1CB9A

Nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (major form).
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTOTOXIN 2)
publication title Two forms of cytotoxin II (cardiotoxin) from Naja naja oxiana in aqueous solution: spatial structures with tightly bound water molecules.
pubmed doi rcsb
molecule tags Toxin
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1999-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cb9A00
1H0JA 3PLCA 2QJBC 1CDSA 2MJ4A 2LCRA 3U74U 2ERAA 1MAHF 3QB4B 4HQPF 2K3GA 2MUPA 4LFTA 4BIKB 1KTZB 1COEA 6EBXA 1FF4A 2HLQA 3EVSC 2ABXA 4BDTB 5EBXA 4P7UA 1FASA 1HAJA 1HAAA 1ABTA 1KBSA 4FAOE 2UX2A 1KL8A 2CRTA 1LJZA 1BXPA 2N99A 2X8BB 1DRSA 3NEQA 2H64C 1KC4A 2H64B 4OM5A 2H62C 1FSCA 3LAQU 1CRFA 1LSIA 2MFAA 2VLWA 1TXBA 1JE9A 1B41B 3ERAA 3KFDI 5DZ5A 1NTXA 2JVEA 1YWHA 1KXIA 3U73U 1RL5A 1NTNA 1CDTA 1V6PA 2BHIA 2MUOA 2HLRA 2QC1A 1G6MA 1IDIA 1XT3A 1QM7A 1UG4A 2BTXA 1ES7B 2MJYA 1MR6A 1ONJA 3BT1U 1KBAA 2L5SA 1RGJA 2UWRA 1KBTA 1NYUA 4AEAA 1VB0A 3HH7A 3BT2U 3NH7A 1CDQA 1ERGA 3EBXA 1FRAA 1CXNA 3KFDE 4QTIU 2PJYC 1NEAA 4UY2C 2GOOC 2GOOB 1JBDA 3NDSA 4FAOC 1KFHA 1S4YA 4OM4A 1PLOA 2CTXA 2LA1A 2MHYA 5DU1A 1ERAA 1JGKA 1FFJA 1CHVS 1IKCA 1CODA 2CCXA 2CRSA 1KS6A 2OFSA 1NORA 1TXAA 1REWC 5IMTD 1F94A 3VTSA 3FEVA 1CVOA 1CXOA 1BTEA 1CREA 2H62D 2H7ZB 1TFSA 2H8UA 2JQPA 4XJJA 1CCQA 2H5FA 2I9BE 1M9ZA 1IJCA 1CTXA 1HC9B 5DO6A 1HOYA 4DO8A 1W6BA 2J8BA 1TGXA 1F8UB 2PJYB 1IDGA 1L4WA 1NXBA 1LX5B 2NBTA 4ZQYA 1IQ9A 5IMYC 2QJAC 4EY8B 2H7ZA 1KU6B 4RUDA 4IYEA 1IDLA 1LXGA 1ZADA 2CDXA 2MJ0A 1HC9A 1IK8A 2L03A 1FSSB 1QKDA 1CB9A 1LXHA 2QJ9C 1NYSA 1QKEA 1IDHA 1I02A 2FD6U 1CDRA
chains in the Genus database with same CATH superfamily
1H0JA 3PLCA 2QJBC 1CDSA 2MJ4A 2LCRA 3U74U 2ERAA 1MAHF 3QB4B 4HQPF 2K3GA 2MUPA 4LFTA 4BIKB 1KTZB 1COEA 6EBXA 1FF4A 2HLQA 3EVSC 2ABXA 4BDTB 5EBXA 4P7UA 1FASA 1HAJA 1HAAA 1ABTA 1KBSA 4FAOE 2UX2A 1KL8A 2CRTA 1LJZA 1BXPA 2N99A 2X8BB 1DRSA 3NEQA 2H64C 1KC4A 2H64B 4OM5A 2H62C 1FSCA 3LAQU 1CRFA 1LSIA 2MFAA 2VLWA 1TXBA 1JE9A 1B41B 3ERAA 3KFDI 5DZ5A 1NTXA 2JVEA 1YWHA 1KXIA 3U73U 1RL5A 1NTNA 1CDTA 1V6PA 2BHIA 2MUOA 2HLRA 2QC1A 1G6MA 1IDIA 1XT3A 1QM7A 1UG4A 2BTXA 1ES7B 2MJYA 1MR6A 1ONJA 3BT1U 1KBAA 2L5SA 1RGJA 2UWRA 1KBTA 1NYUA 4AEAA 1VB0A 3HH7A 3BT2U 3NH7A 1CDQA 1ERGA 3EBXA 1FRAA 1CXNA 3KFDE 4QTIU 2PJYC 1NEAA 4UY2C 2GOOC 2GOOB 1JBDA 3NDSA 4FAOC 1KFHA 1S4YA 4OM4A 1PLOA 2CTXA 2LA1A 2MHYA 5DU1A 1ERAA 1JGKA 1FFJA 1CHVS 1IKCA 1CODA 2CCXA 2CRSA 1KS6A 2OFSA 1NORA 1TXAA 1REWC 5IMTD 1F94A 3VTSA 3FEVA 1CVOA 1CXOA 1BTEA 1CREA 2H62D 2H7ZB 1TFSA 2H8UA 2JQPA 4XJJA 1CCQA 2H5FA 2I9BE 1M9ZA 4KSNA 1IJCA 1CTXA 1HC9B 5DO6A 1HOYA 4DO8A 1W6BA 2J8BA 1TGXA 1F8UB 2PJYB 1IDGA 1L4WA 1NXBA 1LX5B 2NBTA 4ZQYA 1IQ9A 5IMYC 2QJAC 4EY8B 2H7ZA 1KU6B 4RUDA 4IYEA 1IDLA 1LXGA 1ZADA 2CDXA 2MJ0A 1HC9A 1IK8A 2L03A 1FSSB 1QKDA 1CB9A 1LXHA 2QJ9C 1NYSA 1QKEA 1IDHA 1I02A 2FD6U 1CDRA
chains in the Genus database with same CATH topology
1H0JA 3PLCA 2QJBC 1CDSA 2MJ4A 2LCRA 3U74U 2ERAA 1MAHF 3QB4B 4HQPF 2K3GA 2MUPA 4LFTA 4BIKB 1KTZB 1COEA 6EBXA 1FF4A 2HLQA 3EVSC 2ABXA 4BDTB 5EBXA 4P7UA 1FASA 1HAJA 1HAAA 1ABTA 1KBSA 4FAOE 2UX2A 1KL8A 2CRTA 1LJZA 1BXPA 2N99A 2X8BB 1DRSA 3NEQA 2H64C 1KC4A 2H64B 4OM5A 2H62C 1FSCA 3LAQU 1CRFA 1LSIA 2MFAA 2VLWA 1TXBA 1JE9A 1B41B 3ERAA 3KFDI 5DZ5A 1NTXA 2JVEA 1YWHA 1KXIA 3U73U 1RL5A 1NTNA 1CDTA 1V6PA 2BHIA 2MUOA 2HLRA 2QC1A 1G6MA 1IDIA 1XT3A 1QM7A 1UG4A 2BTXA 1ES7B 2MJYA 1MR6A 1ONJA 3BT1U 1KBAA 2L5SA 1RGJA 2UWRA 1KBTA 1NYUA 4AEAA 1VB0A 3HH7A 3BT2U 3NH7A 1CDQA 1ERGA 3EBXA 1FRAA 1CXNA 3KFDE 4QTIU 2PJYC 1NEAA 4UY2C 2GOOC 2GOOB 1JBDA 3NDSA 4FAOC 1KFHA 1S4YA 4OM4A 1PLOA 2CTXA 2LA1A 2MHYA 5DU1A 1ERAA 1JGKA 1FFJA 1CHVS 1IKCA 1CODA 2CCXA 2CRSA 1KS6A 2OFSA 1NORA 1TXAA 1REWC 5IMTD 1F94A 3VTSA 3FEVA 1CVOA 1CXOA 1BTEA 1CREA 2H62D 2H7ZB 1TFSA 2H8UA 2JQPA 4XJJA 1CCQA 2H5FA 2I9BE 1M9ZA 4KSNA 1IJCA 1CTXA 1HC9B 5DO6A 1HOYA 4DO8A 1W6BA 2J8BA 1TGXA 1F8UB 2PJYB 1IDGA 1L4WA 1NXBA 1LX5B 2NBTA 4ZQYA 1IQ9A 5IMYC 2QJAC 4EY8B 2H7ZA 1KU6B 4RUDA 4IYEA 1IDLA 1LXGA 1ZADA 2CDXA 2MJ0A 1HC9A 1IK8A 2L03A 1FSSB 1QKDA 1CB9A 1LXHA 2QJ9C 1NYSA 1QKEA 1IDHA 1I02A 2FD6U 1CDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0J A;  3PLC A;  2QJB C;  1CDS A;  2MJ4 A;  2LCR A;  3U74 U;  2ERA A;  1MAH F;  3QB4 B;  4HQP F;  2K3G A;  2MUP A;  4LFT A;  4BIK B;  1KTZ B;  1COE A;  6EBX A;  1FF4 A;  2HLQ A;  3EVS C;  2ABX A;  4BDT B;  5EBX A;  4P7U A;  1FAS A;  1HAJ A;  1HAA A;  1ABT A;  1KBS A;  4FAO E;  2UX2 A;  1KL8 A;  2CRT A;  1LJZ A;  1BXP A;  2N99 A;  2X8B B;  1DRS A;  3NEQ A;  2H64 C;  1KC4 A;  2H64 B;  4OM5 A;  2H62 C;  1FSC A;  3LAQ U;  1CRF A;  1LSI A;  2MFA A;  2VLW A;  1TXB A;  1JE9 A;  1B41 B;  3ERA A;  3KFD I;  5DZ5 A;  1NTX A;  2JVE A;  1YWH A;  1KXI A;  3U73 U;  1RL5 A;  1NTN A;  1CDT A;  1V6P A;  2BHI A;  2MUO A;  2HLR A;  2QC1 A;  1G6M A;  1IDI A;  1XT3 A;  1QM7 A;  1UG4 A;  2BTX A;  1ES7 B;  2MJY A;  1MR6 A;  1ONJ A;  3BT1 U;  1KBA A;  2L5S A;  1RGJ A;  2UWR A;  1KBT A;  1NYU A;  4AEA A;  1VB0 A;  3HH7 A;  3BT2 U;  3NH7 A;  1CDQ A;  1ERG A;  3EBX A;  1FRA A;  1CXN A;  3KFD E;  4QTI U;  2PJY C;  1NEA A;  4UY2 C;  2GOO C;  2GOO B;  1JBD A;  3NDS A;  4FAO C;  1KFH A;  1S4Y A;  4OM4 A;  1PLO A;  2CTX A;  2LA1 A;  2MHY A;  5DU1 A;  1ERA A;  1JGK A;  1FFJ A;  1CHV S;  1IKC A;  1COD A;  2CCX A;  2CRS A;  1KS6 A;  2OFS A;  1NOR A;  1TXA A;  1REW C;  5IMT D;  1F94 A;  3VTS A;  3FEV A;  1CVO A;  1CXO A;  1BTE A;  1CRE A;  2H62 D;  2H7Z B;  1TFS A;  2H8U A;  2JQP A;  4XJJ A;  1CCQ A;  2H5F A;  2I9B E;  1M9Z A;  1IJC A;  1CTX A;  1HC9 B;  5DO6 A;  1HOY A;  4DO8 A;  1W6B A;  2J8B A;  1TGX A;  1F8U B;  2PJY B;  1IDG A;  1L4W A;  1NXB A;  1LX5 B;  2NBT A;  4ZQY A;  1IQ9 A;  5IMY C;  2QJA C;  4EY8 B;  2H7Z A;  1KU6 B;  4RUD A;  4IYE A;  1IDL A;  1LXG A;  1ZAD A;  2CDX A;  2MJ0 A;  1HC9 A;  1IK8 A;  2L03 A;  1FSS B;  1QKD A;  1CB9 A;  1LXH A;  2QJ9 C;  1NYS A;  1QKE A;  1IDH A;  1I02 A;  2FD6 U;  1CDR A; 
#chains in the Genus database with same CATH topology
 1H0J A;  3PLC A;  2QJB C;  1CDS A;  2MJ4 A;  2LCR A;  3U74 U;  2ERA A;  1MAH F;  3QB4 B;  4HQP F;  2K3G A;  2MUP A;  4LFT A;  4BIK B;  1KTZ B;  1COE A;  6EBX A;  1FF4 A;  2HLQ A;  3EVS C;  2ABX A;  4BDT B;  5EBX A;  4P7U A;  1FAS A;  1HAJ A;  1HAA A;  1ABT A;  1KBS A;  4FAO E;  2UX2 A;  1KL8 A;  2CRT A;  1LJZ A;  1BXP A;  2N99 A;  2X8B B;  1DRS A;  3NEQ A;  2H64 C;  1KC4 A;  2H64 B;  4OM5 A;  2H62 C;  1FSC A;  3LAQ U;  1CRF A;  1LSI A;  2MFA A;  2VLW A;  1TXB A;  1JE9 A;  1B41 B;  3ERA A;  3KFD I;  5DZ5 A;  1NTX A;  2JVE A;  1YWH A;  1KXI A;  3U73 U;  1RL5 A;  1NTN A;  1CDT A;  1V6P A;  2BHI A;  2MUO A;  2HLR A;  2QC1 A;  1G6M A;  1IDI A;  1XT3 A;  1QM7 A;  1UG4 A;  2BTX A;  1ES7 B;  2MJY A;  1MR6 A;  1ONJ A;  3BT1 U;  1KBA A;  2L5S A;  1RGJ A;  2UWR A;  1KBT A;  1NYU A;  4AEA A;  1VB0 A;  3HH7 A;  3BT2 U;  3NH7 A;  1CDQ A;  1ERG A;  3EBX A;  1FRA A;  1CXN A;  3KFD E;  4QTI U;  2PJY C;  1NEA A;  4UY2 C;  2GOO C;  2GOO B;  1JBD A;  3NDS A;  4FAO C;  1KFH A;  1S4Y A;  4OM4 A;  1PLO A;  2CTX A;  2LA1 A;  2MHY A;  5DU1 A;  1ERA A;  1JGK A;  1FFJ A;  1CHV S;  1IKC A;  1COD A;  2CCX A;  2CRS A;  1KS6 A;  2OFS A;  1NOR A;  1TXA A;  1REW C;  5IMT D;  1F94 A;  3VTS A;  3FEV A;  1CVO A;  1CXO A;  1BTE A;  1CRE A;  2H62 D;  2H7Z B;  1TFS A;  2H8U A;  2JQP A;  4XJJ A;  1CCQ A;  2H5F A;  2I9B E;  1M9Z A;  4KSN A;  1IJC A;  1CTX A;  1HC9 B;  5DO6 A;  1HOY A;  4DO8 A;  1W6B A;  2J8B A;  1TGX A;  1F8U B;  2PJY B;  1IDG A;  1L4W A;  1NXB A;  1LX5 B;  2NBT A;  4ZQY A;  1IQ9 A;  5IMY C;  2QJA C;  4EY8 B;  2H7Z A;  1KU6 B;  4RUD A;  4IYE A;  1IDL A;  1LXG A;  1ZAD A;  2CDX A;  2MJ0 A;  1HC9 A;  1IK8 A;  2L03 A;  1FSS B;  1QKD A;  1CB9 A;  1LXH A;  2QJ9 C;  1NYS A;  1QKE A;  1IDH A;  1I02 A;  2FD6 U;  1CDR A; 
#chains in the Genus database with same CATH homology
 1H0J A;  3PLC A;  2QJB C;  1CDS A;  2MJ4 A;  2LCR A;  3U74 U;  2ERA A;  1MAH F;  3QB4 B;  4HQP F;  2K3G A;  2MUP A;  4LFT A;  4BIK B;  1KTZ B;  1COE A;  6EBX A;  1FF4 A;  2HLQ A;  3EVS C;  2ABX A;  4BDT B;  5EBX A;  4P7U A;  1FAS A;  1HAJ A;  1HAA A;  1ABT A;  1KBS A;  4FAO E;  2UX2 A;  1KL8 A;  2CRT A;  1LJZ A;  1BXP A;  2N99 A;  2X8B B;  1DRS A;  3NEQ A;  2H64 C;  1KC4 A;  2H64 B;  4OM5 A;  2H62 C;  1FSC A;  3LAQ U;  1CRF A;  1LSI A;  2MFA A;  2VLW A;  1TXB A;  1JE9 A;  1B41 B;  3ERA A;  3KFD I;  5DZ5 A;  1NTX A;  2JVE A;  1YWH A;  1KXI A;  3U73 U;  1RL5 A;  1NTN A;  1CDT A;  1V6P A;  2BHI A;  2MUO A;  2HLR A;  2QC1 A;  1G6M A;  1IDI A;  1XT3 A;  1QM7 A;  1UG4 A;  2BTX A;  1ES7 B;  2MJY A;  1MR6 A;  1ONJ A;  3BT1 U;  1KBA A;  2L5S A;  1RGJ A;  2UWR A;  1KBT A;  1NYU A;  4AEA A;  1VB0 A;  3HH7 A;  3BT2 U;  3NH7 A;  1CDQ A;  1ERG A;  3EBX A;  1FRA A;  1CXN A;  3KFD E;  4QTI U;  2PJY C;  1NEA A;  4UY2 C;  2GOO C;  2GOO B;  1JBD A;  3NDS A;  4FAO C;  1KFH A;  1S4Y A;  4OM4 A;  1PLO A;  2CTX A;  2LA1 A;  2MHY A;  5DU1 A;  1ERA A;  1JGK A;  1FFJ A;  1CHV S;  1IKC A;  1COD A;  2CCX A;  2CRS A;  1KS6 A;  2OFS A;  1NOR A;  1TXA A;  1REW C;  5IMT D;  1F94 A;  3VTS A;  3FEV A;  1CVO A;  1CXO A;  1BTE A;  1CRE A;  2H62 D;  2H7Z B;  1TFS A;  2H8U A;  2JQP A;  4XJJ A;  1CCQ A;  2H5F A;  2I9B E;  1M9Z A;  4KSN A;  1IJC A;  1CTX A;  1HC9 B;  5DO6 A;  1HOY A;  4DO8 A;  1W6B A;  2J8B A;  1TGX A;  1F8U B;  2PJY B;  1IDG A;  1L4W A;  1NXB A;  1LX5 B;  2NBT A;  4ZQY A;  1IQ9 A;  5IMY C;  2QJA C;  4EY8 B;  2H7Z A;  1KU6 B;  4RUD A;  4IYE A;  1IDL A;  1LXG A;  1ZAD A;  2CDX A;  2MJ0 A;  1HC9 A;  1IK8 A;  2L03 A;  1FSS B;  1QKD A;  1CB9 A;  1LXH A;  2QJ9 C;  1NYS A;  1QKE A;  1IDH A;  1I02 A;  2FD6 U;  1CDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...