1CBFA

The x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
GLVPRGSHMKLYIIGAGPGDPDLITVKGLKLLQQADVVLYADSLVSQDLIAKSKPGAEVLKTAGMHLEEMVGTMLDRMREGKMVVRVHTGDPAMYGAIMEQMVLLKREGVDIEIVPGVTSVFAAAAAAEAELTIPDLTQTVILTRAEGRTPVPEFEKLTDLAKHKCTIALFLSSTLTKKVMKEFINAGWSEDTPVVVVYKATWPDEKIVRTTVKDLDDAMRTNGIRKQAMILAGWALDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of a cobalamin biosynthetic enzyme, cobalt-precorrin-4 methyltransferase.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Methyltransferase
molecule keywords COBALT-PRECORRIN-4 TRANSMETHYLASE
total genus 65
structure length 239
sequence length 239
ec nomenclature ec 2.1.1.271: Cobalt-precorrin-4 methyltransferase.
pdb deposition date 1998-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 1cbfA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 1cbfA01
2EL2A 3NUTA 2EEQA 2PCMA 3KWPA 2EK4A 2P6IA 2DXWA 1VA0A 2P5FA 2HUTA 2HUQA 2DV7A 2EJJA 2EK2A 2EGSA 2EGBA 2ED5A 2P6LA 1WNGA 3FQ6A 2EHLA 2PB4A 2E8RA 1PJQA 2EH2A 3NEIA 2E8HA 3HH1A 2DSIA 2EMRA 2EKAA 2ZVCA 2DV5A 1PJSA 1S4DA 2PCHA 3ND1A 2OWFA 2ZVBA 2DSHA 2P6DA 2NPNA 4E16A 2HUVA 2E0NA 2E4RA 2E8QA 3I4TA 2ELEA 2EL1A 2QBUA 1CBFA 2E4NA 2OWGA 3FFYA 2EL3A 2YBQA 2PCKA 2PCIA 2E8SA 2ED3A 2HR8A 2EHCA 2EK3A 2PCGA 2EN5A 2YBOA 2EL0A 2OWUA 1WYZA 2DV4A 2EJKA 2EMUA 2EH5A 1VHVA 2E7RA 2OWVA 1WDEA 2E15A 2E08A 2P5CA 2EK7A 2DV3A 2DXVA 1VE2A 2DXXA 5HW4A 2EH4A 2P2XA 2E0KA 1V9AA 2HUXA 1VCEA 2P9DA 2ELDA 2BB3A 2DEKA 2EJZA 1PJTA 2P6KA 2CBFA 2E16A 2OWKA 2PB6A 2DSGA 2Z6RA 2EGLA 2E07A 2ENIA 2PCAA 3NDCA 2E17A 2PB5A
chains in the Genus database with same CATH superfamily
2EL2A 3NUTA 2EEQA 2PCMA 3KWPA 2EK4A 3F7TA 2P6IA 2DXWA 1VA0A 2P5FA 2HUTA 2HUQA 2DV7A 3KEMA 2EJJA 2EK2A 2EGSA 2EGBA 2ED5A 2P6LA 3ZGLA 1WNGA 3FQ6A 2EHLA 2PB4A 3UV7A 2E8RA 1PJQA 2EH2A 3UTCA 3NEIA 2E8HA 3HH1A 2DSIA 2EMRA 2EKAA 3KE8A 2ZVCA 2DV5A 1PJSA 1S4DA 2PCHA 3ND1A 4N7BA 2OWFA 2ZVBA 3KELA 4H4EA 2DSHA 2P6DA 2NPNA 4E16A 2HUVA 2E0NA 2E4RA 4MUXA 4H4CA 2E8QA 3T0FA 3I4TA 3KE9A 2ELEA 2EL1A 2QBUA 1CBFA 2E4NA 2OWGA 3FFYA 4H4DA 4MV5A 2EL3A 2YBQA 3KEFA 2PCKA 2PCIA 2E8SA 2ED3A 3SZUA 2HR8A 3URKA 2EHCA 2EK3A 2PCGA 2EN5A 2YBOA 3UWMA 3SZOA 2EL0A 2OWUA 1WYZA 2DV4A 2EJKA 2EMUA 2EH5A 1VHVA 2E7RA 2OWVA 1WDEA 2E15A 2E08A 2P5CA 2EK7A 3SZLA 2DV3A 4MV0A 2DXVA 1VE2A 2DXXA 5HW4A 3T0GA 3UV6A 2EH4A 2P2XA 3LMMA 2E0KA 1V9AA 2KYYA 3TIXB 2HUXA 1VCEA 2P9DA 2ELDA 2BB3A 4EB3A 2DEKA 2EJZA 1PJTA 2P6KA 2CBFA 2E16A 2OWKA 2PB6A 2DSGA 3UTDA 3ZGNA 3DNFA 2Z6RA 2EGLA 3UV3A 2E07A 2ENIA 2PCAA 3NDCA 2E17A 4MUYA 2PB5A
chains in the Genus database with same CATH topology
2EL2A 3NUTA 2EEQA 2PCMA 3KWPA 2EK4A 3F7TA 2P6IA 2DXWA 1VA0A 2P5FA 2HUTA 2HUQA 2DV7A 3KEMA 2EJJA 2EK2A 2EGSA 2EGBA 2ED5A 2P6LA 3ZGLA 1WNGA 3FQ6A 2EHLA 2PB4A 3UV7A 2E8RA 1PJQA 2EH2A 3UTCA 3NEIA 2E8HA 3HH1A 2DSIA 2EMRA 2EKAA 3KE8A 2ZVCA 2DV5A 1PJSA 1S4DA 2PCHA 3ND1A 4N7BA 2OWFA 2ZVBA 3KELA 4H4EA 2DSHA 2P6DA 2NPNA 4E16A 2HUVA 2E0NA 2E4RA 4MUXA 4H4CA 2E8QA 3T0FA 3I4TA 3KE9A 2ELEA 2EL1A 2QBUA 1CBFA 2E4NA 2OWGA 3FFYA 4H4DA 4MV5A 2EL3A 2YBQA 3KEFA 2PCKA 2PCIA 2E8SA 2ED3A 3SZUA 2HR8A 3URKA 2EHCA 2EK3A 2PCGA 2EN5A 2YBOA 3UWMA 3SZOA 2EL0A 2OWUA 1WYZA 2DV4A 2EJKA 2EMUA 2EH5A 1VHVA 2E7RA 2OWVA 1WDEA 2E15A 2E08A 2P5CA 2EK7A 3SZLA 2DV3A 4MV0A 2DXVA 1VE2A 2DXXA 5HW4A 3T0GA 3UV6A 2EH4A 2P2XA 3LMMA 2E0KA 1V9AA 2KYYA 3TIXB 2HUXA 1VCEA 2P9DA 2ELDA 2BB3A 4EB3A 2DEKA 2EJZA 1PJTA 2P6KA 2CBFA 2E16A 2OWKA 2PB6A 2DSGA 3UTDA 3ZGNA 3DNFA 2Z6RA 2EGLA 3UV3A 2E07A 2ENIA 2PCAA 3NDCA 2E17A 4MUYA 2PB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL2 A;  3NUT A;  2EEQ A;  2PCM A;  3KWP A;  2EK4 A;  2P6I A;  2DXW A;  1VA0 A;  2P5F A;  2HUT A;  2HUQ A;  2DV7 A;  2EJJ A;  2EK2 A;  2EGS A;  2EGB A;  2ED5 A;  2P6L A;  1WNG A;  3FQ6 A;  2EHL A;  2PB4 A;  2E8R A;  1PJQ A;  2EH2 A;  3NEI A;  2E8H A;  3HH1 A;  2DSI A;  2EMR A;  2EKA A;  2ZVC A;  2DV5 A;  1PJS A;  1S4D A;  2PCH A;  3ND1 A;  2OWF A;  2ZVB A;  2DSH A;  2P6D A;  2NPN A;  4E16 A;  2HUV A;  2E0N A;  2E4R A;  2E8Q A;  3I4T A;  2ELE A;  2EL1 A;  2QBU A;  1CBF A;  2E4N A;  2OWG A;  3FFY A;  2EL3 A;  2YBQ A;  2PCK A;  2PCI A;  2E8S A;  2ED3 A;  2HR8 A;  2EHC A;  2EK3 A;  2PCG A;  2EN5 A;  2YBO A;  2EL0 A;  2OWU A;  1WYZ A;  2DV4 A;  2EJK A;  2EMU A;  2EH5 A;  1VHV A;  2E7R A;  2OWV A;  1WDE A;  2E15 A;  2E08 A;  2P5C A;  2EK7 A;  2DV3 A;  2DXV A;  1VE2 A;  2DXX A;  5HW4 A;  2EH4 A;  2P2X A;  2E0K A;  1V9A A;  2HUX A;  1VCE A;  2P9D A;  2ELD A;  2BB3 A;  2DEK A;  2EJZ A;  1PJT A;  2P6K A;  2CBF A;  2E16 A;  2OWK A;  2PB6 A;  2DSG A;  2Z6R A;  2EGL A;  2E07 A;  2ENI A;  2PCA A;  3NDC A;  2E17 A;  2PB5 A; 
#chains in the Genus database with same CATH topology
 2EL2 A;  3NUT A;  2EEQ A;  2PCM A;  3KWP A;  2EK4 A;  3F7T A;  2P6I A;  2DXW A;  1VA0 A;  2P5F A;  2HUT A;  2HUQ A;  2DV7 A;  3KEM A;  2EJJ A;  2EK2 A;  2EGS A;  2EGB A;  2ED5 A;  2P6L A;  3ZGL A;  1WNG A;  3FQ6 A;  2EHL A;  2PB4 A;  3UV7 A;  2E8R A;  1PJQ A;  2EH2 A;  3UTC A;  3NEI A;  2E8H A;  3HH1 A;  2DSI A;  2EMR A;  2EKA A;  3KE8 A;  2ZVC A;  2DV5 A;  1PJS A;  1S4D A;  2PCH A;  3ND1 A;  4N7B A;  2OWF A;  2ZVB A;  3KEL A;  4H4E A;  2DSH A;  2P6D A;  2NPN A;  4E16 A;  2HUV A;  2E0N A;  2E4R A;  4MUX A;  4H4C A;  2E8Q A;  3T0F A;  3I4T A;  3KE9 A;  2ELE A;  2EL1 A;  2QBU A;  1CBF A;  2E4N A;  2OWG A;  3FFY A;  4H4D A;  4MV5 A;  2EL3 A;  2YBQ A;  3KEF A;  2PCK A;  2PCI A;  2E8S A;  2ED3 A;  3SZU A;  2HR8 A;  3URK A;  2EHC A;  2EK3 A;  2PCG A;  2EN5 A;  2YBO A;  3UWM A;  3SZO A;  2EL0 A;  2OWU A;  1WYZ A;  2DV4 A;  2EJK A;  2EMU A;  2EH5 A;  1VHV A;  2E7R A;  2OWV A;  1WDE A;  2E15 A;  2E08 A;  2P5C A;  2EK7 A;  3SZL A;  2DV3 A;  4MV0 A;  2DXV A;  1VE2 A;  2DXX A;  5HW4 A;  3T0G A;  3UV6 A;  2EH4 A;  2P2X A;  3LMM A;  2E0K A;  1V9A A;  2KYY A;  3TIX B;  2HUX A;  1VCE A;  2P9D A;  2ELD A;  2BB3 A;  4EB3 A;  2DEK A;  2EJZ A;  1PJT A;  2P6K A;  2CBF A;  2E16 A;  2OWK A;  2PB6 A;  2DSG A;  3UTD A;  3ZGN A;  3DNF A;  2Z6R A;  2EGL A;  3UV3 A;  2E07 A;  2ENI A;  2PCA A;  3NDC A;  2E17 A;  4MUY A;  2PB5 A; 
#chains in the Genus database with same CATH homology
 2EL2 A;  3NUT A;  2EEQ A;  2PCM A;  3KWP A;  2EK4 A;  3F7T A;  2P6I A;  2DXW A;  1VA0 A;  2P5F A;  2HUT A;  2HUQ A;  2DV7 A;  3KEM A;  2EJJ A;  2EK2 A;  2EGS A;  2EGB A;  2ED5 A;  2P6L A;  3ZGL A;  1WNG A;  3FQ6 A;  2EHL A;  2PB4 A;  3UV7 A;  2E8R A;  1PJQ A;  2EH2 A;  3UTC A;  3NEI A;  2E8H A;  3HH1 A;  2DSI A;  2EMR A;  2EKA A;  3KE8 A;  2ZVC A;  2DV5 A;  1PJS A;  1S4D A;  2PCH A;  3ND1 A;  4N7B A;  2OWF A;  2ZVB A;  3KEL A;  4H4E A;  2DSH A;  2P6D A;  2NPN A;  4E16 A;  2HUV A;  2E0N A;  2E4R A;  4MUX A;  4H4C A;  2E8Q A;  3T0F A;  3I4T A;  3KE9 A;  2ELE A;  2EL1 A;  2QBU A;  1CBF A;  2E4N A;  2OWG A;  3FFY A;  4H4D A;  4MV5 A;  2EL3 A;  2YBQ A;  3KEF A;  2PCK A;  2PCI A;  2E8S A;  2ED3 A;  3SZU A;  2HR8 A;  3URK A;  2EHC A;  2EK3 A;  2PCG A;  2EN5 A;  2YBO A;  3UWM A;  3SZO A;  2EL0 A;  2OWU A;  1WYZ A;  2DV4 A;  2EJK A;  2EMU A;  2EH5 A;  1VHV A;  2E7R A;  2OWV A;  1WDE A;  2E15 A;  2E08 A;  2P5C A;  2EK7 A;  3SZL A;  2DV3 A;  4MV0 A;  2DXV A;  1VE2 A;  2DXX A;  5HW4 A;  3T0G A;  3UV6 A;  2EH4 A;  2P2X A;  3LMM A;  2E0K A;  1V9A A;  2KYY A;  3TIX B;  2HUX A;  1VCE A;  2P9D A;  2ELD A;  2BB3 A;  4EB3 A;  2DEK A;  2EJZ A;  1PJT A;  2P6K A;  2CBF A;  2E16 A;  2OWK A;  2PB6 A;  2DSG A;  3UTD A;  3ZGN A;  3DNF A;  2Z6R A;  2EGL A;  3UV3 A;  2E07 A;  2ENI A;  2PCA A;  3NDC A;  2E17 A;  4MUY A;  2PB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...