1CBFA

The x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
GLVPRGSHMKLYIIGAGPGDPDLITVKGLKLLQQADVVLYADSLVSQDLIAKSKPGAEVLKTAGMHLEEMVGTMLDRMREGKMVVRVHTGDPAMYGAIMEQMVLLKREGVDIEIVPGVTSVFAAAAAAEAELTIPDLTQTVILTRAEGRTPVPEFEKLTDLAKHKCTIALFLSSTLTKKVMKEFINAGWSEDTPVVVVYKATWPDEKIVRTTVKDLDDAMRTNGIRKQAMILAGWALDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of a cobalamin biosynthetic enzyme, cobalt-precorrin-4 methyltransferase.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Methyltransferase
molecule keywords COBALT-PRECORRIN-4 TRANSMETHYLASE
total genus 65
structure length 239
sequence length 239
ec nomenclature ec 2.1.1.271: Cobalt-precorrin-4 methyltransferase.
pdb deposition date 1998-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 1cbfA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 1cbfA01
2E08A 2EK7A 2E4RA 2CBFA 2PB6A 2HUTA 2P6DA 2EL1A 2PB4A 2E0NA 2PCGA 2EK4A 1VHVA 2HR8A 1V9AA 2E7RA 2P9DA 2PCKA 2P5FA 3NUTA 2P2XA 2DV4A 2YBQA 3I4TA 2ZVCA 2OWGA 2HUXA 5HW4A 1VA0A 2E16A 4E16A 2E17A 2DV3A 2YBOA 3NEIA 2E8HA 2ENIA 2ELDA 2PCIA 1S4DA 2BB3A 2DSIA 2E4NA 2P6LA 1PJSA 2E07A 2OWKA 2Z6RA 2PCAA 2P5CA 1WNGA 2DV7A 2OWVA 3KWPA 2PCMA 2EK2A 2DV5A 1WYZA 3FFYA 2E15A 2P6IA 2NPNA 2OWUA 2EK3A 2EL0A 2DXXA 2EH5A 2EH4A 3HH1A 3ND1A 2PCHA 2DSHA 1CBFA 2EH2A 2ELEA 1VE2A 2HUQA 2EGSA 2EEQA 2ED5A 2P6KA 1PJQA 2EJZA 2EN5A 2EL2A 2EGBA 2PB5A 2DXVA 2E8QA 2E8SA 2EKAA 2DSGA 2EL3A 2QBUA 2E0KA 2DXWA 1PJTA 1WDEA 2OWFA 2DEKA 2EJKA 2EJJA 2ZVBA 2ED3A 2EHCA 2HUVA 2EGLA 3FQ6A 2EMRA 1VCEA 2E8RA 2EMUA 3NDCA 2EHLA
chains in the Genus database with same CATH superfamily
2E08A 2EK7A 2E4RA 2CBFA 2PB6A 2HUTA 2P6DA 3KE8A 4MV0A 2EL1A 2PB4A 2E0NA 4H4DA 2PCGA 4H4EA 2EK4A 3TIXB 1VHVA 2HR8A 1V9AA 3F7TA 3UV3A 2E7RA 3UV7A 2P9DA 2PCKA 2P5FA 3NUTA 2P2XA 2DV4A 2YBQA 3I4TA 2ZVCA 4H4CA 2OWGA 2HUXA 5HW4A 1VA0A 3KEMA 3UV6A 2E16A 4E16A 3UWMA 2E17A 2DV3A 2YBOA 3NEIA 2E8HA 4MUXA 2ENIA 2ELDA 2PCIA 3DNFA 1S4DA 2BB3A 4EB3A 2DSIA 2E4NA 2P6LA 1PJSA 3UTDA 2E07A 2OWKA 2Z6RA 3KEFA 2PCAA 2KYYA 2P5CA 1WNGA 2DV7A 3SZOA 2OWVA 3KWPA 2PCMA 2EK2A 3LMMA 3SZLA 3KE9A 2DV5A 1WYZA 3FFYA 2E15A 2P6IA 2NPNA 2OWUA 2EK3A 2EL0A 2DXXA 2EH5A 2EH4A 3HH1A 3ND1A 2PCHA 2DSHA 1CBFA 2EH2A 2ELEA 1VE2A 2HUQA 2EGSA 4MUYA 2EEQA 2ED5A 2P6KA 1PJQA 3ZGNA 2EJZA 2EN5A 2EL2A 3KELA 2EGBA 2PB5A 3T0FA 2DXVA 2E8QA 4N7BA 3SZUA 2E8SA 2EKAA 2DSGA 2EL3A 2QBUA 3URKA 2E0KA 2DXWA 1PJTA 4MV5A 1WDEA 2OWFA 2DEKA 2EJKA 2EJJA 2ZVBA 2ED3A 2EHCA 2HUVA 3ZGLA 2EGLA 3FQ6A 3T0GA 3UTCA 2EMRA 1VCEA 2E8RA 2EMUA 3NDCA 2EHLA
chains in the Genus database with same CATH topology
2E08A 2EK7A 2E4RA 2CBFA 2PB6A 2HUTA 2P6DA 3KE8A 4MV0A 2EL1A 2PB4A 2E0NA 4H4DA 2PCGA 4H4EA 2EK4A 3TIXB 1VHVA 2HR8A 1V9AA 3F7TA 3UV3A 2E7RA 3UV7A 2P9DA 2PCKA 2P5FA 3NUTA 2P2XA 2DV4A 2YBQA 3I4TA 2ZVCA 4H4CA 2OWGA 2HUXA 5HW4A 1VA0A 3KEMA 3UV6A 2E16A 4E16A 3UWMA 2E17A 2DV3A 2YBOA 3NEIA 2E8HA 4MUXA 2ENIA 2ELDA 2PCIA 3DNFA 1S4DA 2BB3A 4EB3A 2DSIA 2E4NA 2P6LA 1PJSA 3UTDA 2E07A 2OWKA 2Z6RA 3KEFA 2PCAA 2KYYA 2P5CA 1WNGA 2DV7A 3SZOA 2OWVA 3KWPA 2PCMA 2EK2A 3LMMA 3SZLA 3KE9A 2DV5A 1WYZA 3FFYA 2E15A 2P6IA 2NPNA 2OWUA 2EK3A 2EL0A 2DXXA 2EH5A 2EH4A 3HH1A 3ND1A 2PCHA 2DSHA 1CBFA 2EH2A 2ELEA 1VE2A 2HUQA 2EGSA 4MUYA 2EEQA 2ED5A 2P6KA 1PJQA 3ZGNA 2EJZA 2EN5A 2EL2A 3KELA 2EGBA 2PB5A 3T0FA 2DXVA 2E8QA 4N7BA 3SZUA 2E8SA 2EKAA 2DSGA 2EL3A 2QBUA 3URKA 2E0KA 2DXWA 1PJTA 4MV5A 1WDEA 2OWFA 2DEKA 2EJKA 2EJJA 2ZVBA 2ED3A 2EHCA 2HUVA 3ZGLA 2EGLA 3FQ6A 3T0GA 3UTCA 2EMRA 1VCEA 2E8RA 2EMUA 3NDCA 2EHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E08 A;  2EK7 A;  2E4R A;  2CBF A;  2PB6 A;  2HUT A;  2P6D A;  2EL1 A;  2PB4 A;  2E0N A;  2PCG A;  2EK4 A;  1VHV A;  2HR8 A;  1V9A A;  2E7R A;  2P9D A;  2PCK A;  2P5F A;  3NUT A;  2P2X A;  2DV4 A;  2YBQ A;  3I4T A;  2ZVC A;  2OWG A;  2HUX A;  5HW4 A;  1VA0 A;  2E16 A;  4E16 A;  2E17 A;  2DV3 A;  2YBO A;  3NEI A;  2E8H A;  2ENI A;  2ELD A;  2PCI A;  1S4D A;  2BB3 A;  2DSI A;  2E4N A;  2P6L A;  1PJS A;  2E07 A;  2OWK A;  2Z6R A;  2PCA A;  2P5C A;  1WNG A;  2DV7 A;  2OWV A;  3KWP A;  2PCM A;  2EK2 A;  2DV5 A;  1WYZ A;  3FFY A;  2E15 A;  2P6I A;  2NPN A;  2OWU A;  2EK3 A;  2EL0 A;  2DXX A;  2EH5 A;  2EH4 A;  3HH1 A;  3ND1 A;  2PCH A;  2DSH A;  1CBF A;  2EH2 A;  2ELE A;  1VE2 A;  2HUQ A;  2EGS A;  2EEQ A;  2ED5 A;  2P6K A;  1PJQ A;  2EJZ A;  2EN5 A;  2EL2 A;  2EGB A;  2PB5 A;  2DXV A;  2E8Q A;  2E8S A;  2EKA A;  2DSG A;  2EL3 A;  2QBU A;  2E0K A;  2DXW A;  1PJT A;  1WDE A;  2OWF A;  2DEK A;  2EJK A;  2EJJ A;  2ZVB A;  2ED3 A;  2EHC A;  2HUV A;  2EGL A;  3FQ6 A;  2EMR A;  1VCE A;  2E8R A;  2EMU A;  3NDC A;  2EHL A; 
#chains in the Genus database with same CATH topology
 2E08 A;  2EK7 A;  2E4R A;  2CBF A;  2PB6 A;  2HUT A;  2P6D A;  3KE8 A;  4MV0 A;  2EL1 A;  2PB4 A;  2E0N A;  4H4D A;  2PCG A;  4H4E A;  2EK4 A;  3TIX B;  1VHV A;  2HR8 A;  1V9A A;  3F7T A;  3UV3 A;  2E7R A;  3UV7 A;  2P9D A;  2PCK A;  2P5F A;  3NUT A;  2P2X A;  2DV4 A;  2YBQ A;  3I4T A;  2ZVC A;  4H4C A;  2OWG A;  2HUX A;  5HW4 A;  1VA0 A;  3KEM A;  3UV6 A;  2E16 A;  4E16 A;  3UWM A;  2E17 A;  2DV3 A;  2YBO A;  3NEI A;  2E8H A;  4MUX A;  2ENI A;  2ELD A;  2PCI A;  3DNF A;  1S4D A;  2BB3 A;  4EB3 A;  2DSI A;  2E4N A;  2P6L A;  1PJS A;  3UTD A;  2E07 A;  2OWK A;  2Z6R A;  3KEF A;  2PCA A;  2KYY A;  2P5C A;  1WNG A;  2DV7 A;  3SZO A;  2OWV A;  3KWP A;  2PCM A;  2EK2 A;  3LMM A;  3SZL A;  3KE9 A;  2DV5 A;  1WYZ A;  3FFY A;  2E15 A;  2P6I A;  2NPN A;  2OWU A;  2EK3 A;  2EL0 A;  2DXX A;  2EH5 A;  2EH4 A;  3HH1 A;  3ND1 A;  2PCH A;  2DSH A;  1CBF A;  2EH2 A;  2ELE A;  1VE2 A;  2HUQ A;  2EGS A;  4MUY A;  2EEQ A;  2ED5 A;  2P6K A;  1PJQ A;  3ZGN A;  2EJZ A;  2EN5 A;  2EL2 A;  3KEL A;  2EGB A;  2PB5 A;  3T0F A;  2DXV A;  2E8Q A;  4N7B A;  3SZU A;  2E8S A;  2EKA A;  2DSG A;  2EL3 A;  2QBU A;  3URK A;  2E0K A;  2DXW A;  1PJT A;  4MV5 A;  1WDE A;  2OWF A;  2DEK A;  2EJK A;  2EJJ A;  2ZVB A;  2ED3 A;  2EHC A;  2HUV A;  3ZGL A;  2EGL A;  3FQ6 A;  3T0G A;  3UTC A;  2EMR A;  1VCE A;  2E8R A;  2EMU A;  3NDC A;  2EHL A; 
#chains in the Genus database with same CATH homology
 2E08 A;  2EK7 A;  2E4R A;  2CBF A;  2PB6 A;  2HUT A;  2P6D A;  3KE8 A;  4MV0 A;  2EL1 A;  2PB4 A;  2E0N A;  4H4D A;  2PCG A;  4H4E A;  2EK4 A;  3TIX B;  1VHV A;  2HR8 A;  1V9A A;  3F7T A;  3UV3 A;  2E7R A;  3UV7 A;  2P9D A;  2PCK A;  2P5F A;  3NUT A;  2P2X A;  2DV4 A;  2YBQ A;  3I4T A;  2ZVC A;  4H4C A;  2OWG A;  2HUX A;  5HW4 A;  1VA0 A;  3KEM A;  3UV6 A;  2E16 A;  4E16 A;  3UWM A;  2E17 A;  2DV3 A;  2YBO A;  3NEI A;  2E8H A;  4MUX A;  2ENI A;  2ELD A;  2PCI A;  3DNF A;  1S4D A;  2BB3 A;  4EB3 A;  2DSI A;  2E4N A;  2P6L A;  1PJS A;  3UTD A;  2E07 A;  2OWK A;  2Z6R A;  3KEF A;  2PCA A;  2KYY A;  2P5C A;  1WNG A;  2DV7 A;  3SZO A;  2OWV A;  3KWP A;  2PCM A;  2EK2 A;  3LMM A;  3SZL A;  3KE9 A;  2DV5 A;  1WYZ A;  3FFY A;  2E15 A;  2P6I A;  2NPN A;  2OWU A;  2EK3 A;  2EL0 A;  2DXX A;  2EH5 A;  2EH4 A;  3HH1 A;  3ND1 A;  2PCH A;  2DSH A;  1CBF A;  2EH2 A;  2ELE A;  1VE2 A;  2HUQ A;  2EGS A;  4MUY A;  2EEQ A;  2ED5 A;  2P6K A;  1PJQ A;  3ZGN A;  2EJZ A;  2EN5 A;  2EL2 A;  3KEL A;  2EGB A;  2PB5 A;  3T0F A;  2DXV A;  2E8Q A;  4N7B A;  3SZU A;  2E8S A;  2EKA A;  2DSG A;  2EL3 A;  2QBU A;  3URK A;  2E0K A;  2DXW A;  1PJT A;  4MV5 A;  1WDE A;  2OWF A;  2DEK A;  2EJK A;  2EJJ A;  2ZVB A;  2ED3 A;  2EHC A;  2HUV A;  3ZGL A;  2EGL A;  3FQ6 A;  3T0G A;  3UTC A;  2EMR A;  1VCE A;  2E8R A;  2EMU A;  3NDC A;  2EHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...