1CBFA

The x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
b'GLVPRGSHMKLYIIGAGPGDPDLITVKGLKLLQQADVVLYADSLVSQDLIAKSKPGAEVLKTAGMHLEEMVGTMLDRMREGKMVVRVHTGDPAMYGAIMEQMVLLKREGVDIEIVPGVTSVFAAAAAAEAELTIPDLTQTVILTRAEGRTPVPEFEKLTDLAKHKCTIALFLSSTLTKKVMKEFINAGWSEDTPVVVVYKATWPDEKIVRTTVKDLDDAMRTNGIRKQAMILAGWALDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COBALT-PRECORRIN-4 TRANSMETHYLASE
publication title The X-ray structure of a cobalamin biosynthetic enzyme, cobalt-precorrin-4 methyltransferase.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Methyltransferase
total genus 65
structure length 239
sequence length 239
ec nomenclature ec 2.1.1.271: Cobalt-precorrin-4 methyltransferase.
pdb deposition date 1998-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 1cbfA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 1cbfA01
2DSIA 3NUTA 2EK2A 2PB6A 2E0NA 2EMUA 2PCAA 2E8SA 3NEIA 2EK7A 2P6KA 1WDEA 2PCGA 2DV3A 2EEQA 2DV5A 2E0KA 3I4TA 2PCMA 2EL1A 2PB5A 5HW4A 2PB4A 2EJZA 2P5FA 1VCEA 2EHLA 1S4DA 3KWPA 2E17A 2HR8A 4E16A 2ELDA 2EGBA 2EN5A 2E8QA 2OWUA 2Z6RA 2HUTA 1VA0A 2P9DA 2OWVA 2DSHA 2ZVCA 2DXXA 2ED3A 2EGLA 1PJTA 2EGSA 2ELEA 2PCKA 2P2XA 2ENIA 2YBOA 2DSGA 2YBQA 3FQ6A 2PCIA 2QBUA 1WYZA 2DEKA 1V9AA 2P6IA 2DV7A 2P5CA 2HUVA 2EL3A 2EJKA 2P6DA 1CBFA 2DXVA 2E7RA 3NDCA 2EJJA 2OWGA 2P6LA 2E16A 2EH4A 2OWKA 2HUXA 2E4RA 2DV4A 2HUQA 3ND1A 2E08A 2ED5A 2EKAA 1PJQA 2DXWA 2E15A 2EHCA 2EL0A 2ZVBA 3HH1A 2E8RA 2EMRA 2E8HA 2EH5A 1VE2A 3FFYA 1WNGA 2EL2A 2EH2A 2EK4A 2CBFA 1VHVA 2NPNA 1PJSA 2EK3A 2BB3A 2OWFA 2E07A 2PCHA 2E4NA
chains in the Genus database with same CATH superfamily
4EB3A 2DSIA 3NUTA 2EK2A 3ZGLA 2PB6A 3UTCA 2E0NA 2EMUA 2PCAA 3UV3A 2KYYA 2E8SA 3NEIA 2EK7A 2P6KA 3SZLA 1WDEA 2PCGA 2DV3A 3SZUA 2EEQA 3SZOA 2DV5A 2E0KA 3I4TA 4H4EA 2PCMA 2EL1A 2PB5A 4MV0A 5HW4A 2PB4A 2EJZA 2P5FA 1VCEA 2EHLA 4MV5A 1S4DA 3KWPA 2E17A 2HR8A 4E16A 3KE9A 2ELDA 2EGBA 2EN5A 3LMMA 2E8QA 2OWUA 2Z6RA 3T0GA 2HUTA 3KE8A 1VA0A 2P9DA 2OWVA 2DSHA 4H4CA 2ZVCA 2DXXA 3TIXB 2ED3A 2EGLA 3UWMA 1PJTA 4MUXA 2EGSA 2ELEA 2PCKA 2P2XA 3DNFA 2ENIA 2YBOA 3KEMA 2DSGA 2YBQA 3FQ6A 2PCIA 2QBUA 3UTDA 1WYZA 2DEKA 1V9AA 2P6IA 3UV7A 2DV7A 2P5CA 2HUVA 2EL3A 2EJKA 2P6DA 1CBFA 2DXVA 2E7RA 3NDCA 2EJJA 4MUYA 2OWGA 2P6LA 2E16A 4H4DA 3UV6A 2EH4A 2OWKA 2HUXA 2E4RA 2DV4A 2HUQA 3ND1A 2E08A 2ED5A 3ZGNA 2EKAA 3URKA 4N7BA 1PJQA 2DXWA 3T0FA 2E15A 2EHCA 2EL0A 2ZVBA 3HH1A 2E8RA 2EMRA 2E8HA 2EH5A 1VE2A 3FFYA 3F7TA 1WNGA 2EL2A 2EH2A 2EK4A 2CBFA 1VHVA 2NPNA 1PJSA 2EK3A 2BB3A 3KEFA 2OWFA 2E07A 3KELA 2PCHA 2E4NA
chains in the Genus database with same CATH topology
4EB3A 2DSIA 3NUTA 2EK2A 3ZGLA 2PB6A 3UTCA 2E0NA 2EMUA 2PCAA 3UV3A 2KYYA 2E8SA 3NEIA 2EK7A 2P6KA 3SZLA 1WDEA 2PCGA 2DV3A 3SZUA 2EEQA 3SZOA 2DV5A 2E0KA 3I4TA 4H4EA 2PCMA 2EL1A 2PB5A 4MV0A 5HW4A 2PB4A 2EJZA 2P5FA 1VCEA 2EHLA 4MV5A 1S4DA 3KWPA 2E17A 2HR8A 4E16A 3KE9A 2ELDA 2EGBA 2EN5A 3LMMA 2E8QA 2OWUA 2Z6RA 3T0GA 2HUTA 3KE8A 1VA0A 2P9DA 2OWVA 2DSHA 4H4CA 2ZVCA 2DXXA 3TIXB 2ED3A 2EGLA 3UWMA 1PJTA 4MUXA 2EGSA 2ELEA 2PCKA 2P2XA 3DNFA 2ENIA 2YBOA 3KEMA 2DSGA 2YBQA 3FQ6A 2PCIA 2QBUA 3UTDA 1WYZA 2DEKA 1V9AA 2P6IA 3UV7A 2DV7A 2P5CA 2HUVA 2EL3A 2EJKA 2P6DA 1CBFA 2DXVA 2E7RA 3NDCA 2EJJA 4MUYA 2OWGA 2P6LA 2E16A 4H4DA 3UV6A 2EH4A 2OWKA 2HUXA 2E4RA 2DV4A 2HUQA 3ND1A 2E08A 2ED5A 3ZGNA 2EKAA 3URKA 4N7BA 1PJQA 2DXWA 3T0FA 2E15A 2EHCA 2EL0A 2ZVBA 3HH1A 2E8RA 2EMRA 2E8HA 2EH5A 1VE2A 3FFYA 3F7TA 1WNGA 2EL2A 2EH2A 2EK4A 2CBFA 1VHVA 2NPNA 1PJSA 2EK3A 2BB3A 3KEFA 2OWFA 2E07A 3KELA 2PCHA 2E4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSI A;  3NUT A;  2EK2 A;  2PB6 A;  2E0N A;  2EMU A;  2PCA A;  2E8S A;  3NEI A;  2EK7 A;  2P6K A;  1WDE A;  2PCG A;  2DV3 A;  2EEQ A;  2DV5 A;  2E0K A;  3I4T A;  2PCM A;  2EL1 A;  2PB5 A;  5HW4 A;  2PB4 A;  2EJZ A;  2P5F A;  1VCE A;  2EHL A;  1S4D A;  3KWP A;  2E17 A;  2HR8 A;  4E16 A;  2ELD A;  2EGB A;  2EN5 A;  2E8Q A;  2OWU A;  2Z6R A;  2HUT A;  1VA0 A;  2P9D A;  2OWV A;  2DSH A;  2ZVC A;  2DXX A;  2ED3 A;  2EGL A;  1PJT A;  2EGS A;  2ELE A;  2PCK A;  2P2X A;  2ENI A;  2YBO A;  2DSG A;  2YBQ A;  3FQ6 A;  2PCI A;  2QBU A;  1WYZ A;  2DEK A;  1V9A A;  2P6I A;  2DV7 A;  2P5C A;  2HUV A;  2EL3 A;  2EJK A;  2P6D A;  1CBF A;  2DXV A;  2E7R A;  3NDC A;  2EJJ A;  2OWG A;  2P6L A;  2E16 A;  2EH4 A;  2OWK A;  2HUX A;  2E4R A;  2DV4 A;  2HUQ A;  3ND1 A;  2E08 A;  2ED5 A;  2EKA A;  1PJQ A;  2DXW A;  2E15 A;  2EHC A;  2EL0 A;  2ZVB A;  3HH1 A;  2E8R A;  2EMR A;  2E8H A;  2EH5 A;  1VE2 A;  3FFY A;  1WNG A;  2EL2 A;  2EH2 A;  2EK4 A;  2CBF A;  1VHV A;  2NPN A;  1PJS A;  2EK3 A;  2BB3 A;  2OWF A;  2E07 A;  2PCH A;  2E4N A; 
#chains in the Genus database with same CATH topology
 4EB3 A;  2DSI A;  3NUT A;  2EK2 A;  3ZGL A;  2PB6 A;  3UTC A;  2E0N A;  2EMU A;  2PCA A;  3UV3 A;  2KYY A;  2E8S A;  3NEI A;  2EK7 A;  2P6K A;  3SZL A;  1WDE A;  2PCG A;  2DV3 A;  3SZU A;  2EEQ A;  3SZO A;  2DV5 A;  2E0K A;  3I4T A;  4H4E A;  2PCM A;  2EL1 A;  2PB5 A;  4MV0 A;  5HW4 A;  2PB4 A;  2EJZ A;  2P5F A;  1VCE A;  2EHL A;  4MV5 A;  1S4D A;  3KWP A;  2E17 A;  2HR8 A;  4E16 A;  3KE9 A;  2ELD A;  2EGB A;  2EN5 A;  3LMM A;  2E8Q A;  2OWU A;  2Z6R A;  3T0G A;  2HUT A;  3KE8 A;  1VA0 A;  2P9D A;  2OWV A;  2DSH A;  4H4C A;  2ZVC A;  2DXX A;  3TIX B;  2ED3 A;  2EGL A;  3UWM A;  1PJT A;  4MUX A;  2EGS A;  2ELE A;  2PCK A;  2P2X A;  3DNF A;  2ENI A;  2YBO A;  3KEM A;  2DSG A;  2YBQ A;  3FQ6 A;  2PCI A;  2QBU A;  3UTD A;  1WYZ A;  2DEK A;  1V9A A;  2P6I A;  3UV7 A;  2DV7 A;  2P5C A;  2HUV A;  2EL3 A;  2EJK A;  2P6D A;  1CBF A;  2DXV A;  2E7R A;  3NDC A;  2EJJ A;  4MUY A;  2OWG A;  2P6L A;  2E16 A;  4H4D A;  3UV6 A;  2EH4 A;  2OWK A;  2HUX A;  2E4R A;  2DV4 A;  2HUQ A;  3ND1 A;  2E08 A;  2ED5 A;  3ZGN A;  2EKA A;  3URK A;  4N7B A;  1PJQ A;  2DXW A;  3T0F A;  2E15 A;  2EHC A;  2EL0 A;  2ZVB A;  3HH1 A;  2E8R A;  2EMR A;  2E8H A;  2EH5 A;  1VE2 A;  3FFY A;  3F7T A;  1WNG A;  2EL2 A;  2EH2 A;  2EK4 A;  2CBF A;  1VHV A;  2NPN A;  1PJS A;  2EK3 A;  2BB3 A;  3KEF A;  2OWF A;  2E07 A;  3KEL A;  2PCH A;  2E4N A; 
#chains in the Genus database with same CATH homology
 4EB3 A;  2DSI A;  3NUT A;  2EK2 A;  3ZGL A;  2PB6 A;  3UTC A;  2E0N A;  2EMU A;  2PCA A;  3UV3 A;  2KYY A;  2E8S A;  3NEI A;  2EK7 A;  2P6K A;  3SZL A;  1WDE A;  2PCG A;  2DV3 A;  3SZU A;  2EEQ A;  3SZO A;  2DV5 A;  2E0K A;  3I4T A;  4H4E A;  2PCM A;  2EL1 A;  2PB5 A;  4MV0 A;  5HW4 A;  2PB4 A;  2EJZ A;  2P5F A;  1VCE A;  2EHL A;  4MV5 A;  1S4D A;  3KWP A;  2E17 A;  2HR8 A;  4E16 A;  3KE9 A;  2ELD A;  2EGB A;  2EN5 A;  3LMM A;  2E8Q A;  2OWU A;  2Z6R A;  3T0G A;  2HUT A;  3KE8 A;  1VA0 A;  2P9D A;  2OWV A;  2DSH A;  4H4C A;  2ZVC A;  2DXX A;  3TIX B;  2ED3 A;  2EGL A;  3UWM A;  1PJT A;  4MUX A;  2EGS A;  2ELE A;  2PCK A;  2P2X A;  3DNF A;  2ENI A;  2YBO A;  3KEM A;  2DSG A;  2YBQ A;  3FQ6 A;  2PCI A;  2QBU A;  3UTD A;  1WYZ A;  2DEK A;  1V9A A;  2P6I A;  3UV7 A;  2DV7 A;  2P5C A;  2HUV A;  2EL3 A;  2EJK A;  2P6D A;  1CBF A;  2DXV A;  2E7R A;  3NDC A;  2EJJ A;  4MUY A;  2OWG A;  2P6L A;  2E16 A;  4H4D A;  3UV6 A;  2EH4 A;  2OWK A;  2HUX A;  2E4R A;  2DV4 A;  2HUQ A;  3ND1 A;  2E08 A;  2ED5 A;  3ZGN A;  2EKA A;  3URK A;  4N7B A;  1PJQ A;  2DXW A;  3T0F A;  2E15 A;  2EHC A;  2EL0 A;  2ZVB A;  3HH1 A;  2E8R A;  2EMR A;  2E8H A;  2EH5 A;  1VE2 A;  3FFY A;  3F7T A;  1WNG A;  2EL2 A;  2EH2 A;  2EK4 A;  2CBF A;  1VHV A;  2NPN A;  1PJS A;  2EK3 A;  2BB3 A;  3KEF A;  2OWF A;  2E07 A;  3KEL A;  2PCH A;  2E4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...