QEXA 4FPHA 4HOOA 3K4AA 1H1IA 2QQNA 3LQCA 2XGXA 5F5CA 4NIAA 3ZYIB 1UYXA 4PQQA 4Y1XA 1QQP3 3UGFA 5LA0A 2AEYA 3DEMA 3VL8A 3MFCA 4RL7A 5IK7A 4RQPA 5IAVA 2C6SA 3GBGA 3NW4A 3M1HA 3JQWA 1LNSA 2P6HA 1OLME 4P5YA 4UI9L 4CCLA 3KV9A 4M4PA 2DTYA 4KGGA 2ZX3A 2QE3A 4XCBA 1O8PA 2IXIA 1GWKA 4MZUA 3OYWA 2QQOA 5C3OA 1RUF3 1S2EA 3VDAA 5IATA 1FV2A 4IV1C 2WNUA 2WINB 2JXAA 4DIQA 2A5ZA 3R0RA 3CEWA 1YHFA 1MS9A 1NUKA 2R073 5FUPA 4XDPA 4YZ5A 1IQDC 1ND2C 2AREA 4QB6A 4B1MA 4Z2WA 2K2SA 2P37A 5FYHA 5IVFA 1NY71 4AAPA 2OZJA 2JB8A 3ACLA 3C7EA 5E6HA 1HDKA 1L7LA 1LOCA 2WFPA 5FYMA 1YNAA 1DP0A 5LEJA 4C91A 4YGBA 3CJXA 3BTAA 4Y33A 1N3PA 2VMCA 4Z2AA 4LO6B 3GXUA 2I45A 3VZLA 3IPVB 3EO6A 1QY4A 2R6QA 4CDUC 3NAPB 3QH6A 3ETPA 3KT7A 5AC93 5IAXA 4F8AA 1AR83 5JWPA 5A3LA 2HKXA 1G9BA 4QX5A 5EHDA 2J42A 4P08A 3K48A 2Q0AA 1XOYA 4AGGA 4XIKA 3TOJA 2FDHA 2ADDA 2IXHA 4XF1A 3TB0A 3VBHB 3WD5A 3THCA 5I0RA 3W59A 3V64A 4WM7C 3M3EA 1UY2A 4QPIB 1EPZA 2HWE2 2XG3A 1OLQA 3HNYM 3K3NA 3C3VA 4AI8A 4CEWA 4OVEA 4FP3A 2W91A 5GZGA 4XF3A 4Q8KA 1XPWA 1NLQA 2WA4A 2VQAA 1TQ5A 1OBNA 1V6JA 2HWD1 1K5JA 5DAQA 1XSRA 2R32A 3PURA 3WNLA 2PXJA 1OOPB 3PVOA 3PJYA 5C6CA 2RS31 1PIV3 4O9GA 4HVQA 1GNYA 2E7AA 1ZRIA 2CGOA 5FZBA 4KBBA 3V0BB 4QPGC 4DO0A 2OKXA 4U2AA 4LBJA 2YDEA 3ZVXA 1BXHA 4BQ5A 5BNOA 3T08A 4Q4W1 1X7NA 4YM2A 4RR3B 3V65A 3KZ4C 3GJBA 2UWAA 3FLPA 1YYNA 4JTOA 2LROA 3HBKA 1HN1A 1RUG3 2XHKA 3VBOB 3VDCA 3POGA 2WQ8A 3MLJA 1JZ7A 5IHRA 4D7YA 1GKBA 2BOJA 4YFWA 5A1FA 3WP3A 4BQWA 4OMDA 4KQ7A 2HWF3 5JCTA 4E9KA 1ZBA2 1UW8A 2YPJA 4Y5SA 3ALQA 1CAVA 4QAWA 2XBO3 1VBA3 2XLGA 1GQPA 1A6CA 2PHLA 4IEPA 1FAYA 4IE0A 4AEDA 1RUF1 1YO8A 2BDRA 2UYAA 5C4WC 4M0NA 2VC9A 1J83A 1Y43B 4R9CA 3A0KA 2VUJA 5JDBA 5JZGA 3QD6A 1YQCA 4X8NA 3ELNA 4I0BA 3ZXFA 3RDIA 3OBRA 3HVDA 1S2BA 1RUE2 4FPKA 4DNYA 3GHNA 4DPNA 1FOD3 1RITA 2Q8OA 5F7UA 4LHKA 2X5IA 1BBT3 4YW1A 1X82A 1MS5A 1QJU3 1OSGA 1GQGA 3FLRA 2JX9A 1ASJ1 5FWJA 5CFDB 4XTMA 4YVSA 5C5TA 3AFGA 3FHAA 3NL1A 2WO2A 1DYOA 4MUVA 2Q30A 4XUPA 3J9SA 5ANQA 4GMP3 1EV13 3FWEA 4JQRA 1O6UA 2F17A 4YNIA 2AC1A 2RG4A 1JYTA 5EP9A 2BVVA 4NHLA 3I49A 3ZR6A 4HVOA 1RUD1 4RHV1 5FZIA 5I8TA 5JLVA 3AX4A 3WDVA 2W2IA 1DF0A 5LY2A 2HBTA 3E1F1 1B35C 5BNPA 1W6OA 1LAJA 4C0BA 3SQOA 4CCCA 2B5HA 3H7JA 3OSDA 2SBAA 2OIIA 4DXTA 2WNVC 2YMZA 1V9U1 1SMVA 1W6MA 4JDOA 4DUWA 1T6GC 4UBGA 3H3LA 4UXAA 1UN1A 5FY9A 2EAAA 4PHZA 3VBRB 1DQ2A 2GMMA 1JU3A 2VOWA 1W2OA 3TAYA 5B2GB 3T0DA 1JODA 1X9PA 2DFCA 5GZDA 4NIDA 2DCKA 3UJOA 2H6BA 4ASLA 4NIGA 1VP6A 4TYSA 2VGDA 1YFXA 4MSVA 2MEV2 3MUZ1 4FP2A 4IV1B 2P2KA 4NWWA 4ZHNA 3J8F3 4K8FA 4RN5A 2XLAA 4K8RB 1C8M3 1H2NA 3RJ2X 2HWC1 3H1YA 4K1YA 4WZFA 3VD4A 2VNRA 3PHMA 4LKDA 3ZFEC 4CSWA 5JR2A 2ZMLA 5FYUA 3BYWA 3O7OA 2FDFA 4Y22A 1VBC1 4AYUA 2YC0A 2WLQA 3ZR5A 4Y20A 1M06G 3UYJA 5FXWA 3IN9A 2P3IA 1J59A 4XEZA 1X8EA 4B3NA 1YJKA 4PDWA 4CDUB 2DVFA 5HV4A 4OI0A 2P3YA 3I3QA 4COUA 1Q8SA 3WW4A 3UKTA 1AXYA 1E5RA 3S7EA 5ERLA 1J1TA 5A7NA 4AVVA 3C2UA 1CZTA 4Y4RA 5L73A 4Q26A 3FUOA 1UD1A 3OY8B 4GQ7A 4WM7B 4MVTA 1DLCA 2GZWA 3V0AA 2P17A 1D7PM 5T52A 2Z5WA 3P1IA 1POV3 4A3ZA 1IS5A 2AR6A 4IDZA 5FTTC 4HN0A 1FNYA 2Y6JA 1OT5A 2IC1A 1VLNA 3OEAA 4OUEA 3KB5A 2W68A 3T09A 3ZXDA 4DQAA 1XU2A 3AKQA 4BQYA 2DVAA 1QXRA 1A3KA 2C5DA 1RVF2 1AR71 1KJRA 2F6BA 3RZLA 3IM0A 3VB9A 3ZKYA 5FZ1A 4XPVA 5A7PA 3JQXA 5HV0A 1TME2 1WW7A 2A70A 4AGVA 1GQHA 3DECA 1UZ0A 3GZEA 3KGZA 3FUQA 4I2OA 1C5IA 2EXHA 2R063 4TSVA 4ZY9A 5KXDA 3QLQA 5KXCA 5HPOA 4D3WA 3P5BA 3U07A 4WVMA 1JYWA 4LBOA 4ZZ5A 5EYXA 3A22A 4FPGA 1RUJ3 4R9AA 4EJRA 2A71A 2FZ2A 3QH7A 3LIGA 1MACA 5T50A 3ILFA 2XJTA 1QQP2 4KWLA 1H4HA 3I2GA 4EN9B 3N9MA 4FQ4A 3HR9A 4DZGA 1KD7A 1E5HA 4GKYA 4LKSA 2RS13 4PCRA 2XUMA 5FXVA 4WBBA 4CVUA 4CA9A 5F3IA 1FMD1 2AEZA 3SH4A 3FZ3A 4P02B 3MBWA 4UOJA 1TMF2 3LE0A 4UF0B 3MO4A 2E9QA 2DVGA 3LZZA 3T4VA 4B4PA 4YG3A 3VKOA 4HK9A 1W8NA 4QPWA 1IKPA 1UMIA 1V70A 2XONA 5GLUA 3SKVA 3THDA 1WA6X 1BEV2 5A32A 4NWVA 2UYBA 2ARBA 3CMGA 4Q29A 5FR3A 3CJIA 2WWSA 3OUJA 5C70A 1MQTC 3VBUA 1RUH1 2EAKA 1US3A 5G04L 4N53A 1W90A 4XJUA 1W2NA 3K4DA 1AXZA 3PL0A 4FPFA 3UETA 2BNNA 3KV4A 4BJ0A 1UPIA 2LW8A 3BOWA 3KT1A 2RM23 3HN1A 5AC92 1NCRC 1YRZA 3EHKA 4FPCA 4LJHA 4A44A 2D97A 4GH4B 4LBQA 2Y64A 1HQWA 4AQ2A 3T2OA 1ZX5A 1ALYA 2Z42A 4HL0A 5FY1A 2GDFA 4BCUA 4DEVA 3FFZA 1B35B 3GBFA 1HJGA 2W1SA 3O1TA 4Q4V1 4D7SA 1I6XA 1P8JA 2QNKA 1OD5A 4YW7A 3WLUA 3ZFFC 1PM4A 4E4HA 5FOBB 1KDMA 4JRLA 2C0ZA 1D0GA 4NPMA 3Q8AA 4ZU4A 2Q8EA 3WNPA 3POYA 4WM8B 2E7TA 1RUOA 1O4ZA 4NOTA 3RVHA 5L9BA 3ES4A 3MI8A 4UFJA 1COV3 1RMU3 1K5MA 1YEWA 4QXHA 1KJLA 2ERFA 2JDPA 4IEVA 3WZ1A 5C9AC 1QNWA 1AHSA 4LPLA 2QQWA 5I93A 1VBD1 2DDUA 2OVUA 3FBMA 4HK8A 4C8DA 3UESA 3LOIA 2WZEA 2XL9A 3H1WA 4XQ4A 4XF9A 4DXRA 5LZ6A 2RR11 3NVCA 2WABA 5F2WA 3LAGA 5D8AA 4EZ4A 5A3TA 2NN8A 3OGRA 1UQXA 1MEC1 3H50A 1RUG2 2D43A 1Q43A 2WS91 3POSA 3PU8A 3ZFEB 4E8DA 4I09A 4A42A 4ES9A 4CUGA 5J37A 3NJYA 4FQZA 4YW3A 1F8VA 3PUIA 4ATEA 3FMGA 2B9UA 2HWF2 1VBE2 1XE7A 1S0FA 2PMWB 3C8XA 1ST8A 3JBG3 4JCKA 4RYDA 5T5LA 1H1MA 3J4UH 4XABA 1PNGA 5IVYA 2G9GA 2BZDA 4IERA 3MICA 4OZXA 1MZFA 2XBO2 1VBA2 3B7MA 1DBNA 1ZYBA 2D6LX 2VU9A 4XFHA 1OH4A 2B45X 2IFRA 3U75A 4IE4A 3ZN6A 3CNAA 5IVCA 4KWUA 1VB2A 2C9AA 3MW2A 1CZVA 1A8MA 3NNMA 1ULGA 4YZ3A 4BQXA 3HT2A 5J48A 3MHZA 4E4DX 4RFT0 1IPSA 1JU4A 4FTEA 4IGQA 4OHWA 4Q4X1 4A41A 1CZSA 2P4EA 3DPRB 3MW3A 1CVNA 4IE6A 3IT8A 3T2TA 1OFSA 3AC0A 1ZZ9A 3RZKA 3U4XA 3VBFA 4CP0A 4Z92B 3WT3A 3H3UA 2FDGA 1FOD2 4K20A 4RS5A 1MS0A 4RQPC 3AP7A 4Y3OA 3KV6A 2GNMA 2K46A 1VE0A 2CTVA 1GICA 3T2PA 1BBT2 4NROA 3BI3A 2YROA 4FTSA 3VZNA 1YCIA 4J25A 5JIUA 1LGNA 1ULPA 1HLCA 4MV2A 1BVVA 1LB2A 4JAAA 2HLEA 3B02A 2DUOA 2C24A 3S5AA 3O0XA 1EV12 1OH3A 3BTYA 2IUWA 4MXWA 2HYXA 2HWE3 4OUSA 2EVXA 4YG0A 3VBSB 1PVXA 1NYWA 2CWMA 3MIEA 4GWJA 4WVVA 3ZYBA 2ZGOA 5F1RA 1NZIA 1TE1B 5FDBA 1UX7A 2BP6A 2PHTA 2VJXA 1SZBA 5H9QA 5IK5A 1LHVA 1ENXA 1SFYA 3C7FA 5FP4A 3WHTA 1CAXA 3WF4A 4AHYA 1BKZA 2QVSB 1BJQA 3VKNA 1NKGA 4NHXA 1CONA 1ODNA 2Q4SA 3BODA 3MZHA 1S0JA 4GB33 1QDCA 3BCWA 5K7PA 1OXCA 4MGYE 4E2SA 1LULA 2OW4A 5LBEA 2I74A 3ZXJA 1U12A 5BY5A 1O5LA 5EV7A 3AKTA 3WHUA 4JGYA 2ZGPA 4XUQA 1GLHA 2AH2A 4OQ9A 4C1WA 2VM9A 4CPBD 4LKEA 4IEXA 4UFHA 2WLPA 4CDQA 4Y1ZA 2GNDA 3KS7A 2E33A 4HXCA 5ABJA 1SBFA 1PHMA 4CEWC 2J1RA 4HVRA 1XE0A 1JZ3A 3J8F2 3FHIB 4XJAA 3MIDA 4FPLA 5K0UA 1C8M2 1MZ5A 2HWB3 3LKJA 5A3MA 1HRI1 3VD7A 4EN7B 1AYN2 1JTZX 2KA3A 4Z1VA 2XPJA 1US2A 1MQTB 4FOYA 5A3PA 4BLJA 2Y6FA 4JKMA 1HJFA 5DUVA 5A7WB 2BTVC 3MLLA 4AQTA 1W6NB 1DIWA 2KXLA 3GHMA 3E6CC 2LRPA 2VOXA 4CEYB 5H9SA 1D0HA 3HD8B 4KNCA 4NRQA 5BNOC 2NZ9A 5LW9A 2ZAHA 4Y26A 2E6VA 3O14A 4FBFA 3RGBA 1NCRB 2ZEXA 3A7QA 2CSGA 2P1BA 1F5JA 5FV3A 3NV1A 1JOBA 4CP1A 4D8MA 1QMJA 2Y6GA 2D3SA 4BU2A 1WWYA 2X10A 2JENA 3LDBA 1WUVA 5FLIA 1N3QA 1XBFA 1MZEA 5LK5A 1D4M1 2P3KA 5JR7B 2OX0A 5EJ3A 4NUBA 4YGCA 3ZFFB 4HPKA 3KF3A 5DG2A 1G8WA 2FZ1A 2GN3A 4FXGB 1S0IA 2NQYA 2OXBA 2QQJA 4H2AA 1CR7A 1ZZ6A 4HKWA 4XBQA 4AEDC 1AL21 5C71A 3WUDA 4COWA 1OQ1A 1SCSA 3VDBA 1WCKA 3V56A 2FDIA 4XCAA 5JZGC 5C9AB 5C8CA 4AQSA 4PIXA 3EBRA 1CAWB 3DF0A 2WR9A 3ME2A 1JYCA 4M3CB 2ZZQA 3I7DA 5H9RA 5AFBA 4E8CA 1Q56A 2X5IC 1JS9A 3IMNA 1DZQA 1EAH2 4LBMA 4LEJA 5JOWA 1WMXA 2R062 4IE5A 3U11A 1GBGA 2A73B 5FZEA 3QBQA 2WL1A 3A23A 3OPWA 4FI9A 3SHRA 4QKDA 4RA0A 4YVSC 3T3YA 5JMCA 4AF9A 3D3AA 4FFHA 5FJKA 3KV5A 5JXHA 2VD7A 1H30A 3A0NA 3ROUA 4SLIA 1PGW1 3AFKA 3SCGA 4QKFA 3B94A 1AX2A 4L9BA 2MEV3 5BNNA 2YFUA 5JIAA 1PNFA 3AJZA 3M3OA 3OGVA 5LA2A 3EYPA 1PVC1 1UWWA 3OGGA 2QZ3A 2VE1A 2RS12 4AFDA 1U5YA 2VXJA 1PZ9A 2ZBJA 3FHQA 4NAOA 4QGLA 3WXPA 4E27A 1ZBA1 2BEOA 2BWAA 1QJX3 1J84A 3KWVA 4LO5B 4Q0QA 5BNPC 1STMA 3VKMA 4MHUA 2VQTA 4IQPA 5LATA 4F7ZA 2Z79A 2QJVA 4COZA 2V4AA 3J26N 1QJY1 2WRAA 1JHJA 2EALA 1N3OA 2GC0A 5LBCA 5CBLA 1MS3A 2XOMA 3U37A 4RQPB 3ATGA 4P9GA 2AYHA 4E2GA 5BNQA 1O4YA 2VNOA 5KHIA 1BLZA 1CAUA 5KC5A 1HN0A 1RHI3 4IEWA 5EXOA 1LHOA 3POWA 5L7OA 1KS4A 1RUE1 1CPMA 3OYWB 3OJBA 2P3JA 2F4LA 1L7QA 3N7JA 2P6CA 1XE8A 4XFBA 2HEWF 5IK8A 4AG4A 4QDQA 1D2SA 2RM22 1UZYA 4Y1VA 4L92A 2RDRA 2VNGA 1GNHA 3HNBM 4DINB 4TXWA 5FP3A 1W06A 5FZ0A 3O1PA 4DUXA 2DUPA 1S55A 4CXYA 2VECA 1Q3EA 4KU8A 1AUYA 3PUAA 3AMPA 3EMRA 1YQ2A 4NR1A 2ZACA 5FYTA 3MIGA 2JG8A 5JXIA 2K0GA 4GJZA 4N7IA 4XBNA 4AW7A 2WWUA 1QKQA 4BQ2A 2WYFA 4LLFA 3ZFGB 3ZYGA 2JE8A 4PDWC 1X50A 4RFRB 3LWCA 3D4KA 2GC1A 1ZA4A 3KCYA 5TSWA 3AB0A 3TEZA 3WP5A 1C4RA 4XACA 1RMU2 2NYYA 1BCXA 2DUQA 2FQPA 4QXCA 4CDXC 5FYVA 3WW2A 4AI3A 4KG8A 4QB2A 5FZ8A 2YXSA 2D5HA 4FOQA 1R083 5FPAA 4CEWB 1HQNA 4HG6B 4V2WA 4IXLA 4FOVA 3U1XA 4IV3B 1ZRDA 1CIYA 4D69A 2HEVF 5T5PA 3WDTA 1Q5OA 5JI9A 3DCQA 1RL3A 1PX3A 2ET1A 1TMF3 3MIBA 1LESA 2MEV1 4XFGA 1RUC1 3IWZA 3KQ4B 3T0AA 3ZLIA 4EQVA 1ULEA 3K75B 1H2KA 5KHHA 2OUJA 3JBG2 4P9LA 1SACA 1VMFA 2D98A 5FY0A 3RWNA 1RUI1 5F32A 2VZ3A 1URXA 1BEV3 1A78A 3IAPA 4IE7A 2DWRA 2Z69A 1S0EA 1ULCA 1XNAA 3O5SA 3WY6A 1F2NA 3OBAA 4PI0A 1N1YA 4DRVA 2BPA2 1WLTA 5FZ9A 4Q0SA 2GH8A 3MV01 3VD5A 4AI0A 1RB8G 2V72A 1UYZA 3CZJA 5CVRA 1QXPA 3PMSA 2XJPA 5FRAA 5HI0A 1DU3D 4K1ZA 3I2HA 2WJSA 1CAVB 1Q8PA 1HIXA 1SLLA 1Q8VA 4BPZA 1FATA 4I02A 4YWAA 3WCSA 1RJ7A 4AI9A 1GOHA 1V6IA 4UW4A 4AEDB 3U4SA 1LEMA 4MG2A 3NQHA 4GKXA 3KVAA 1RC6A 3N9OA 2XVLA 2XJVA 1XC6A 3A21A 1UIKA 1UO9A 2BQPA 4PI2A 4A6SA 1W8HA 3AK0A 3RWKX 1F4AA 2HH9A 3KD4A 3B3QE 2X5IB 3CKHA 2DVBA 3TNQA 4CZSA 3BVCA 1PO23 1QJZA 1Q8QA 1RVF1 1SBDA 2MPFA 3CJIC 1O3SA 1PK6A 3VBUC 4IESA 5FYIA 4V1PA 2SLIA 2BU9A 1TME1 1WMDA 4N53C 5FP8A 1Y9QA 2UWBA 1S0GA 1SPPA 5K4LA 3CHXA 3M3QA 4Q5OA 4QX3A 5CAZA 3URFA 1UZWA 4LITA 2BFUS 4LIVA 2FDKA 4GB32 4OMCA 5BYNA 2DCJA 1FPN2 4M3CE 4Z8BA 4WZCA 5JOZA 4MGIE 3POFA 1BZWA 2XKOA 3PVEA 3GCWA 5DPNA 4UFLA 5FYZA 5LRSA 1QQP1 4GAZA 3PIJA 4GULA 1VBE3 2PHUA 4HETA 2BGOA 5CIRA 3EQEA 1G9FA 4NJ4A 3E6BA 1I1EA 3WNXA 4Q0UA 1TEIA 4YM1A 1OF3A 3KQRA 4ISRA 4ORFA 2G1MA 1LR5A 1W6MB 5ACA3 2AZ5A 1R092 2OZ6A 2HWB2 5GALA 4MGSA 4E2QA 5FZLA 4JVAA 1GP4A 1LCLA 3WUCA 1K5MC 2ZA9A 3HN3A 4IEZA 4CP9B 4OQ8A 5FPBA 4NRPA 2ZHLA 5DZEA 5F2SA 2VW0A 1DGWA 3NWKA 2C26A 1KQRA 4QWNA 1UOJA 4BB3A 3ASIA 2R071 3L2YA 1AF9A 5FLJA 2WA3A 3DYOA 4TWTA 4QT6A 5D8AC 1UY0A 3AYCA 1OA3A 3IPVA 5C5UA 2W92A 4AHWA 2OT7A 3KCCA 3NSTA 4TLGA 1ZVFA 4L0PA 3AMMA 5F5AA 1W0OA 4YGDA 3USUB 4Y22B 3ZOIA 1HW5A 4CYDA 3B69A 2LTNA 3I8TA 3KLSA 4NVPA 1QJFA 3HNMA 2A7AA 2IWGB 5FXZA 3ZDSA 4META 5AC91 1AR81 1SDWA 4XFFA 1W9SA 3NV3A 1RGSA 3ZPYA 4A4AA 1WCSA 4A2UA 2WDBA 4JV4A 3APBA 4PDWB 4AVAA 4QPIA 4H14A 5EZWA 4OULA 3SMHA 2N7GA 4LO8A 4I0WB 4YW4A 3WEZA 4NO4A 2VVDA 1KFUL 3GGLA 4QKBA 4COYA 1Y3TA 4ZS3A 4CDXB 4URAA 2O0OA 4GWNA 1AX1A 4B4QA 1OOPA 2DBIA 5FMBA 5FZKA 3GNEA 3UK9A 5JUVA 4Q27A 3I3DA 4JRAA 3VBFC 4CCDA 2WT0A 4ASMB 5I91A 5A6XA 4YZ4A 2OPWA 4RS5C 2X53S 1PIV1 2BBAA 4CXWA 4YW2A 3VZOA 3DXTA 3I3BA 4MOAA 5I0DA 4JGZA 4QQ2A 1N47A 1KITA 1J58A 2D6NA 3RYKA 2WZ8A 2HEYF 4FT8A 4BWOA 4BYYA 1ENRA 1SLAA 4YVWA 2W5FA 3Q8FA 2CL2A 1HRV2 2DFBA 2NMOA 3KCXA 1HXS3 1RUG1 3AZWA 5SV8A 4MGZE 1LOEA 2WIIB 3WG3A 3LCPA 1UPSA 2QQLA 3WG4A 4XDOA 4W65A 1B09A 2XLFA 3AYAA 3JB4C 3ACIA 1UMZA 1XSQA 1XRUA 1ND2B 2X09A 2HWF1 2VH9A 2ZKLA 1AYN3 1NLRA 2O8OA 1XYOA 4GJYA 2ENRA 4I3GA 4NHYA 5GLVA 1NE6A 2JB4A 3I97A 1QJX2 2GP5A 1BVP1 1WA4A 2XBO1 4OUMA 2JKBA 1VBA1 2V09A 2ZMKA 3GCXA 3POBA 3SISA 1PMIA 3AZXA 3C7GA 4XURA 1ZRCA 5DZGA 4FPJA 3Q8EA 3KVBA 4XQDA 2BWCA 1ND3C 1IS6A 1UCXA 4COVA 5IFTA 2JEMA 3O0VA 2NM1A 2EXIA 2VMFA 3ZKUA 4JGYC 4CRQA 1QXJA 1YUDA 2VVEA 1RHI2 3QCWA 4QXKA 4CDQC 4R9BA 3HT1A 1FOD1 2IXJA 5FZAA 1XNBA 2WZR3 2W52A 1C3HA 3Q8CA 1JUHA 1BBT1 1AR92 5ABJC 4S2GA 1O3QA 2YGMA 1QJU1 4ITCA 2VTFA 4M4RA 3DKQA 4NPLA 5K0UC 2I07B 1POQA 1UX6A 3LSDA 5A33A 4KWJA 4BK5A 2OQ6A 4EWDA 3AMHA 2GH2A 3CJIB 5B4XA 4Y1YA 1T6BX 1EV11 1EY2A 1UOFA 3AMQA 3AYEA 3NNJA 3QACA 4GMP1 2IVJA 4Y1UA 5FUNA 1S1AA 2I2SA 3HQUA 1YQ6A 3WNMA 5APAA 5CKMA 2ZMNA 4QPGB 2VTXA 3I59B 1RXGA 3DKWA 4RSUA 1KEXA 3THPA 3N9LA 5K9YA 2WNOA 1AVBA 4YM3A 3USSA 2YBKA 1QHDA 5I8YA 1GMMA 1EAH3 4LBQB 1F5FA 4YSFA 4LMFA 1EYBA 4HKLA 1EUUA 2QUOA 3VBRA 3O1UA 1H2LA 1APNA 1Z7S2 2QQUA 4HFSA 4P9WA 5F5IA 2RDQA 2VQUA 5FYSA 1FX5A 5FY4A 3C7OA 4ATFA 4AVBA 3TEWA 3O1VA 1H8TA 3CIHA 1JZ8A 1REFA 2ORXA 4LBQD 2ZCWA 2YU1A 3LIHA 4X6QB 1R082 1W8OA 5KBFA 3I2OA 2OUHA 1W2TA 2VOTA 4WVZA 2W1WA 5FKBA 5EIYB 1W39A 1U5XA 4BDVB 2WKKA 3O1MA 3M4FA 1LU1A 3J7HA 2DF7A 2JE9A 1WCUA 1LTEA 2VW2A 5EFUA 3TRSB 1UKGA 2A6WA 1K5MB 2R7EB 5C4WB 4CE8A 3R05A 2PHDA 3D82A 2PYTA 3WP6A 1Q8OA 3J8F1 1KXGA 4QU2A 4BMEA 5C8CC 2JIJA 1NA1C 1C8M1 3IMMA 3OGJA 3ZYHA 2VUCA 4B29A 3LA2A 1AYN1 4Q4Y3 4EV0A 2TBVA 3E5UA 1VJ2A 3VUOA 5C33A 1H2MA 1VPHA 4XXPA 4YARA 5FO8B 3OGSA 2W46A 3OPZA 5FZMA 5JSOA 5JVVA 2D6PA 4N8MA 1OA4A 4LO4B 1PGL1 1ZZBA 4XW3A 3U78A 4ZXKA 4QGNA 1S0DA 3E5QA 3FBYA 3MIFA 4LXLA 5BNNC 3UNPA 2R0FA 3K77A 4NN0A 5FPZA 2YY1A 4AFAA 5JSRA 1W6PA 1DDLA 2Q1FA 4XDQA 1E5IA 5J96B 3T30A 4AEJA 1DG6A 1QH6A 3ZN6B 2BGPA 1UZVA 4BM8A 3SEPA 2YBSA 5CKNA 1JBCA 4XJ8A 2QQMA 1U5ZA 4XAAA 2W95A 2YG0A 5FREA 1AYM3 1UXXX 2DCTA 3F2ZA 1GWLA 3JD73 1TNRA 2GNTA 1W6QA 2CNAA 2ZEZA 3ZXLA 1POV1 1CIWA 5F6LB 2QFEA 2B7YA 4CXXA 2XHNA 5J3UA 2WNVB 4CCNA 5I0UA 4Q2FA 1SLCA 2LM3A 4RS5B 5FAXA 5A3UA 3ON7A 5EJ1B 3WQBA 1C8NA 3ZMNA 1PO22 3RZGA 4NE9A 2VOKA 2YC2A 5AVAA 2ZKNA 3W9AA 1H4GA 1ACCA 1R1A3 2RJLA 2WAAA 4YPJA 4G4FA 4XZUG 1H6XA 4XJ9A 2VUAA 4PBOA 3PUSA 3UV9A 1EAH1 1W8FA 4JDMA 2R061 2RDSA 4BQ4A 4HT1T 4K21A 3MV11 5C8WA 1QJEA 4ZS2A 2WFF3 5EPAA 4N43A 2CU5A 4QHOA 2XUEA 5SV5A 1JN2P 4DFSA 1RUJ1 3BALA 1CAXB 5FOJB 1K42A 2GP3A 4IEUA 1OFNA 1SLIA 2D6OX 2JG9A 1Z0HA 4JKLA 4M01A 5HCBA 2JG8C 3RRDA 4LK6A 3B01A 2BVBA 2B42B 2EIEA 4LE3A 4UF0A 5DAPA 3SCHA 4QHBA 2RS11 5A7QA 2E26A 2J1AA 2ATFA 3E5XA 4QX8A 1JOJA 2FCVA 2IFWA 4KI5M 1XU1A 2NLRA 1AX0A 3T2QA 4L11A 2Y38A 5ACA2 3GF6A 1ND3B 3O0WA 4IL7A 4CU6A 3KHCA 3RYRA 1REDA 1LOFA 2GN7A 3DN7A 1I3HA 4FPYA 5FPLA 4AVCA 1SDDB 1IZ3A 3ZO0B 2H0BA 1DQ4A 5CA6A 3IIAA 2E63A 3ES1A 3GDBA 5ABJB 1ZREA 4OLLA 1VBB3 2YV8A 2XR4A 2YGLA 5K0UB 4NHKA 5AVPA 4AR2A 1LOBA 1VBC2 1NE4A 5JAXA 2Q5TA 3M70A 3VZKA 4CDWA 2PN5A 1GANA 4LK7A 4AOCA 2MHFA 4GH4A 4ASKA 5GLTA 2WZPP 1LECA 5FPVA 2JDYA 3HJRA 2RM21 2VR4A 1SFPA 4OHYA 4YM0A 2PLV3 2WNUC 4DY5A 3PUQA 2R1DA 3OD4A 1LHWA 1W9WA 2UURA 2VVFA 3KHBA 4WM8A 2PFWA 1RXFA 2TNFA 2VL4A 3NNFA 2BYVE 3WW1A 3U0ZA 4NAMA 1DYPA 2WNEA 2IVIB 2RMU3 1HB3A 3RMXA 1YLLA 2XJSA 5CFCA 2A3WA 1ULDA 5IVBA 2BBVA 3C7HA 3ZMOA 3AMNA 3PMEA 1DGRA 2ZHKA 1AR63 4HPKB 3A4UA 1V6LA 1L3JA 5A6QA 1COV1 1RMU1 2L9LA 3SXWA 4ZU7A 1FPN3 1R1ZA 1I5PA 2R043 4XMAA 3S30A 3ZYJB 1N1SA 1YC61 4S2HA 3ZM8A 4N7UA 2PELA 1XYPA 1MS1A 1SQ4A 4JQTA 4JC1A 3WV6A 1WZXA 4XF0A 3NMBA 4FAGA 1UF2C 5CZKA 5AFEA 1YIPA 3N7LA 1W8TA 1NA1B 4R8HA 4FTBA 2V5DA 1HXS2 4XE9A 3MLKA 3HWJA 3ECQA 3K2OA 2ET7A 1BMV2 1SEFA 2WC2A 3BU7A 4XQWA 1R093 2JECA 3WOGA 2XJUA 4LIUA 4OCTA 2EXJA 3AP9A 1CX1A 1JZ6A 3ETQA 4LBLA 2B4KA 1GYKA 1GOFA 3JBG1 3RSJA 4AFCA 3H8OA 1PK6C 1OMIA 1IS3A 3KT4A 2EF6A 4J6GA 3ZSJA 1DGLA 1C1FA 1WW6A 4CUBA 3OEBA 3FN9A 2WAOA 2XJQA 2GMPA 4MO3M 4C1XA 5BNNB 1IHMA 5CKQA 2BFUL 1JYIA 3GZUC 4LE4A 5J1XA 3DPRA 1H8VA 4LKFA 5FZOB 5IT6A 3FL7A 3OG2A 1WLDA 2J1SA 1OUSA 5FQ0A 3OF1A 4INDA 2ARAA 3MDPA 4NRMA 1JHNA 4DS0A 3OUIA 5L36A 2Y8KA 3U14A 1I5ZA 2VZQA 1YI9A 4PT6A 1GWMA 3FFQA 1UY4A 3GBWA 1AL0G 1XNDA 2XB6C 3PIGA 4LR4A 5FP9A 1V00A 3PDQA 1NCQA 2CAUA 3UGGA 2WZR2 4AVTA 1G9AA 2WQ4A 2DTWA 3CLPA 4I0AA 3VD3A 2PHRA 1OKQA 2W39A 3AVSA 1UOBA 2XXZA 3OBTA 4HONA 4OHXA 4SBVA 2RE9A 5G05L 3SITA 3ZYFA 3VBSA 3VZMA 1OD3A 3NJZA 4RGKA 2W94A 5D1IA 1CAUB 3VDDA 1GZWA 4Q0PA 2VO5A 3ILNA 1IS4A 4AE2A 1JYVA 3CDZB 1Y7BA 4ISQA 2ZGSA 3HPNA 2HWE1 2VG9A 4QMAA 5IYYA 3H7YA 5A70A 1UAIA 3HBZA 1BK0A 2O14A 2Z4FA 4FPEA 3SLIA 2YFZA 3EXUA 3S5QA 1CJDA 3WDUA 4DXSA 5DDJ2 4DUVA 4YZ1A 3J7MA 2RS53 4EWEA 5FWEA 3NNLA 4Y4YA 4CTEA 1F15A 2UWCA 2D6KA 2ZX4A 2VZ1A 4XMIA 5KR7A 4PLMA 3RFRA 1GP6A 1A8DA 2VBPA 3WDXA 3W20A 2Y0OA 1OLMA 3B9CA 4X6RB 3Q8BA 1C28A 3LEGA 5F37A 2D3PA 2W1QA 4GB31 3S6PA 3S57A 3BPZA 2D7FA 1FPN1 1HRV3 2Y60A 1ZNPA 1GFF2 4ZXEA 3VHNA 2ZX2A 5E1RA 5L9RA 5FZ3A 1N1VA 3WW3A 3TN93 4DXZA 2VPVA 5C3SA 1YQ5A 3N7KA 2BRTA 2TEPA 4AL9A 4XXAA 3W21A 2ZAAA 3NJXA 5A3NA 4S2FA 4HBNA 3WG1A 1VBD2 1JMUB 1JW6A 1GP5A 2ZOEB 4FPOB 4BISA 3P3PA 2C1FA 4XTPA 3OOXA 4XILA 1HB4A 2BNOA 4WV8A 2BNMA 3U10A 1PO12 4O7XA 1OOPC 1MQTA 2V73A 4MXVA 1OKOA 3BOPA 4Q1RA 4UWDA 5A7WA 2HWB1 1MEC2 1UU5A 5A6ZA 3AZVA 2PQSA 4Q4Y2 2Z2SB 3DYPA 2OYZA 3DXUA 1T2XA 2A3YA 3NJVA 4CEYA 1Y4WA 4N9IA 5H9PA 1O4TA 2FHRA 3B5LB 3G7DA 1UU6A 2D40A 4FO9A 2HBUA 3B9IA 4JGZC 3I3EA 4GALA 1WD4A 4DY3A 3NV4A 3NRUA 4GIQA 3ZSMA 4BE3A 4YVWC 4A45A 2IXKA 3R4SA 4W6WA 3KM5A 3VN4A 5FY8A 1AR93 4OHVA 5DAWA 2ZEYA 2WNUB 2CYFA 3NKTA 5D2AA 3L2HA 1QGLA 3ZFFA 2VZPA 4A3XA 5CADA 1W8UA 2B8MA 4Q4X2 1MZ6A 2WN2A 2CDPA 2RVAA 3ZXGA 3GZAA 2GC3A 2YC4A 3POIA 4U36A 1IG3A 4IEOA 3WP4A 1AYM2 1Y9GA 3D5OA 3JU9A 3JD72 3PJQA 2W47A 4I01A 1UKRA 4KG0A 1UYYA 4UAPA 5FCCA 4AEMA 4BMBA 2IXCA 4UFMA 2BERA 2VAUA 2JDAA 1PZ7A 1RIRA 4P00B 4GWIA 4YG6A 4XJWA 5D21A 2CY6A 1FXZA 2V5YA 5JSPA 1XJAA 2ZABA 4J1WA 1Z7S3 4IETA 1OQEA 4LA3A 1ZBE2 2VZTA 3THTA 2Y0IA 1R1A2 4IGPA 4O9EA 4V2VA 2CGNA 1W2AX 2FD8A 4BH9A 5T5OA 4MGKE 3ZPOA 4H7LA 3BIEA 4AAXA 2HWD3 2QDRA 2ZGNA 1KDKA 3MEPA 4ZONA 5HCAA 4UFKA 4OYUA 5GKAC 2E51A 3RG0A 2RS33 1YFWA 5CG9A 2WFF2 2ZZJA 4ONUA 2PA7A 4GD4A 3G6JB 3BTXA 5IUQA 4C0HA 5A80A 2PHFA 1PK6B 4O61A 2FMYA 1KGYA 3ZYRA 4ES8A 2HJIA 2GAUA 3H8UA 5KHJA 2PAMA 5FYCA 3WDWA 2WSVA 3IIIA 1WLCA 4MGQA 5BNOB 2C4XA 2J1TA 4JKKA 1QJX1 1XXNA 1O59A 4K6BA 4R9DA 5C3PA 5FZFA 4LNVA 4AI2A 2ZGQA 1GU3A 4AI1A 4RD7A 4TLFA 3VBRC 1F4HA 1FI2A 3NV2A 2ADEA 3RZJA 1H8TC 2VZRA 3FC0A 3NNGA 5FMOS 4AFMA 1HRI2 3OB8A 2ZX1A 2NMNA 2WQZC 2VMIA 1LEDA 1VBB2 2CWSA 1CN1A 4IUGA 1REEA 5CB7A 5JPNB 1OVPA 1RHI1 4ZU5A 4Z82A 3PVNA 1DYKA 2EA7A 3POJA 4H3WA 4XBLA 2VMGA 2PHWA 4XC9A 1AR91 5CNAA 2WSUA 1NOVA 1X8MA 5F5QA 3VKLA 3MF6A 5JZGB 1YFYA 1ZRFA 3K4ZA 5E8AA 5J09A 1VMJA 2PLV2 1V6OA 2BGCA 4MHRA 2KD7A 5FIXA 3DL3A 2D44A 1ASJ3 3ZFGA 4CU9A 1W05A 3I3MA 2O8QA 4LT5A 1VRH2 1O8SA 1D4M2 1HV0A 5IVVA 1WW4A 1IPKA 1IGOA 2VMDA 4OI4A 4BIOA 5HXMA 1W3XA 4QB1A 1OLRA 1GR3A 3LF7A 4LHSA 2RMU2 4K7JA 4YVSB 2YU2A 1Y9MA 1X36A 1W3VA 1LODA 5JI7A 4P9JA 3W5NA 1JYXA 1RUD3 2ZGTA 4K9SA 4RHV3 1K3IA 5I8SA 3BTZA 1AL22 2R1BA 3AKPA 3LFIA 1AR62 1W28A 2DV9A 2W08A 3MPPG 1Z7S1 5KWRA 2R042 1OHFA 2W3JA 4DOUA 3O1RA 2ZGLA 4D94A 4LLOA 1W0NA 4GMP0 5GLWA 2ZGKA 2VZUA 4WVWA 4IV3A 1VALA 5HCFA 5JMOA 1O3TA 1EUTA 1R081 2ORZA 3ILRA 3UT0A 1IPJA 5BNPB 1W6OB 1W03A 1HKDA 1V9U3 2QCSB 4BZ4A 4CCMA 2XQXA 1C57A 2XMLA 5J36A 3NO8A 3ENRA 4JDNA 2P5BA 5EJZB 2TUNA 3PVBB 3MIHA 1VR3A 4PF1A 4Z07A 3TWIA 2VTXJ 5FY7A 1DQ5A 2YHJA 1TMF1 4EYUA 3E97A 1HQLA 2VUDA 3GM8A 2A75A 3SEEA 3DV8A 1PGW2 4Q8LA 3LOBA 4JGZB 3GALA 1DFQA 1ULFA 3HIFA 2YYOA 3NKGA 4UFIA 4YVWB 2ZS6B 1PVC2 5A3OA 2HWC3 2WT2A 1BEV1 3ABZA 2JDUA 5F3GA 3D0JA 2VQ0A 2W87A 3BGAA 5DABA 1LOAA 1SLBA 2WT1A 3K3OA 3M7AA 2WN3A 4OZOA 4JTNA 5LCWL 2J7MA 4I3PA 3AJYA 1JXNA 3BN6A 1VBC3 4N43C 2ZGRA 3K51A 4M00A 3LPGA 4BK4A 3NAPA 5DG1A 4MADA 2A6YA 4XIOA 1QJY2 2JG9C 3WQ0A 4QGMA 3BUCA 3IB3A 4RGGA 3R4UA 1F31A 4JHTA 4Y20B 3QOPA 1ZA7A 2Y34A 1JUIA 3VBHA 1YI7A 3WQ1A 2VCAA 4BQ3A 3RI9A 1PZ8A 1GZTA 1DQ6A 3JXSA 3ORJA 1DGWX 1V6NA 1NQDA 2DU0A 1IKQA 3MYXA 4GZ9A 4CUAA 1DHKB 1WD3A 1LOFC 4FVVA 5DAXA 4X8PA 5LBFA 3VKFC 1CD3G 4XOGA 4IGOA 4A6OA 1ZZ7A 2CGPA 1MR5A 2E31A 4AGRA 1UIJA 3RMYA 1H1AA 5FZ6A 1GOGA 5GJ6A 3ZXKA 3OUHA 4BIFA 4PLNA 3OTFA 1PO21 1G86A 5FPUA 4Y5Z0 2RS52 3V0AB 5CISA 1LENA 2XJRA 3V0BA 3LD8A 4HMZA 5BV6A 5FFOC 5A33B 2G19A 2R0HA 3JB8A 5E88A 4DMIA 1AR73 2ARCA 4RR3A 4CDWC 5JOYA 2X05A 2FCTA 3GJAA 4GH4C 5DN2A 1QIQA 3VBOA 1PGSA 1O7FA 3CU7A 4LBKA 1PX4A 1POV0 3W5MA 1WBLA 3AP6A 1LGCA 1JZ2A 4LTAA 4QDRA 5F3CA 3ZIXA 1WCQA 3TN92 4LUMA 2J1VA 5A3WA 3SKJE 1K12A 3CL1A 4B1LA 1CESA 2W1UA 4LHLA 3ZYPA 4Y24A 3I2KA 1VBE1 4H55A 4WM8C 2QZ2A 1RJ8A 3H0OA 5FK7A 2Q1MA 1LJ7A 5FKCA 5CFCC 5JOXA 4WVMB 1XQNA 4CP9A 1QOOA 2EICA 2PHXA 1H8TB 4UT5A 3RQ0A 3HOBA 4XHXA 4YYOA 2G9ZA 5ACA1 1WLWA 2B9VA 4N9HA 1FMD3 3ITQA 3POEA 2XDVA 4KWKA 3DGTA 3SH3A 5DAVA 1EP0A 1YQ8A 1IG0A 1RUC2 2GNBA 3N7MA 4QHZA 3H8XA 1KRIA 3ZDVA 4YLZA 4EE2A 1E57A 5T55A 2Y6HA 3WNNA 2IZWA 1DZRA 4QX7A 3CQOA 3DYMA 2QDNA 5F6KA 3RJRA 1RUI2 1JZ4A 3IZOA 2BW8A 3H42B 3USUA 3P6BA 1W8ZA 3M8LA 1VIWB 5CFDA 1ENQA 1O3RA 4BOWA 3KSCA 4B7KA 5I0SA 5FZ7A 1NY72 2PQQA 2XWBB 3W58A 4FFGA 1W9TA 4YGEA 1RUH3 2FBEA 5LRRA 5LEKA 5A32B 4L99A 3R4DB 2KR2A 3LB9A 1RUNA 2DCYA 3OBZA 3GYDA 4HSJA 5FMCA 1JZ5A 3AM2A 5GZEA 1G9DA 1JOPA 3VBUB 3I2DA 4XUTA 3AXDA 3LA7A 3B93A 2X8KA 2VMHA 4N53B 4QM8A 1MS8A 3N36A 2MNGA 2G4IA 4UYBA 4CDXA 4EWAA 5DDJ3 4F83A 2E53A 4GA9A 2XVKA 2LALA 2JD4A 3DPRC 3WF2A 2QQPA 5A1AA 1AZDA 1W6PB 3T1LA 1J3QA 4TZDA 1LHUA 1W99A 3L9JT 3PTYA 2VCMA 1WMFA 4IEYA 4Q4V3 5FK8A 3WG2A 3X29B 4D0QA 4CCEA 1HB1A 4KMQA 3TNPB 3UKNA 4TTGA 5T5JA 4ARXA 4F3JA 5FZ4A 2WYSA 5LB6A 4LHNA 3RPQA 2VULA 3D6EA 1W04A 2X29A 3ACGA 5HBAA 1NCQC 1NX9A 4MH0E 1W6QB 3S7IA 4KGQA 3MW4A 1O5UA 2HYKA 1UY1A 2PAEA 2HWD2 4JHZA 4MX3A 2GMEA 2B46X 1QWRA 5L19A 4HZFA 4NHMA 5FJHA 5FUIA 2WWJA 4IV1A 3VBSC 4AK3A 2RS32 1VBD3 3AL6A 5J98B 1O91A 4MLOA 2BJSA 3DUIA 2ILMA 2FCUA 5FO9B 1RTVA 2OA2A 3VDDC 3S0MA 1ND2A 5FYBA 1H9WA 1HXS1 5FP7A 4C90A 3FLTA 5BUVA 2RR13 2RHPA 1GSLA 3AZYA 1PO13 4Q1PA 5A7OA 1BMV1 3SCFA 4Q4W2 3VHPA 5IVEA 2Y26A 5LY1A 1MEC3 3IAQA 1JH5A 1OUXA 2WS93 3GZTB 2VCCA 1UOGA 1AJOA 1LGBA 2AUYA 4LOSA 4O65A 1HB2A 5D8AB 3TYJA 2J1EA 2VBBA 3CF6E 4N43B 3D0SA 4CDUA 4BXFA 4IW3A 3D8CA 2WO1A 1RYYA 1GZ9A 2GU9A 4BQ1A 2VY0A 1LKNA 2JG9B 1FT9A 2GALA 3I54A 2DYCA 2EIBA 4OI2A 1WCDJ 4S2DA 5HCHA 2JDNA 4UW3A 5M0TA 1RUF2 2YUEA 2QBXA 3OY8A 4FCAA 4WM7A 2XL7A 4CU8A 4PJYA 3E6DA 3AVRA 4Q4X3 3TEYA 4OFGA 4URTA 2RV9A 4QM9A 4UW5A 4QX0A 2R072 3SNMA 2WZR1 1WW5A 5FO7B 2D3RA 3LEMA 1N1TA 1PM7A 4NMIA 1GNZA 1D2QA 2R49A 2RJKA 4ARYA 4YRDA 3WF0A 4R52A 1DQ0A 5LA1A 3RZHA 2GSYA 3JCIA 3O1SA 5FZGA 2WBKA 1U0AA 4CU7A 4K3UA 1ULOA 3VBFB 1OQDA 3ZN5A 2VNVA 2WUHA 4JX0A 1I9RA 3LGRA 2H6CA 4JZRA 4CEYC 1ASJ2 4HKOA 4QPGA 1PMJX 3I59A 3LSEA 4XUOA 3ZSKA 2Y6LA 5EYYA 5EQUA 2CAVA 2ZHNA 3M3CA 1NT0A 2R16A 4CDWB 1AR82 3FE5A 3AKSA 4R4XA 2BUKA 5DDJ1 2VBDA 1W9YA 1MS4A 1ZBE3 1W9FA 2ZGUA 5IK4A 5L7OC 2E7QA 2ZX0A 4NIIA 2XQRA 2W9XA 4Q0VA 1NZCA 2JICA 1RUD2 4LUKA 2VZOA 4KL1A 4MXWB 1F9KA 4R4ZA 3LEIA 4RHV2 1ZM1A 4MGTA 2G9FA 4W8JA 1WMEA 4QKNA 3ZXAC 2EIGA 4A7KA 4CCKA 1DGRN 1MVEA 1G6NA 5KXBA 2XWJB 5L9VA 4P9XA 2DURA 3WF3A 1QNYA 5CFCB 3WNKA 3I2JA 3HQRA 1V9U2 5C4WA 2B39A 1PIV2 3ST7A 5LBBA 4HANA 5IFPA 1KFXL 4YZ2A 3IDBB 4OI1A 4D6QA 5FBZA 1QH7A 2NPIA 4PLOA 1PO11 4ZKTB 2LS6A 3T1MA 2ARXA 4W6YA 3VZJA 2Q8CA 1GUIA 3R6SA 3UL2A 4UW6A 1VRBA 4EN8B 4JGYB 4PQ9A 3H8RA 4IEQA 4Q4Y1 3O12A 4LORA 1BQPA 4CDQB 1NXMA 2E32A 2ZPXA 4KBZA 2HWC2 1HRI3 3JZVA 1XYNA 5FMDA 1X9TA 3LDRA 2ZGMA 4N90A 4PF5A 5FYYA 5ANNA 2LUWA 2WO3A 3AZZA 4HSLA 2ETEA 5IW0A 2QQVA 1IQAA 1AXKA 3N35A 3WVJA 1MVQA 5DQ0A 3F95A 1YWKA 1A34A 1ENSA 1BK1A 3RZMA 1FYUA 3JUUA 2VXRA 2DCZA 2JDZA 2P34A 1E5SA 3VGIA 1VAVA 4A7ZA 2ZJCA 5HXVA 1CPNA 1B35A 4FOWA 1H9PA 4LBNA 2QQIA 3I2IA 1AJKA 1SLTA 5IWFA 3UKVA 4P5HA 4LQRA 3SH5A 3J7LA 4BHPA 5E89A 1AYM1 4AHXA 1VRH3 2UY9A 2WNVA 5DUXA 1D4M3 3JD71 5FQ0B 1G9CA 2BV4A 2JJ6A 2VZSA 4P9YA 4XAEA 4LULA 2JIGA 2VW1A 1J3RA 2OQ7A 2EXKA 3Q9OA 4H7MA 3IDAA 5JXJA 1QJU2 2A6XA 1CX4A 2DBNA 2JDHA 2OPKA 2XKPA 5DXDA 5FMOL 5LA9A 1IOAA 3HMYA 1NCQB 2A6VA 4PIYA 1AL23 3HEIA 1U5IA 5CU1A 5GZCA 5FZHA 1F35A 1WGPA 3B00A 1ODMA 1ZBE1 5BXXA 1R1A1 1SG3A 1OA2A 3PNAA 4CUCA 1AR72 4B4RA 3MGUA 1GZWB 3VDDB 4M3CF 1Z78A 1JI6A 5LWBA 1ZZ8A 3MUY1 2JDMA 3ZFEA 3FJSA 4RGAA 1W0PA 3AP5A 4A7YA 5C8CB 3PLQA 3BKZA 5E16A 2UU8A 4QQHA 1UU4A 1QOSA 1S4CA 4D7TA 1QOTA 2WFF1 1XNCA 4TN7A 3WQ7A 1H0BA 3UGHA 2QKDA 4ZPIA 3ZFGC 2H0VA 4AEKA 2VZVA 2RDNA 4J1XA 1CWPA 5FY5A 2ZEWA 5C7GA 1UXZA 2JWPA 4GXLA 1LOGA 2ZXQA 1ND3A 3WCRA 1ZRRA 2VOVA 4NPRA 3ZSEA 4YFZA 1UL9A 3N3HA 4PBPA 4ZZ8A 5CG8A 1GV9A 4XHBA 3WX5A 2OS2A 1PVC3 5B4NA 1OVSA 4AQ6A 4XETA 5K8SA 3EJKA 1SHWB 4AVSA 1QF3A 2J1UA 2PTMA 1FMD2 3BB6A 3MPBA 1ZBA3 5CYYA 3IKWA 4DB5A 4B7EA 1BYHA 2CV6A 1RINA 3ZXEA 5F3EA 1QU0A 4P14A 4QD2A 5CEHA 1S0CA 2ZTNA 3M3IA 4LOTA 3TEXA 4IV3C 5J7MA 4KH9A 4XVHA 5DUWA 2F4PA 2DVDA 1QJY3 3MF9A 1XNTA 4FFFA 1VMHA 3RYPA 3VLBB 3PU3A 1VBB1 1FNZA 1HV1A 1OPMA 1UYPA 2FMDA 4QPYA 4XFIA 1WKYA 1G7YA 2YZ4A 4P9IA 4CCJA 5F9TA 1DCSA 1K45A 1KS5A 3BIWE 2YB7A 1RUH2 4QU1A 5BPXA 4CP2A 1RUE3 1PGL2 2R30A 1UZZA 3AYDA 3KMHA 2QQKA 4QQPA 2NP0A 2ID4A 2JKXA 1OC1A 3LPFA 1CJPA 3LEKA 1GZCA 2PLV1 5GLZA 3LA3A 3VHOA 5L7OB 3RZZA 4FXKB 1MPXA 5KC6A 3RS6A 4FAHA 1HX6A 3VV1A 2YPDA 4EZHA 1UMHA 1VRH1 3WSOA 4NIHA 5KHKA 4AXOA 1VAMA 4QQOA 2ZHMA 4L8QA 1YFUA 4FFIA 3ZN4A 2RMU1 2DU1A 3WF1A 2O1QA 1YXWA 4CPBA 3IDEA 4LA2A 1CGPA 3NAPC 4Q4V2 5FPXA 3BPSA 3PTRB 3HQXA 5FZCA 4G9SB 3ACHA 3KGLA 3OCPA 1AR61 2D5FA 1OURA 4QQLA 1TVGA 1JYNA 2JG8B 1M4WA 1OF4A 5T3NA 3TBDA 1VAKA 4PIZA 2R041 3VL9A 3VD9A 2YBPA 1ZZCA 2VCBA 5FXXA 3VBHC 1OI6A 4XJZA 1LU2A 2AGSA 5JXGA 4BA6A 1NA1A 3UJQA 1YJLA 4E4SA 3O1OA 4I30A 2V4VA 4QPIC 4XFCA 4HN1A 5C3QA 3AL5A 5FLHA 4Y5TA 1YIFA 1TNFA 3WDYA 4AHZA 3N9PA 2KM2A 4QXBA 4QX1A 1NQJA 1VB4A 1C1LA 1W2UA 1XB9A 1X33A 1NXD1 3IBMA
chains in the Genus database with same CATH topology
2JE7A 2RR12 5KXEA 3MFAA 3ZSLA 3RNSA 1R091 4MYEA 2WS92 1RUJ2 4L97A 1W6NA 1ONAA 4B8EA 1FV3A 1RUC3 2IXLA 3HAGA 3AKRA 3OD0A 4M0HA 4HLTA 4RR3C 1DZTA 4UBHA 4LO7A 1EPWA 1WBFA 4EROA 5KHGA 1NCRA 4XFAA 3VBOC 2XH6A 1V6KA 3H3ZA 3N4MA 1RUI3 1OPOA 3ZX7A 3ZIWA 1DLLA 2ES3A 2W0XA 1SFNA 4EN6B 3AXEA 3CO2A 1QDOA 2UY8A 1SCRA 2D93A 4G3YC 4BLIA 4XYXA 2QQPA 3INAA 1S2KA 3AP4A 3FX3A 4XZPA 3I4IA 3IDCB 1SBEA 5DUUA 1XNKA 4GWMA 3WINE 4AFBA 5C9AA 1LHNA 1CQ9A 4DRRA 1CAWA 5T54A 4OHZA 2Q1ZB 4AWDA 1S0BA 4M3CA 2A6ZA 5I0TA 5JPMB 4E4ZA 3H1MA 4L2NA 4W6XA 5GM0A 3VHRA 2AENA 2RS51 1LRHA 1NG0A 2K9ZA 3P3NA 4EN0A 5CFDC 4YW5A 4K40A 4XF4A 2GC2A 1RVF3 3H9AA 2PAKA 1C5HA 3RI8A 5GZFA 4FSJA 1J1LA 1TME3 2XVGA 5DZFA 1D4VB 1J3PA 5LK7B 1HRV1 2D6MA 3M2MA 3TN91 1NLSA 1COV2 1DQ1A 4Q4W3 5EWSA 4KU7A 2A3XA 1V6MA 3WR0A 4FPHA 1H1IA 2XGXA 3ZYIB 4Y1XA 1QQP3 3VL8A 3MFCA 4RL7A 5IK7A 4RQPA 3GBGA 3NW4A 3M1HA 3JQWA 2DTYA 4KGGA 2ZX3A 2QE3A 2IXIA 4MZUA 3OYWA 1RUF3 1FV2A 4IV1C 2WNUA 2WINB 2JXAA 2A5ZA 3R0RA 3CEWA 1YHFA 1MS9A 2R073 4YZ5A 1ND2C 2AREA 4Z2WA 2K2SA 2P37A 1NY71 2OZJA 3ACLA 1HDKA 1LOCA 2WFPA 1YNAA 5LEJA 4C91A 4YGBA 3CJXA 3BTAA 1N3PA 4LO6B 2I45A 3VZLA 3IPVB 3EO6A 1QY4A 2R6QA 4CDUC 3NAPB 3QH6A 3KT7A 5AC93 5JWPA 4F8AA 1AR83 5A3LA 2HKXA 1G9BA 4QX5A 3K48A 2Q0AA 4AGGA 4XIKA 3TOJA 2IXHA 4XF1A 3TB0A 3VBHB 3WD5A 3W59A 3V64A 4WM7C 3M3EA 4QPIB 1EPZA 2HWE2 2XG3A 1OLQA 4AI8A 3C3VA 4CEWA 4OVEA 4FP3A 5GZGA 4XF3A 4Q8KA 2WA4A 2VQAA 1TQ5A 1V6JA 2HWD1 2R32A 1OOPB 3PVOA 3PJYA 5C6CA 2RS31 1PIV3 4O9GA 4HVQA 2E7AA 2CGOA 4KBBA 3V0BB 4QPGC 4U2AA 4LBJA 2YDEA 3ZVXA 1BXHA 5BNOA 4Q4W1 1X7NA 4YM2A 4RR3B 3V65A 3KZ4C 4A7ZA 2UWAA 3FLPA 1YYNA 4JTOA 1RUG3 2XHKA 3VBOB 3MLJA 4D7YA 1GKBA 4YFWA 3WP3A 4KQ7A 2HWF3 5JCTA 4E9KA 1ZBA2 1UW8A 2YPJA 3ALQA 1CAVA 2XBO3 1VBA3 2XLGA 1A6CA 2PHLA 4IEPA 1FAYA 4AEDA 1RUF1 1YO8A 2UYAA 5C4WC 4M0NA 4R9CA 1Y43B 3A0KA 2VUJA 5JDBA 5JZGA 3QD6A 4X8NA 3ELNA 4I0BA 3ZXFA 3RDIA 3OBRA 1S2BA 1RUE2 4FPKA 4DNYA 3GHNA 4DPNA 1FOD3 1RITA 2Q8OA 4LHKA 2X5IA 1BBT3 4YW1A 1X82A 1MS5A 1QJU3 1OSGA 1GQGA 3FLRA 2JX9A 1ASJ1 5CFDB 4XTMA 4YVSA 3AFGA 3NL1A 4MUVA 2Q30A 3J9SA 4GMP3 1EV13 3FWEA 4JQRA 4YNIA 2BVVA 4NHLA 4HVOA 1RUD1 4RHV1 5I8TA 5JLVA 3AX4A 3WDVA 1DF0A 1B35C 5BNPA 1W6OA 4C0BA 2B5HA 3H7JA 2SBAA 2OIIA 2WNVC 2YMZA 1V9U1 1SMVA 1W6MA 4JDOA 1T6GC 4UBGA 4UXAA 3VBRB 1UN1A 2EAAA 1DQ2A 2GMMA 2VOWA 3TAYA 5B2GB 2DFCA 5GZDA 2DCKA 3UJOA 2H6BA 4ASLA 1VP6A 4TYSA 2VGDA 1YFXA 4MSVA 2MEV2 4FP2A 4IV1B 4NWWA 2P2KA 3J8F3 4K8FA 2XLAA 1C8M3 1H2NA 3RJ2X 2HWC1 3H1YA 4K1YA 4WZFA 2VNRA 3PHMA 3ZFEC 2ZMLA 3O7OA 4Y22A 1VBC1 4AYUA 2YC0A 2WLQA 4Y20A 1M06G 3IN9A 2P3IA 1J59A 4XEZA 1X8EA 4B3NA 1YJKA 4PDWA 4CDUB 2DVFA 4OI0A 4COUA 1Q8SA 3WW4A 3UKTA 1AXYA 3S7EA 1J1TA 4AVVA 3C2UA 5L73A 4Q26A 3FUOA 1UD1A 3OY8B 4GQ7A 4WM7B 4MVTA 2GZWA 3V0AA 2P17A 5T52A 2Z5WA 1POV3 1IS5A 2AR6A 5FTTC 4HN0A 1FNYA 2IC1A 1VLNA 3ZXDA 3KB5A 2W68A 4DQAA 1XU2A 3AKQA 2DVAA 1QXRA 1A3KA 2C5DA 1RVF2 1AR71 1KJRA 2F6BA 3IM0A 4XPVA 3JQXA 1TME2 1WW7A 2A70A 4AGVA 1GQHA 3KGZA 3FUQA 4I2OA 1C5IA 2EXHA 2R063 4TSVA 5KXDA 3QLQA 5KXCA 4D3WA 3U07A 4WVMA 4LBOA 5EYXA 4R9AA 4FPGA 1RUJ3 4EJRA 2FZ2A 2A71A 3QH7A 1MACA 5T50A 3ILFA 2XJTA 1QQP2 4KWLA 1H4HA 4EN9B 4FQ4A 3HR9A 4DZGA 1KD7A 4GKYA 4PCRA 2RS13 2XUMA 4WBBA 1FMD1 3SH4A 3FZ3A 1TMF2 2E9QA 2DVGA 3LZZA 4B4PA 4YG3A 3VKOA 4HK9A 1IKPA 1V70A 5GLUA 1BEV2 5A32A 4NWVA 2UYBA 2ARBA 4Q29A 3CJIA 2WWSA 1MQTC 3VBUA 1RUH1 2EAKA 4N53A 4XJUA 4FPFA 1AXZA 2BNNA 1UPIA 3BOWA 3KT1A 2RM23 3HN1A 5AC92 1NCRC 1YRZA 3EHKA 4FPCA 2D97A 4GH4B 4LBQA 1HQWA 4AQ2A 1ZX5A 1ALYA 2Z42A 4HL0A 2GDFA 4BCUA 3FFZA 1B35B 3GBFA 4Q4V1 4D7SA 1I6XA 2QNKA 1OD5A 3WLUA 3ZFFC 5FOBB 1KDMA 4JRLA 2C0ZA 1D0GA 4ZU4A 3POYA 4WM8B 2E7TA 1RUOA 1O4ZA 4NOTA 3ES4A 3MI8A 1COV3 1RMU3 1K5MA 1KJLA 2ERFA 3WZ1A 4IEVA 5C9AC 1QNWA 1AHSA 5I93A 1VBD1 2OVUA 3FBMA 4HK8A 3LOIA 2XL9A 3H1WA 4XQ4A 4XF9A 2RR11 3NVCA 3LAGA 5D8AA 2NN8A 1MEC1 3H50A 1RUG2 2D43A 1Q43A 2WS91 3POSA 3ZFEB 4I09A 4ES9A 5J37A 4FQZA 4YW3A 1F8VA 4ATEA 3FMGA 2B9UA 1VBE2 2HWF2 1S0FA 1XE7A 3JBG3 5T5LA 4JCKA 1H1MA 3J4UH 1PNGA 2G9GA 4IERA 3MICA 4OZXA 1MZFA 2XBO2 1VBA2 3B7MA 1DBNA 1ZYBA 2D6LX 2VU9A 4XFHA 2B45X 2IFRA 3ZN6A 3CNAA 1VB2A 2C9AA 3MW2A 1A8MA 4YZ3A 1ULGA 5J48A 3HT2A 4E4DX 4RFT0 4FTEA 4OHWA 4Q4X1 3MW3A 3DPRB 3T2TA 1CVNA 3IT8A 1OFSA 1ZZ9A 3U4XA 3VBFA 4CP0A 4Z92B 3WT3A 3H3UA 1FOD2 4K20A 4RS5A 1MS0A 4RQPC 3AP7A 2GNMA 2CTVA 1GICA 4FTSA 1BBT2 2YROA 3VZNA 1YCIA 5JIUA 1LGNA 1HLCA 4MV2A 1BVVA 1LB2A 4JAAA 3B02A 2DUOA 3O0XA 1EV12 4MXWA 2HWE3 4OUSA 2EVXA 4YG0A 3VBSB 1PVXA 1NYWA 2CWMA 3MIEA 4WVVA 5I0RA 2ZGOA 5F1RA 1TE1B 5FDBA 2PHTA 5H9QA 5IK5A 1LHVA 1ENXA 1SFYA 3WHTA 4AHYA 1CAXA 1BKZA 2QVSB 1BJQA 3VKNA 1CONA 2Q4SA 3BODA 3MZHA 1S0JA 4GB33 1QDCA 3BCWA 5K7PA 4MGYE 4E2SA 1LULA 2OW4A 3ZXJA 2I74A 1U12A 5BY5A 1O5LA 5EV7A 3AKTA 3WHUA 4JGYA 2ZGPA 4C1WA 1GLHA 2AH2A 4IEXA 2WLPA 4CDQA 4Y1ZA 2GNDA 3KS7A 5ABJA 1SBFA 1PHMA 4CEWC 4HVRA 3J8F2 3FHIB 4XJAA 3MIDA 4FPLA 5K0UA 1C8M2 1MZ5A 2HWB3 3LKJA 5A3MA 1HRI1 4EN7B 1AYN2 1JTZX 2KA3A 4Z1VA 2XPJA 1MQTB 4FOYA 4BLJA 5DUVA 2BTVC 3MLLA 4AQTA 1W6NB 1DIWA 2KXLA 3GHMA 3E6CC 2VOXA 4CEYB 5H9SA 1D0HA 3HD8B 4KNCA 5BNOC 2NZ9A 2ZAHA 4Y26A 2E6VA 3O14A 4FBFA 1NCRB 1F5JA 3NV1A 4CP1A 1QMJA 2D3SA 2JENA 1WUVA 5FLIA 1N3QA 1MZEA 5LK5A 1D4M1 2P3KA 5JR7B 5EJ3A 4YGCA 3ZFFB 4HPKA 5DG2A 1G8WA 2FZ1A 2GN3A 4FXGB 1S0IA 2NQYA 1CR7A 1ZZ6A 4HKWA 4XBQA 4AEDC 1AL21 3WUDA 4COWA 1OQ1A 1SCSA 1WCKA 3V56A 5JZGC 5C9AB 5C8CA 4AQSA 4PIXA 3EBRA 1CAWB 3DF0A 3ME2A 1JYCA 4M3CB 2ZZQA 3I7DA 5H9RA 5AFBA 1Q56A 2X5IC 3IMNA 1DZQA 1EAH2 4LBMA 4LEJA 5JOWA 2R062 3U11A 1GBGA 2A73B 3QBQA 2WL1A 3SHRA 4RA0A 4YVSC 5JMCA 4AF9A 1H30A 3A0NA 3ROUA 4SLIA 1PGW1 3AFKA 3SCGA 3B94A 1AX2A 4L9BA 2MEV3 5BNNA 5JIAA 1PNFA 3AJZA 3M3OA 1PVC1 3OGGA 2QZ3A 2RS12 4AFDA 1U5YA 1PZ9A 2ZBJA 3WXPA 4QGLA 4E27A 1ZBA1 2BEOA 1QJX3 2BWAA 4LO5B 4Q0QA 5BNPC 3VKMA 4IQPA 4F7ZA 2Z79A 2QJVA 4COZA 3J26N 1QJY1 2EALA 1N3OA 2GC0A 5CBLA 1MS3A 4RQPB 3ATGA 4P9GA 2AYHA 4E2GA 5BNQA 1O4YA 2VNOA 5KHIA 1CAUA 5KC5A 1RHI3 4IEWA 5EXOA 1LHOA 3POWA 5L7OA 1KS4A 1RUE1 1CPMA 3OYWB 3OJBA 2P3JA 3N7JA 1XE8A 4XFBA 2HEWF 5IK8A 4AG4A 1D2SA 2RM22 1UZYA 4Y1VA 4L92A 2VNGA 1GNHA 4DINB 2DUPA 1S55A 2VECA 1Q3EA 4KU8A 1AUYA 3AMPA 4NR1A 2ZACA 3MIGA 2JG8A 2K0GA 4AW7A 4N7IA 4XBNA 1QKQA 4LLFA 3ZFGB 3ZYGA 4PDWC 1X50A 3LWCA 3D4KA 2GC1A 1ZA4A 3KCYA 5TSWA 3AB0A 3WP5A 1C4RA 1RMU2 2NYYA 1BCXA 2DUQA 2FQPA 4CDXC 3WW2A 4AI3A 4KG8A 2YXSA 2D5HA 4FOQA 1R083 4CEWB 1HQNA 4IXLA 4FOVA 1ZRDA 4IV3B 4D69A 2HEVF 5T5PA 3WDTA 1Q5OA 5JI9A 1RL3A 2ET1A 1TMF3 3MIBA 1LESA 2MEV1 4XFGA 1RUC1 3IWZA 1ULEA 1H2KA 5KHHA 2OUJA 3JBG2 4P9LA 1SACA 2D98A 3RWNA 1RUI1 1URXA 1BEV3 1A78A 2DWRA 2Z69A 1S0EA 1ULCA 3O5SA 3WY6A 1F2NA 4DRVA 1N1YA 2BPA2 1WLTA 4Q0SA 2GH8A 4AI0A 1RB8G 5CVRA 1QXPA 3PMSA 2XJPA 5FRAA 5HI0A 1DU3D 4K1ZA 2WJSA 1CAVB 1Q8PA 1HIXA 1SLLA 1Q8VA 4BPZA 1FATA 4I02A 3WCSA 1RJ7A 1V6IA 4UW4A 4AEDB 1LEMA 4GKXA 1RC6A 2XVLA 2XJVA 1UIKA 2BQPA 3AK0A 3KD4A 3B3QE 2X5IB 2DVBA 3TNQA 4CZSA 1PO23 1QJZA 1Q8QA 1RVF1 1SBDA 2MPFA 3CJIC 1O3SA 1PK6A 3VBUC 4IESA 4V1PA 2SLIA 1TME1 1WMDA 4N53C 1Y9QA 2UWBA 1S0GA 3M3QA 5CAZA 3URFA 2BFUS 4GB32 5BYNA 2DCJA 1FPN2 4M3CE 4Z8BA 4WZCA 5JOZA 4MGIE 1BZWA 2XKOA 3PVEA 5LRSA 1QQP1 4GULA 1VBE3 2PHUA 4HETA 5CIRA 3EQEA 1G9FA 3E6BA 1I1EA 3WNXA 4Q0UA 1TEIA 4YM1A 3KQRA 4ISRA 4ORFA 1LR5A 1W6MB 5ACA3 2AZ5A 1R092 2OZ6A 2HWB2 5GALA 4E2QA 4JVAA 1LCLA 3WUCA 1K5MC 2ZA9A 4IEZA 2ZHLA 5DZEA 2VW0A 1DGWA 3NWKA 1KQRA 3ASIA 2R071 3L2YA 1AF9A 5FLJA 2WA3A 4TWTA 4QT6A 5D8AC 3AYCA 1OA3A 3IPVA 4AHWA 3KCCA 3NSTA 1ZVFA 3AMMA 1W0OA 4YGDA 3USUB 4Y22B 1HW5A 4CYDA 3B69A 2LTNA 3I8TA 3KLSA 4NVPA 2A7AA 2IWGB 3ZDSA 4META 5AC91 1AR81 1SDWA 4XFFA 3NV3A 1RGSA 3ZPYA 1WCSA 4A2UA 4JV4A 3APBA 4PDWB 4AVAA 4QPIA 4H14A 5EZWA 4OULA 3SMHA 2N7GA 4LO8A 4I0WB 4YW4A 4NO4A 2VVDA 1KFUL 4COYA 1Y3TA 4CDXB 2O0OA 4GWNA 1AX1A 4B4QA 1OOPA 3GNEA 3UK9A 4Q27A 4JRAA 3VBFC 2WT0A 4ASMB 5I91A 4YZ4A 4RS5C 2X53S 1PIV1 4YW2A 3VZOA 4JGZA 4QQ2A 1N47A 1KITA 1J58A 2D6NA 3RYKA 2HEYF 4FT8A 4BWOA 4BYYA 1ENRA 1SLAA 4YVWA 2CL2A 1HRV2 2DFBA 2NMOA 3KCXA 1HXS3 1RUG1 3AZWA 5SV8A 4MGZE 1LOEA 2WIIB 3WG3A 3LCPA 1UPSA 3WG4A 4W65A 1B09A 2XLFA 3AYAA 3JB4C 1UMZA 1ND2B 1XRUA 2HWF1 2VH9A 2ZKLA 1AYN3 1NLRA 2O8OA 1XYOA 4I3GA 2ENRA 5GLVA 1NE6A 1QJX2 1BVP1 1WA4A 2XBO1 4OUMA 2JKBA 1VBA1 2V09A 2ZMKA 3SISA 1PMIA 3AZXA 1ZRCA 5DZGA 4FPJA 4XQDA 2BWCA 1ND3C 1IS6A 1UCXA 4COVA 2JEMA 3O0VA 2NM1A 2EXIA 4CRQA 4JGYC 1QXJA 1YUDA 2VVEA 1RHI2 3QCWA 4QXKA 4CDQC 4R9BA 3HT1A 1FOD1 2IXJA 1XNBA 2WZR3 2W52A 1C3HA 5ABJC 1JUHA 1BBT1 1AR92 4S2GA 1O3QA 2YGMA 1QJU1 4ITCA 5K0UC 2I07B 1UX6A 3LSDA 5A33A 4KWJA 4EWDA 3AMHA 2GH2A 3CJIB 4Y1YA 3QACA 1EV11 1EY2A 3AMQA 3AYEA 4GMP1 4Y1UA 1S1AA 2I2SA 2ZMNA 4QPGB 3I59B 3DKWA 4RSUA 3THPA 5K9YA 1AVBA 4YM3A 3USSA 1QHDA 5I8YA 1EAH3 4LBQB 1F5FA 4YSFA 1EYBA 4HKLA 2QUOA 3VBRA 1H2LA 1APNA 1Z7S2 4HFSA 4P9WA 1FX5A 4ATFA 4AVBA 1H8TA 1REFA 4LBQD 2ZCWA 4X6QB 1R082 5KBFA 2OUHA 4WVZA 1W39A 1U5XA 2WKKA 3M4FA 1LU1A 2DF7A 2JE9A 1LTEA 2VW2A 5EFUA 3TRSB 1UKGA 2A6WA 1K5MB 5C4WB 3R05A 2PHDA 3D82A 2PYTA 3WP6A 1Q8OA 3J8F1 1KXGA 4QU2A 4BMEA 5C8CC 1NA1C 1C8M1 3OGJA 4B29A 3LA2A 1AYN1 4Q4Y3 4EV0A 2TBVA 3E5UA 1VJ2A 3VUOA 5C33A 1H2MA 4XXPA 4YARA 5FO8B 3OPZA 5JSOA 5JVVA 2D6PA 1OA4A 4LO4B 1PGL1 1ZZBA 4XW3A 4ZXKA 4QGNA 1S0DA 3E5QA 3FBYA 3MIFA 5BNNC 2R0FA 4NN0A 5FPZA 2YY1A 4AFAA 5JSRA 1W6PA 1DDLA 4XDQA 5J96B 4AEJA 1DG6A 1QH6A 3ZN6B 4BM8A 1JBCA 4XJ8A 1U5ZA 5FREA 1AYM3 2DCTA 3JD73 1TNRA 2GNTA 1W6QA 2CNAA 3ZXLA 1POV1 1CIWA 5F6LB 2QFEA 2B7YA 5J3UA 2WNVB 5I0UA 4Q2FA 1SLCA 2LM3A 4RS5B 5FAXA 1C8NA 3ZMNA 1PO22 2VOKA 3W9AA 5AVAA 2ZKNA 1H4GA 1R1A3 2RJLA 4G4FA 4XJ9A 2VUAA 4PBOA 3UV9A 1EAH1 4JDMA 2R061 4HT1T 4K21A 5C8WA 2WFF3 4N43A 5SV5A 1JN2P 4DFSA 1RUJ1 3BALA 1CAXB 5FOJB 4IEUA 1OFNA 1SLIA 2D6OX 2JG9A 1Z0HA 4M01A 5HCBA 2JG8C 3RRDA 3B01A 2BVBA 2B42B 4LE3A 3SCHA 4QHBA 2RS11 2ATFA 3E5XA 1JOJA 2IFWA 1XU1A 2NLRA 1AX0A 4L11A 2Y38A 5ACA2 3GF6A 1ND3B 3O0WA 4IL7A 3RYRA 1REDA 1LOFA 2GN7A 3DN7A 1I3HA 4FPYA 4AVCA 1IZ3A 3ZO0B 2H0BA 1DQ4A 5CA6A 3IIAA 2E63A 3ES1A 5ABJB 1ZREA 4OLLA 1VBB3 2YV8A 2YGLA 5K0UB 4NHKA 5AVPA 1LOBA