1CAUA

Determination of three crystal structures of canavalin by molecular replacement
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
AQNNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CANAVALIN
publication title Determination of three crystal structures of canavalin by molecular replacement.
pubmed doi rcsb
source organism Canavalia ensiformis
molecule tags Seed storage protein
total genus 37
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cauA00
1NE6A 1J3QA 3FJSA 3H1WA 3BPZA 1O3RA 2BYVE 3WW4A 2XHKA 3WW3A 3RYRA 1SEFA 2BNMA 4UXAA 4AVAA 5CADA 1U12A 2KXLA 1RTVA 1VJ2A 5FLIA 2EA7A 4XF0A 4MGKE 2V09A 4XFAA 4R8HA 3SCGA 3H50A 3NKTA 3E5UA 5KHIA 2XKPA 3TNPB 3USSA 3CO2A 4Q29A 4PIZA 4XFIA 2IXIA 3I7DA 4HMZA 4LUMA 2GC0A 2WFPA 5EZWA 2Z69A 5BXXA 1CAXA 4ZU5A 4WBBA 4XF9A 5JSPA 4DINB 3FWEA 4F7ZA 1H1IA 3FFQA 5BPXA 4LA3A 1VP6A 4YYOA 1J3RA 1V70A 1WA4A 4WVZA 2PHLA 2QNKA 2PFWA 5I0SA 4XEZA 1ZZ7A 5FLHA 5LRSA 2VECA 3D0SA 1ZZ8A 5BUVA 4XFHA 2XL9A 4JTNA 3LWCA 1I5ZA 4AQ6A 4XFCA 4ZU7A 3E6CC 1YWKA 4NVPA 4A2UA 1OMIA 3DN7A 4KL1A 5CVRA 5J7MA 3E5QA 2IXHA 1J3PA 5T3NA 4KWJA 2GAUA 2MNGA 3IDCB 3IDBB 4ONUA 3D0JA 3SCFA 3KGLA 5I8YA 5LRRA 3ROUA 5CU1A 4AVCA 3LA2A 2XLGA 4ORFA 4LLOA 4P9GA 5JAXA 4Z07A 3OD0A 3H7JA 2OZJA 4B29A 1Y3TA 5KHGA 3ELNA 5I91A 4LTAA 1YFUA 4O9GA 3SHRA 3TNQA 4QM9A 2UYAA 2OYZA 2ZKLA 2PAKA 4IEUA 2DCTA 2QCSB 3OF1A 4HLTA 5FPXA 2GC2A 1ZZBA 4LULA 3H9AA 2O8QA 1YHFA 5C6CA 3H1YA 3JZVA 1SQ4A 4N9HA 4YARA 5KHHA 1Y9QA 4J1XA 3CL1A 4BH9A 4O9EA 3ETQA 1OI6A 3FX3A 2K9ZA 5JCTA 3RYKA 4IESA 2EVXA 4E2SA 3LA7A 1ZRCA 2BNNA 4E2GA 3EJKA 1YFWA 3BALA 4K8FA 3SXWA 3H1MA 4UBHA 3MPBA 2VQAA 3ACLA 3SCHA 2CAUA 3E6DA 3HIFA 4OFGA 2XKOA 1CAXB 4XF3A 5EFUA 3DL3A 4YSFA 4IERA 2XGXA 4Q0QA 4AQ2A 2GZWA 5I0UA 2ZCWA 3PNAA 1NXMA 1XE7A 1LKNA 3NJZA 3RPQA 2FMYA 1H1MA 5FCCA 4J1WA 5FPZA 5I93A 1DZTA 2IC1A 2MPFA 1NZCA 2UY8A 5F1RA 4H7LA 1O5UA 3O14A 1FT9A 2CGPA 4MZUA 4N9IA 1HW5A 2E9QA 2ATFA 4PIXA 2BGCA 4KU8A 4L11A 5JSRA 3LOIA 2VPVA 2H6BA 4E2QA 4IEVA 4EV0A 4TLFA 4QX5A 3PVBB 2ETEA 1O4TA 1X7NA 3IWZA 2BEOA 4IEPA 3LAGA 3R6SA 3MZHA 2IXLA 3VHRA 3NSTA 4D7TA 4UBGA 4WZCA 4EWEA 4I01A 1ZRFA 3FE5A 3I59A 2I45A 2Y0OA 1Q43A 2Q0AA 4KWKA 1GQGA 2Q30A 1DGWA 4Q0VA 4XF4A 2PAMA 3NW4A 1ZZ6A 3ST7A 3BU7A 5I0TA 4OLLA 3U0ZA 4HN0A 4EWDA 2UY9A 1WLTA 5JR7B 3ES1A 1X8EA 1O7FA 4Q0UA 1QXRA 5C8WA 3I54A 5FLJA 5BV6A 4FAGA 4HBNA 1RUNA 4MX3A 3CLPA 2K0GA 4JV4A 1L3JA 3OCPA 5HI0A 4LA2A 2B9UA 2IXJA 1Q3EA 3EO6A 3QOPA 3MYXA 4I02A 1LR5A 5K8SA 4QGLA 2PYTA 3HT2A 1EY2A 1QXJA 1O5LA 5FQ0A 1ZZCA 1I6XA 3L2HA 3WW2A 3SMHA 3IBMA 1GQHA 3FHIB 1QWRA 2ET1A 1ZRRA 2C0ZA 2GC3A 3S7EA 3H7YA 3LA3A 2MHFA 3E6BA 4HVQA 4HVOA 5JSOA 2XL7A 1NYWA 4MGYE 5AVPA 3NVCA 1NE4A 2Z2SB 3BCWA 3UKVA 5I8SA 4QGNA 1UCXA 3QACA 1Q5OA 2O1QA 2CAVA 3U11A 4MGZE 1YLLA 3H3UA 2PHDA 2PTMA 4HVRA 1ZRDA 1LB2A 4IEXA 1O3SA 2H6CA 4FAHA 3OTFA 4I0AA 1UIKA 5FDBA 1IPKA 2QDRA 3I59B 1ZREA 4MGIE 4MV2A 3D82A 3GYDA 3EQEA 4Z82A 5D1IA 1G6NA 2ET7A 2N7GA 4I09A 4IEYA 4HSJA 1CGPA 3UKTA 1YUDA 4KWLA 1X8MA 2FQPA 4QM8A 1IPJA 1RL3A 4HZFA 2OA2A 2GH2A 1LRHA 5E1RA 2D5FA 4HN1A 3HQXA 1ZVFA 2D5HA 3S0MA 1TQ5A 4I3PA 3DV8A 2EAAA 1DZRA 1ZX5A 4RD7A 4QXKA 5E16A 4JVAA 1O3QA 1UD1A 5BY5A 3FZ3A 4L2NA 1OD5A 2Q4SA 1CAWA 4IEWA 3E5XA 3RDIA 2D93A 5J48A 5KBFA 1FXZA 1EPZA 4MUVA 4PIYA 5I0RA 1FI2A 2HKXA 4AXOA 4D7SA 4LEJA 1CX4A 4Q0SA 3ZDSA 1CAVA 2XLAA 3GBFA 5FQ0B 3KGZA 4IEQA 1CAUA 2BNOA 2D40A 3PLQA 1VR3A 3WW1A 4HSLA 3CEWA 1QY4A 4X6QB 1O3TA 1ZZ9A 3EHKA 1XRUA 2IXCA 3M70A 4MH0E 1XE8A 1X82A 1EYBA 3OGJA 3S7IA 2B5HA 4IEZA 1UW8A 2PA7A 3KSCA 4FBFA 4F8AA 2PAEA 3RYPA 4I2OA 5KHJA 2PQQA 1ZNPA 4GULA 3IIAA 3E97A 3U10A 1UPIA 2GU9A 4R52A 1RUOA 3H3ZA 3HT1A 2QJVA 3H8UA 2QVSB 1RGSA 4FT8A 4ZU4A 2HJIA 3M3IA 5I8TA 2WC2A 4CYDA 1YFXA 4XETA 1SFNA 3BB6A 1YFYA 2GC1A 2P17A 4XFGA 4QMAA 2Q1ZB 4YNIA 5LEKA 4BHPA 3EBRA 4BYYA 2XLFA 4IEOA 4Q0PA 1UIJA 3N4MA 3LZZA 3KCCA 1J58A 3MDPA 3CJXA 1J1LA 2OZ6A 3G7DA 5KHKA 3UKNA 1DGRA 4PJYA 4META 4X6RB 2F4PA 4EWAA 4JTOA 3NL1A 4BIFA 1WGPA 4IETA 4XFFA 3RZZA 2B8MA 3KMHA 3CF6E 2IXKA 4XF1A 1CAWB 4XFBA 3B02A 2OPKA 4I0BA 3DKWA 1EP0A 1JUHA 4YRDA 1OFNA 1PM7A 3C3VA 4QGMA 1CAVB 3ES4A 5J3UA 4KU7A 4EROA 5LEJA 2H0VA 3RNSA 4LUKA 1J59A 1PMIA 1CAUB 2CV6A 2UYBA 1RC6A 4AVBA
chains in the Genus database with same CATH superfamily
3BN6A 3BTZA 2V5YA 2VC9A 4ATFA 1J3QA 2Q1MA 5JMOA 1VMHA 3FJSA 3HN3A 3H1WA 4IE5A 4DOUA 3CQOA 3JQXA 3PVOA 3WW4A 3WW3A 4Q8KA 2BNMA 1W8ZA 4N53A 2E7AA 2HLEA 2JB8A 1U12A 2J42A 3C7GA 1RTVA 4RR3C 5BNPA 3JBG1 3KCYA 2XR4A 1WLCA 4OMDA 1CN1A 4QDSA 1IQDC 4B8EA 2AC1A 1W9WA 2JDNA 2W91A 3BGAA 1SDWA 2E63A 4MXVA 5FZ4A 4B4QA 4R8HA 1ENQA 3KLSA 5FXWA 4AFCA 3NMBA 4PBPA 1S2KA 2ZS6B 2XKPA 4J25A 2VZQA 3NJVA 4UT5A 2EIBA 3T0DA 2I74A 2LRPA 1YQ6A 2IXIA 4HMZA 4QU2A 4Q26A 2OXBA 4X8NA 4AHXA 5EZWA 5FZLA 2WNOA 1M06G 1CAXA 3C7FA 1LOEA 1Q8VA 4N43C 5FBZA 2BFUL 3WNPA 3FWEA 1SACA 2GMEA 2BUKA 3WCRA 1S0GA 1H1IA 2BGPA 4UFHA 3FFQA 5BPXA 1UYPA 5BNOB 3GBGA 4WV8A 2WBKA 2W9XA 1V70A 2JG8B 1OQ1A 2JDZA 2PHLA 2R7EB 5A7NA 4YPJA 4BQ1A 1QQP3 1JHNA 2ZA9A 3A22A 4XEZA 5I0SA 2YROA 3EYPA 5CAZA 1RUF3 5LRSA 1NG0A 2VECA 4F3JA 4ARYA 4HK9A 4BDVB 1VRH3 2NM1A 3ZOIA 3PTRB 2A1XA 2BWCA 3MUZ1 5BUVA 4CSWA 3KCXA 4M4PA 2A71A 4AQ6A 1CZTA 1I5ZA 1YIPA 2RM21 1VBD3 3LWCA 3R4DB 4XFCA 3WNOA 4CPBA 1UX7A 4K21A 4O61A 3TEXA 5LK7B 1RYYA 3VL9A 3EMRA 3PUQA 1UY4A 3HAGA 1EUUA 4CDXC 5A3LA 5CFCA 3ALQA 1RJ7A 1BKZA 1SCSA 5J7MA 2IXHA 3UJQA 2RR12 1LOBA 1FATA 3RZKA 3WP4A 5FWEA 4CUCA 5IATA 2XHNA 4INDA 4ONUA 3SCFA 4CU8A 5LW9A 4LIUA 3P5BA 1UU4A 1NCQB 1GLHA 2A5ZA 2XXZA 5CU1A 4AAXA 3S5QA 1IPSA 1LU1A 1XNDA 4LLOA 4X8PA 4AGRA 4C0HA 1W06A 5FUNA 2OZJA 2Y6LA 3UL2A 5C9AB 4TSVA 3B9IA 1PX4A 1QOTA 1N1SA 2GN7A 3M8LA 3RI8A 4Z8BA 4AQSA 4Y33A 1UZYA 3I2GA 3DF0A 4GZ9A 1ENSA 3ZSEA 5C4WB 4CUBA 4AEKA 4IEUA 5LBEA 5L19A 3OF1A 4AFAA 5FPXA 1JZ8A 5JOYA 1GKBA 2VE1A 3H9AA 4YZ2A 2O8QA 2CDOA 1S1AA 5FUIA 1IZ3A 1FMD2 3ZYBA 4MLOA 5FZ0A 3ZN6A 1ACCA 1QJZA 3ZN4A 2W46A 3ZFGC 5KHHA 5JXJA 4XCBA 3CL1A 2CY6A 2ZOEB 1AR92 3ETQA 4DQAA 3AZZA 4XHXA 2G9GA 1OPMA 2JE8A 1C28A 4LBQA 3VBHA 2YC2A 1VBE2 5IW0A 2W47A 4IESA 2LS6A 1QDCA 2JD4A 2EVXA 3LA7A 1RUF1 2BNNA 1ZRCA 3POFA 2HWF2 1YFWA 2LTNA 4N90A 2DBIA 4QPGB 4K8FA 4AL9A 5C7GA 1VRH1 4PDWB 1JTZX 3VDDC 4CDUC 3H1MA 5JI9A 4QX2A 1WD3A 1VBD1 2CAUA 2QBXA 3HIFA 1ST8A 3NV4A 4OFGA 1VALA 1ZYBA 4QWNA 4QXBA 1ZBE3 3U4SA 1BEV2 1JU3A 4LBMA 1UKGA 2DFBA 4CU6A 2FDIA 1PGL1 3AMHA 5DQ0A 1KRIA 3UGFA 3SLIA 4QKNA 4YFZA 3ZLIA 1NQDA 5H9QA 1EAH3 2IVJA 1RUD2 2JIGA 3GBWA 1MS0A 2RDQA 2ZJCA 4JRLA 5FYIA 4AYUA 3MUY1 4XIOA 3T0AA 3AXEA 1W9YA 4NWVA 3AYEA 1VIWB 2VGDA 2ADEA 2MPFA 1G8WA 4DZGA 3C2UA 1NZCA 4IV3A 2VCAA 1VMJA 4P00B 5IHRA 4NPLA 4H7LA 5FBJA 3O1SA 2QQKA 1FT9A 5JUVA 3OSDA 2ZX1A 4CP1A 4RFRB 4MHRA 1GOFA 3QCWA 4C90A 3WNNA 2BGCA 1QH6A 3WQ1A 3H42B 3POJA 3RWKX 4QQHA 2A7AA 3HQRA 5C8CB 2VPVA 5SV5A 1OF4A 2H6BA 3TEWA 4QPIB 2EIDA 4QAWA 3I3MA 3NV3A 1WCSA 4ZHNA 1LHOA 4D3WA 3LOBA 1X7NA 4MXWB 4GH4C 2ZABA 1HV0A 4LMFA 3R6SA 3V0BA 3VHRA 3GXUA 1COV2 2I07B 3ZYFA 1XYPA 1W0NA 4N7IA 1MZ5A 1FOD2 2PXJA 3POYA 1ZRFA 1IS4A 2GNTA 5JMCA 3BI3A 3RZMA 3I59A 2I45A 4M3CF 3K4DA 3WP3A 5C70A 3ME2A 4JDOA 4CDXA 2NMNA 2PELA 3KVAA 5F39A 1DGWA 1LAJA 3ZXKA 4Q0VA 3ZXDA 5FYBA 4CEWA 2PAMA 1VE0A 3FHAA 3NW4A 3V56A 5FYUA 1ZBE1 3UT0A 2WT0A 3AMNA 4YG0A 1KJRA 1SFPA 1UL9A 4FP2A 1XC6A 2UY9A 5EIYB 1JHJA 3FFZA 1W6PA 1QOSA 3W5MA 1XNBA 4E4DX 1YEWA 3ZYPA 1NCRB 3GHMA 3B93A 3I54A 5F2SA 4RGKA 5BV6A 3GZAA 4YG6A 2FBEA 5I0DA 1TNRA 4QDQA 3MW3A 2LROA 2VXJA 2RR13 3CLPA 3J4UH 5FZOA 3VBRA 3WQ7A 5IFTA 2XJSA 3VBSB 2JWPA 1VMFA 4CP0A 3B94A 1ULOA 1DQ1A 1WD4A 2IFWA 1W8FA 1BYHA 2B9UA 2IXJA 2WNVC 3AMPA 2ZX0A 3MYXA 4LE3A 4NWWA 2PQSA 3O0XA 1AYM2 3AP7A 3HT2A 2BJSA 4OHZA 3J7LA 1EY2A 3J7HA 3TYJA 4V2WA 3RSJA 4E8CA 1O5LA 2BQPA 4Q1PA 3USUB 2YG0A 4DO0A 5FQ0A 3SKVA 1I6XA 4GWNA 3L2HA 3SMHA 2RMU2 1BLZA 1MS3A 2YGMA 1TMF2 2A6YA 4QB1A 3CMGA 3VDDA 4CDUA 4DUWA 2ZHKA 4D94A 2GC3A 1NT0A 1FMD3 3GJAA 4YW7A 3S7EA 5B2GB 1DZQA 1YYNA 3WG4A 5CEHA 2QQJA 1C8M2 5C33A 2FZ1A 1BK0A 5KC5A 1CX1A 4KNCA 5DN2A 5F5CA 1H2MA 1GZTA 3CHXA 4P5HA 1OA3A 1IHMA 5FOJB 5AVPA 1UF2C 2WNUB 1VBE3 4XCAA 4BMEA 1A6CA 5T5JA 3U07A 3AFKA 5CNAA 2VBBA 4QGNA 4UFLA 1GZCA 2HWF3 5EP9A 3QACA 2A6ZA 4NN0A 2VG9A 3K4AA 1YLLA 2PHDA 2Y64A 1V00A 1SLLA 2P34A 2ES3A 4AGVA 4FSJA 3AYDA 2VUCA 2FDKA 1H2NA 2GDFA 1LGNA 3KHBA 3I3DA 1IG0A 1BEV3 5A1LA 3ZXFA 3AKRA 1O3SA 5A3UA 2DUPA 4I0AA 3WVJA 4KG8A 1IPKA 3PUAA 4FFGA 3KWVA 4D0QA 2RR11 1ZREA 4QX8A 1UN1A 1YQCA 3ZFFB 4K40A 4MGIE 4BB3A 5IK5A 4NRQA 1TVGA 1NLSA 1RHI2 1D0GA 4GMP3 4YVWC 2D3SA 4YLZA 3KV4A 1PHMA 3EQEA 1G6NA 1DQ5A 1O6UA 3JB8A 3OD4A 4IEYA 3RZGA 3AP9A 3ZYJB 2AEYA 1YUDA 2BFUS 4OUEA 5GZEA 4KWLA 1D2QA 4Q5OA 3PMSA 4LBOA 2R6QA 3WHUA 1GNHA 2GH2A 4HN1A 4JGZC 5IVVA 3HWJA 1O4ZA 1RJ8A 3MIHA 1TQ5A 3AMMA 3DV8A 2C9KA 4QPYA 1WMDA 2X5IC 1DZRA 3A0KA 5L7OB 1ZX5A 3POEA 4FPKA 2BPA2 2Q8CA 1UYYA 2J22A 2DU1A 1NX9A 4IXLA 1WWYA 2XMLA 5EJZB 5E16A 4FTSA 1FMD1 1DF0A 4A3XA 1C1FA 3QD6A 1W28A 4K7JA 1CONA 3POBA 3SNMA 1UY1A 3AJZA 3CZUA 5BY5A 3O5SA 1WZXA 3LFIA 4OHYA 4DNYA 4L2NA 3C7EA 2RS33 3WX5A 5F2WA 5KXBA 3E5XA 2R16A 1GWMA 2DCZA 2VZTA 4V2VA 3RDIA 2WFF2 2HBUA 1EPZA 1COV3 1W2OA 1VBE1 4MUVA 1V6JA 5FMDA 5FY4A 5I0RA 1JYTA 4YW2A 3VZKA 1FOD3 1CX4A 1F2NA 4DY5A 1SLAA 2B42B 2HWF1 2XB6C 3GCXA 2XLAA 4OYUA 3GBFA 3WT3A 1FX5A 1VB4A 1KJLA 2R1BA 1N1TA 1SBDA 4CCMA 1AR82 4XBNA 4UFKA 3WW1A 4FFHA 3AZWA 4OI1A 1ONAA 1QY4A 2Y33A 4X6QB 4Y5SA 3WDYA 1BEV1 2VZPA 3MIDA 1VBA2 5A3MA 3THDA 2VNVA 2DDUA 4R9BA 1NOVA 2SLIA 2WNVA 3LDBA 2C24A 2W08A 5FY0A 2DV9A 3ZFEC 4UF0B 4DXTA 5A32A 1SPPB 1XRUA 1WCUA 3FC0A 1GYKA 3M70A 1RITA 4IE0A 1MQTC 1QOOA 3OPWA 4M4RA 5FMCA 4RN5A 2WZR2 1EYBA 1RUD1 3OGJA 2WJSA 3W59A 3BU0A 1E5IA 1H2LA 5FZKA 4GMP1 3KM5A 2BOJA 3LB9A 4IEZA 3GZEA 2HWB3 4YM1A 1UW8A 2R072 2NZ9A 1AVBA 5DG2A 5G05L 3PIGA 2PA7A 1ULFA 5JVVA 3VBFB 1H8VA 1UZVA 3ZMNA 1NUKA 1XJAA 4XDOA 4COZA 4YGBA 3RYPA 3AFGA 3MIFA 4UW6A 1BZWA 1E57A 4I2OA 1YRZA 1MPXA 2DURA 3OUIA 2XVKA 1ZNPA 4GULA 5H9PA 1AYM3 3HMYA 5F3GA 2DUOA 3IPVB 3QBQA 3WNKA 4AFDA 4A7ZA 1C1LA 4LOTA 4AI8A 1RUOA 5FREA 4AFMA 1HJFA 3O12A 5FYHA 1BVP1 2JD9A 2VR4A 2QJVA 3WV6A 1C5HA 1XB9A 2R062 3ACFA 3H8UA 3INAA 4C91A 1W2UA 2VOKA 4XXAA 1RGSA 4ZY9A 4ZU4A 5JIUA 2TEPA 5JI7A 1LHUA 2R30A 3VKNA 3WEZA 2JDKA 5GLZA 1SFNA 5J36A 1YFYA 5J37A 4JDNA 2UU8A 4LLFA 1GMMA 1BCXA 4ISQA 2ZTNA 1COV1 2Q1ZB 4DXRA 3CKHA 4YW1A 1YQ2A 1SCRA 4BYYA 1FOD1 1VBC2 1WW4A 4Q0PA 1C8M3 5EHDA 3LZZA 5JOWA 1GQPA 1MS9A 3VBUB 3WD5A 1ZRIA 3KCCA 3MDPA 2H0BA 3DPRB 4NJ4A 1POQA 2VULA 1J1LA 2OZ6A 4GKXA 1A8MA 2GALA 1CZSA 2P3YA 5KHKA 4AR2A 1FNZA 1B35C 4AVVA 3IDEA 3CJIB 2C9AA 1V9U2 3LE0A 4TN7A 3I49A 1H4GA 1AUYA 1TME2 1WGPA 5FZEA 4XVHA 1NA1B 2B8MA 2HBTA 1RMU3 3MIBA 1UAIA 4E9KA 4P14A 1XQNA 2VMIA 4XF1A 4XFBA 2YC4A 2HEWF 4ZXKA 3LEIA 3ZKYA 4XJUA 1CESA 4HONA 4I0BA 3X29B 5JPMB 1EP0A 2BVVA 2ORXA 1JUHA 3IN9A 3TWIA 1QJU2 2YPDA 1HXS3 1S2BA 1HV1A 3AP5A 4HPKA 4JGZA 4Q4Y2 2O0OA 3PUHA 4YRDA 2JG9C 4Y26A 3C3VA 1KD7A 4QGMA 2Q8DA 1NLQA 2QE3A 1CAVB 1WW7A 2VZ1A 4I30A 5J3UA 4KU7A 4Y3OA 2YGLA 4FPCA 4UFMA 4EROA 3VDCA 4CDUB 1KS5A 4FCAA 1RHI3 1STMA 2UYBA 2FD8A 1RC6A 1DHKB 4Y1UA 1PK6B 1D4VB 2EIGA 2E7QA 5CFDC 1AYM1 4NHMA 4XURA 3ZMOA 1UOFA 1T6BX 2OVUA 4FO9A 1MS4A 1LOFC 1WW5A 3MICA 4GKYA 3IKWA 4NPRA 4UW3A 4AVAA 3T09A 1JOJA 1DQ0A 5CADA 3BTXA 4IV1B 4JHZA 4XF0A 2BERA 2RMU1 1UXXX 2ZHNA 4FQ4A 1TMF1 1V6MA 5C3RA 1WKYA 4Y5TA 4JDMA 1VB2A 2V09A 2LW8A 3M3CA 4PLNA 5A33B 3H50A 2E7TA 2ZGSA 1AF9A 4E4ZA 4I0WB 4XDPA 4F83A 2VOTA 2EALA 5B4NA 3GZUC 1C8M1 2KA3A 3AL6A 4NAOA 4Q29A 3TNPB 2J1TA 2B46X 4MOAA 4XFIA 2NQYA 2B45X 5C5UA 2W52A 4N53C 4FFFA 4AEDC 3ZFEA 3FL7A 3JXSA 4LUMA 2VM9A 2WFF3 1JU4A 1IGOA 3LF7A 2ZEYA 1MQTA 5GZDA 4Z92B 1HQNA 3MLLA 5FXVA 4CE8A 5ACA2 4DINB 5JSPA 4QKFA 3BKZA 4AG4A 2WDBA 1FNYA 4QQPA 2QQPA 2QQMA 2WR9A 2PHRA 1PNFA 1QQP2 3BPSA 1VP6A 2A3WA 2V4AA 1W6MA 2W1WA 3THTA 3TAYA 4BIOA 1CR7A 2JKBA 2QNKA 4LQRA 2VD7A 4EN8B 3N3HA 1ZZ7A 1VBA3 3GF6A 2KD7A 5A7WB 4NE9A 3ACGA 5FUPA 1S0JA 4HXCA 5F6LB 2YU1A 4C1WA 4UW4A 2JDAA 3T2TA 1OOPB 3M7AA 2UWCA 4Q4V3 3WUCA 2DCYA 1HB3A 3AKQA 2WZR3 2WWJA 2Y8KA 4JTNA 1RHI1 2YBKA 4RQPA 4XTMA 1AHSA 1F4AA 2QQOA 2R073 3IAPA 2R32A 4GWMA 4CU7A 4JGYB 3H8XA 4LKEA 1W39A 5CVRA 5IFPA 4CVUA 4PHZA 3E5QA 5EV7A 4KWJA 1JYCA 1OLRA 1Q8QA 3THPA 1SLTA 5D8AB 1K5MB 2FCUA 3B00A 2W39A 3GHNA 2A6WA 2YB7A 3PDQA 5FY1A 1OLQA 3KGLA 5LRRA 3T4HB 3ROUA 1LGCA 4AVCA 2AREA 4L97A 5CA6A 1DLCA 1F35A 1R1A2 4Y20A 1GWKA 1ULCA 3H7JA 4XJZA 3NNJA 1XU1A 1HKDA 1WLDA 1Y3TA 4P08A 4QX1A 4UOJA 2R063 3ELNA 2WO2A 5CFCC 5EWSA 3VDBA 3POIA 1XBFA 2HWE2 1YFUA 1GOHA 4LTAA 4O9GA 4RR3B 1G9BA 4DRRA 3SHRA 2VBPA 1OQEA 2HEVF 2ZKLA 2J1EA 3AL5A 1S2EA 1CJDA 2JECA 3VZJA 2KR2A 2VNGA 2WFF1 4FPOB 4ARXA 4BU2A 2GC2A 2PHUA 3SITA 2BDRA 1W6NB 3DUIA 1REEA 1VBC3 3JZVA 1MZFA 2DVDA 2HWD2 4JKKA 3RMXA 1RUE3 1Y9QA 2PHTA 4J1XA 4JKMA 5DUVA 5K0UA 4OI0A 2W1UA 1AR81 1HB2A 4NRMA 1NQJA 1W05A 3I2FA 3RWNA 5LY1A 4XW3A 2VMHA 3KS7A 4N43B 4FPEA 3W9AA 2VL4A 1V9U3 3WUDA 5H9SA 1VBA1 1URXA 2AACA 3O1OA 1K12A 1RXFA 1TME3 2LALA 3PU3A 4HKLA 5CFDA 3BALA 5DZEA 2FCTA 4S2DA 2ZHLA 3DEMA 4RFT0 4CCOA 3MPBA 2WZR1 3ACLA 3PUIA 3U78A 1QJU3 3E6DA 4EZHA 2G19A 1AL22 4KBZA 1LHWA 4XF3A 4L8QA 2R071 3DL3A 1G9AA 1EAH2 1E5HA 4LE4A 5DAVA 4ASMB 4Q0QA 5HPOA 3FBYA 1X36A 2ZGRA 5DMYA 2ZCWA 5JXIA 3DXTA 3IPVA 1GP6A 1NXMA 1XE7A 2RDNA 5F5QA 1V6IA 1U5IA 1QU0A 3NJZA 4Y1YA 3RPQA 4P02B 3WNXA 3HNMA 1H1MA 1JBCA 1UU5A 1UX6A 4AEDA 4Y1XA 1DU3D 4Y4RA 5LBFA 2R061 1RB8G 3N9PA 5FJHA 3WF0A 3I4IA 4GWJA 4AOCA 5M0TA 3NAPA 5JOXA 1HW5A 2E9QA 1R092 3GGLA 3S57A 3H8RA 1S0EA 2D97A 3GDBA 2CL2A 1MACA 3JCIA 5D2AA 3K4ZA 1HN0A 2G9ZA 3LOIA 4LK7A 5JXHA 2L9LA 3NNMA 3WF3A 1VBC1 4EV0A 4MVTA 3WCSA 4PLOA 4CDWB 4IV3C 3I3BA 4QB2A 4W6XA 1HJGA 3GZTB 3K77A 2A6XA 2WL1A 3IWZA 4COVA 2BEOA 3NSTA 5ABJB 1OURA 1LENA 1XNTA 2GMPA 4UBGA 5FP4A 2VAUA 4KWUA 1V9U1 5E89A 3ZFGB 1W6OA 4Q2FA 4I01A 4EWEA 3M4FA 1G9FA 5BNNB 1GZWB 1TME1 3MF6A 4KH9A 3MF9A 4JC1A 1DBNA 3LFMA 2LM3A 4AAPA 1VAMA 1XNKA 2AZ5A 2Q30A 2VUJA 3KV9A 3PJYA 4Y1ZA 1WUVA 1WCQA 1QJU1 4IQPA 1ZZ6A 1UNBA 3FMGA 4Q4Y1 5JIAA 3ZR6A 4A42A 3ST7A 1I1EA 3BU7A 5EQUA 1NY72 1KFXL 1X9TA 4EWDA 3QH6A 1W99A 3ES1A 1X8EA 1O7FA 4XZUG 2CNAA 1F31A 3HBZA 3MO4A 3J26N 4Q0UA 1WBLA 1QNYA 2CTVA 2E51A 2NYYA 4M00A 4NPMA 2VVEA 4Y4YA 5FLJA 1HRV2 1TNFA 4AI2A 4GAZA 1JUIA 1AZDA 3A0NA 4CEWC 1JOBA 3T1MA 1UOGA 4NIIA 1RUNA 1AXKA 1LEMA 4QPWA 4ES8A 3ASIA 5HCFA 1AR62 2NN8A 3A7QA 3I2DA 1L3JA 3MIGA 3VUOA 1UZWA 1ULGA 3I2KA 1A78A 4Y22A 4GMP0 4RS5A 5DDJ3 4EJRA 1AL0G 5DAQA 4LA2A 1R1A3 4DS0A 3O0WA 3QOPA 1D0HA 1RUH2 4LO5B 1E5RA 5K8SA 1TZOA 2BOIA 3U1XA 1H9WA 5JOZA 3P3NA 2HWE3 4XILA 3OY8B 1MEC3 3VBRC 2V4VA 1JI6A 4QB6A 2GNDA 4CUAA 3V0AA 4BE3A 1CVNA 1QJX2 3MLJA 3BTAA 1GQHA 4IE6A 1PO12 1JOPA 3B5LB 4QQOA 5J09A 3FHIB 1HB4A 2Q5TA 5HXMA 1M4WA 1OHFA 3LEMA 2ET1A 1ZRRA 2C0ZA 2FCVA 4AHYA 4H55A 4NO4A 5GLWA 5ACA1 2HWD3 2MHFA 3HQUA 3VKMA 2QTWB 4GALA 4HVQA 2R49A 5A70A 2XL7A 1QQP1 3MW4A 4GH4B 4ZXEA 1OKQA 1NLRA 1H8TA 1PO23 3DYMA 3L9JT 2G4IA 1NE4A 3QLQA 3LIGA 1WA6X 1R082 4PI0A 4GA9A 3BCWA 1IS3A 1L7QA 2CGOA 1OF3A 3IMMA 4XMIA 5CKQA 5F3EA 5F3IA 5FKCA 5GM0A 3ZIWA 5BNOC 1C8NA 3UYJA 1ZBA2 1UCXA 1Q5OA 1S0IA 1JYVA 4XUPA 1UKRA 1XYOA 4YG3A 5LK5A 1AX0A 1RUJ2 1H1AA 4Q1RA 4QXHA 3WF1A 4W50A 5IAVA 5ANQA 1AL23 3WF2A 4CCJA 1JZ6A 2OQ7A 4LKDA 4CRQA 1WCDJ 3J7MA 4FAHA 2V72A 3OTFA 2ORZA 1UIKA 5F5IA 5FXXA 3C8XA 3RJRA 1HB1A 3OGGA 1RIRA 1SZBA 5CZKA 2TUNA 2VXRA 1DQ4A 1LOAA 3D82A 3KF3A 1W2TA 5DABA 4CEYB 3GYDA 3DECA 4M3CA 1R1A1 2E6VA 2N7GA 4I09A 5D1IA 5DZGA 5GZFA 4LJHA 2WZ8A 2GN3A 4YZ4A 1YNAA 1V6OA 2FQPA 1RL3A 1NCQC 2OA2A 2XJQA 4N8MA 2HWE1 1N3PA 2D5FA 4GIQA 1HRI2 4YGDA 5E1RA 1YIFA 4AK3A 1H6XA 1IKQA 2NMOA 1R093 4OQ9A 1WMEA 5JWPA 5IWFA 2RJ2A 2ILMA 1A8DA 4RD7A 1KDKA 1ND2A 4WM8B 4LIVA 1PGW2 3RQ0A 1DDLA 2PHWA 1ND3B 3CNAA 1Y4WA 3AP6A 4QXKA 5C4WC 1JXNA 1D4M3 3ILFA 2RS32 5E8AA 1UY2A 4CTEA 5CG9A 1O3QA 2HWD1 2YC0A 3AKPA 2ZPXA 3Q8AA 2W3JA 3GM8A 3WOGA 3VLBB 4JQTA 1V6NA 5IVBA 1CAWA 4L0PA 4DEVA 2D93A 4A4AA 3FN9A 1ZM1A 3AC0A 2WWUA 5FY7A 3ZXEA 1GR3A 3OB8A 4B7KA 4FI9A 4CP9B 4LEJA 5J96B 3ZDSA 5JZGB 2B4KA 1QGLA 3AZVA 3H0OA 5T5LA 2JKXA 4LOSA 3KV5A 2JDUA 4NHKA 3KGZA 2BNOA 2D40A 4CP2A 5LCWL 1AL21 5DUWA 4QPGC 1O3TA 1EAH1 4BA6A 1RUC3 2R043 4AGGA 1S0DA 2XUEA 3EHKA 3HEIA 4HKOA 5FYSA 2MEV3 4XE9A 2CHHA 2HWB2 5EYYA 1N1VA 3WG2A 3N7KA 1FV2A 1GNYA 3HD8B 3I2JA 4URTA 3RJ2X 3ZXJA 1HRV3 1YI7A 3VB9A 5GLVA 1S0CA 2Y26A 1PVXA 3M2MA 4A7YA 1AR63 4F8AA 3KQRA 2PAEA 3J8F3 4CZSA 4YVWB 1Y9MA 5IK7A 4HFSA 2AR6A 2F6BA 3A21A 1CJPA 1R091 2IUWA 3J9SA 2PQQA 1RUH3 1OPOA 3BIWE 3OPZA 3E97A 4CDWA 2VTXJ 5EJ3A 4YM2A 1LULA 4NR1A 2D43A 3H3ZA 5FY5A 2QVSB 4A45A 1D4M1 1ZA7A 3LDKA 3VHOA 2B9VA 2HJIA 1QJX3 3P3PA 3M3IA 4NMIA 3WR0A 1PO13 4D6SA 3VZMA 2C6SA 2WSVA 5ABJA 1BVVA 3Q8EA 3BB6A 2GC1A 3OEAA 2JG8A 3N9OA 3PU8A 1GZWA 3PUSA 4FFIA 4MGSA 4QU1A 1VBB3 4CA9A 2Z4FA 2WN3A 4TLGA 5A6QA 4O65A 3WSOA 3FLTA 4IEOA 2G9FA 2DUQA 5CBLA 5LY2A 2WO3A 3BUCA 4OHXA 4YVSB 4P9LA 3VL8A 1OVSA 4PCRA 1X9PA 4Q4W3 4ES9A 1C57A 2BBAA 1R083 5FZCA 4XJWA 3I8TA 3G7DA 2PMWB 1RMU2 1Q8OA 2O8OA 3KB5A 4W8JA 4BPZA 4LBQD 1ZBA3 2JDYA 2P6HA 3HBKA 4BK4A 1LEDA 1NY71 1YJKA 1JZ7A 3FLPA 4JRAA 4IETA 1P8JA 2IZWA 1A3KA 1WLWA 4ZS2A 1VLNA 4JX0A 2D98A 1HXS2 1RUJ3 4FOWA 3FHQA 4WVMB 3S6PA 1NCQA 3DKWA 1S4CA 1HRV1 3URFA 2DCJA 2VO5A 3POSA 4HANA 1PMHX 3B9CA 1PM7A 1Z7S2 4FOVA 4H7MA 2CGNA 2LUWA 2Z5WA 5DZFA 4OUSA 5C9AA 5LZ6A 2IFRA 1UOJA 2FHRA 1G86A 3OOXA 2FDGA 1AR61 3UJOA 1LECA 2E31A 1NCRC 3MBWA 4ZS3A 5LASA 3OYWB 1CAUB 4K1ZA 5C4WA 4NHLA 4ASKA 3IT8A 3RMYA 5A3TA 1XNCA 1UMIA 1W9TA 1BMV2 5L9BA 4GB32 4OMCA 5IVCA 1RUH1 2QQWA 1HLCA 1US2A 3BPZA 1O3RA 2P5BA 2VZUA 1AR73 2BYVE 2XHKA 3VBSC 4KMQA 5APAA 5A7SA 5IYYA 5F9TA 4OCTA 5A7OA 3RYRA 4HL0A 2P1BA 1SEFA 1HRI3 4QQ2A 3VDAA 1OLMA 5T50A 1IS6A 1VJ2A 1QJX1 5FLIA 4L9BA 2EA7A 1PO11 4CXWA 3LDRA 1MR5A 2BBVA 4LT5A 3Q8CA 3N9QA 1SLBA 1TG7A 2YV8A 1YC61 1VAVA 2A75A 5A7QA 2WS92 3DYPA 5KXDA 1JW6A 5KHIA 1SBEA 4LPLA 4QPGA 2BGOA 3CO2A 2SBAA 4W6YA 4Q8LA 4QD2A 2ZXQA 4PDWA 5FK8A 4B4PA 2XJVA 2ZMNA 4YGCA 1R081 4EQVA 5CYYA 4KBBA 2Z69A 5J98B 4ZU5A 3K48A 1DFQA 4WBBA 4LBNA 3NKGA 4XACA 3ZM8A 4D6RA 1ZBA1 2WQZC 1VPHA 3LGRA 4F7ZA 4EYUA 1DYKA 1QHDA 1UPSA 2WNUC 1PX3A 3S5AA 2W1QA 3T1LA 1Q8PA 3WZ1A 4LKFA 4YYOA 1J3RA 1RUJ1 4P9XA 4W65A 4WVZA 2GH8A 2HEYF 2WKKA 4QX7A 5SV8A 1B35B 1JS9A 2P6CA 2D3PA 5FLHA 1QJY2 4Q4V2 4OHVA 1EUTA 3RI9A 3WDVA 5FPUA 1PZ7A 2NLRA 4AVTA 2P3IA 4ZZ5A 1N1YA 2XL9A 3AP4A 1POV3 3Q9OA 4OUMA 5FIXA 4WM7B 2FDHA 4XJAA 4B3NA 5FFOC 1J84A 1UOBA 4IDZA 3E6CC 2JG9B 2VW0A 5IK8A 1AYN2 4A6SA 1DYOA 2VTXA 1CIWA 2Y6KA 2DVAA 5FO7B 3C7OA 1OMIA 3W5NA 5C8CA 1SMVA 3B7MA 3R4SA 1J3PA 4QPIA 4Z1VA 4R4ZA 4JZRA 1WMXA 2ARBA 3UNPA 4J6GA 1H2KA 1HRI1 3IDBB 3D0JA 5I8YA 1ND3A 3LA2A 1SLCA 2XLGA 4MXWA 4RQPC 1OC1A 1CPMA 4Z07A 3WP5A 5KWRA 1BBT2 1Q8SA 1PGW1 1OA4A 2OW4A 1APNA 2RS31 2XH6A 5I91A 1DG6A 5K9YA 1J83A 3D8CA 5L7OC 4XC9A 5FOBB 2EICA 3JD72 1U0AA 2UYAA 4HKWA 4QM9A 3PMEA 2PAKA 2Z42A 5IUQA 2DCTA 4HETA 3UESA 1XOYA 2VCCA 1HX6A 2QCSB 1W8TA 2HYXA 4O7XA 1ZZBA 5FZFA 1RUE2 2XJUA 4MSVA 1O8SA 3K3OA 4PBOA 4Y24A 2WA4A 1SQ4A 2AH2A 2WINB 2ZGOA 4BISA 4N53B 1F4HA 2BRTA 2PN5A 5G04L 4BH9A 4O9EA 5BNPB 2AEZA 3FX3A 2K9ZA 1VAKA 4IE4A 1NCRA 5JCTA 4SBVA 2VUDA 3Q8FA 5FZ1A 1OFSA 5C5TA 1XXNA 5JDBA 4AI9A 4E2SA 5AFBA 4E2GA 1T2XA 3EJKA 3WINE 3KT4A 2R0FA 4L92A 4ZPIA 2EXJA 3I2IA 2WZPP 3SXWA 3VBSA 3JB4C 3QH7A 2HWB1 4K6BA 4UBHA 5K0UC 4S2HA 1AX2A 1U5ZA 3LPGA 4LR4A 5HBAA 1ASJ2 3SQOA 2XKOA 2QUOA 1CAXB 1Z7S3 3ZSMA 5DAWA 1QIQA 3AJYA 1CWPA 2GSYA 4KG0A 1G7YA 4AQ2A 5I0UA 4GD4A 3NQHA 4XQWA 4UAPA 4YFWA 3U4XA 3WF4A 3USUA 3PTYA 4CDQB 3PNAA 4SLIA 1MVEA 1KGYA 3VBFC 4GB33 2FMYA 1CQ9A 2X29A 3ILRA 4GQ7A 1JZ2A 5FCCA 2ZGKA 3PVEA 1DZTA 2ZEWA 2WABA 2ZZJA 4QKDA 4MGQA 5J1XA 1I5PA 2XJPA 1Z78A 2UY8A 3WDWA 2X09A 5F1RA 1JZ5A 5EJ1B 3AVSA 4BQ4A 1O5UA 3OGVA 2YY1A 2CGPA 1PVC2 4MZUA 5KXCA 5DPNA 2ATFA 1L7RA 5FK7A 1OH4A 2WNUA 3FLRA 5FRAA 2XQXA 2BWAA 5FY8A 2WS93 2VMCA 1C3HA 1UMZA 2AYHA 3BOWA 1US3A 1U5YA 2D6NA 5T5PA 2VOWA 3NWKA 2YDEA 4QX5A 2HYKA 4TXWA 4ZONA 4FOYA 1YI9A 3ZXGA 1QDOA 3NAPC 1LU2A 2RHPA 2ZGPA 3N7LA 4IEPA 3LCPA 3KVBA 2IXLA 3MZHA 2JIJA 1XSQA 2VW2A 5A6ZA 4BQ3A 3ATGA 1RMU1 4D7TA 3VBUC 1N3QA 2AGSA 1ZA4A 3I3QA 2NP0A 3FE5A 3WXPA 1N47A 3VBOC 5LBBA 1FPN3 2R0HA 1IS5A 2JX9A 3UV9A 2Q0AA 1HXS1 3ZFFA 1PZ9A 4YZ5A 1GQGA 2VH9A 1TE1B 2ZGLA 2PHFA 5GKAC 4XF4A 3CBNA 1RUI3 1QJY3 1NA1C 3HN1A 1Z7S1 4Z2AA 3ZN6B 4BWOA 1NXD1 4E8DA 3ZYRA 2WNEA 4XUTA 5D21A 2VNRA 2WLPA 4ITCA 2TBVA 1QXRA 1Y43B 3VBHB 3FUOA 3ENRA 4LBQB 4CXXA 2J1UA 2P3KA 4DXZA 2XUMA 2XJTA 3VZOA 1AYN3 1BMV1 4GB31 1JMUB 5L7OA 5LB6A 5KR7A 4FAGA 1PMJX 5K4LA 2JICA 4HBNA 5DDJ2 5L36A 4CU9A 4H2AA 4XTPA 3S30A 2OUJA 4BLJA 1AJKA 2W5FA 3OCPA 4FXGB 2JE7A 2QQUA 4L99A 5AC92 3ORJA 1HN1A 4G4FA 1JODA 1HQLA 5ANNA 1X50A 3I2HA 5AFEA 2VOXA 3EO6A 1BBT3 1MEC2 1LR5A 2GNBA 4COUA 2C4XA 2PYTA 3PVNA 4IGQA 4A41A 1DIWA 2WS91 3APBA 4BQ2A 4LO8A 4LO4B 1ULEA 2Y6FA 5A6YA 1GICA 3M3QA 2CDPA 3JD73 3KQ4B 2VQ0A 3WW2A 4FP3A 3P6BA 4RS5C 3VD9A 3DYOA 1H0BA 3T2PA 3O1VA 2ZHMA 1MVQA 3WNLA 1JYXA 1GUIA 5AVAA 1QWRA 3NNFA 3PIJA 2HH9A 2W0XA 4IV3B 2Y0IA 4LORA 2X8KA 1PO22 2VQTA 5IK4A 3IMNA 5JSOA 4HVOA 2DTWA 4UF0A 4MGYE 1SPPA 1V6KA 4R9AA 4KQ7A 3ZSKA 4E4HA 2FZ2A 5FMOL 3EB7A 4P9WA 4FTEA 1YQ5A 2VVDA 4XPVA 2D3RA 2ZAAA 3UKVA 3O1UA 5I8SA 1QJY1 4QX3A 4Q4V1 1UU6A 3VBFA 4HK8A 5T52A 4P9JA 2O1QA 3B69A 3U11A 3UETA 4MGZE 2RJLA 2PTMA 3DXUA 1GFF2 4XZPA 4AF9A 4RHV2 1ALYA 1UQXA 3M3EA 2BZDA 3N9NA 3OBRA 3RVHA 1ASJ3 3VKFC 1KFUL 1H8TC 4XUOA 4K9SA 5FO8B 3V0BB 3NO8A 2XPJA 2WA3A 1AYN1 3POGA 4IEXA 3NV2A 1AX1A 2BU9A 2WAAA 2H6CA 3PURA 1JH5A 5C3PA 5FDBA 3N9MA 4Q4X2 2O14A 3T30A 1NKGA 5DAXA 4LHSA 1SFYA 3I59B 4B1MA 4CDXB 2DF7A 2JDPA 2WWSA 4FVVA 4GXLA 4LNVA 3R0RA 1LCLA 3ZIXA 1UXZA 3H8OA 1Y9GA 4K3UA 1QH7A 4TZDA 1AJOA 1W6QB 5KC6A 2YFZA 4CEWB 2ET7A 1PGSA 4HSJA 1BBT1 1FYUA 3IB3A 4P9YA 3UKTA 2ZX4A 1SDDB 1BK1A 4QM8A 1IPJA 5FJKA 2B7YA 1W6PB 1GP4A 3LPFA 5FZ3A 1PVC3 4NOTA 4FXKB 3VBUA 3HQXA 4B4RA 4QHBA 4CCNA 2D5HA 1LGBA 1ZVFA 3AM2A 3JD71 3R4UA 5FYZA 3S0MA 1SG3A 3DPRA 4YM3A 2EAAA 3TEZA 1D4M2 2RG4A 1W2AX 2CYFA 2WIIB 4A6OA 2V73A 5BNOA 2VCMA 1RUE1 3WG3A 2A70A 2E53A 5FZOB 3VBRB 3CJIA 4E4SA 5JR2A 3VD7A 2YXSA 4BZ4A 4JVAA 1X33A 2VU9A 3ZVXA 2W94A 1RUG2 1NA1A 1UD1A 3WDXA 4AQTA 2Q4SA 5ISLA 5J48A 4CCKA 1OT5A 5FZMA 1W04A 2VVFA 4PIYA 4COWA 2TNFA 5HCHA 2HKXA 4D6QA 1ND2C 4AXOA 1CPNA 2ZEXA 3V64A 1VRBA 2XG3A 1CAVA 5FTTC 3ZPOA 4XUQA 5FQ0B 3U14A 3WLUA 3E1F1 4PF5A 3FBMA 1HQWA 3MV01 4IEQA 3LD8A 3OGRA 4K8RB 4P9IA 1DGWX 4N7UA 5DG1A 1H30A 4A44A 1RUC2 1OUSA 2R042 3ZN5A 1PK6A 4XAEA 1ASJ1 3AXDA 5H9RA 3CEWA 2VY0A 3VDDB 2RVAA 2EXKA 2YHJA 4FPFA 5T54A 4AHWA 2MEV2 4XABA 4CDQA 5FZ8A 5C71A 3OGSA 1GWLA 2EIEA 3MGUA 4D69A 5IVEA 5FO9B 3K2OA 4C0BA 2C26A 1F15A 2BV4A 3I97A 4BOWA 2IXCA 4MH0E 2XQRA 3VGIA 1XE8A 1X82A 2VMGA 2D6PA 1W8HA 2OPWA 2QFEA 3S7IA 1W0OA 2UWAA 4IV1A 5FV3A 2YYOA 3J8F2 1WBFA 4LBJA 4S2FA 3D3AA 4HOOA 5A33A 4K1YA 5FYMA 4LITA 2F17A 4OI2A 3AVRA 3MI8A 3CDZB 2GP5A 4EN9B 1PVC1 3VD5A 1REDA 2ENRA 5A1AA 2RV9A 5AC93 4KI5M 3RZLA 2YPJA 5IVFA 4IE7A 4YZ1A 3MEPA 3SEPA 2A6VA 2YUEA 2OUHA 3ACIA 4R52A 1WCKA 4QXCA 4LBLA 3PJQA 2P4EA 4LXLA 1VBB2 1OXCA 1Q56A 2WC2A 1UMHA 2Y34A 4CYDA 4C1XA 1XPWA 3GJBA 4XETA 3WY6A 3WQ0A 4XFGA 5FYYA 4CCEA 4YM0A 4QMAA 1UYXA 4U36A 1BQPA 4CXYA 2QQIA 2Y6HA 2ZGUA 4BHPA 4CDWC 5LEKA 3CIHA 2WRAA 5A7WA 2XLFA 4P5YA 3THCA 4Q4W2 4JCKA 4DXSA 1U5XA 2OX0A 4MHUA 1OOPA 2Q8EA 5FZGA 2YZ4A 3VD4A 3AYCA 3UGHA 5CKNA 5FPVA 5ABJC 3NV1A 1JYNA 4FTBA 5A6XA 1D2SA 2JG8C 1JZ4A 3SC7X 5BNNC 2CU5A 1DGRA 4PJYA 5IAXA 4X6RB 4JGYA 4EWAA 3OUHA 1QEXA 4CCDA 4BIFA 1R64A 4XFFA 3RZZA 4JKLA 4RL7A 1DQ2A 2Q1FA 2YBPA 3KMHA 4RHV3 5IT6A 5D8AA 1K5MA 4RA0A 2W87A 2XOMA 2W2IA 5FP7A 3AMQA 3MV11 3T0BA 3HNYM 4CCLA 4FPGA 4OQ8A 3HVDA 5LA1A 3ZPYA 5DDJ1 4Q4X3 3ZKUA 3ES4A 1POV0 3ZSLA 4FOQA 5FY9A 3RNSA 4LUKA 4YW5A 4RR3A 2CV6A 2ZKNA 4CCCA 3AB0A 1AR72 4AVBA 5AC91 3IM0A 2XVGA 1NE6A 3T4VA 1W8WA 1LHVA 3O1MA 4LBKA 4AI0A 1DLLA 4DY3A 4QT6A 4OHWA 1MEC1 2CSGA 2QQVA 2XWBB 2ZEZA 1W6NA 2WNVB 4IGPA 5A32B 5C9AC 5FYVA 3D5OA 2ZGNA 4KGGA 4IGOA 2D6OX 4UXAA 2JE9A 4BXFA 1JYWA 1RINA 1LTEA 4HG6B 2F4LA 2KXLA 2PHXA 3JU9A 2EF6A 4UI9L 1Z0HA 2D7FA 3SEEA 1NAEA 3WDTA 5FP8A 2XONA 4MGKE 4OZOA 3WHTA 4IL7A 4OI4A 5HXVA 4XFAA 4N43A 3SCGA 3VKOA 3O1TA 3MW2A 2G1MA 3NKTA 4YW3A 3E5UA 1ENRA 3NJXA 4XOGA 4XYXA 4XUNA 2RJKA 1PO21 1RUG3 4B1LA 3KD4A 3U75A 2QZ2A 2Y60A 5FMBA 3USSA 4PIZA 2W68A 3MPPG 3VZLA 4AI1A 3TN92 2VMEA 2VZRA 5HCAA 3I7DA 1PM4A 5FZ9A 5F37A 2RS52 4DEQA 2GC0A 2WFPA 4AEMA 5BXXA 4YGEA 2I2SA 4XF9A 4C8DA 1QXPA 3M3OA 4IUGA 5C3QA 3ZDVA 4QHOA 4XDQA 2K46A 3CZJA 3ZXLA 1RVF2 1UY0A 2WLQA 4XMAA 1JYIA 4LA3A 4RHV1 2D44A 1WW6A 3CU7A 1WA4A 2HWC2 3TB0A 3G6JB 4JAAA 4MGTA 4PDWC 3B3QE 5B4XA 1D7PM 2PFWA 2C5DA 5A3PA 3P1IA 3F95A 2ZX3A 2ZAHA 1IG3A 3PL0A 2ZX2A 3D0SA 5CG8A 4Q4X1 1W6QA 1ZZ8A 4GJZA 3H3LA 3ZR5A 3DCQA 1O8PA 4XFHA 2WYFA 4CPBD 2JEMA 4MG2A 3HNBM 3KT7A 4CUGA 5ACA3 4ZU7A 3NRUA 1YWKA 2DVFA 4NVPA 4A2UA 3LKJA 2DBNA 3ZYGA 1ENXA 2E32A 3DN7A 2KM2A 2P3JA 4KL1A 2VJXA 3OEBA 5EPAA 4BXSV 2BP6A 1BXHA 5T3NA 2W92A 2GAUA 2MNGA 3VHPA 4JQRA 4D7YA 1QKQA 3LEKA 2DCKA 2DYCA 4FPLA 1FV3A 3IDCB 4CEYC 2BTVC 2B39A 3ZYIB 5CIRA 5FMOS 1LOCA 4LHLA 1GANA 4ORFA 4JGZB 4P9GA 5JAXA 5KXEA 4HPKB 3OD0A 4PLMA 4BM8A 2XDVA 2ID4A 4B29A 4M0NA 2X5IB 1IQAA 5JZGC 4NIAA 5KHGA 1ODNA 3NNGA 3ZFGA 2ARCA 5JLVA 5C8CC 1GV9A 5BNNA 4QPIC 1RUG1 5FZAA 4BQWA 4NUBA 2WSUA 1O4YA 1UY3A 2ZMKA 3TNQA 1K5JA 2VMDA 1OVPA 4RGAA 1MS5A 5DXDA 4WM8C 2OYZA 1QF3A 1ND3C 5A3OA 3D6EA 4HLTA 3AKTA 4PQ9A 4XHBA 1KS4A 5DUUA 3EXUA 1OKOA 4LULA 4ATEA 2D6KA 4XBQA 2QDNA 1MZ6A 1YHFA 2VOVA 4K20A 5C6CA 3H1YA 2ADDA 4FPHA 4N9HA 3TEYA 4YARA 1V6LA 3AK0A 4M01A 3RRDA 1HDKA 5A80A 1YCIA 1OI6A 1WMFA 5A3NA 1JZ3A 1RUC1 2R041 2YBSA 2WQ8A 3KT1A 3RYKA 4LO6B 4YW6A 4FQZA 1AR93 4RGGA 5FZDA 2MEV1 5LWBA 1YXWA 2K2SA 2OKXA 3N35A 3K51A 2ZBJA 3RS6A 4ZZ8A 2J7MA 2DFCA 2JJ6A 2OS2A 5FKBA 4A7KA 3J7NA 1C5IA 2WO7A 4EN7B 2NPIA 2ZACA 1PIV2 2VZSA 3I3EA 2VNOA 3ZFEB 2VQAA 4AZZA 3SCHA 1DP0A 4NROA 3VBOB 1MQTB 4G3YC 2JDHA 3J8F1 1LOGA 5EFUA 1GBGA 1RXGA 4YSFA 2RDRA 4PT6A 2EXHA 4UYBA 4IERA 2XGXA 2YU2A 3ECQA 1PNGA 1LODA 2GZWA 3ABZA 4PI2A 4UWDA 2RE9A 1CD3G 3ZXAC 3OY8A 5ERLA 3RZJA 2WAOA 4DPNA 1W6MB 2JDMA 1LKNA 5T55A 1UZZA 4J1WA 2VMFA 5FZIA 2CWSA 1RUD3 5FPZA 5I93A 3I2OA 2IC1A 2J1VA 2ZGTA 1XNAA 3SH5A 1OBNA 1DQ6A 4AFBA 4TYSA 2V5DA 5FR3A 5TSWA 2XJRA 3O14A 3VKLA 1B09A 1F9KA 1ULDA 1VBB1 3OPTA 4N9IA 4GH4A 4RQPB 5FPBA 4Z2WA 4NIHA 3MFCA 4PIXA 1G9DA 4NRPA 3HJRA 4RYDA 2UURA 3ZSJA 4M3CE 5E6HA 4TTGA 2Y38A 1K42A 5EXOA 2X10A 2A3YA 1MZEA 1KDMA 4KU8A 4L11A 5GLTA 5FWJA 5JSRA 1IOAA 4S2GA 4E2QA 2PLV2 4IEVA 4GJYA 1PZ8A 4Q4W1 2OQ6A 4TLFA 3PVBB 5L9VA 1NZIA 2DVGA 2ETEA 3TN93 3M1HA 1O4TA 1R1ZA 5GZGA 4DB5A 4Y20B 3JQWA 2RS53 3LAGA 4PQQA 4AWDA 2IWGB 4DMIA 2RS12 1FPN2 1QJEA 4NIGA 3N7JA 1AR91 3OJBA 3SH4A 2Z79A 4GWIA 1QJFA 4WZCA 4YVSC 3W21A 1YJLA 2OT7A 4XXPA 5FZ6A 5FZBA 1RVF3 4WVVA 5L9RA 2Y0OA 1Q43A 1XU2A 2HWC3 1RUI2 1W8NA 3DKQA 4KWKA 4OULA 2J1SA 3WNMA 5FXZA 3N9LA 5F7UA 4NIDA 5CKMA 5CISA 5LBCA 4CEYA 2W95A 2AENA 3RFRA 5FAXA 1DGRN 1F8VA 1EV12 5I0TA 4OLLA 1W9FA 3U0ZA 4HN0A 1F5FA 2JENA 1WLTA 2XBO2 5IJRA 1GU3A 4TWTA 5JR7B 5K0UB 1K45A 2FDFA 5JZGA 5A1FA 2D6LX 4YW4A 4LK6A 5C8WA 4Q27A 1H4HA 4QX0A 3WP6A 1AR71 3ZFFC 4ET7A 1OUXA 1QMJA 4BCUA 4YZ3A 5FZ7A 4WM8A 1H9PA 1CZVA 3RZHA 1W3XA 3L2YA 3PHMA 5CFDB 4MX3A 2K0GA 4JV4A 1GOGA 4AW7A 3KV6A 2IVIB 4HT1T 1KQRA 2Y6JA 5FP3A 2QQNA 2Q8OA 3GNEA 5HV0A 3WDUA 2ZMLA 3AX4A 3OBAA 3MIEA 5HI0A 1OQDA 1Q3EA 3OBTA 2C1FA 4I02A 4BQ5A 4R9DA 4R4XA 3BTYA 4QGLA 5EYXA 4OVEA 4OZXA 5FZHA 3AZYA 4QHZA 4CP9A 5FP9A 1QXJA 1W0PA 4KGQA 1YQ8A 4I3GA 2WT2A 1ZZCA 4EN0A 1IKPA 4COYA 2YFUA 3IBMA 3IIIA 3JBG2 3TN91 2XWJB 3OG2A 2RDSA 2RS51 4LKSA 1QNWA 1W90A 4JHTA 4AEDB 2RMU3 5LA2A 1TMF3 4XBLA 2QKDA 3H7YA 3LA3A 5T5OA 3IDAA 2EAKA 1S0FA 2W1SA 4YWAA 4AI3A 1SLIA 3E6BA 1RVF1 2QQLA 1NYWA 3NAPB 1KXGA 1ULPA 2DVBA 2HWC1 3A23A 5FYCA 1OA2A 2GP3A 3NVCA 4DUVA 3AKSA 3VZNA 2VCBA 2Z2SB 1BJQA 2WT1A 1E5SA 4UFJA 3HR9A 1KEXA 4W6WA 1REFA 3SH3A 5DUXA 4EZ4A 1A34A 1W8UA 1POV1 4MADA 4DFSA 4RSUA 2CAVA 1PIV3 1TEIA 2VZVA 3H3UA 3HOBA 4HVRA 3T08A 4AEJA 5A3WA 3TOJA 4YVWA 4EN6B 1ZRDA 1DGLA 2VTFA 1LB2A 3UK9A 4MO3M 4DIQA 5F6KA 2DWRA 2GNMA 5GJ6A 4URAA 4EE2A 4H3WA 1W6OB 1BHGA 3ZO0B 2VQUA 4DUXA 3F2ZA 3GCWA 2QDRA 4WM7C 4WVWA 4AVSA 2R1DA 3RGBA 3NJYA 3UGGA 2JB4A 3IAQA 4MV2A 2RM22 3RG0A 5IVJA 1T6GC 2CWMA 2X5IA 3ITQA 4LO7A 4XIKA 2WQ4A 3ACHA 5IVYA 2P37A 3ILNA 4Z82A 3VN4A 5F5AA 1CGPA 4UFIA 4QKBA 1XSRA 3T3YA 1FAYA 4ISRA 1X8MA 4G9SB 2DU0A 5BNQA 2ZGQA 4HZFA 1G9CA 1CIYA 1LRHA 2VW1A 2WYSA 2DTYA 1H6YA 1S55A 2UWBA 4YVSA 1N3OA 5CFCB 5JPNB 1UO9A 4I3PA 3Q8BA 2Y6GA 1UWWA 3LIHA 3NNLA 4H14A 4WZFA 4BLIA 1LJ7A 2WO1A 1W8OA 3MFAA 2VUAA 2PLV3 2J1AA 4R9CA 5BYNA 4QDRA 5L73A 2ARXA 1LNSA 5F3CA 3N36A 4Y22B 4RS5B 1OLME 3BOPA 1J1TA 1SHWB 3FZ3A 1OD5A 3K46A 4M0HA 1OSGA 4IEWA 1SBFA 4WVMA 5LA9A 5KBFA 1FXZA 3DPRC 2EXIA 2RS13 3LSEA 1XE0A 1W2NA 5GALA 1FI2A 1EPWA 4BQXA 1GZ9A 4D7SA 5LATA 4Q0SA 2E26A 3O1PA 1LESA 5BNPC 3CJIC 4XQ4A 4U2AA 3VBOA 1W3VA 3V0AB 4NHYA 4FPYA 1PIV1 3OYWA 1CAUA 3R05A 3ON7A 5LA0A 5HCBA 4Y5Z0 3PLQA 1VR3A 4HSLA 5K7PA 4BK5A 3BODA 1AR83 1EV13 1OH3A 2FDJA 2ARAA 1RUF2 3KHCA 3LQCA 2XBO3 4XQDA 5FYTA 1ZZ9A 5HV4A 1VRH2 4W4ZA 1DYPA 4B7EA 4MYEA 4BMBA 1H8TB 1AXYA 1AXZA 5JXGA 1O59A 3LEGA 3LSDA 3OBZA 1VBD2 2WN2A 3U37A 3KF5A 3ZYHA 2B5HA 4XAAA 1PK6C 3TBDA 1LHNA 5FPAA 2BVBA 3KSCA 1PGL2 4CDQC 2E33A 4FBFA 4IW3A 4NAMA 2ZZQA 2YMZA 3O7OA 2OIIA 5FPLA 2AUYA 3AZXA 3BYWA 2VZOA 5F8PA 2X05A 3FUQA 5F32A 4NHXA 5KHJA 2WZEA 1W9SA 3POWA 1V0AA 2JXAA 4IV1C 3IIAA 3U10A 3N7MA 1UPIA 2GU9A 3T2QA 3W58A 1I9RA 3B01A 3HT1A 1W03A 2PLV1 3ETPA 1L7LA 4LHNA 2J1RA 1HIXA 4FT8A 3JBG3 5I8TA 3MHZA 1I3HA 5E88A 1YFXA 3O1RA 3OUJA 2P17A 2VBDA 4M3CB 4ZKTB 1F5JA 1B35A 5GLUA 5GZCA 2D6MA 4PF1A 4YNIA 2RS11 1FPN1 1MS1A 4V1PA 2GMMA 4Y1VA 3EBRA 3V65A 1O91A 1UIJA 2P2KA 3AYAA 5A7PA 1K3IA 1C4RA 3N4MA 4XJ9A 3C7HA 1J58A 1GP5A 3VV1A 1RUI1 3CJXA 3W20A 4WM7A 3T2OA 3DGTA 1UZ0A 1XYNA 2ERFA 4E27A 2QZ3A 3MLKA 1GNZA 1ND2B 3A4UA 2JG9A 3UKNA 2ZGMA 4META 1EV11 2F4PA 3O0VA 5C3SA 4JTOA 3BIEA 3NL1A 4LHKA 1KITA 1JN2P 2XBO1 1DCSA 3CF6E 3HPNA 3WG1A 3TRSB 5DAPA 2IXKA 3K75B 3SKJE 4A3ZA 4DRVA 5C3OA 2FMDA 2BW8A 1CAWB 3K3NA 3B02A 4AE2A 1OOPC 4BJ0A 4AHZA 2OPKA 3KZ4C 2WUHA 3D4KA 3VD3A 4XJ8A 3WQBA 1MS8A 3ZX7A 2VZ3A 5CB7A 3JUUA 4QQLA 3SISA 1OFNA 1ZBE2 2A73B 2XVLA 4FPJA 4D8MA 3VHNA 2A3XA 1S0BA 1LOFA 3GALA 4JGYC 3IZOA 3VBHC 2X53S 1Y7BA 4Q4Y3 2H0VA 5LEJA 1GSLA 1YO8A 1J59A 1OD3A 4ASLA 1PMIA 3BVCA 2RM23 4BQYA 1ODMA 5D8AC 1K5MC 1UYZA 4UW5A
chains in the Genus database with same CATH topology
2V5YA 4ATFA 1J3QA 2Q1MA 3FJSA 3H1WA 4DOUA 3JQXA 3PVOA 3WW4A 3WW3A 4Q8KA 2BNMA 4N53A 2E7AA 1U12A 1RTVA 4RR3C 5BNPA 3JBG1 3KCYA 1WLCA 1CN1A 4B8EA 1M06G 4MXVA 1SDWA 2E63A 4B4QA 4R8HA 1ENQA 3KLSA 4AFCA 4PBPA 1S2KA 2ZS6B 2XKPA 2I74A 2IXIA 4HMZA 4QU2A 4Q26A 4X8NA 4AHXA 5EZWA 1CAXA 1LOEA 1Q8VA 4N43C 5FBZA 2BFUL 3FWEA 1SACA 2GMEA 2BUKA 3WCRA 1S0GA 1H1IA 3FFQA 5BPXA 5BNOB 3GBGA 4WV8A 1V70A 2JG8B 1OQ1A 2JDZA 2PHLA 4BQ1A 1QQP3 1JHNA 2ZA9A 4XEZA 5I0SA 2YROA 5CAZA 1RUF3 5LRSA 1NG0A 2VECA 4F3JA 4HK9A 1VRH3 2NM1A 2BWCA 5BUVA 3KCXA 2A71A 4AQ6A 2RM21 1I5ZA 1YIPA 3LWCA 1VBD3 3R4DB 4XFCA 4K21A 5LK7B 3VL9A 3HAGA 4CDXC 5A3LA 5CFCA 3ALQA 1RJ7A 1BKZA 1SCSA 5J7MA 2IXHA 3UJQA 2RR12 1LOBA 1FATA 3WP4A 4INDA 4ONUA 3SCFA 1UU4A 1NCQB 1GLHA 2A5ZA 5CU1A 1LU1A 1XNDA 4X8PA 4LLOA 4AGRA 4C0HA 2OZJA 3UL2A 5C9AB 4TSVA 3B9IA 1QOTA 1N1SA 2GN7A 3M8LA 3RI8A 4Z8BA 4AQSA 1UZYA 3DF0A 1ENSA 3ZSEA 5C4WB 4AEKA 4IEUA 5L19A 3OF1A 4AFAA 5FPXA 5JOYA 1GKBA 3H9AA 4YZ2A 2O8QA 1S1AA 1IZ3A 1FMD2 4MLOA 3ZN6A 1QJZA 3ZN4A 3ZFGC 5KHHA 3CL1A 2CY6A 2ZOEB 1AR92 3ETQA 4DQAA 3AZZA 4XHXA 2G9GA 1OPMA 3VBHA 1C28A 4LBQA 1VBE2 4IESA 1QDCA 2JD4A 2EVXA 3LA7A 1RUF1 2BNNA 1ZRCA 2HWF2 1YFWA 2LTNA 4N90A 4QPGB 4K8FA 1VRH1 4PDWB 1JTZX 3VDDC 4CDUC 3H1MA 5JI9A 1WD3A 1VBD1 2CAUA 3HIFA 3NV4A 4OFGA 1VALA 1ZYBA 1ZBE3 1BEV2 4LBMA 1UKGA 2DFBA 1PGL1 3AMHA 1KRIA 3SLIA 4YFZA 1NQDA 5H9QA 1EAH3 1RUD2 3GBWA 1MS0A 4AYUA 2ZJCA 4JRLA 4XIOA 3AXEA 4NWVA 3AYEA 1VIWB 2VGDA 2MPFA 1G8WA 4DZGA 3C2UA 1NZCA 4IV3A 4H7LA 1FT9A 2ZX1A 4CP1A 3QCWA 4C90A 2BGCA 1QH6A 3WQ1A 4QQHA 2A7AA 5C8CB 2VPVA 5SV5A 2H6BA 4QPIB 3NV3A 1WCSA 1LHOA 4D3WA 3LOBA 1X7NA 4MXWB 4GH4C 2ZABA 1HV0A 3R6SA 3V0BA 3VHRA 1COV2 2I07B 1XYPA 4N7IA 1MZ5A 1FOD2 1ZRFA 3POYA 1IS4A 2GNTA 5JMCA 3I59A 2I45A 4M3CF 3WP3A 3ME2A 4JDOA 4CDXA 2NMNA 2PELA 1DGWA 3ZXKA 4Q0VA 3ZXDA 4CEWA 2PAMA 3NW4A 3V56A 1ZBE1 2WT0A 3AMNA 4YG0A 1KJRA 1UL9A 4FP2A 2UY9A 3FFZA 1W6PA 1QOSA 1XNBA 4E4DX 3ZYPA 1NCRB 3GHMA 3B93A 3I54A 5BV6A 3GZAA 4YG6A 2FBEA 1TNRA 3MW3A 2RR13 3CLPA 3J4UH 3VBRA 3WQ7A 2XJSA 3VBSB 4CP0A 3B94A 1DQ1A 1WD4A 2IFWA 1BYHA 2B9UA 2IXJA 2WNVC 3AMPA 2ZX0A 3MYXA 4LE3A 4NWWA 3O0XA 1AYM2 3AP7A 3HT2A 4OHZA 1EY2A 3TYJA 3RSJA 1O5LA 2BQPA 4Q1PA 3USUB 5FQ0A 1I6XA 4GWNA 3L2HA 3SMHA 2RMU2 1MS3A 2YGMA 1TMF2 2A6YA 3VDDA 4CDUA 2ZHKA 4D94A 2GC3A 3S7EA 1FMD3 5B2GB 1DZQA 1YYNA 3WG4A 1C8M2 5C33A 2FZ1A 5KC5A 4KNCA 1H2MA 4P5HA 1OA3A 1IHMA 5FOJB 5AVPA 1UF2C 2WNUB 1VBE3 4BMEA 1A6CA 5T5JA 3U07A 3AFKA 5CNAA 4QGNA 1GZCA 2HWF3 3QACA 2A6ZA 4NN0A 2VG9A 1YLLA 2PHDA 1V00A 1SLLA 2P34A 2ES3A 4AGVA 4FSJA 3AYDA 1H2NA 2GDFA 1LGNA 1BEV3 3ZXFA 3AKRA 1O3SA 2DUPA 4I0AA 3WVJA 4KG8A 1IPKA 2RR11 1ZREA 1UN1A 3ZFFB 4K40A 4MGIE 5IK5A 1NLSA 1RHI2 1D0GA 4GMP3 4YVWC 2D3SA 4YLZA 1PHMA 3EQEA 1G6NA 1DQ5A 3JB8A 3OD4A 4IEYA 3AP9A 3ZYJB 1YUDA 2BFUS 5GZEA 4KWLA 1D2QA 3PMSA 4LBOA 2R6QA 3WHUA 1GNHA 2GH2A 4HN1A 4JGZC 3HWJA 1O4ZA 1RJ8A 3MIHA 1TQ5A 3AMMA 3DV8A 4QPYA 1WMDA 2X5IC 1DZRA 3A0KA 5L7OB 1ZX5A 4FPKA 2BPA2 2DU1A 4IXLA 5E16A 4FTSA 1FMD1 1DF0A 4A3XA 1C1FA 3QD6A 4K7JA 1CONA 3SNMA 3AJZA 5BY5A 3O5SA 4DNYA 4L2NA 2RS33 3WX5A 5KXBA 3E5XA 2R16A 3RDIA 2DCZA 2WFF2 1EPZA 1COV3 1VBE1 4MUVA 5I0RA 1V6JA 4YW2A 3VZKA 1FOD3 1CX4A 1F2NA 4DY5A 1SLAA 2B42B 2HWF1 2XB6C 3WT3A 2XLAA 3GBFA 1FX5A 1VB4A 1KJLA 2R1BA 1N1TA 1SBDA 1AR82 4XBNA 3WW1A 3AZWA 4OI1A 1ONAA 1QY4A 4X6QB 3WDYA 1BEV1 3MIDA 1VBA2 5A3MA 4R9BA 1NOVA 2SLIA 2WNVA 2W08A 3ZFEC 5A32A 2DV9A 1XRUA 3FC0A 3M70A 1GYKA 3VBOC 1RITA 1MQTC 1QOOA 2WZR2 1EYBA 1RUD1 3OGJA 2WJSA 3W59A 1H2LA 4GMP1 3KM5A 3LB9A 4IEZA 4YM1A 2HWB3 5DG2A 1UW8A 2R072 2NZ9A 1AVBA 5JVVA 2PA7A 1ULFA 3VBFB 1H8VA 3ZMNA 4COZA 4YGBA 3RYPA 3AFGA 3MIFA 4UW6A 1BZWA 1E57A 4I2OA 1YRZA 2DURA 2XVKA 1ZNPA 4GULA 5H9PA 1AYM3 3HMYA 2DUOA 3IPVB 3QBQA 4AFDA 4A7ZA 1C1LA 4AI8A 1RUOA 5FREA 4AFMA 3O12A 1BVP1 3WV6A 2QJVA 1C5HA 2R062 3H8UA 4C91A 3INAA 1W2UA 2VOKA 4XXAA 1RGSA 5JIUA 4ZU4A 2TEPA 5JI7A 1LHUA 2R30A 3VKNA 5J36A 5GLZA 1SFNA 1YFYA 5J37A 4JDNA 2UU8A 4LLFA 1BCXA 4ISQA 2ZTNA 1COV1 2Q1ZB 4YW1A 1SCRA 4BYYA 1FOD1 1VBC2 1WW4A 4Q0PA 1C8M3 3LZZA 5JOWA 3WD5A 1MS9A 3VBUB 3KCCA 3MDPA 2H0BA 3DPRB 2VULA 1J1LA 2OZ6A 4GKXA 1A8MA 2GALA 5KHKA 1FNZA 1B35C 4AVVA 3IDEA 3CJIB 2C9AA 1V9U2 1H4GA 1AUYA 1TME2 1WGPA 1NA1B 2B8MA 1RMU3 3MIBA 1UAIA 4E9KA 4P14A 1XQNA 2VMIA 4XF1A 4XFBA 2HEWF 4ZXKA 4XJUA 1CESA 4I0BA 5JPMB 1EP0A 2BVVA 3IN9A 1JUHA 3TWIA 1QJU2 4JGZA 1HXS3 1S2BA 1HV1A 3AP5A 4HPKA 4Q4Y2 4YRDA 2O0OA 2JG9C 4Y26A 3C3VA 1KD7A 4QGMA 2QE3A 1CAVB 1WW7A 4I30A 5J3UA 4KU7A 2YGLA 4FPCA 4EROA 1KS5A 4FCAA 1RHI3 2UYBA 1RC6A 1DHKB 4Y1UA 1PK6B 1D4VB 2EIGA 2E7QA 5CFDC 1AYM1 4NHMA 3ZMOA 2OVUA 4FO9A 1MS4A 1LOFC 1WW5A 3MICA 4GKYA 3IKWA 4NPRA 4UW3A 4AVAA 1JOJA 1DQ0A 5CADA 4IV1B 4XF0A 2RMU1 2ZHNA 4FQ4A 1TMF1 1V6MA 4JDMA 1VB2A 2V09A 3M3CA 4PLNA 5A33B 3H50A 2E7TA 2ZGSA 1AF9A 4E4ZA 4I0WB 4F83A 2EALA 3GZUC 1C8M1 2KA3A 3TNPB 4Q29A 2B46X 4XFIA 2NQYA 2B45X 2W52A 4N53C 4AEDC 3ZFEA 4LUMA 2WFF3 1IGOA 1MQTA 5GZDA 4Z92B 1HQNA 3MLLA 5ACA2 5JSPA 4DINB 4AG4A 2QQPA 1FNYA 4QQPA 2PHRA 1PNFA 1QQP2 1VP6A 2A3WA 1W6MA 3THTA 3TAYA 4BIOA 1CR7A 2JKBA 2QNKA 4EN8B 3N3HA 1ZZ7A 1VBA3 3GF6A 1S0JA 5F6LB 4C1WA 4UW4A 3T2TA 1OOPB 3M7AA 2UWCA 4Q4V3 3WUCA 2DCYA 3AKQA 2WZR3 4JTNA 1RHI1 4XTMA 4RQPA 1AHSA 2R073 2R32A 4GWMA 4JGYB 1W39A 5CVRA 3E5QA 5EV7A 4KWJA 1JYCA 1OLRA 1Q8QA 3THPA 1SLTA 5D8AB 1K5MB 3B00A 2W39A 3GHNA 2A6WA 1OLQA 3KGLA 5LRRA 3ROUA 1LGCA 4AVCA 2AREA 4L97A 5CA6A 1R1A2 4Y20A 1ULCA 3H7JA 4XJZA 1XU1A 1HKDA 1WLDA 1Y3TA 2R063 3ELNA 5CFCC 5EWSA 2HWE2 1YFUA 4LTAA 4RR3B 4O9GA 1G9BA 4DRRA 3SHRA 1OQEA 2HEVF 2ZKLA 1CJDA 2JECA 3VZJA 2VNGA 2WFF1 4FPOB 2GC2A 2PHUA 3SITA 1W6NB 3DUIA 1REEA 1VBC3 3JZVA 1MZFA 2DVDA 2HWD2 3RMXA 1RUE3 1Y9QA 2PHTA 4J1XA 5DUVA 5K0UA 4OI0A 1AR81 1NQJA 3RWNA 4XW3A 2VMHA 3KS7A 4N43B 4FPEA 3W9AA 1V9U3 3WUDA 5H9SA 1VBA1 1URXA 1TME3 2LALA 5CFDA 4HKLA 3BALA 5DZEA 4S2DA 2ZHLA 4RFT0 3MPBA 2WZR1 3ACLA 1QJU3 3E6DA 1AL22 1LHWA 4XF3A 4L8QA 2R071 3DL3A 1G9AA 1EAH2 4LE4A 4ASMB 4Q0QA 3FBYA 1X36A 2ZGRA 2ZCWA 3IPVA 1NXMA 1XE7A 5F5QA 1V6IA 1U5IA 1QU0A 3NJZA 4Y1YA 3RPQA 3WNXA 1H1MA 1JBCA 1UU5A 1UX6A 4AEDA 4Y1XA 1DU3D 2R061 1RB8G 3I4IA 3NAPA 5JOXA 1HW5A 2E9QA 1R092 1S0EA 2D97A 2CL2A 1MACA 3JCIA 3LOIA 1VBC1 4EV0A 4MVTA 3WCSA 4PLOA 4CDWB 4IV3C 4W6XA 3GZTB 2A6XA 2WL1A 3IWZA 4COVA 2BEOA 3NSTA 5ABJB 4UBGA 1LENA 2GMPA 5ACA3 5E89A 1V9U1 3ZFGB 1W6OA 4Q2FA 4I01A 4EWEA 3M4FA 1G9FA 5BNNB 1GZWB 1TME1 3MF6A 4KH9A 3MF9A 4JC1A 1DBNA 2LM3A 1VAMA 1XNKA 2AZ5A 2Q30A 2VUJA 3PJYA 4Y1ZA 1WUVA 1QJU1 4IQPA 1ZZ6A 4Q4Y1 3FMGA 5JIAA 1I1EA 3ST7A 3BU7A 1NY72 1KFXL 4EWDA 3QH6A 3ES1A 1X8EA 1O7FA 2CNAA 1F31A 3HBZA 4Q0UA 3J26N 1WBLA 1QNYA 2CTVA 2E51A 2NYYA 4M00A 2VVEA 4Y4YA 5FLJA 1HRV2 1TNFA 4AI2A 1JUIA 1AZDA 3A0NA 4CEWC 3T1MA 1RUNA 1AXKA 1LEMA 4ES8A 3ASIA 5HCFA 1AR62 2NN8A 3I2DA 3MIGA 1L3JA 3VUOA 1ULGA 4Y22A 1A78A 5DDJ3 4GMP0 4RS5A 4EJRA 1AL0G 4LA2A 1R1A3 4DS0A 3O0WA 3QOPA 1D0HA 1RUH2 4LO5B 5K8SA 1H9WA 5JOZA 3P3NA 2HWE3 4XILA 3OY8B 1MEC3 3VBRC 2GNDA 3V0AA 4BE3A 1CVNA 1QJX2 3MLJA 3BTAA 1GQHA 1PO12 3B5LB 4QQOA 5J09A 3FHIB 2Q5TA 1M4WA 1OHFA 2ET1A 1ZRRA 2C0ZA 4AHYA 4H55A 4NO4A 5GLWA 5ACA1 2HWD3 2MHFA 3VKMA 4GALA 4HVQA 2R49A 2XL7A 1QQP1 3MW4A 4GH4B 1OKQA 1NLRA 1H8TA 1PO23 3L9JT 2G4IA 1NE4A 3QLQA 1R082 4GA9A 3BCWA 1IS3A 4XMIA 2CGOA 3ZIWA 5GM0A 5BNOC 1C8NA 1ZBA2 1UCXA 1Q5OA 1S0IA 1UKRA 1XYOA 4YG3A 5LK5A 1AX0A 1RUJ2 1H1AA 4Q1RA 1AL23 4CRQA 1WCDJ 4FAHA 3OTFA 1UIKA 3RJRA 3OGGA 1RIRA 2TUNA 2VXRA 1DQ4A 1LOAA 3D82A 4CEYB 3GYDA 4M3CA 5D1IA 1R1A1 2E6VA 2N7GA 4I09A 5DZGA 5GZFA 4YZ4A 2GN3A 1YNAA 1V6OA 2FQPA 1RL3A 1NCQC 2OA2A 2XJQA 5E1RA 1N3PA 2HWE1 2D5FA 4GIQA 1HRI2 4YGDA 5JZGB 1YIFA 4AK3A 1IKQA 2NMOA 1R093 1WMEA 5JWPA 2ILMA 1A8DA 4RD7A 1KDKA 1ND2A 4WM8B 3RQ0A 1PGW2 1DDLA 2PHWA 1ND3B 3CNAA 4QXKA 3AP6A 5C4WC 1JXNA 1D4M3 3ILFA 2RS32 5E8AA 5CG9A 4CTEA 1O3QA 2HWD1 2YC0A 3AKPA 2ZPXA 3WOGA 3VLBB 1V6NA 1CAWA 2D93A 1ZM1A 3ZXEA 1GR3A 4B7KA 5J96B 4LEJA 3ZDSA 1QGLA 3AZVA 3H0OA 5T5LA 4NHKA 3KGZA 2BNOA 2D40A 4CP2A 1AL21 5DUWA 4QPGC 1O3TA 1EAH1 4BA6A 1RUC3 2R043 4AGGA 1S0DA 4HKOA 3EHKA 2MEV3 4XE9A 5EYYA 2HWB2 3WG2A 1N1VA 3N7KA 1FV2A 3HD8B 4URTA 3RJ2X 3ZXJA 1HRV3 1YI7A 5GLVA 1S0CA 2Y26A 1PVXA 3M2MA 4A7YA 1AR63 4F8AA 3KQRA 2PAEA 3J8F3 4CZSA 4YVWB 5IK7A 4HFSA 2AR6A 2F6BA 1CJPA 1R091 3J9SA 2PQQA 1RUH3 1OPOA 3BIWE 3OPZA 3E97A 4CDWA 5EJ3A 4YM2A 1LULA 4NR1A 2D43A 3H3ZA 2QVSB 1D4M1 3VHOA 2HJIA 1QJX3 3P3PA 3M3IA 3WR0A 5ABJA 1PO13 5BNOA 3VZMA 2WSVA 1BVVA 3BB6A 2GC1A 2JG8A 1GZWA 1VBB3 3FLTA 4IEOA 2G9FA 2DUQA 5CBLA 4OHXA 4YVSB 4P9LA 3VL8A 4PCRA 4ES9A 4Q4W3 1C57A 1R083 4XJWA 3I8TA 3G7DA 1RMU2 1Q8OA 2O8OA 3KB5A 4BPZA 4LBQD 1ZBA3 1LEDA 1NY71 1YJKA 3FLPA 4JRAA 4IETA 2IZWA 1A3KA 1WLWA 1VLNA 2D98A 1HXS2 1RUJ3 4FOWA 4WVMB 3S6PA 1NCQA 3DKWA 1HRV1 3URFA 2DCJA 3POSA 4HANA 3B9CA 1PM7A 1Z7S2 4FOVA 4H7MA 2CGNA 2LUWA 2Z5WA 5DZFA 4OUSA 5C9AA 2IFRA 2FHRA 1G86A 1AR61 3UJOA 1LECA 1NCRC 3OYWB 1CAUB 4K1ZA 5C4WA 4NHLA 3IT8A 3RMYA 1XNCA 1BMV2 4GB32 1RUH1 1HLCA 3BPZA 1O3RA 1AR73 2BYVE 2XHKA 3VBSC 5F9TA 3RYRA 4HL0A 1SEFA 1HRI3 4QQ2A 5T50A 1IS6A 1VJ2A 1QJX1 5FLIA 4L9BA 2EA7A 1PO11 1MR5A 2BBVA 4LT5A 1SLBA 2YV8A 1VAVA 2A75A 2WS92 5KXDA 1JW6A 5KHIA 1SBEA 4QPGA 3CO2A 2SBAA 4W6YA 4Q8LA 4QD2A 4PDWA 4B4PA 2XJVA 2ZMNA 4YGCA 1R081 4KBBA 2Z69A 5J98B 4ZU5A 3K48A 1DFQA 4WBBA 4LBNA 3NKGA 1ZBA1 2WQZC 3LGRA 4F7ZA 1DYKA 1QHDA 1UPSA 2WNUC 3T1LA 1Q8PA 3WZ1A 4YYOA 1J3RA 1RUJ1 4P9XA 4W65A 4WVZA 2GH8A 2HEYF 2WKKA 5SV8A 1B35B 2D3PA 5FLHA 1QJY2 4Q4V2 4OHVA 3RI9A 3WDVA 1PZ7A 2NLRA 4AVTA 2P3IA 1N1YA 2XL9A 3AP4A 1POV3 3Q9OA 4OUMA 4WM7B 4XJAA 4B3NA 5FFOC 3E6CC 2JG9B 2VW0A 5IK8A 1AYN2 1CIWA 2DVAA 5FO7B 1OMIA 5C8CA 1SMVA 3B7MA 3R4SA 1J3PA 4QPIA 4Z1VA 4R4ZA 2ARBA 4J6GA 1H2KA 1HRI1 3IDBB 3D0JA 5I8YA 1ND3A 3LA2A 1SLCA 2XLGA 4MXWA 4RQPC 1CPMA 4Z07A 3WP5A 5KWRA 1BBT2 1Q8SA 1PGW1 1OA4A 2OW4A 1APNA 2RS31 2XH6A 5I91A 1DG6A 5K9YA 3D8CA 5L7OC 5FOBB 3JD72 4QM9A 1U0AA 2UYAA 4HKWA 3PMEA 2PAKA 2Z42A 5IUQA 2DCTA 4HETA 1HX6A 2QCSB 1ZZBA 1RUE2 2XJUA 4MSVA 1K5MC 4PBOA 4Y24A 2WA4A 1SQ4A 2AH2A 2WINB 2ZGOA 4N53B 2PN5A 4BH9A 4O9EA 5BNPB 3FX3A 2K9ZA 1VAKA 5JCTA 1NCRA 4SBVA