1CAUA

Determination of three crystal structures of canavalin by molecular replacement
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
b'AQNNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CANAVALIN
publication title Determination of three crystal structures of canavalin by molecular replacement.
pubmed doi rcsb
source organism Canavalia ensiformis
molecule tags Seed storage protein
total genus 37
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cauA00
2GH2A 3MYXA 2KXLA 2DCTA 4XF0A 4F7ZA 4J1XA 3ES1A 2N7GA 2Y0OA 4I02A 4UBGA 3QOPA 4WBBA 1Y9QA 4N9IA 4K8FA 1ZNPA 3CF6E 1UW8A 1ZZ7A 4EWAA 4MGYE 1RUOA 1J1LA 2XKOA 3FHIB 1OI6A 1ZVFA 1XRUA 2WC2A 4FAGA 5JAXA 2XLAA 2D5HA 4QGMA 1SEFA 4XF3A 1LRHA 3GYDA 3MDPA 5CADA 5FQ0A 3O14A 3G7DA 1Q43A 2GC3A 4IERA 3H3UA 2IC1A 4Q0VA 2C0ZA 4MGKE 3OF1A 3ST7A 5FDBA 2QDRA 4I01A 1VP6A 5KHKA 3I54A 2GAUA 5C6CA 1ZX5A 3PLQA 1U12A 2HKXA 1ZZ6A 4QMAA 3UKVA 4IEPA 3KSCA 3OGJA 4AQ2A 3RDIA 1NYWA 4IEYA 4IEZA 5E16A 4XFGA 2XGXA 1ZZBA 3H50A 1FI2A 1VJ2A 4IEXA 4XF4A 4EWDA 1JUHA 4QGNA 3KCCA 4JTOA 3ELNA 4X6QB 1CAUB 2Q30A 3B02A 1CAWB 3M70A 4A2UA 3OTFA 4GULA 1J59A 1CAXB 2QNKA 5JCTA 2PHLA 4NVPA 5FLHA 5FCCA 2VQAA 3VHRA 3CEWA 4P9GA 4B29A 3RNSA 4JTNA 1Q3EA 4I2OA 5F1RA 2ZKLA 1WLTA 1CX4A 4EROA 3L2HA 4I09A 5BV6A 2ET1A 4EV0A 2K0GA 3H3ZA 3E6DA 4Q29A 4DINB 4LA3A 4HMZA 2GU9A 3USSA 2VECA 5KHJA 2I45A 3IBMA 1CGPA 3NW4A 5FLJA 4KU7A 1O3QA 2CV6A 4HN1A 5T3NA 4QXKA 1YLLA 2H6CA 3I7DA 1I6XA 4E2GA 3D0JA 4MH0E 1TQ5A 1GQGA 2ATFA 3H1YA 2UYAA 3E5UA 3NL1A 1X8MA 1H1IA 4ZU7A 3WW4A 4YRDA 3ES4A 5EZWA 3R6SA 5FPZA 3CL1A 1DGRA 4HBNA 2Z69A 4QM8A 3E97A 4PJYA 1O3SA 1O4TA 4LULA 3EO6A 1PM7A 3RZZA 1YFWA 4O9GA 2D5FA 1X8EA 1EPZA 4QX5A 1ZRFA 4D7SA 3E6CC 4D7TA 3UKNA 1SQ4A 1RGSA 5I8YA 5D1IA 2PQQA 3RPQA 4AXOA 4XFAA 2OPKA 3LA7A 2H6BA 2WFPA 3IDBB 1WGPA 4HZFA 3DN7A 4YNIA 3UKTA 4HSLA 5BUVA 4FBFA 4HVQA 3IIAA 4IEWA 1OMIA 2XL9A 4HLTA 3CLPA 3H9AA 2EVXA 2EA7A 2V09A 1G6NA 5FLIA 3N4MA 2GZWA 4ZU4A 2IXJA 3IWZA 5J48A 1EYBA 2H0VA 4L2NA 3S7EA 1ZRDA 1YFYA 3LZZA 2GC2A 3CO2A 1XE8A 3EHKA 5JR7B 1CAUA 1YWKA 4FT8A 2ZCWA 3NJZA 1CAWA 1CAXA 2Z2SB 5J7MA 2F4PA 3H1WA 5I8SA 2PA7A 4YYOA 4MZUA 4Z82A 3HQXA 4Q0SA 2ETEA 5KBFA 4YSFA 3S0MA 2IXHA 1J3RA 3EJKA 3IDCB 4LTAA 2OZ6A 1DZTA 5BXXA 4E2SA 1LKNA 1QXJA 4I0BA 2BNNA 5BPXA 1LB2A 1HW5A 3KGZA 2O1QA 4HSJA 2BYVE 1FXZA 2Q0AA 3D0SA 5J3UA 3FZ3A 2HJIA 2B5HA 1J58A 2BEOA 3RYPA 4IESA 2XKPA 4MGIE 4L11A 2IXLA 5I0SA 4EWEA 4IEQA 1OD5A 3FX3A 1SFNA 1UD1A 3EQEA 3WW3A 3FE5A 1YHFA 4F8AA 3SHRA 2QCSB 3E5QA 1OFNA 1WA4A 2XHKA 3BCWA 4BHPA 4UBHA 5C8WA 1ZZCA 4LLOA 3LA2A 1LR5A 3KMHA 1ZREA 1QXRA 1IPKA 4IEUA 5AVPA 5BY5A 3MZHA 3BB6A 4QM9A 3I59B 3LOIA 3SCFA 2PAMA 3ZDSA 1ZZ9A 3PVBB 1RTVA 4I0AA 1QWRA 5FPXA 3WW1A 4BH9A 3FJSA 4UXAA 1CAVB 4Q0QA 2PFWA 2MNGA 2GC0A 2MHFA 1UIKA 5JSRA 4OLLA 2PTMA 1RL3A 3NVCA 1ZRCA 2MPFA 2BNMA 4XEZA 1NE6A 3LAGA 3H8UA 4XFHA 3MPBA 3NKTA 4KWJA 4LEJA 2IXIA 3CJXA 5K8SA 3LA3A 2B9UA 4XFFA 5E1RA 1UIJA 4OFGA 4TLFA 4Z07A 4LA2A 1O5LA 4KWKA 2BGCA 4LUKA 4XFBA 2CGPA 2D40A 4IEOA 1UCXA 3E5XA 4JV4A 5LRRA 3U10A 1NE4A 3FWEA 4IETA 1J3QA 4AVBA 2XLFA 1Y3TA 5I0RA 5I8TA 3NSTA 3ETQA 4ZU5A 2OYZA 3M3IA 4N9HA 5CU1A 3RYRA 1YUDA 4MV2A 1EY2A 4HVRA 1NXMA 3JZVA 4RD7A 4XFCA 3BPZA 4HVOA 3DL3A 4MX3A 1YFUA 2QJVA 5I91A 2PAKA 4BIFA 3BU7A 2XL7A 3C3VA 5KHHA 2E9QA 4YARA 3GBFA 4ONUA 4KL1A 1X82A 1DZRA 4XF1A 4XETA 2UYBA 3S7IA 3E6BA 3H7YA 4PIZA 5LEKA 1IPJA 4MGZE 2Q1ZB 1DGWA 3QACA 2UY9A 3BALA 1UPIA 4ORFA 3OCPA 5I0TA 5FQ0B 4FAHA 5LRSA 1PMIA 4QGLA 2FQPA 2ET7A 4AVCA 2K9ZA 3EBRA 1J3PA 1NZCA 4X6RB 2PAEA 5I0UA 3OD0A 2D93A 4R8HA 3I59A 1V70A 4H7LA 2BNOA 1ZRRA 4PIXA 3U11A 2OZJA 4XF9A 2IXCA 1Q5OA 3DKWA 2IXKA 4XFIA 3SMHA 2P17A 4AQ6A 2XLGA 1YFXA 1I5ZA 1CAVA 4META 4E2QA 1XE7A 3HT1A 4I3PA 1H1MA 3FFQA 1RC6A 5HI0A 2B8MA 3H1MA 5EFUA 1O3RA 2UY8A 2EAAA 4R52A 3H7JA 3KGLA 3HT2A 4Q0PA 3U0ZA 3RYKA 3DV8A 5LEJA 2QVSB 5JSOA 3PNAA 3ROUA 1X7NA 3LWCA 3TNPB 3SXWA 4KWLA 2GC1A 4AVAA 2PYTA 1QY4A 1O7FA 4JVAA 2O8QA 3TNQA 4Q0UA 2OA2A 1FT9A 4HN0A 4BYYA 2Q4SA 3D82A 2CAUA 3SCHA 5KHIA 4PIYA 4MUVA 4KU8A 2PHDA 3HIFA 4O9EA 4WVZA 3SCGA 3WW2A 1L3JA 4CYDA 4J1WA 4IEVA 4LUMA 1VR3A 2FMYA 5JSPA 1RUNA 3ACLA 5CVRA 1EP0A 1GQHA 5KHGA 1O5UA 2VPVA 1O3TA 4WZCA 2CAVA 1ZZ8A 5I93A
chains in the Genus database with same CATH superfamily
4XAAA 5F7UA 1RUNA 1H2MA 2ZX3A 3MYXA 4CUAA 2KXLA 3IAQA 4XF0A 4AFAA 2Y0OA 3VBFB 1VE0A 3QOPA 2C26A 2DWRA 2J1EA 1PZ7A 1VMJA 1W0OA 2ZGTA 3T30A 3VBHC 3ZXKA 5J37A 2ZGPA 5GJ6A 3AZZA 2ZMKA 3GGLA 4EWAA 5K0UC 2DDUA 5FZDA 1RUOA 2RR11 2YC2A 4W65A 2PLV1 5C3SA 1OI6A 3WNXA 3M4FA 4YG0A 5HV4A 3GZTB 4YW7A 2D5HA 5HCFA 1JYXA 3ZIXA 1RUD1 3J7LA 4MHUA 4XF3A 4G9SB 2R0HA 2RG4A 2HWF3 1C28A 3GYDA 4OMCA 2J1RA 3VBUC 5IAVA 3G7DA 2GC3A 3CU7A 5F5AA 3WDYA 1FV3A 5HV0A 1W03A 1VB2A 2QQOA 3Q8EA 4CDXA 1AR92 4COZA 2C0ZA 1Y43B 4MGKE 1Z78A 2E6VA 1JOBA 3MIEA 3ST7A 3ZYHA 3GHNA 1HJFA 2XJQA 1LGCA 5DAPA 1HV1A 3J7MA 2Q8OA 4DY5A 5A3NA 4Y1VA 3OJBA 1AZDA 1IZ3A 5JIUA 3B94A 2ZKNA 2X29A 1JBCA 3EYPA 4LKDA 1U12A 2HKXA 3ZN5A 3S6PA 3T2OA 5JMCA 2ES3A 3SH4A 1N3OA 3RS6A 3HNBM 4RS5A 3OGJA 1HB3A 2YPDA 2BOJA 2OPWA 1AR72 5CFCC 1MVEA 5FMOL 5E16A 1CVNA 2BGPA 1YO8A 3BKZA 2RS51 5AC91 3WDWA 3LPGA 1VJ2A 4IEXA 1BVVA 2K2SA 4JKKA 2FDJA 5DUWA 4ZXKA 1SCRA 2A3XA 4XHXA 3VBRA 2BP6A 4CDQA 4WV8A 4B8EA 3PVEA 3ZXFA 3DPRB 4BM8A 3I3BA 1DYOA 3N9OA 5KWRA 3OTFA 5FUIA 4XPVA 1ULFA 5A7NA 1FOD1 1TMF2 3M3OA 5CAZA 4S2HA 4D0QA 2E7QA 5TSWA 1MS5A 2XJPA 5L19A 3KM5A 4CP0A 1R081 3LSDA 3VHRA 1F4HA 3KT7A 5JI7A 1H8TB 4P9GA 4GH4A 1H9WA 4JTNA 3WG2A 4CUCA 1GFF2 2ZKLA 2A6ZA 1JZ7A 1WLTA 4ATFA 4XYXA 4YZ3A 4HK9A 5FZ0A 5C71A 5CEHA 2WDBA 1W99A 3KV4A 1ODNA 3R4DB 3WQ0A 2W91A 5BV6A 4Q4W3 4QHZA 1O6UA 4EV0A 1ASJ3 2GN3A 2ZZQA 2QQJA 2XWBB 4PI2A 4QU2A 5L9VA 4HMZA 2JXAA 1RUH3 3USSA 2WNUC 1S0DA 2JDYA 4NJ4A 4CU6A 1ULOA 2I45A 3VZMA 1CGPA 2GP3A 3PDQA 4L0PA 5FLJA 5IVJA 1O3QA 2CV6A 4HN1A 2PXJA 1PMJX 3AK0A 1YLLA 4ZY9A 2HWC1 3I7DA 1S1AA 1V9U2 5A7PA 1I6XA 5DDJ3 4CCDA 3D0JA 4E2GA 1PGL1 4IE7A 4MH0E 1MS9A 4UFLA 4W6WA 1AX0A 3RMYA 3UESA 4DY3A 1GQGA 1W8HA 2ATFA 1BBT2 3HQRA 4BK4A 3WQ7A 2UURA 5FP7A 4DRVA 4XE9A 1OURA 2VMDA 1BMV1 1VBE2 3P5BA 3RI9A 1OD3A 2MEV1 2ZBJA 4QX0A 1AJOA 2WL1A 4YRDA 5LB6A 3R6SA 1AJKA 1LOFC 2F17A 1ENQA 4HBNA 3R0RA 3ZFFA 4PJYA 3MIBA 2Y64A 1PM7A 3UK9A 1REDA 4EE2A 3ZMNA 4Z92B 1EPZA 4HKWA 1KFUL 3FL7A 1AYM3 1D0HA 3UETA 5FK7A 4Y4YA 3MLLA 2ZPXA 2CNAA 4A4AA 2VZ1A 3I49A 3E6CC 4NIAA 4L8QA 3BODA 4H7MA 5L7OB 3O1VA 1PNGA 4O65A 1WLWA 1GNZA 5A33A 3RPQA 5C8CB 2DU0A 3HNMA 3HNYM 2FDFA 5A7OA 1Q8QA 3POJA 5LA1A 1FNYA 2D6KA 4NHLA 1OLME 1WGPA 2VZSA 4HZFA 1C57A 2XVGA 5DZFA 5FZAA 3V64A 5EYXA 5KC6A 5K7PA 1POV3 4HVQA 3TOJA 1REFA 2W68A 3IIAA 2LW8A 5C9AA 2XL9A 2W9XA 2WT1A 2P34A 4ISQA 3H9AA 1FPN2 2VL4A 1PMHX 1G6NA 3T2PA 4CDWC 5C4WB 2JG9C 2VY0A 4Y26A 5CZKA 5FLIA 5T52A 2EALA 3AKTA 1WMFA 1LOCA 2ZGUA 1V6JA 3DUIA 1UX6A 4L2NA 3PJYA 4GMP1 5F3EA 5ACA2 2PHRA 1S2EA 2WLPA 3LZZA 5LCWL 2DFBA 3WHTA 3AYAA 2DBNA 4CZSA 1YJLA 2ZCWA 2VZOA 3ILNA 3NJZA 3OEAA 5GM0A 1CAWA 3ZYIB 1CAXA 1D0GA 2DF7A 3UGGA 5FYUA 2VW0A 2E26A 1OKQA 3H1WA 3VZKA 1MS0A 2PA7A 2DVAA 4Q0SA 1YNAA 4LHSA 5FYSA 2D6MA 4QPIC 1VAMA 2JJ6A 3C8XA 4OCTA 4BB3A 2VOVA 5FYHA 5FZFA 5A1LA 1W2NA 1AR91 2IXHA 2R043 4QQPA 4YZ4A 1J3RA 4C1XA 1UZ0A 4BPZA 1W6MB 4DEVA 2DCYA 1LEDA 1MEC2 2OZ6A 2VBPA 1JOJA 1DZTA 2XG3A 2Y6GA 4UF0B 2AEZA 1HB1A 1OLRA 3H0OA 2CDPA 1QJY1 3PVOA 1QXPA 3CMGA 2X5IC 3O1OA 1ACCA 1QIQA 3WF4A 2BYVE 4Y1YA 4DO0A 1OSGA 3TAYA 1XU1A 1VALA 3TEXA 2TNFA 2V72A 1Q8PA 1PVC2 4K21A 4BZ4A 5JXHA 2F4LA 3DYOA 1UL9A 1TG7A 4BLIA 4FFFA 3U4SA 4B7KA 1R093 4MGIE 1MS8A 4L11A 2WA4A 3P3PA 3WNNA 1SLBA 4JQRA 2GNBA 4OI2A 2IXLA 1RUJ3 5GLUA 3KCXA 5JZGB 1QMJA 2HEWF 1OD5A 4Q4V1 4QXBA 3O1RA 1O59A 5GLWA 3WNLA 2IVIB 5LZ6A 4EQVA 4YZ2A 1NUKA 1RUF3 4JDNA 1OKOA 4XIKA 3FE5A 3I4IA 4CP9B 1H2LA 2RS12 4XUQA 4D94A 2AEYA 2YPJA 3E5QA 1DYKA 1OFNA 1R1ZA 2W5FA 5FZ9A 3ZYRA 5F32A 2R072 3FBMA 4AI2A 4JCKA 1QXRA 5ABJA 1UXXX 3LEIA 1YEWA 2AREA 5DAQA 5AVPA 4BMBA 1W8ZA 1WW4A 4A41A 1W6NB 5BY5A 3ALQA 3I59B 1CZVA 4A7KA 1VAKA 5FZKA 1XNDA 2PAMA 1DQ4A 4BIOA 2C24A 2J1SA 2HWB1 5IATA 1RTVA 4YWAA 1KFXL 2C6SA 4QPWA 1QU0A 1GV9A 4BH9A 3MV01 2B42B 1DLLA 4HONA 4CE8A 2Y26A 1SHWB 1PGSA 2DVBA 2ORXA 3VZJA 2WWJA 4IE6A 1GP6A 1UIKA 3SQOA 4XCAA 5JSRA 1W6QB 3PUSA 3D8CA 4YW5A 3WF1A 1F9KA 4Q27A 5IJRA 3LAGA 3R4UA 2LTNA 1K5JA 3GBWA 3MPBA 4AFMA 1H6YA 4DXTA 5LW9A 3NKTA 4KWJA 1LGBA 1SLAA 2R1DA 3JU9A 1UYYA 3LA3A 4MSVA 4Z2AA 1V9U1 1YJKA 1RUC3 2B9UA 4RQPC 5JLVA 3IAPA 2P4EA 5IUQA 5F2SA 1BBT1 5FO8B 1BEV2 4LBJA 1V0AA 1G8WA 3FN9A 1O5LA 3HPNA 4LA2A 4N7IA 4YGDA 5KXCA 4IE4A 3AL5A 1WLDA 4A6SA 2A71A 3TN92 2D3PA 3NV3A 4AVTA 4AYUA 4JV4A 5LRRA 4A3ZA 4GA9A 4DUXA 1VAVA 2WNVB 4K8RB 3WV6A 1QOTA 1ZA7A 2GMEA 1X36A 5LY1A 3VDBA 4C8DA 2JE9A 2JDZA 4Q2FA 3PIGA 3J8F2 2DBIA 2VBDA 5FREA 2L9LA 3S57A 1S0IA 4XTMA 1K5MB 1RUG3 1UYZA 4ZU5A 3Q8FA 5LK5A 5IAXA 4R9AA 5CU1A 4AW7A 3I2FA 4N8MA 5B2GB 4FOVA 2DV9A 4HVRA 1APNA 1NXMA 5K4LA 2WLQA 3GDBA 4H14A 3R4SA 3ZPYA 5CKMA 1S0GA 1UPSA 1YFUA 3WQ1A 2NP0A 3BU7A 4QKDA 4UFIA 4WVVA 2O0OA 5KHHA 1BHGA 5J96B 4YW3A 4RA0A 1FPN1 1PIV2 1XJAA 2JG8B 4ONUA 2VZTA 4GKYA 2WZR2 3K4DA 1DF0A 1X82A 4A7ZA 5BNPB 3GXUA 3T2QA 3V0BB 3N9QA 4CXYA 4WM8B 1DDLA 2WZPP 4NOTA 2Q1ZB 2JDPA 2QTWB 4H2AA 1PO22 5BNNA 2QQLA 1V6MA 2UY9A 4HKOA 4MLOA 2A6WA 1GZWA 3HVDA 4PDWA 3NNFA 2Y6KA 1UKGA 3OCPA 4Q4Y2 5I0TA 3ZXGA 1QJX3 1PMIA 1QJU3 3VDDC 3OYWB 1HQWA 4PHZA 1CN1A 3CJIC 4QGLA 2XBO3 2ET7A 2W46A 2ZMLA 4YPJA 5BNOC 2G4IA 4XJUA 2WT0A 1W9WA 2VMCA 4NHKA 1UU4A 4CCJA 3KF3A 3OD0A 4IGQA 4R8HA 2UU8A 4CTEA 4ZKTB 1EV13 2R061 4NAOA 5A7WB 4Q4X1 1ZRRA 1GICA 2BTVC 4RYDA 1NCQA 4N53C 2WSVA 4PDWB 4YZ5A 1O8SA 2GALA 2W39A 3AMNA 3GNEA 4NPRA 4Q1PA 3VLBB 5C3OA 3DKWA 1V00A 2JD4A 3WNOA 1HXS3 2A6YA 2IXKA 4H3WA 4NIIA 1RUI2 3VBOB 3VBSA 3J26N 1SDWA 2WFF2 4JGZA 3WNPA 1UY2A 4E2QA 4KNCA 4RGAA 1H1MA 3FFQA 4G4FA 2WN2A 1PVC1 1UQXA 3VDAA 4KGQA 4AEMA 3N9PA 3ATGA 1O3RA 4D6SA 1SFYA 2JENA 1I3HA 3OOXA 3A4UA 3H7JA 4R52A 3HT2A 4M01A 4Q0PA 1AL22 1VBA2 2Q8CA 5LA0A 2Z42A 3AJYA 3JD72 1W06A 2AC1A 1QQP2 4IXLA 4Y1UA 4R9CA 1X7NA 4AI9A 5EJ3A 3AXDA 2EF6A 3WUCA 5D8AC 5L73A 4LR4A 3M3EA 4N43B 3SXWA 1NA1A 1JI6A 2GC1A 2RS11 1HRV1 3U37A 1QY4A 5EHDA 3PMSA 2R071 3OBAA 4JVAA 1ZBA2 3LQCA 3ITQA 3BTZA 1PZ8A 2GMPA 4D6QA 3WG4A 2ZAHA 1DQ5A 3LDBA 1YQCA 4PF5A 5KHIA 1AYN1 5T55A 4LE4A 1S2BA 3JQXA 4MUVA 4XDPA 3NAPA 2PHDA 3N7MA 4K20A 4O9EA 2WO1A 4JHZA 5FZLA 5LASA 4UWDA 5JMOA 5E6HA 1D4M1 4AVSA 2VQUA 1ODMA 1NZIA 2RE9A 4EYUA 4DIQA 3K77A 1VR3A 1PK6C 3MF9A 2W1UA 1JN2P 4NN0A 1SBDA 2JDHA 3GF6A 4YVSB 3AKQA 1A8DA 1EP0A 2YC0A 3UGFA 5KHGA 4KG8A 1VBD3 3L9JT 3WEZA 2FD8A 2E32A 5A80A 1W6PA 5LATA 4WZCA 2JIJA 4NRQA 1ZZ8A 4OHWA 2WKKA 1CESA 2GH2A 4BMEA 4NRPA 1AVBA 4CXXA 3UJQA 2ZGRA 2DCTA 4F7ZA 3ACFA 3P3NA 5DAWA 4AWDA 2LS6A 3ZN4A 5C70A 2OIIA 2P3KA 4E27A 1MQTA 2VTXA 1OLQA 1UOFA 4K8FA 1UY1A 3CF6E 4RFT0 2BZDA 1MZEA 2AH2A 3MIGA 4PQQA 3WZ1A 5FPUA 1FATA 4GWIA 5D2AA 2Y6FA 4FAGA 2KM2A 3OGVA 5CKQA 3TN91 2X8KA 2XWJB 3JBG3 3POFA 1DU3D 2RJLA 1IS4A 2NPIA 4NPMA 2EXHA 1MR5A 3AL6A 1PNFA 4FPEA 4QGMA 5CNAA 5GLTA 4K9SA 3KV6A 4HETA 4FPYA 3WG3A 4NWVA 5CADA 1XNKA 2VUAA 3WG1A 2RM21 4M3CF 1U5IA 3K2OA 3J8F1 5FXWA 2B39A 5T50A 1RMU3 1ZBE3 4Q0VA 4L92A 3N36A 4WM7A 4XJZA 3ZKUA 4DEQA 1L7QA 4E4HA 4R9BA 4JRLA 3ZYPA 1U5ZA 1GU3A 1SFPA 5A3OA 2NYYA 3VBHB 1COV2 2WQ8A 2A5ZA 5K0UB 2RDQA 4JGYC 2HWE3 3I97A 1GYKA 3PLQA 4AI0A 1N3QA 3BN6A 4CCLA 3VD4A 4CEYC 3OY8A 1G9FA 4QMAA 1YQ6A 4XC9A 4AQTA 4UT5A 4EZHA 2CWMA 4SLIA 3BOWA 5FBZA 1SBFA 2RDRA 3WP5A 5IVVA 1JZ4A 3KSCA 4A42A 4AQ2A 3VD3A 1UAIA 4CEWC 4RN5A 4B4QA 1TE1B 4KG0A 4XW3A 2VXJA 3WOGA 4IEZA 3E1F1 4LOTA 2DU1A 4XFGA 1ZZBA 3AKRA 3THPA 3VBUB 3T4VA 1PIV1 5A32A 2IFRA 2ZX0A 4XF4A 2WZR1 1FNZA 3J7NA 2HWF2 5CFCA 5FMDA 5JDBA 4GALA 5LBEA 5C33A 3ELNA 4LOSA 4AEKA 4NIDA 1CAUB 1XU2A 1CZTA 2RMU2 2A73B 3B02A 4TN7A 4A2UA 4S2GA 1W3VA 1PO21 3I3EA 1A3KA 3MUY1 5F3GA 1YIPA 1PO13 2G9GA 3VHNA 5JPMB 4XXPA 4IUGA 5FCCA 1RXFA 4A3XA 1G9BA 1XQNA 2W1WA 4NAMA 4P02B 1GOFA 3CEWA 1WLCA 3PU8A 4XMAA 5A32B 3THTA 3RNSA 3VKOA 4B29A 5JVVA 4P5HA 4BISA 5CFCB 2D3RA 2YBPA 4YGBA 4BQ2A 1AR63 4RHV2 5JOYA 3B93A 4AE2A 4BQ4A 4XILA 4DXZA 4EROA 2ZMNA 4B4RA 2FCUA 1ND3C 2FZ2A 2JEMA 5GLZA 4Y20B 4BXFA 3MFCA 1V6OA 2LALA 3H3LA 1QJZA 2ET1A 3Q8BA 1UU6A 2VMHA 1X9TA 5F3IA 2IVJA 4XBLA 4OUSA 3POYA 4K7JA 5CFDA 4DINB 4QD2A 4XXAA 1WW5A 3D4KA 3KV5A 1J84A 1J83A 1XNTA 3A22A 3OPWA 4OI0A 1S2KA 2J1TA 2YMZA 1W9TA 3QD6A 1NCRC 1CD3G 5FY8A 5FZMA 5KHJA 2CU5A 3D6EA 5A1AA 3OPZA 1JZ5A 1K12A 1SCSA 2HWD3 3NJVA 5SV5A 3RFRA 3JD71 2RR13 1QQP1 5GZDA 2W94A 1JH5A 4MVTA 2UYAA 3E5UA 4FPFA 4CSWA 1Y4WA 5FXXA 3VBFA 3W59A 5FP3A 3WW4A 4C90A 2QQWA 4Y22B 1ALYA 4Q4W2 1UZYA 2YU1A 5EZWA 5HXVA 1NY72 3PJQA 1Q8VA 5FZCA 4BCUA 1DQ6A 4FI9A 3T0DA 2ARAA 4MYEA 1W9FA 2WNUB 1ZBA1 3E97A 1O3SA 4YZ1A 3EO6A 1HKDA 3J7HA 2XQRA 1YFWA 3RZZA 2GDFA 2D5FA 1X8EA 5FRAA 1RUH2 4OI4A 2QZ2A 4XVHA 2DYCA 2WZEA 4QX5A 4XBNA 3NV4A 4XUTA 1PHMA 4D7SA 2FDGA 1SQ4A 5LA2A 1RGSA 1EAH1 4AHZA 1NLRA 3X29B 4GB33 5D1IA 2YXSA 2OVUA 2R6QA 4JC1A 4XFAA 1SG3A 2WO2A 2CY6A 5DDJ2 3RJRA 2H6BA 2WFPA 2WS91 3HBZA 1FMD3 4HANA 3S5QA 5J36A 1W3XA 2A1XA 1OUSA 1MPXA 4YNIA 5B4NA 3FMGA 1HQNA 4HSLA 1VRBA 4Y5SA 1KGYA 4NIGA 4P9WA 4TWTA 5AC93 3QBQA 4IGPA 1W6OB 3POEA 5J98B 2VOXA 1OHFA 3J4UH 2ORZA 4E4DX 5EIYB 1OMIA 4GJYA 2VMIA 1PZ9A 4LNVA 3USUB 5CG9A 3WLUA 2AUYA 3SH3A 4B1MA 2A6XA 3HJRA 5B4XA 1A6CA 5IFPA 4ZU4A 1UZWA 2GH8A 2BWCA 5FZGA 3RG0A 4QU1A 1QJFA 3SH5A 3ZR5A 1FOD3 1W05A 2VTFA 3CKHA 1AX1A 1YFYA 3N7JA 4QPGC 1N1VA 1HB4A 1R083 1BZWA 1W0NA 3CO2A 3EHKA 3L2YA 3AFKA 4Y5TA 1YWKA 1OLMA 2BDRA 3DPRA 3KHBA 3ZN6B 1SLLA 2YV8A 3FUQA 3LD8A 4RR3C 1JHJA 2Z2SB 3AYEA 4IV3C 1GKBA 1OFSA 5A6YA 2F4PA 4EZ4A 3O1UA 4A6OA 4MZUA 5KBFA 1HB2A 1DFQA 4C91A 2VCBA 4FOWA 4CDWB 3I2KA 2JG9B 4FP3A 1IQAA 1H8TA 3WDXA 4C1WA 1E57A 3ILFA 3GALA 1O8PA 3WXPA 1COV1 5F37A 3VUOA 3BTXA 5A7SA 2VMEA 3EMRA 2BNNA 3ENRA 2EIBA 1HW5A 2WZ8A 1YCIA 1UU5A 1YIFA 3ZXJA 5IHRA 2DVFA 3SLIA 4M3CE 1AUYA 4UFJA 3HN3A 1FXZA 1H2NA 2HWC3 2EIGA 2ZX2A 3D0SA 2P2KA 3FZ3A 4CCNA 5GZCA 1V6LA 3AMMA 1RINA 4OMDA 4CDUC 4QKBA 3ZR6A 3KWVA 1W28A 3BU0A 4MO3M 3AP4A 2GNTA 3ZXDA 2FZ1A 2G1MA 4QPIB 5DG1A 4OUEA 2TUNA 1JZ3A 5IVBA 1UY4A 2V5DA 1B35C 4YLZA 4E4SA 3MBWA 2V4VA 3MGUA 1LHVA 1XNCA 3FX3A 2VZVA 4IEQA 4XJAA 5DXDA 2JDAA 2RMU1 2V73A 3EQEA 2A3WA 2R042 2VUJA 4M00A 5FTTC 2W52A 3NO8A 2R1BA 1F5JA 4CPBD 4V2WA 3SHRA 3WP3A 1WKYA 3AYDA 1LHUA 2X5IB 3LEGA 4YVWC 3BCWA 4BHPA 4UBHA 4Q8KA 2P3IA 1WCKA 2BVBA 4LLOA 3LA2A 1LR5A 3ZLIA 4IE5A 5EQUA 1UN1A 4GWJA 3VBOA 3WP6A 1IPKA 2QE3A 1IS5A 1DGWX 1IS6A 5FKBA 3MZHA 5FYYA 4YG6A 3BB6A 1S0EA 2WRAA 3LOIA 4RHV1 2X05A 3SCFA 4XURA 1ZZ9A 4UW6A 1N1SA 1W8FA 3PVBB 1LU1A 2QQVA 3LOBA 3NJXA 4ASMB 5FY4A 3F95A 1R092 1YC61 2DUPA 5A7QA 3ZFEC 2VOWA 3ZDVA 1WZXA 5L7OA 2PFWA 2MNGA 4O7XA 1WD3A 3MUZ1 5C8CA 1DHKB 1DQ0A 4OVEA 3GBGA 1HV0A 1JYWA 1RUF2 3NVCA 5JPNB 5DQ0A 4DB5A 1RITA 1BK0A 1CONA 1DP0A 3QLQA 2BNMA 3MI8A 4XEZA 5FY1A 1JYVA 5G05L 3NJYA 1IKPA 1CWPA 3WD5A 1TNRA 4NROA 3KB5A 2B46X 2VXRA 1KD7A 2ZGNA 4XUNA 4Z2WA 3CJXA 1S0FA 1VBB2 4GMP3 3UNPA 3DEMA 3PUIA 3C7HA 3ZFGC 3VB9A 4LQRA 5E1RA 1GWKA 1O91A 1A78A 3T2TA 1TEIA 4AEDC 3IN9A 3TYJA 5C4WA 4AFCA 2B9VA 2HYKA 1U0AA 4CCEA 4DUWA 2JDNA 5FY7A 1UXZA 3TBDA 3AYCA 4W6YA 3U78A 4XFBA 1OBNA 4Y4RA 4YM0A 1S0JA 3NV1A 4IEOA 3ZOIA 1NY71 2ZHKA 1VBC1 4XOGA 2VZPA 1HN0A 2VVFA 4IETA 3NV2A 4AVBA 2XLFA 1F8VA 2JICA 1RUH1 2BWAA 3AKSA 4FPGA 1UZZA 2P6CA 3NSTA 4WVMB 5FZ8A 3IMNA 1DIWA 1W90A 1AF9A 2BOIA 5CISA 1MVQA 4RGKA 4RQPB 1QJY3 3LF7A 3M2MA 1E5IA 3M3IA 3MIFA 4FFIA 4S2DA 4QQOA 3I2OA 5GZEA 2C1FA 4L9BA 4MV2A 1RUC2 3URFA 4AHWA 1EY2A 1OA4A 1RHI3 3ZXAC 1G9CA 3JZVA 5JOWA 4RD7A 3B3QE 3U4XA 3RZLA 1W6MA 2VCCA 3DL3A 4UF0A 2QQPA 2QJVA 2VNVA 2YHJA 4PCRA 5EWSA 5I91A 1RUE3 4BIFA 1S55A 2PN5A 3BOPA 3AP7A 5DAXA 4AAXA 3OG2A 4XACA 5F39A 2FHRA 3SNMA 4CDXC 4EN0A 2WR9A 3C3VA 3VD5A 4Q4V3 1GOHA 2CGNA 4YW1A 2FMDA 3RJ2X 2RJ2A 2R16A 4UFMA 3PIJA 4KL1A 4D6RA 1DZRA 2JECA 2DCKA 1C5IA 3S7IA 2ZA9A 3E6BA 1W8OA 3PHMA 3H7YA 3UYJA 2C9AA 1W2TA 1IPJA 4JQTA 1XPWA 4ES8A 1ONAA 1RUG2 5LY2A 5JZGA 2JX9A 1HIXA 4RS5C 3RQ0A 1QKQA 3VD9A 3KF5A 4U36A 3JCIA 5FQ0B 4FAHA 3P6BA 1S0BA 3A0KA 3B5LB 3DKQA 3IIIA 5CYYA 3T1LA 4CP9A 3I3QA 2FQPA 1JZ2A 2HWB3 1LOAA 4AVCA 4Y1ZA 2HLEA 3VDDA 3RI8A 1AR71 5FY0A 3VBRC 3M8LA 4CDQC 3ETPA 2OUJA 1J3PA 1NZCA 2PAEA 2VW1A 2VMFA 1W9SA 4COUA 2VZUA 5EP9A 3KV9A 1W6NA 5LA9A 4FCAA 3W58A 3MHZA 4BQ5A 4CPBA 3I59A 1V70A 4H7LA 4YG3A 2BNOA 3MW4A 1HRI3 3MLJA 1BVP1 4LIUA 1NOVA 1HJGA 2OZJA 2TBVA 2X10A 2XJSA 1Q5OA 2W92A 3BYWA 3ZYGA 4EJRA 2ZJCA 4XFIA 4OQ8A 1WWYA 2P17A 1OQDA 4GH4C 4AQ6A 1UF2C 1TMF1 3VDDB 5LBCA 4META 3HT1A 4I3PA 4FSJA 3CJIB 1RC6A 4NHMA 4Z1VA 5A1FA 4O61A 3MF6A 1UWWA 4F83A 5HI0A 4QHOA 2B8MA 1W6QA 2WYSA 3N35A 3NWKA 1QJX2 2VNRA 1QJU2 4KBZA 5EFUA 5H9SA 5BNOB 2UY8A 5FWJA 2XBO2 3AFGA 4QX7A 1CJPA 3BIEA 1BXHA 1VRH3 3RYKA 2HYXA 2J22A 4XDOA 4MHRA 1E5RA 3LWCA 1FX5A 3TNPB 4LHNA 1GNHA 2P5BA 4MGSA 4N53B 2FCTA 3POBA 1LU2A 4FFHA 2R041 2EICA 1UZVA 1EV12 2D43A 1A8MA 1RVF2 4YW2A 1V6NA 4BQWA 3OBRA 1AXKA 1ND2C 2LROA 1HXS2 2ZS6B 4Q0UA 1GWMA 4HN0A 1BKZA 2Q4SA 1NKGA 4G3YC 2Z5WA 4LO8A 4MG2A 2IWGB 3ZX7A 2WNVA 4PIYA 2O8OA 4H55A 2NM1A 4KU8A 3FUOA 1VB4A 4AGVA 1UYXA 3HIFA 1T6BX 5D21A 2AYHA 3W5NA 1J1TA 1LNSA 1OC1A 1L3JA 2W87A 3WW2A 3AJZA 3N7KA 2WABA 4J1WA 1JW6A 3ZPOA 4CYDA 1OH3A 3AC0A 5L36A 4AQSA 1MZ6A 5JSPA 5D8AB 2WNOA 1K5MA 2G19A 2RDNA 2RS32 1GR3A 3ZFFC 5FO7B 1UOJA 2ZEXA 1OOPA 1O5UA 1VBE1 4QKNA 1Y7BA 1Z7S3 2P3JA 4W8JA 1JS9A 4RGGA 5FK8A 3C7OA 2CAVA 2DCZA 1REEA 3HN1A 4NHYA 4AZZA 5AFEA 4I30A 2ID4A 2XJRA 5FPLA 1UMZA 5J09A 5F2WA 5DABA 4J1XA 1VIWB 2OXBA 3ES1A 1NG0A 2Y60A 1VBB1 1AR82 2XR4A 2PHXA 1DZQA 3OGRA 4I02A 4UBGA 3WF2A 5BNQA 1WUVA 1WBLA 4WBBA 1Y9QA 4N9IA 1OOPB 4BQXA 2FDIA 2JG8A 5BNPA 5GZGA 1PK6B 3C2UA 1ZZ7A 1D2QA 1WD4A 1C8M2 1SLCA 2VBBA 3K4ZA 4MGYE 5IW0A 5F5IA 4R9DA 1J1LA 2XKOA 2NMNA 3V0BA 1AXZA 1ZVFA 1CJDA 5C9AC 5FUPA 1R1A2 1TME2 4WM8A 2GN7A 5JAXA 3ZVXA 2XLAA 3WP4A 1IS3A 5FV3A 1VBD2 4FXGB 2R063 3MDPA 2HBUA 3O14A 4IERA 1Q43A 1YYNA 3OYWA 2J42A 4PLNA 4Q4X3 4QX3A 2IC1A 3VDCA 2CHHA 3DYPA 1CQ9A 4DXSA 5FXZA 3K3NA 4ASKA 3OF1A 3HAGA 1MZFA 4COVA 2YG0A 4FPCA 2Q1MA 2CDOA 2AENA 4IQPA 5KHKA 3OUHA 3FBYA 3I54A 5FR3A 1OPMA 2GAUA 5IK5A 5ACA1 2W3JA 5C6CA 3KD4A 4LK6A 4A7YA 1GOGA 5A7WA 4LHKA 4Q5OA 2A7AA 2BFUS 2QUOA 3UKVA 3G6JB 1JMUB 4Y1XA 1KDKA 5HCAA 2Q8EA 5F8PA 5FAXA 3RDIA 2ZHNA 2VZQA 5FWEA 3POIA 3JBG2 4IEYA 3LKJA 4RFRB 5JR2A 3ZO0B 2IFWA 2XGXA 5C3QA 4E4ZA 4NUBA 1Q56A 3WDVA 4Y24A 5FPAA 2WA3A 4EWDA 4P9JA 1W2UA 1JUHA 3LFMA 2RS13 4QGNA 4AGGA 2YB7A 1HRV3 5DZEA 5A6QA 3N7LA 1RMU2 1ZBE2 1GSLA 4UW3A 4YGCA 3K4AA 1WMXA 3WINE 1U5XA 1MEC1 1ULGA 4HK8A 4URTA 1G9AA 4JGYB 3OD4A 3WR0A 2QNKA 5JOZA 3LDRA 1ENXA 4CEYB 3H8RA 2PHLA 3V0AB 4NVPA 5FLHA 1AYN3 1T6GC 4N43A 2ARBA 2ILMA 2YDEA 2VQAA 1TVGA 4CEWB 1WMDA 1C5HA 4AOCA 1VLNA 1D4M3 1Q3EA 5F1RA 4ISRA 5FYTA 3POSA 3PURA 1W04A 1NLSA 4CCCA 2VH9A 3L2HA 1HDKA 4AHYA 4HG6B 4MGTA 3WCRA 2GSYA 4IL7A 4LBKA 4K3UA 1KJLA 2K0GA 2AACA 5ABJC 4QAWA 3E6DA 3NNJA 3DF0A 5F9TA 4LA3A 5M0TA 3OUIA 1KS4A 3OSDA 4MXWB 5FZOB 1GQPA 2GU9A 3M3CA 4NR1A 5FZ4A 2EXIA 2A3YA 4YVSA 5EJ1B 3JXSA 5A3PA 1L7RA 2CTVA 3ACGA 4HPKB 4CA9A 2R0FA 1LOBA 4CU9A 4WZFA 1QJX1 5GKAC 1QJU1 4B4PA 2W0XA 4YFZA 1OH4A 1W39A 1WMEA 1PGW2 2H6CA 2J7MA 3H8XA 3W9AA 1DGRN 1ND3B 3KZ4C 1AR62 1GZTA 3TN93 4CP2A 3O7OA 1X8MA 5FJKA 1H1IA 1N1YA 2DTWA 5FZ6A 5FZHA 5FY5A 4KGGA 2ARXA 2UWCA 4I0WB 1RVF1 4IW3A 2RM23 4TYSA 1LECA 1DGRA 4QM8A 2Z69A 3J8F3 3SKVA 4LULA 2H0BA 1NCRB 3KT1A 1CR7A 3HBKA 2WO7A 2ZOEB 1PX3A 5FPBA 4RSUA 4N7UA 4DZGA 4D7TA 3DGTA 1ULCA 3NNMA 1R64A 3AX4A 3QH7A 3QCWA 1JYTA 3OBZA 1W8NA 2HWD2 3SKJE 5F6KA 4CXWA 3DXUA 2VCMA 3EXUA 2GP5A 4HL0A 2BW8A 2WNEA 4FTSA 1BEV1 1GWLA 2OPKA 4UW4A 1GMMA 2RS31 3R05A 2Y6JA 3M1HA 4OZXA 1UOBA 1SPPA 4ATEA 3DN7A 2DUQA 3VBHA 1N3PA 3HMYA 2WBKA 5DN2A 1XC6A 4GKXA 1CPMA 5K0UA 3KS7A 2HH9A 1W8TA 4FBFA 2WIIB 5HCBA 2WZR3 4IEWA 4GZ9A 4GIQA 4KI5M 4YGEA 3TEYA 1RB8G 3LGRA 1UO9A 4HLTA 5IYYA 5EJZB 2EVXA 1LENA 2EA7A 3V65A 4B1LA 3WQBA 2ZEWA 3B9IA 1AR81 4GWMA 2IXJA 4JX0A 4TZDA 3NNLA 1PO23 3AMHA 4UYBA 5C3RA 3W21A 1QNYA 3VBUA 2QKDA 1CX1A 3GZUC 1SPPB 4V2VA 5JWPA 1RJ8A 1YQ5A 2VC9A 2VR4A 2YBSA 3BIWE 2P6HA 3JUUA 3S7EA 4AFBA 4DQAA 1LESA 4GB32 1C8M1 1ZRDA 2G9ZA 4ARYA 1KXGA 4CCOA 3ME2A 5JR7B 1XE8A 3VL9A 5I0DA 1KDMA 4E9KA 1CAUA 1S4CA 3T08A 5BYNA 5F3CA 1R1A1 1TME1 4TTGA 4FPLA 4PT6A 4BA6A 1D2SA 1FMD2 5J7MA 4ITCA 1LJ7A 4LBQB 3AXEA 1EUUA 5FKCA 5I8SA 1LOEA 1PM4A 2JDKA 4P9YA 3OB8A 2HEVF 3HQXA 2ETEA 3C7FA 3BVCA 3Q8CA 4IV3A 4YSFA 4R4ZA 3IM0A 4URAA 1GZ9A 3LSEA 3S0MA 4BU2A 5BNNC 1GNYA 1KRIA 1YI7A 4LTAA 5A3LA 4P9LA 5FYCA 5BXXA 3WF0A 1P8JA 4F3JA 1LKNA 4QPGB 5FYVA 4Q8LA 2J1VA 2VNGA 5BPXA 4FPKA 2C5DA 4Y20A 2O1QA 4HSJA 4BXSV 4Q4Y1 4RR3B 4LXLA 5EV7A 3VZOA 4IV3B 2Q0AA 4EN7B 4Y3OA 2HJIA 4YW6A 1J58A 1QQP3 4OQ9A 2BEOA 4LBMA 3HR9A 2XKPA 2ZHLA 3TB0A 3RZJA 2ZHMA 1NCQC 4QQLA 2YU2A 3S30A 3PVNA 4HFSA 4EWEA 5HBAA 4LHLA 1RMU1 1ZBE1 2ENRA 3T4HB 2KR2A 1LAJA 1SFNA 3AKPA 3VBSC 1ZBA3 4JGZC 1Y9MA 4D69A 3RWKX 2WO3A 2QCSB 4QB1A 1WA4A 2BFUL 2YY1A 3OBTA 1ZZCA 3VKFC 2ZZJA 4BLJA 1RUI1 3D3AA 3KMHA 1ZREA 2WFF1 5KXDA 4Y22A 1DGLA 2JKBA 1X9PA 1EAH3 4PBPA 1G7YA 5F6LB 4D7YA 4EN6B 1KJRA 4CDUB 5AFBA 4X8NA 4C0HA 3LEKA 2WNUA 4CVUA 2J1AA 1PGL2 3TWIA 4CU7A 3P1IA 4QKFA 4XIOA 1Q8SA 3ZDSA 5ANQA 1AL21 1C1FA 1VBA1 2WS93 1B35B 2PMWB 4JZRA 1UY3A 4FVVA 1NA1C 4I0AA 5FPXA 2PLV3 3OPTA 2BGOA 2CL2A 2DURA 4XMIA 5IVFA 3QH6A 3MIHA 3WW1A 3FJSA 4UXAA 1CAVB 4FO9A 4Q0QA 3KQ4B 1D4VB 4M3CB 3VGIA 2MHFA 1RUD3 3W20A 2R7EB 4YVWB 2PTMA 2QFEA 3THDA 2MPFA 1ASJ2 1UMIA 3WY6A 3GM8A 1F35A 2VMGA 1GANA 3CBNA 1OQEA 2ZGKA 1LOFA 3NAPC 3O0XA 4DUVA 4XFHA 5ISLA 1BYHA 4XBQA 2QBXA 4V1PA 5A70A 2QDNA 5E88A 3BPSA 2IXIA 1W6OA 2PHFA 3RVHA 4XZUG 4MADA 4NPLA 1UMHA 3USUA 4XFFA 3ZXEA 2W47A 3HOBA 1DYPA 1UIJA 4OFGA 5F5QA 5FUNA 4QQHA 5A3WA 4K6BA 1YI9A 3ZFEB 3ZIWA 1AHSA 4KWKA 3VHOA 1H8VA 2QZ3A 4GWNA 4KBBA 3BTYA 4CRQA 4J6GA 2DCJA 3H42B 4LUKA 1LHNA 5A3UA 2D40A 4JKLA 5CG8A 1UCXA 3E5XA 3JB8A 4Z8BA 3LPFA 2A75A 1DQ2A 2BQPA 5K9YA 4LKFA 4NHXA 3TRSB 1NE4A 4GJZA 5L9BA 2RS53 2D7FA 2D97A 3DXTA 3FWEA 3LCPA 1IOAA 4LBNA 4IDZA 1OF4A 5I0RA 4TXWA 3ZN6A 1Z0HA 2NMOA 1MQTC 5F5CA 1POV0 1COV3 1JYIA 2LRPA 3ZFGB 3ETQA 2HEYF 3LB9A 4E8CA 5FZBA 2HWD1 2ZTNA 4IV1C 1AYM2 4HXCA 4AEDB 1RYYA 4CDWA 3LFIA 2JG9A 2E33A 3UT0A 4PI0A 1ST8A 3FC0A 4A45A 2GNDA 3UV9A 1OVPA 3MW3A 4NMIA 5DZGA 5FOBB 1V6IA 1JTZX 1I1EA 1SDDB 1N47A 2XL7A 5IK8A 1W2AX 3AB0A 1JU4A 3ACIA 4WM7C 3SISA 3UGHA 2XOMA 1CIWA 2E9QA 4YARA 2RMU3 3O0VA 1H4HA 1URXA 2NQYA 4MOAA 1O4ZA 3BGAA 4XQ4A 1WA6X 1LCLA 5C3PA 4PIZA 4QPIA 3B69A 5GALA 5LEKA 4MGZE 4LITA 1QJY2 4ZPIA 4GB31 3VN4A 3QACA 1ENRA 4LLFA 1LHWA 5GLVA 1OF3A 3BALA 1U5YA 1UPIA 3GZAA 3TEZA 1RHI2 5LRSA 1H9PA 3C7EA 4RHV3 5DAVA 3RZMA 1FMD1 1GZCA 1TNFA 4U2AA 4QHBA 4OUMA 1ULEA 2X5IA 3RWNA 5FFOC 4CDXB 2F6BA 5IVCA 5KXBA 1RUE2 2WAAA 4BK5A 3W5MA 4DOUA 2Y38A 1IKQA 2VUDA 3RMXA 3UL2A 1I5PA 1HQLA 5I0UA 3KT4A 4XZPA 4Q4V2 2HBTA 2D93A 2AGSA 2BVVA 2HWF1 2MEV3 3KVBA 4OHVA 2Y33A 2VO5A 2JD9A 4CCMA 4K40A 4XF9A 1QGLA 4AEJA 3O5SA 4NRMA 4RS5B 3MO4A 4COYA 3SMHA 3BI3A 4KH9A 4OYUA 3O12A 2ZGQA 2XLGA 1YFXA 4ES9A 3GJAA 4QPYA 3K51A 3T0AA 1Y9GA 4Y33A 3OUJA 1AXYA 3WT3A 1V6KA 1YQ8A 2NN8A 4FTEA 3H1MA 1MS1A 3ORJA 2C9KA 1ZM1A 4LIVA 2WN3A 3Q8AA 5AVAA 1XBFA 5H9QA 3VBRB 3KGLA 3ZXLA 2HWB2 1GP4A 2Y6HA 3IB3A 3DV8A 4MXVA 4YM3A 2ADEA 2QVSB 5CFDC 1NX9A 4CU8A 1VBC3 4AVVA 4PF1A 1YXWA 1RUJ2 2P3YA 3BTAA 2JB8A 3A23A 4KWLA 1H30A 4AVAA 5KXEA 1D7PM 2ERFA 3GZEA 4INDA 1HRI2 4GH4B 4FP2A 4D3WA 4JHTA 4LBLA 5EXOA 1LTEA 1O7FA 3LE0A 5JI9A 1L7LA 3ZSKA 1WCDJ 2XUMA 3J9SA 3AZYA 1ZRIA 2TEPA 3LEMA 2EIDA 2ZGSA 3FLTA 3FFZA 3IKWA 1EPWA 4BYYA 3A21A 5L9RA 3N9NA 1ND2A 3SCHA 2P37A 3K75B 2VOKA 3O1SA 3ZMOA 2UWAA 3VBFC 1POQA 2XXZA 1E5HA 2VNOA 3A7QA 4WVZA 3HD8B 5APAA 5T5OA 2X53S 4AFDA 4GQ7A 5IK4A 2VTXJ 4FOYA 1OA3A 1VRH2 4LUMA 2VVEA 1X50A 1YRZA 2O14A 1QHDA 1AL0G 3PTYA 2ZGOA 1XOYA 4RQPA 4CP1A 5CVRA 4AL9A 1BQPA 3ABZA 4OZOA 4PLMA 5HPOA 4Q4W1 1OT5A 2XHNA 1ND2B 1ASJ1 3I3MA 2XJVA 2ZGLA 4A44A 5E8AA 2QQUA 2VULA 3MIDA 1AR93 1JU3A 3JB4C 4DXRA 1F4AA 3IMMA 2N7GA 1C1LA 4ZS3A 2RJKA 2XUEA 4ZXEA 4ASLA 4CDQB 3EB7A 4UW5A 1OXCA 1QDCA 2W95A 4P14A 1ZNPA 3V56A 1UW8A 4KMQA 5DDJ1 3ZFFB 1STMA 4R4XA 3FHIB 1BK1A 1SBEA 2JDMA 5H9RA 1XRUA 2WC2A 5SV8A 2VZRA 4AHXA 4OULA 1AR73 1SLIA 1MACA 3WNKA 3ZSLA 2WINB 1IG0A 1JZ8A 1QJEA 3S5AA 1SEFA 4HKLA 3CQOA 3I2GA 1ZA4A 1Z7S2 1LRHA 4W4ZA 5FQ0A 3NNGA 2Z4FA 3POGA 5DUXA 4AAPA 5A33B 3U14A 3H3UA 2FBEA 1M06G 1QEXA 2WT2A 4DFSA 2VVDA 4LMFA 4GAZA 1WW6A 4CCKA 2OT7A 4NO4A 4QQ2A 2WJSA 3IPVA 3AZWA 2B7YA 2XVKA 1AYM1 1UX7A 2QDRA 2XONA 2VD7A 1SACA 1TMF3 1VP6A 3B9CA 3DPRC 1W8UA 3IDAA 3AP5A 4I01A 4SBVA 3T09A 4AI1A 1ZX5A 4DS0A 1T2XA 1YQ2A 4NE9A 5C9AB 1ZZ6A 4XTPA 1QOSA 3D5OA 2VM9A 2VJXA 3HEIA 4JRAA 4N90A 4XJWA 1JYNA 4IEPA 5FPVA 4P5YA 1H8TC 1NYWA 5FOJB 2PHWA 4LT5A 2D6PA 4YW4A 3RGBA 2EXJA 2ZGMA 3FLRA 2VOTA 4B3NA 1NAEA 3CJIA 3IPVB 3H50A 1POV1 4XJ8A 5CIRA 1FI2A 5IT6A 4ZZ8A 2R062 4BWOA 4QX1A 1MS4A 4Q4X2 3KCCA 2D6NA 4JTOA 5H9PA 3ZYJB 1IQDC 1ZYBA 4X6QB 4B7EA 5BNOA 4ZONA 2R32A 3GHMA 2Q30A 1CAWB 1X33A 3M70A 4GULA 4J25A 1J59A 1CAXB 2PELA 3VHPA 1QNWA 2D98A 4BQYA 2CGOA 4LPLA 4M0NA 5JCTA 3U75A 4COWA 5FZ1A 3KLSA 4N53A 4OHZA 1RHI1 4XUPA 3RZGA 2E31A 2A70A 3IDEA 5LBBA 1V9U3 3VZLA 2FDHA 4LO5B 3C7GA 4QB6A 2YYOA 4P08A 1G9DA 4I2OA 1RUE1 1GUIA 1WCSA 1BBT3 3TEWA 1CX4A 4CUBA 4XHBA 1JUIA 1VBE3 4FPOB 4I09A 5CB7A 2PQSA 3NKGA 4Q26A 4AF9A 4PBOA 1HRV2 4D8MA 2OQ6A 2VW2A 2YFUA 1JXNA 1QOOA 3H3ZA 2RHPA 4Q29A 5FJHA 3VBOC 4ZHNA 4FPJA 2Y6LA 4QWNA 4RL7A 3WUDA 5D8AA 5G04L 1NQJA 1KS5A 2VECA 4MGQA 3IT8A 1VBB3 3SEEA 3INAA 2IUWA 3FHQA 3M3QA 3GJBA 3RZHA 1FAYA 3IBMA 4LKEA 3NW4A 1AYN2 2R30A 2V4AA 4KU7A 2R49A 4EN8B 5T3NA 4QXKA 3WNMA 1UNBA 2I2SA 5FZ7A 5L7OC 1D4M2 1TQ5A 4YM1A 3SITA 2XH6A 5C8CC 3H1YA 4DPNA 3AVRA 3NL1A 1R091 2EXKA 1US2A 4ZU7A 1RUJ1 5ABJB 5ERLA 1ULPA 3ES4A 4HOOA 1UYPA 5HXMA 2VG9A 1HRI1 5FPZA 1PK6A 2CYFA 3CL1A 3OGSA 1RJ7A 1RUF1 3PTRB 3MEPA 1VMHA 2DVGA 1FPN3 3ZYFA 1O4TA 5C5TA 4O9GA 3HWJA 3CZUA 4Y5Z0 1ZRFA 1C4RA 5C4WC 1NXD1 2P1BA 2QQMA 2WUHA 4UI9L 3UKNA 3ZM8A 5IK7A 2QQNA 5J1XA 3AP6A 5ACA3 3ZSMA 2OX0A 5I8YA 5JOXA 2XJTA 2ZABA 2PQQA 4AXOA 1SLTA 5IWFA 1VRH1 1TZOA 2JWPA 1LGNA 1QH7A 1SZBA 3LA7A 4ET7A 4UFHA 1C3HA 1C8NA 3IDBB 3BUCA 3PUQA 2Q8DA 5A3MA 3UKTA 4TSVA 3IZOA 1LULA 1XYPA 1CIYA 5FP9A 1JODA 5BUVA 1FYUA 2JDUA 1DQ1A 4HT1T 4XCBA 1K45A 2CSGA 2BRTA 2RM22 3NMBA 4UFKA 2JKXA 3LIHA 3CLPA 3N3HA 5FYZA 3I2DA 3PUHA 1KEXA 2V09A 3N4MA 1MEC3 2GZWA 5DG2A 5T5PA 5DUUA 4DMIA 3ZYBA 3IWZA 2YBKA 5J48A 5T5JA 5FY9A 2SBAA 4QX8A 2E7AA 3PU3A 1NQDA 4AI8A 2OW4A 4LBQD 4NIHA 2ZACA 1OQ1A 1EYBA 2H0VA 2VE1A 2ARCA 4AGRA 2W08A 4LBOA 1BLZA 1RUC1 1WW7A 2GC2A 4QT6A 1PX4A 3F2ZA 1F15A 1EUTA 4FT8A 1PVC3 5T54A 1AX2A 1E5SA 5A3TA 4S2FA 1XNBA 2VCAA 4JGYA 1N1TA 2BERA 1Z7S1 2E53A 3B7MA 3CDZB 4YYOA 1XSRA 3MW2A 4CEYA 4Z82A 3VKLA 3LIGA 1VPHA 1HX6A 3V0AA 5ANNA 1LODA 3JQWA 5DUVA 5E89A 4AR2A 4JKMA 4CEWA 3GCWA 1W2OA 1GLHA 5JZGC 2PHUA 2BU9A 4QDRA 3EJKA 3IDCB 3K46A 4LJHA 3I8TA 4XUOA 3I2IA 2B4KA 2SLIA 4BQ3A 5IVYA 4E2SA 2R073 1QXJA 3APBA 4I0BA 1RUG1 4Q1RA 5FBJA 1LB2A 2FCVA 4W6XA 2E51A 1OPOA 2YGMA 1RIRA 3KGZA 4C0BA 4BE3A 1GBGA 3WSOA 1CPNA 2YUEA 1WCQA 4QB2A 3AM2A 4OHYA 3DYMA 1JHNA 2NLRA 2CWSA 2HWE2 2WWSA 5FZ3A 5J3UA 5FYBA 2B5HA 2JB4A 4MXWA 3PL0A 5FZOA 4K1ZA 3MICA 1H2KA 1O4YA 2Y0IA 3RYPA 5IVEA 1K3IA 2JE8A 2BV4A 2DFCA 3PUAA 4IESA 4LO6B 4XAEA 1IPSA 4HPKA 2WWUA 2BBAA 3M7AA 5I0SA 5BNNB 2ZX1A 2GMMA 4FOQA 1RVF3 5FP4A 3ECQA 1XYNA 1GZWB 2KD7A 3I2JA 4OI1A 1BJQA 3O0WA 2OQ7A 4XABA 1UD1A 2LUWA 4FXKB 1I9RA 3WW3A 1W8WA 3H8OA 1DLCA 1ND3A 1YHFA 4F8AA 3AZXA 4P9IA 2XHKA 1F2NA 5C8WA 2DVDA 3FHAA 2VZ3A 4LO7A 1QF3A 3VL8A 4AG4A 2XPJA 1JZ6A 2ADDA 2WYFA 3T3YA 5DMYA 2AR6A 3DCQA 5DPNA 4IEUA 1PO12 2EAKA 1LHOA 1A34A 2WQ4A 3I2HA 4ZS2A 5FMCA 4LKSA 4QM9A 3WDTA 2D44A 3VV1A 1BEV3 1CZSA 1NCQB 1NCRA 2XBO1 2ZX4A 2RS33 3CNAA 3WDUA 3Q9OA 3OEBA 2AZ5A 1W0PA 1QWRA 1MS3A 4M0HA 2KA3A 2A6VA 3NQHA 2W1QA 5KR7A 3VBSB 4JGZB 4NWWA 1QDOA 1UOGA 1DG6A 1XNAA 3DECA 2GC0A 1EV11 5LWBA 4W50A 2C4XA 4OLLA 3K48A 1DCSA 4L97A 1RL3A 3WCSA 3ASIA 4BQ1A 1ZRCA 2WNVC 3O1MA 4AK3A 1AR83 2OS2A 1NE6A 1HXS1 5GZFA 3H8UA 3CHXA 4LE3A 1ULDA 4FQZA 3B00A 3AVSA 4LEJA 1HN1A 2VGDA 5T5LA 5K8SA 1EAH2 2ZXQA 4GXLA 1C8M3 1K5MC 4I3GA 1NA1B 4DNYA 1VMFA 1OOPC 3N9MA 4TLFA 1R1A3 1TME3 4Z07A 1XYOA 2BJSA 2WS92 2V5YA 1NT0A 2RR12 2BGCA 4BDVB 2PLV2 2YGLA 1DBNA 4XQWA 2CGPA 5IFTA 2QQKA 2E63A 2XB6C 1WBFA 2J1UA 5FYIA 3U10A 3ON7A 1PIV3 1J3QA 1RUD2 1OVSA 3NAPB 2XDVA 1Y3TA 3VD7A 4QDQA 4WVMA 3WF3A 4IE0A 5FMOS 4M4PA 5I8TA 4LBQA 2JG8C 5BNPC 3T1MA 1UY0A 2RV9A 3VKMA 5KC5A 2OYZA 2B45X 5FMBA 4OHXA 1XE0A 2WQZC 4N9HA 1H6XA 4LK7A 2BUKA 3RYRA 1YUDA 3SC7X 2LM3A 4Q4Y3 1W6PB 4WM8C 1JYCA 3ZKYA 3CZJA 1SMVA 2Y8KA 4IV1A 3RZKA 3THCA 4XFCA 3BPZA 1Q8OA 3I3DA 4HVOA 3POWA 4MX3A 3AZVA 4P9XA 4QPGA 2PAKA 2JE7A 1H4GA 4TLGA 2Q1FA 3MPPG 3UJOA 4BOWA 1FV2A 2YC4A 4JAAA 1VBD1 1JOPA 1MQTB 4RR3A 2RS52 5AC92 2OUHA 3GBFA 1RXGA 2VQ0A 3O1PA 3A0NA 4XF1A 5CA6A 2VUCA 3ILRA 4XETA 4QDSA 2UYBA 4IV1B 5LBFA 3WHUA 4QXCA 5FZIA 4EN9B 5HCHA 2Q5TA 4PDWC 1RUI3 3AMPA 2WFF3 5JIAA 1DGWA 4XJ9A 3KCYA 2NZ9A 3WX5A 1US3A 5CBLA 1FOD2 4XDQA 1WCUA 3ACHA 3RRDA 5EPAA 4ORFA 2RDSA 2XMLA 1M4WA 1H1AA 1R082 2Z79A 4M4RA 3RSJA 3VKNA 1AL23 1VBA3 5JXGA 2QQIA 1B09A 5FYMA 3JD73 2YROA 4WM7B 5EYYA 4QX2A 4E8DA 3JBG1 2K9ZA 4FQ4A 1OA2A 2RVAA 3CIHA 3EBRA 3K3OA 2GNMA 4X6RB 5FDBA 4JDMA 1XXNA 2PHTA 4CDUA 3FLPA 3OGGA 4YFWA 2I07B 3ZSJA 1HLCA 1K42A 3OY8B 3VZNA 4BJ0A 4PIXA 3U11A 2I74A 2VU9A 1H0BA 1XB9A 2XVLA 3KQRA 3MLKA 2JIGA 4DRRA 1B35A 2EIEA 4N43C 2IXCA 3NRUA 4LO4B 5JXIA 2VQTA 4XQDA 3MV11 4FPHA 3N9LA 1I5ZA 1OUXA 1CAVA 1KQRA 3ZSEA 5LK7B 1XE7A 1ENSA 2YZ4A 1NLQA 2DTYA 2VAUA 4M3CA 2HWE1 1IGOA 3GCXA 4WVWA 4YVWA 2Y34A 1XSQA 2BPA2 1PVXA 1G86A 5FXVA 2YFZA 4KWUA 2EAAA 4P00B 1F31A 5A6ZA 2HWC2 5JUVA 2E7TA 3U0ZA 2BBVA 2WAOA 3U07A 5FP8A 1UKRA 5LEJA 5JSOA 3SEPA 2W2IA 3PNAA 3ROUA 5FIXA 2FDKA 3MFAA 2DUOA 1BMV2 2ZEYA 5A6XA 4YVSC 5C7GA 2MEV2 5FO9B 1LOGA 4PLOA 2PYTA 2G9FA 4FFGA 3ZFEA 4ARXA 2ZEZA 2IZWA 4X8PA 4K1YA 2XQXA 2XJUA 4CUGA 2O8QA 3B01A 3TNQA 5FZEA 3PMEA 1PO11 2OA2A 1FT9A 2WSUA 1MZ5A 3D82A 4UAPA 5CKNA 3LDKA 2CAUA 4PQ9A 4KQ7A 1KITA 1GP5A 1W9YA 2D6LX 4UOJA 4AI3A 3AMQA 4ZZ5A 2W1SA 1PGW1 1QH6A 1S0CA 1LEMA 2K46A 3SCGA 5JXJA 2X09A 2OKXA 3KVAA 5CFDB 3O1TA 4IEVA 3WVJA 4GD4A 1AR61 2UWBA 4GMP0 2FMYA 4L99A 2D6OX 4IGOA 1BCXA 3ACLA 3AP9A 4LORA 3U1XA 1IG3A 3ZFGA 3KHCA 1F5FA 1GQHA 4YM2A 2D3SA 2VPVA 2ZAAA 4AEDA 3HQUA 4QXHA 5C5UA 1O3TA 1IHMA 1VBC2 4JDOA 4FTBA 5I93A 3T0BA
chains in the Genus database with same CATH topology
1H2MA 2ZX3A 3MYXA 2KXLA 4XF0A 4AFAA 2Y0OA 3VBFB 3QOPA 2DWRA 1PZ7A 1W0OA 2ZGTA 3VBHC 3ZXKA 5J37A 2ZGPA 5GJ6A 3AZZA 2ZMKA 5K0UC 4EWAA 1RUOA 2RR11 4W65A 2PLV1 1OI6A 3WNXA 3M4FA 4YG0A 3GZTB 2D5HA 5HCFA 3ZIXA 1RUD1 4XF3A 4G9SB 2R0HA 2HWF3 1C28A 3GYDA 3VBUC 3G7DA 2GC3A 3CU7A 3WDYA 1FV3A 1VB2A 4CDXA 1AR92 4COZA 2C0ZA 1Y43B 4MGKE 1Z78A 2E6VA 3ST7A 3MIEA 5FDBA 3GHNA 2Q8OA 2XJQA 1LGCA 1HV1A 4DY5A 4Y1VA 3OJBA 1AZDA 1IZ3A 5JIUA 3B94A 2ZKNA 2X29A 1JBCA 1U12A 2HKXA 3ZN5A 3S6PA 5JMCA 2ES3A 3SH4A 1N3OA 3RS6A 4RS5A 3OGJA 1AR72 5CFCC 1MVEA 5FMOL 5E16A 1CVNA 1YO8A 2RS51 5AC91 3WDWA 1VJ2A 4IEXA 1BVVA 2K2SA 5DUWA 4ZXKA 1SCRA 2A3XA 4XHXA 3VBRA 4CDQA 4WV8A 4B8EA 3PVEA 3ZXFA 3DPRB 4BM8A 5KWRA 3OTFA 4XPVA 1ULFA 1FOD1 1TMF2 3M3OA 5CAZA 4S2HA 2E7QA 5TSWA 1MS5A 2XJPA 5L19A 3KM5A 4CP0A 1R081 3LSDA 3VHRA 3KT7A 5JI7A 1H8TB 4P9GA 4GH4A 1H9WA 4JTNA 3WG2A 1GFF2 2ZKLA 2A6ZA 1WLTA 4ATFA 4XYXA 4YZ3A 4HK9A 3R4DB 3WQ0A 5BV6A 4Q4W3 4EV0A 1ASJ3 2GN3A 2ZZQA 2XWBB 4QU2A 4HMZA 2JXAA 1RUH3 3USSA 2WNUC 1S0DA 2I45A 3VZMA 1CGPA 5FLJA 1O3QA 2CV6A 4HN1A 3AK0A 1YLLA 2HWC1 3I7DA 1S1AA 1V9U2 1PGL1 1I6XA 5DDJ3 4E2GA 3D0JA 4MH0E 1MS9A 4W6WA 3RMYA 1AX0A 4DY3A 1GQGA 2ATFA 1BBT2 3WQ7A 2UURA 4DRVA 4XE9A 1BMV1 1VBE2 3RI9A 2MEV1 2ZBJA 4YRDA 1AJOA 2WL1A 3VBOB 3R6SA 1AJKA 1LOFC 1ENQA 4HBNA 3R0RA 3ZFFA 4PJYA 3MIBA 3UK9A 1PM7A 1REDA 3ZMNA 4Z92B 1EPZA 4HKWA 1KFUL 1AYM3 1D0HA 4Y4YA 3MLLA 2ZPXA 2CNAA 3E6CC 4L8QA 3BODA 4H7MA 5L7OB 1PNGA 1WLWA 1GNZA 5A33A 3RPQA 5C8CB 2DU0A 1Q8QA 1FNYA 2D6KA 4NHLA 1WGPA 4HZFA 1C57A 2XVGA 5DZFA 3V64A 5EYXA 5KC6A 5K7PA 1POV3 4HVQA 3TOJA 1REFA 2W68A 3IIAA 5C9AA 2XL9A 2WT1A 2P34A 4ISQA 3H9AA 1FPN2 4CDWC 1G6NA 5C4WB 2JG9C 2VY0A 4Y26A 5FLIA 5T52A 2EALA 3AKTA 1WMFA 1LOCA 2ZGUA 1V6JA 3DUIA 1UX6A 4L2NA 3PJYA 4GMP1 5ACA2 2PHRA 2WLPA 3LZZA 2DFBA 3WHTA 3AYAA 4CZSA 1YJLA 2ZCWA 3ILNA 3NJZA 5GM0A 1CAWA 3ZYIB 1CAXA 1D0GA 2DF7A 2VW0A 1OKQA 3H1WA 3VZKA 1MS0A 2PA7A 2DVAA 4Q0SA 1YNAA 2D6MA 4QPIC 1VAMA 2JJ6A 2VOVA 2IXHA 1AR91 2R043 4QQPA 4YZ4A 1J3RA 4C1XA 4BPZA 1W6MB 2DCYA 1LEDA 1MEC2 2OZ6A 2XG3A 1JOJA 1DZTA 1OLRA 3H0OA 1QJY1 3PVOA 1QXPA 2X5IC 2BYVE 4Y1YA 1OSGA 3TAYA 1XU1A 1VALA 2TNFA 1Q8PA 1PVC2 4K21A 4BZ4A 1UL9A 4BLIA 4B7KA 1R093 4MGIE 1MS8A 4L11A 2WA4A 3P3PA 1SLBA 4JQRA 2GNBA 4OI2A 2IXLA 1RUJ3 5GLUA 3KCXA 5JZGB 1QMJA 2HEWF 1OD5A 4Q4V1 5GLWA 4YZ2A 1RUF3 4JDNA 4XIKA 3FE5A 3I4IA 1H2LA 2RS12 4D94A 2YPJA 3E5QA 1DYKA 1OFNA 1R1ZA 3ZYRA 2R072 3FBMA 4AI2A 4JCKA 1QXRA 5ABJA 2AREA 5AVPA 4BMBA 1WW4A 5BY5A 1W6NB 3ALQA 3I59B 4A7KA 1VAKA 1XNDA 2PAMA 1DQ4A 4BIOA 2HWB1 1RTVA 1KFXL 1QU0A 1GV9A 4BH9A 2B42B 1DLLA 2Y26A 1PGSA 2DVBA 3VZJA 1UIKA 5JSRA 1W6QB 3D8CA 4YW5A 1F9KA 4Q27A 3LAGA 3R4UA 2LTNA 4AFMA 3GBWA 3MPBA 3NKTA 4KWJA 1LGBA 1SLAA 2R1DA 3JU9A 3LA3A 4MSVA 1V9U1 1YJKA 1RUC3 2B9UA 4RQPC 5JLVA 5IUQA 1BBT1 5FO8B 1BEV2 4LBJA 1G8WA 4LA2A 1O5LA 4YGDA 5KXCA 4N7IA 1WLDA 2A71A 3TN92 2D3PA 3NV3A 4AVTA 4AYUA 4JV4A 5LRRA 4GA9A 1VAVA 2WNVB 3WV6A 1QOTA 2GMEA 1X36A 2JE9A 2JDZA 4Q2FA 3J8F2 5FREA 1S0IA 4XTMA 1K5MB 1RUG3 4ZU5A 5LK5A 4R9AA 5CU1A 4AW7A 5B2GB 4FOVA 2DV9A 4HVRA 1APNA 1NXMA 2WLQA 4H14A 3R4SA 3ZPYA 1S0GA 1UPSA 1YFUA 3WQ1A 2NP0A 3BU7A 4WVVA 2O0OA 5KHHA 5J96B 4YW3A 4RA0A 1FPN1 1PIV2 2JG8B 4ONUA 5BNPB 4GKYA 2WZR2 1DF0A 1X82A 4A7ZA 3V0BB 4WM8B 1DDLA 2WZPP 4NOTA 2Q1ZB 1PO22 5BNNA 1V6MA 2UY9A 4HKOA 4MLOA 2A6WA 1GZWA 4PDWA 4Q4Y2 1UKGA 3OCPA 5I0TA 3ZXGA 1QJX3 1PMIA 1QJU3 3VDDC 3OYWB 1HQWA 1CN1A 3CJIC 4QGLA 2XBO3 2ET7A 2ZMLA 5BNOC 2G4IA 4XJUA 2WT0A 4NHKA 1UU4A 3OD0A 4CTEA 4R8HA 2UU8A 4ZKTB 1EV13 2R061 4Q4X1 1ZRRA 1GICA 2BTVC 4YZ5A 1NCQA 4N53C 2WSVA 4PDWB 3AMNA 2GALA 2W39A 3GNEA 4NPRA 4Q1PA 3VLBB 3DKWA 1V00A 2JD4A 1HXS3 2A6YA 2IXKA 4H3WA 1RUI2 3VBSA 3J26N 1SDWA 2WFF2 4JGZA 4E2QA 4KNCA 4RGAA 1H1MA 3FFQA 4G4FA 1PVC1 4AEMA 4KGQA 3ATGA 1O3RA 1SFYA 2JENA 1I3HA 4R52A 3A4UA 3H7JA 3HT2A 4M01A 4Q0PA 1AL22 1VBA2 2Z42A 3AJYA 3JD72 1QQP2 4IXLA 4Y1UA 4R9CA 1X7NA 5EJ3A 3AXDA 2EF6A 3WUCA 5D8AC 5L73A 4LR4A 3M3EA 4N43B 3SXWA 1NA1A 2RS11 2GC1A 1HRV1 1QY4A 3PMSA 2R071 4JVAA 1ZBA2 1PZ8A 2GMPA 3WG4A 2ZAHA 1DQ5A 4PF5A 5KHIA 1AYN1 5T55A 4LE4A 1S2BA 3JQXA 4MUVA 3NAPA 2PHDA 3N7MA 4K20A 4O9EA 1D4M1 4AVSA 2RE9A 1VR3A 1PK6C 3MF9A 4NN0A 1JN2P 1SBDA 3GF6A 4YVSB 3AKQA 1A8DA 1EP0A 2YC0A 5KHGA 4KG8A 1VBD3 3L9JT 1W6PA 4WZCA 1ZZ8A 4OHWA 2WKKA 1CESA 2GH2A 4BMEA 1AVBA 3UJQA 2ZGRA 2DCTA 4F7ZA 3P3NA 4AWDA 3ZN4A 2OIIA 2P3KA 4E27A 1MQTA 1OLQA 4K8FA 3CF6E 4RFT0 1MZEA 2AH2A 3MIGA 3WZ1A 1FATA 4FAGA 2KM2A 3TN91 2X8KA 2XWJB 3JBG3 1DU3D 2RJLA 1IS4A 2NPIA 2EXHA 1MR5A 1PNFA 4FPEA 4QGMA 5CNAA 5GLTA 4K9SA 4HETA 4FPYA 3WG3A 4NWVA 5CADA 1XNKA 2VUAA 3WG1A 2RM21 4M3CF 1U5IA 3J8F1 2B39A 5T50A 1RMU3 1ZBE3 4Q0VA 4L92A 3N36A 4WM7A 4XJZA 4R9BA 4JRLA 3ZYPA 1U5ZA 3VBHB 2NYYA 1COV2 2A5ZA 5K0UB 4JGYC 2HWE3 4AI0A 1GYKA 3PLQA 1N3QA 4CEYC 3OY8A 1G9FA 4QMAA 4AQTA 2CWMA 4SLIA 3BOWA 5FBZA 1SBFA 3WP5A 3KSCA 4AQ2A 4CEWC 1UAIA 4B4QA 1TE1B 4KG0A 4XW3A 3WOGA 4IEZA 4XFGA 3VBUB 2DU1A 1ZZBA 3AKRA 3THPA 1PIV1 5A32A 2IFRA 2ZX0A 4XF4A 2WZR1 1FNZA 5CFCA 2HWF2 5JDBA 4GALA 5C33A 3ELNA 4AEKA 1CAUB 1XU2A 2RMU2 2A73B 3B02A 4A2UA 4S2GA 1PO21 1A3KA 1YIPA 1PO13 2G9GA 3VHNA 5JPMB 4XXPA 5FCCA 4A3XA 1G9BA 1XQNA 4XMAA 3CEWA 1WLCA 5A32B 3THTA 3VKOA 4B29A 3RNSA 5JVVA 4P5HA 5CFCB 2D3RA 4YGBA 1AR63 4RHV2 5JOYA 3B93A 4AE2A 4XILA 4DXZA 4EROA 2ZMNA 4B4RA 2FZ2A 1ND3C 2JEMA 5GLZA 4Y20B 3MFCA 1V6OA 2LALA 1QJZA 2ET1A 1UU6A 2VMHA 4XBLA 4OUSA 3POYA 4K7JA 5CFDA 4DINB 4QD2A 4XXAA 1WW5A 3D4KA 4OI0A 1S2KA 2YMZA 3QD6A 1NCRC 1CD3G 5KHJA 3D6EA 3OPZA 1SCSA 2HWD3 5SV5A 3JD71 2RR13 1QQP1 5GZDA 1JH5A 4MVTA 2UYAA 3E5UA 4FPFA 3VBFA 3W59A 3WW4A 4C90A 4Y22B 1ALYA 4Q4W2 1UZYA 5EZWA 5HXVA 1NY72 3PJQA 1Q8VA 4BCUA 1DQ6A 4MYEA 2WNUB 1ZBA1 3E97A 1O3SA 4YZ1A 3EO6A 1HKDA 3RZZA 1YFWA 2GDFA 2D5FA 1X8EA 5FRAA 1RUH2 4OI4A 2QZ2A 2DYCA 4QX5A 4XBNA 3NV4A 1PHMA 4D7SA 1SQ4A 1RGSA 1EAH1 4AHZA 1NLRA 3X29B 4GB33 5D1IA 2YXSA 2OVUA 2R6QA 4JC1A 4XFAA 2CY6A 5DDJ2 3RJRA 2H6BA 2WFPA 2WS91 3HBZA 1FMD3 4HANA 5J36A 4YNIA 3FMGA 1HQNA 4HSLA 4P9WA 4TWTA 5AC93 3QBQA 1W6OB 5J98B 2VOXA 1OHFA 3J4UH 4E4DX 1OMIA 2VMIA 1PZ9A 4LNVA 3USUB 5CG9A 3WLUA 2AUYA 3SH3A 2A6XA 1A6CA 4ZU4A 2GH8A 3RG0A 2BWCA 3SH5A 1FOD3 1AX1A 1YFYA 3N7JA 4QPGC 1N1VA 1R083 1BZWA 3CO2A 3EHKA 3L2YA 3AFKA 1YWKA 3DPRA 3ZN6B 1SLLA 2YV8A 3FUQA 4RR3C 2Z2SB 3AYEA 4IV3C 1GKBA 1OFSA 2F4PA 4MZUA 5KBFA 1DFQA 4C91A 4FOWA 4CDWB 2JG9B 4FP3A 1IQAA 1H8TA 3WDXA 4C1WA 1E57A 3ILFA 3GALA 3WXPA 1COV1 3VUOA 2BNNA 3ENRA 1HW5A 1YCIA 1UU5A 1YIFA 3ZXJA 2DVFA 3SLIA 4M3CE 1AUYA 1FXZA 1H2NA 2HWC3 2EIGA 2ZX2A 3D0SA 2P2KA 3FZ3A 5GZCA 1V6LA 3AMMA 1RINA 4CDUC 3ZXDA 3AP4A 2GNTA 2FZ1A 4QPIB 5DG1A 2TUNA 1B35C 4YLZA 4E4SA 3MGUA 4IEQA 1LHVA 1XNCA 3FX3A 4XJAA 5DXDA 2RMU1 2V73A 3EQEA 2A3WA 2R042 2VUJA 4M00A 5FTTC 2W52A 3NO8A 2R1BA 1F5JA 3SHRA 3WP3A 3AYDA 1LHUA 2X5IB 4YVWC 3BCWA 4BHPA 4UBHA 4Q8KA 2P3IA 1WCKA 2BVBA 4LLOA 3LA2A 1LR5A 1UN1A 3VBOA 3WP6A 1IPKA 2QE3A 1IS5A 1DGWX 1IS6A 3MZHA 4YG6A 3BB6A 1S0EA 4RHV1 3LOIA 3SCFA 1ZZ9A 4UW6A 1N1SA 3PVBB 1LU1A 3LOBA 4ASMB 1R092 2DUPA 3ZFEC 2VOWA 5L7OA 2PFWA 2MNGA 1WD3A 5C8CA 1DHKB 1DQ0A 4OVEA 3GBGA 1HV0A 1RUF2 3NVCA 5JPNB 4DB5A 1RITA 1CONA 3QLQA 2BNMA 3MI8A 4XEZA 1IKPA 3WD5A 1TNRA 3KB5A 2B46X 2VXRA 1KD7A 2ZGNA 4Z2WA 3CJXA 1S0FA 1VBB2 4GMP3 3ZFGC 5E1RA 1O91A 1A78A 3T2TA 1TEIA 4AEDC 3IN9A 3TYJA 5C4WA 4AFCA 2HYKA 1U0AA 3TBDA 3AYCA 4W6YA 4XFBA 4YM0A 1S0JA 3NV1A 4IEOA 1NY71 2ZHKA 1VBC1 4XOGA 2VVFA 4IETA 3NV2A 4AVBA 2XLFA 1F8VA 2JICA 1RUH1 2BWAA 3AKSA 4FPGA 1UZZA 3NSTA 4WVMB 3IMNA 1DIWA 1AF9A 1MVQA 4RQPB 1QJY3 3M2MA 3M3IA 3MIFA 4S2DA 4QQOA 5GZEA 2C1FA 4L9BA 4MV2A 1RUC2 3URFA 4AHWA 1EY2A 1OA4A 1RHI3 3ZXAC 1G9CA 3JZVA 5JOWA 4RD7A 3B3QE 3U4XA 1W6MA 3DL3A 2QQPA 2QJVA 2YHJA 4PCRA 5EWSA 5I91A 1RUE3 4BIFA 1S55A 2PN5A 3BOPA 3AP7A 4EN0A 3SNMA 2FHRA 4CDXC 3C3VA 4Q4V3 2CGNA 4YW1A 2FMDA 3RJ2X 2R16A 4KL1A 1DZRA 2JECA 2DCKA 1C5IA 3S7IA 2ZA9A 3E6BA 3PHMA 3H7YA 2C9AA 1IPJA 4ES8A 1ONAA 1RUG2 5JZGA 2JX9A 1HIXA 4RS5C 3RQ0A 1QKQA 4U36A 4FAHA 3JCIA 5FQ0B 1S0BA 3A0KA 3B5LB 3T1LA 2FQPA 2HWB3 1LOAA 4AVCA 4Y1ZA 3VDDA 3RI8A 1AR71 3VBRC 4CDQC 3M8LA 2OUJA 1J3PA 1NZCA 2PAEA 2VW1A 4COUA 1W6NA 4FCAA 3W58A 3I59A 1V70A 4H7LA 4YG3A 2BNOA 3MW4A 1HRI3 3MLJA 1BVP1 1NOVA 2OZJA 2TBVA 2XJSA 1Q5OA 3ZYGA 4EJRA 2ZJCA 4XFIA 2P17A 4GH4C 1OQDA 4AQ6A 1UF2C 1TMF1 3VDDB 4META 3HT1A 4I3PA 4FSJA 3CJIB 1RC6A 4NHMA 4Z1VA 3MF6A 4F83A 5HI0A 2B8MA 1W6QA 3N35A 3NWKA 5IK4A 1QJX2 2VNRA 1QJU2 5EFUA 5H9SA 5BNOB 2UY8A 2XBO2 3AFGA 1CJPA 1BXHA 1VRH3 3RYKA 3LWCA 1FX5A 3TNPB 4LHNA 1GNHA 4N53B 1LU2A 2R041 1EV12 2D43A 1A8MA 1RVF2 4YW2A 1V6NA 3OBRA 1AXKA 1ND2C 1HXS2 2ZS6B 4Q0UA 4HN0A 1BKZA 2Q4SA 4G3YC 4LO8A 2Z5WA 2IWGB 3ZX7A 2WNVA 4PIYA 2O8OA 4H55A 2NM1A 4KU8A 3FUOA 1VB4A 4AGVA 3HIFA 2AYHA 1J1TA 3WW2A 1L3JA 4CYDA 3AJZA 3N7KA 4J1WA 1JW6A 5L36A 4AQSA 1MZ6A 5JSPA 5D8AB 1K5MA 2RS32 1GR3A 3ZFFC 5FO7B 1OOPA 1O5UA 1VBE1 1Y7BA 1Z7S3 2P3JA 4RGGA 2CAVA 2DCZA 1REEA 3HN1A 5AFEA 4I30A 2XJRA 1UMZA 5J09A 4J1XA 1VIWB 3ES1A 1NG0A 4I02A 1VBB1 1AR82 4UBGA 2PHXA 1DZQA 5BNQA 1WUVA 1WBLA 4WBBA 1Y9QA 4N9IA 1OOPB 2JG8A 5BNPA 5GZGA 1PK6B 3C2UA 1ZZ7A 1D2QA 1WD4A 1C8M2 1SLCA 4MGYE 4R9DA 1J1LA 2XKOA 2NMNA 3V0BA 1AXZA 1ZVFA 1CJDA 5C9AC 1R1A2 1TME2 4WM8A 2GN7A 5JAXA 3ZVXA 2XLAA 3WP4A 1IS3A 1VBD2 4FXGB 2R063 3MDPA 3O14A 4IERA 1Q43A 1YYNA 3OYWA 4PLNA 4Q4X3 2IC1A 1CQ9A 3OF1A 3HAGA 1MZFA 4COVA 4FPCA 2Q1MA 4IQPA 2AENA 5KHKA 3FBYA 3I54A 1OPMA 2GAUA 5IK5A 5ACA1 5C6CA 3KD4A 4A7YA 4LHKA 2A7AA 2BFUS 2QUOA 3UKVA 3G6JB 4Y1XA 1KDKA 5HCAA 5FAXA 3RDIA 2ZHNA 3JBG2 4IEYA 3LKJA 3ZO0B 2IFWA 2XGXA 4E4ZA 1Q56A 3WDVA 4Y24A 2WA3A 4EWDA 4P9JA 1W2UA 1JUHA 2RS13 4QGNA 4AGGA 1HRV3 5DZEA 3N7LA 1RMU2 1ZBE2 1GSLA 4UW3A 4YGCA 3WINE 1U5XA 1MEC1 1ULGA 4HK8A 4URTA 1G9AA 4JGYB 3OD4A 3WR0A 2QNKA 5JOZA 1ENXA 4CEYB 2PHLA 3V0AB 4NVPA 5FLHA 1AYN3 1T6GC 4N43A 2ARBA 2ILMA 2YDEA 2VQAA 4CEWB 1WMDA 1C5HA 1VLNA 1D4M3 1Q3EA 5F1RA 4ISRA 3POSA 1NLSA 2VH9A 3L2HA 1HDKA 4AHYA 3WCRA 2GSYA 4IL7A 4LBKA 4K3UA 1KJLA 2K0GA 5ABJC 3E6DA 3DF0A 5F9TA 4LA3A 1KS4A 4MXWB 2GU9A 3M3CA 4NR1A 2EXIA 2A3YA 4YVSA 2CTVA 4HPKB 2R0FA 1LOBA 4WZFA 1QJX1 5GKAC 1QJU1 4B4PA