1CBKA

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase from haemophilus influenzae
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
MITAYIALGSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAKIETELSPLKLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-PYROPHOSPHOKINASE
publication title The structure and function of the 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 1999-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1cbkA00
5ETQA 3UD5A 1RAOA 1IM6A 4AD6A 1TMMA 1RTZA 2BMBA 3HSZA 3UDVA 4PZVA 1EQ0A 3KUEA 1KBRA 3MCNA 3ILOA 2F65A 5ETOA 3UDEA 3HT0A 4F7VA 4M5JA 3HD2A 2QX0A 3ILJA 1F9HA 1HKAA 3KUHA 1HQ2A 5ETPA 5ETMA 3QBCA 4M5IA 1DY3A 2CG8A 3KUGA 3HCXA 3ILLA 3MCOA 1EQMA 4M5LA 5ETRA 4M5MA 5ETSA 5ETVA 1RU1A 3MCMA 3ILIA 5ETLA 4M5NA 4CYUA 1Q0NA 1CBKA 4CYUB 4M5GA 4M5HA 1RB0A 5ETNA 4CRJA 3HD1A 1TMJA 1G4CA 1EX8A 5ETTA 3HSDA 3IP0A 2F63A 5ETKA 4CWBA 1RU2A 3HSGA 3HSJA 4M5KA
chains in the Genus database with same CATH superfamily
1TL4A 1RBLA 3KHGA 3BSNA 4CLZA 2WVFA 2UVVA 3OFEA 2ZOFA 4URGA 5GADU 1V3ZA 2ZNYA 1REVB 2MYFA 3B78A 1ZTTA 3UW1A 4F3MA 4KGZB 2FVSA 4FYXB 1GXUA 4ZMMA 1FX2A 2I6WA 1M5HA 3AOAA 3BJYA 3Q89A 3IN5A 2GVZA 1U09A 3HSZA 4C8OA 3JQJA 2A10A 5EGYA 3DM2A 1DQ8A 1B0TA 1U7LA 3PY8A 3PACA 1RTIB 4BDPA 3KLEB 5JXSA 3AD8C 2MEWA 1B3TA 3CC4S 4C8ZA 4F0KA 2J0XA 5T14A 3J7Z5 2PMWA 2FHKA 4LR9A 3IRWP 3KMQA 4OYBA 1WTBA 1SH3A 3HCXA 4CLYA 3O3LA 1YJ9S 4ZITA 2UU9J 2J6SA 2E66A 3BBCA 1L3UA 2IA0A 1W7WA 3BO3A 2FVCA 4UZCA 3OL7A 1HKAA 2HBYB 1KWMA 2BRLA 3GSDA 5LM7E 1FNOA 4RO0A 4FS2A 4DX8H 3G8SA 3KLIA 3AXKA 1RTZA 3KK3B 4QJVA 1S9GB 5LMUJ 2ZHOA 8AT1B 4K2XA 2XCPA 1IKYA 3UPFA 3R2CJ 1VQYA 2EKYA 2HKEA 1X5PA 5J2PB 1WOPA 5K14A 4QR2A 3CD6S 2QT7A 2Z2ZA 2HVDA 3K59A 4J9PA 1AROP 3R5BA 3OT9A 4NYPA 3PZPA 2F4FA 2EG2A 1L3TA 3GFYA 4P10A 1VQ9S 3A8JA 1F3VA 3OJSA 4QYZJ 5GMDA 4NRUA 1T9TA 4DCPB 4OI0A 2V50A 2D9PA 1H7WA 1LXJA 2QA4S 2HLTA 2R7UA 5L46A 3VAJA 2AGPA 4WFZA 3CJ3A 3KDNA 2GQQA 3JTPA 2RQMA 3GIJA 1DARA 3MM9B 4LSNB 1S6PB 1RU1A 3BKTA 2YWHA 3TYTA 3O44A 4RX6A 1X5TA 2IRXA 1S97A 3K89A 2F40A 1HWUA 4BHQA 3GIKA 1VK8A 4CM2A 3Q8YA 1XBWA 2PO4A 1HW9A 3DKDA 4KE5A 2GS8A 1B70B 2RQ4A 5E33A 1HNZJ 1Q8KA 3C6UA 1G4CA 1NSPA 1MSWD 3A8KA 4ZCKA 1LWCB 4DV1F 4RPFA 2H5EA 2XMTA 1NHUA 4OJ1A 3CUNA 2OELA 1TFWA 4NE9C 1VC6A 1K8AT 4V1Ak 3LWLA 2ZC4A 3DLGB 1YJRA 5J1EA 1TKXA 3LGHA 4DG1A 3VTIA 3UR3C 3MR3A 2BQ3A 2XMMA 3KTQA 2QTWA 3PR5B 3K0JA 3QJJA 3VZHA 2XWYA 1PCAA 1SUQA 2KL8A 1NAQA 5HJYA 3HHNB 5D77A 3MR6A 2MZSA 4NCBA 2RDJA 4YDDB 2VOOA 1IKWB 4FXWA 2I8EA 1K47A 1N34J 4DV7F 2YPZA 3NOGA 2YBVA 5DDQC 3R8YA 1IN0A 3AD9C 3CCTA 1M1KT 5DG7A 5LJ5Y 2EPIA 1VJWA 5F9NA 3Q86A 4ZJQA 1O51A 1RU2A 4LF8J 2VV5A 4RBVA 2MZQA 4K4TA 1T7PA 4UY85 2POKA 4OZNA 3GILA 1SC6A 5ETMA 2EVZA 1NDKA 4C8NA 3CJKB 2OD6A 4OL8A 4DHVA 2KHDA 3DRPB 3K5NA 1OQ6A 3BH7B 2ERRA 1NSKL 5D4PA 4MKBA 4QWCA 4DN0A 2M7SA 3RGIA 2CZ9A 3DOKB 4PEOA 3I0SA 2GX8A 1KOOA 2P9EA 2IRUA 2RILA 2OSQA 4QIEA 4B9LA 5HVHA 3SFUA 1SL1A 1F60B 3DYAB 3B6BA 1C0TA 1UJ6A 5L1LA 1S1UA 4WIQA 1DLOA 2MHNA 1KKHA 2VG5B 2AJ1A 3V81B 5HP1B 2DNQA 2HQCA 1NXIA 2V94A 5B0BA 1DTTB 4O4GA 2QGFB 5FD1A 1I94J 4PPDA 4LF4J 3HHLA 2R7RA 2Y3YA 1VQMS 3KJNB 4E8UA 2UV8G 1RK8A 2Y9HA 3KWMA 5D15A 3RYLA 3TEGA 1JLGA 5KOXA 4FPIA 2B56A 1B99A 2QN6B 3POTA 5HMXA 5ITHA 1XC9A 4P2MA 1N5VA 1NB2A 3HXMA 3PYGA 3LTOA 4ED5A 4U95A 3W66A 1X4EA 4KQZA 4CYUA 3KG0A 5KT7A 4KPCA 4M5DB 2BUNA 2O5DA 3IG1B 4OZ3A 3PFEA 4L76A 2BXJA 4ENOA 2UP1A 1HBUA 2IDLA 3M1VB 5J2QB 1FK9A 1YQHA 1Y9OA 2R2RA 3T5JA 2H51B 3W8PA 5EHHA 5C42A 3KKFA 2J0SD 1TL1B 4ZVHA 3V6DB 4ECVA 3H5UA 5DDRC 4IG0A 1NDLA 3PRBA 1M5SA 3CDBA 5DQIA 2COLA 3GFZA 4IFVA 2VBYA 4ZN1A 3Q8RB 2HQGA 1JLAB 4USUA 4CLTA 1TKTA 3UCGA 4FYWB 2ZH7A 5F3ZA 4JI1F 3M8QB 2I5JB 2RDDA 3TWZA 1WEYA 3RW6A 4WF9Q 3ZO7A 4CH7A 4FKXA 4HT7A 1ICEB 3JYTB 1S72S 2XYGB 1GXTA 3AQOA 4UQTA 1TK8A 2HQDA 4CZCA 5KT2A 4PYDA 5GAGI 5D0EA 5CCMA 1HW8A 3FBEA 1C0UB 1ZA2B 2UZAA 2B8QA 3NGTA 2ROGA 1U8SA 3RR7A 5GMKa 3HHDA 2DGWA 4KJIA 3TP2A 4PG5A 2CPJA 1ELOA 4NEZA 3TJ9A 1IXKA 1KQSR 4X65F 4LFAF 3SI8A 1OQ3A 2IAJA 3CE8A 4KH1B 1UEUA 3KLEA 2CJQA 2J9CA 1CQNA 2HFOA 1VOMA 2F65A 1QJHA 1TUVA 2QFJA 3MEKA 2VG6B 4BBYA 1RXOB 1S76D 2EK1A 2ZH9A 3UFCX 3I4HX 3TUZC 2D69A 3BYRA 3I31A 3TOQA 3GU0A 1Q7YT 4GKJF 2JVOA 2OI2A 2M8DB 4OI4A 2U2FA 4QR1A 5KFGA 3B4DA 2HBQB 1NK6A 1FHTA 2XBPA 3D1OA 3UVJB 4OZJA 4NLPA 1HBMB 2G13A 4RLEA 4DFKA 3KK3A 1XEZA 1VRUB 3M2VB 2IA6A 4CLKA 1CS4A 3SCIE 3EPIA 1IQZA 1X0FA 5FLXY 4HLBA 2ILZA 5H9EJ 3QWPA 5J2PA 2RUGA 3TAMA 1KLMB 4FYVB 3EX7B 3C6TB 2Q43A 2MLYA 3HZEA 5M2UA 2XMVA 4FN5A 2OFHX 2VODA 2XGQA 3O8WA 3WQPA 1VQOS 4B3MJ 1ULRA 4PQAA 1RYSA 4LBHA 2JLGA 3PRVA 4E98A 3UCZP 2R7XA 5E3RA 1FRJA 5IV3A 1JMTA 4Q44A 2KJWA 1XR5A 3G8QA 4Q2LA 4KFBB 5CYMB 5CD4H 1XWLA 4DPUA 2JZ5A 3MEDB 4E2FB 4WTOB 4PWUA 2MQQA 3N4WA 3MM9A 3HI9A 3CCQS 1U2FA 2BA9A 1SPBP 4LFBJ 5E5NA 5HAOA 2M8HA 4EU0A 2CVIA 4OX7A 4KIAA 2HQIA 3HD2A 1YWXA 4ED4A 1UTAA 2HAFA 2QLWA 2C28A 3NWGA 4YB1P 2FPHX 3ULHA 2DNRA 5ETNA 2BEFA 2E5JA 4LREA 1XMQF 2PSZA 1LWCA 3W63A 3QIPB 1RT5A 1FD2A 4D3GA 4EBDA 2R8GA 1RCXB 4DX5A 3CB4A 1TKDA 2CDRB 2W9BB 4JI2J 4OIXA 5ETQA 4X4RA 2BJ3A 2BR0A 4RNFA 5I3UA 2F8HA 1GFWB 4KKOB 2B9WA 1OPZA 4ZVTB 3QFHA 3L09A 5J1NA 2GV1A 1H74A 5EX0A 3UN2A 5IC4B 2DGXA 5HJXA 2H5IB 3GLJA 5DS7A 4I56A 2HNZB 3CJQA 1P9YA 1OSDA 1IKWA 3T5KA 5IM0B 1D8ZA 4C48A 4F4YA 3I87A 4WFNQ 3RRHA 2F3JA 2NYHA 2FJAB 4HHJA 4K5RA 1ZZNA 1RWVB 3PO4A 4A8KA 1Y10A 4F4XA 3J81Y 1AYEA 2XI3A 5KFHA 1SKWA 3H59A 1M5PC 1JJHA 1R8BA 5G0RA 3KOAA 1Q95G 3EICA 2DY1A 4KGKA 4DPXA 1GX5A 1OJ4A 3J7ZT 2MSTA 1U1PA 1F9FA 1KBRA 2DJWA 2AW0A 4I4BA 3PVXA 4FXVA 1Q79A 2FC9A 4N8NA 2K8GA 1SKRA 2EFPA 1BGXT 4X4VA 3CJKA 1FEHA 1WSRA 4D3HA 3DRPA 4I67A 4HTJA 3N6NA 2E7XA 1HHQA 4ES3A 3LH2S 2MKSA 3DOKA 4PPZA 3I9ZA 1I51B 3OSPA 4F36A 3MFIA 1W25A 3KUEA 2ZD1B 2WOMA 3CCVS 2DISA 3Q8PB 1VQKS 1AUSL 4ED2A 4LSZB 4MT1A 1FVQA 3QJLA 2BV3A 3W5XA 3TZYA 2ZH8A 1FT8A 5HMYA 2B4UA 4WKYA 2VG5A 3V81A 2HHHF 1XN9A 5C25B 1IKVA 1DTTA 3HLUA 4DI6A 4IRCA 4ZPCA 4LSLB 2UVUA 2Q1LA 1ZPWX 1J27A 1WNEA 3G87A 4DQPA 1HI8A 4OJGA 1QAYA 4TLQA 4RW9A 2AWZA 3WX4A 1U26A 1WHYA 3I82A 4J9NA 3QGPA 2YWFA 3DHWC 3TJ8A 2H54B 4ELTA 4G1IA 4ZPVR 1X4BA 2UUBF 4ZP8A 4OZ0A 4J9SA 2R2SA 2XGPA 3PW7A 4M5DA 1RAEB 2ATCB 2F63A 1S99A 1H38A 3OV7A 3IG1A 3CWJA 4XK8C 1SQGA 3CULA 5HROA 1QUVA 1FWKA 2ZOMA 2YH1A 4IFYA 5CABA 3RU0A 2VOPA 1SC3B 1VQ8S 2QL9B 2DIVA 3UN3A 2XMKA 2QO3A 4DV1J 1Y5NB 3P8BB 2J9EA 4KRWA 2BJ9A 2QLFB 3DRRB 4M5MA 3V6DA 5LSLA 1IBLF 2QG9B 1T3NA 2AGOA 3UD5A 1Q8BA 4X2BA 3A8EA 4WXOA 5LSRA 1CG2A 3MPVA 1JLAA 4HI1A 2YNGB 2MZ1A 3M4XA 4AYBD 2QZ8A 2MKYA 3FSYA 1KS2A 3T1HF 1HHSA 3M8QA 1E6YA 1R31A 3DGPB 5KFYA 3NS5A 3VAFA 2VONA 3IAS9 1WC1A 2BE7D 2CQ1A 1YJTA 3PO5A 3JYTA 2WSFC 3QO9A 3OHBA 4OV6A 1RHQB 4ZVQB 3T19A 2HGMA 3D54A 5FDLB 3K8VA 4A48A 4RZRA 1OO0B 9RUBA 3BSOA 4DV7J 1C0UA 1YSJA 1SJFA 3KG4A 4F3QA 1EQMA 1C1BB 4C0OC 3CDUA 3D0HE 1PG5B 2VPZB 3AJDA 1H72C 1SJ1A 5JUMA 3R6LB 3EVWA 4UY8T 3CJ5A 1C2PA 4TQRA 2DY9A 4F0MA 3P6YC 2AIRB 5HK4A 2NZ4A 1K73T 4OHYA 2DCLA 3GB0A 3EJMA 3IWXA 2KXNB 3AAWB 2BACA 4FYDA 1P27B 3M2UB 4B3RF 1NCLA 4IOCQ 3SQOP 5DZ6A 2XMJA 5GAEU 3BN7A 3FEYB 1G6BA 1NB7A 1UL3A 1WF2A 2NPIA 2AQ4A 4I1TA 2ZWOA 4FZVA 3AB4B 3VGVA 1FNXH 2GQ2A 1ZM2A 2DYAA 1S7HA 3TJAA 4ECQA 3UVJA 1UVLA 2B9YA 5EDWA 4DL3A 3W9HA 2LA4A 4CO5A 3QWUA 1VRUA 2K7KA 4PG7A 4LRCA 2XCAA 3WX8A 3D66A 1P6TA 3RBZA 4PG8A 2ZH4A 3CD5A 3E01B 1KLMA 3MWBA 2OKQA 2AJFE 3NXZA 3C6TA 5KT6A 2FLLA 4F8RA 4DL7A 2MLZA 2F5GA 3THVA 3GG0A 3D0IE 4B02A 4ZP6A 2JRSA 3QSYB 5D3GB 3I9V9 1H73A 2QL7B 1GMUA 4PCQA 4C0BA 4NYOA 5K8PA 4H4MB 2HGNA 2R8HA 3M6VA 4FF4A 2KFYA 3KNGA 2F9JA 1N32F 2E9RX 3GJSB 4MK7A 4KFBA 2JWNA 4UOCA 3EPGA 4DV4F 2LEPA 3TRGA 3IBCB 1UW4A 2CJAA 4WPAA 3HO1A 3OR1B 2BOPA 4PWDB 5F41A 3U1LA 5IQQA 2HNYA 1HWIA 3NGSA 4QPXA 2B8PA 2D3ZA 4U6PA 2F9DA 3E51A 2AZ3A 3WHIA 1GAOA 5F8JA 3KLGB 2MZTA 5D4NA 4HL9A 3ICLA 3Q83A 3M8ZA 4J9KA 3PNIA 3QIPA 1KTQA 4ZP9A 1KONA 2MQOA 3MMCB 1PAUB 4TXSA 4MIAA 5AE2A 4NI2A 1R8CA 1UCNA 2W9BA 1APSA 4W98A 2VFVA 3AODA 4RW6B 4JI1J 3R6GB 5CXTA 2J9DA 1X8DA 2V8PA 1BE4A 2DR6A 1U0SA 3MMAB 3NCRA 5K8MA 3VAKA 3A1YG 4OLOA 1ZAWA 4DLGA 1NJWA 4WCEQ 4L73A 3I0RB 3DCAA 2HNDB 2EBEA 4PAAA 2O01C 2QIFA 2E5LF 2ZHBA 5IM0A 2MQMA 3JQKA 5D4LA 1VDHA 1JLCB 4B9VA 4OYXA 1UWBB 2D3OR 3ZZ0A 3GYGA 3MI7X 4ATNA 2XY5A 3ITHB 4X65J 2WVEA 4LFAJ 3MCSA 2ZDOA 1WC0A 4J9QA 2R7TA 1OYEA 5F9LA 2DO4A 1JB0C 2OD4A 1G7CB 4F4AA 1TFYA 4NLXA 1VC0A 2VF3A 4QIWD 5HSPA 1ACMB 1N48A 2V68A 2GFFA 1KFDA 4OI6A 3EE3A 3PW5A 4J90A 3K5PA 1YVFA 3NAIA 4B3OB 1V9OA 4J9LA 1U6FA 3BPDA 2R9LA 2Z8QA 4DSJA 4LF6F 3BBBA 4ED8A 2WBRA 2A0FB 1FRMA 1HHTP 4GKJJ 3E2EA 4DV2F 2L9DA 4ID8A 3CCZA 4IRDA 1RBAA 1V6HA 4MAKA 1RADB 3BEGB 4FPRA 2CKWA 4G1QB 1F3FA 1NDCA 2ZD1A 3DLJA 1OYDA 2RH3A 1RYRA 4ECWA 2KRBA 2HVEA 2V2ZA 4WBFA 5CAAA 1Q4RA 4YB7A 2ZH1A 3C3LA 4RUAA 1UVIA 1M1GA 3ILOA 4WIIA 4ELUA 5C25A 1D1UA 3LGMA 5C7PA 3ONQA 1U45A 5ETLA 3N28A 1S1TB 3QGIA 5EN1A 5A8WB 3BB5A 5ETKA 2XO6A 4OQJA 1UAWA 2L3MA 2EFVA 2C3YA 4I6WA 2DPJA 2VA3A 1A9NB 3R2DJ 4CIOA 1LK5A 2CRLA 4CTAB 3GJTB 3Q8QB 1ZZFA 3C16B 1A7GE 2E1PA 4ZVEA 4FVMA 2FB0A 3MEGB 4I2QB 1CJTB 2XTJP 3GFHA 2CFXA 3I5CA 1ITPA 3THTA 2W2MP 4L75A 4K4ZA 4JI5F 4WK1A 3GE9A 2FQQB 4R5PB 4EYIB 2FJDB 4EZ6A 2LVWA 1OPIA 4M1KA 4F4WA 1T0TV 2W2QP 3EM1A 1DY3A 3RB6A 2H48B 1RTHB 5BYRA 2D3O1 4NZ6A 2KVQE 4O3OA 1TK0A 1XMQJ 1KNZA 2JL9A 1FVSA 5KFXA 3D6MB 3MPWA 5EWEA 1J5OB 4FP9A 2G2YA 4FS1A 3HVTA 1JLQA 2HFSA 2YNGA 1RSCA 3RW7A 1VBZA 3MM5A 2C2ZB 1BLUA 4UZBA 2KDOA 1WF0A 4C3MA 2VC0A 3K5OA 3D0GE 3H2UB 4NYZA 2ZOGA 2KT2A 4IYQA 4YFUA 5F8NA 5GAGU 2CADA 4ED1A 1O6XA 4UT4A 1CVJA 2ZZMA 5FDLA 4XPEA 3N01A 2AJ0A 3EGWB 2PMZD 4JB8B 2VD3A 3RBXA 2DRAA 3MM7B 1VMBA 2GJFA 4MYTA 3GTYX 2QRRA 9ATCB 2MQ8A 1Z2ZA 4N47A 5KG4A 1TL3B 4PXDA 1DRZA 2E5IA 1FEEA 2GIQA 1ZS6A 2IM1A 3K17A 2DHSA 2HFZA 2ZFHA 5C5JA 2OMOA 1HNIA 3HP6A 4KSEB 3HHEA 5IZHA 2DRBA 3D68A 4QBUA 1PYOB 2UUAF 5IFMA 1ZM3A 2HLUA 2CQ4A 3UNGC 3F73A 2DB1A 1TUGB 4WFXA 3SBMA 4Y0FA 4OI1A 2DVIA 1X60A 3ZTRA 2KRRA 2BZ2A 3H4BA 1S1XA 3ZZUA 3MCOA 1TELA 4WE1A 2NR0A 2NSBA 1UVJA 2I1RA 3BGRB 5DLFA 2DGUA 3MUMP 4RNHA 3FQKA 4XTTA 3G6ES 4H54A 3CCMS 2VJUA 1LOUA 4USHA 1KHWA 4WYWA 4UW2A 2HHHJ 2ZM6F 1B7YB 3MCMA 2HVHA 3OPKA 1WWHA 5B08A 4V19X 3AQPA 3DDIA 2BE2B 5C2GA 3TQEA 3QGGA 2ABYA 3SV3A 3HF5A 2LU2A 2JVRA 4TYBA 3BQ2A 2BDPA 4AL5A 3ILIA 2CXEA 5D3GA 3TR5A 3MGJA 4K50A 2R42A 4ZVFA 2P5VA 5A8RB 1NJXA 1HNWF 4DV0F 2UUBJ 3OL8A 2CQPA 3VHQA 3GMGA 2UXCF 1LK7A 2ACMA 2HHUA 3BR8A 1RT1B 3MM8B 3ELHA 3US5A 4NXNF 4BLGA 2A2CA 4CLFA 3M6XA 5CQGA 2XSFA 3U02A 2MDAA 2B0GA 3OR1A 2MLXA 3PW0A 1IJFB 3JTOA 3HZGA 4OX9F 2APOA 1KTVA 4B3SF 4X4QA 2PEHA 3T9NA 3WBZA 2V67A 4DDFA 5KTQA 3KJVB 4OHZA 3B4MA 3H25A 1IBLJ 3IFEA 1MNEA 2LQBA 2G0CA 4QWBA 5GVQA 2K2PA 2DGTA 4QYRA 4XPCA 3NBPB 2V6AA 2E9ZA 2RIJA 4F2RA 3T1HJ 1R6YA 3SYZA 1SXLA 1LW0B 4TKTA 1YKWA 4NRTA 4EO8A 4DUYF 3TO8A 1WHVA 4HEA9 4ZHRA 1XNQF 4QZVB 2LQJA 3VVTA 1Y3KA 1DJ0A 2QE5A 3I0RA 4LR7A 2HNDA 1FKPB 3D7SB 4F4KA 1URRA 5LMNF 1PJ5A 5KG0A 3FZ2A 1JLFA 4ZCMA 4B9SA 3QLHB 2IIHA 4O23A 1UWBA 4BWMA 1T9UA 2RVJA 1N56A 3Q23A 2RKIB 1Y11A 4DS5A 2MY8A 1T11A 3SCKE 3MOJB 3RG6A 3VWSA 1TAUA 3CJSA 2M4MA 4PUOB 5HLFB 4LT6A 3GG1A 4JOUA 2WTFA 4F4ZA 2NCKL 2RD5C 4EBEA 4C0HA 3DLHA 2E9TA 2XNQA 2X7IA 4B3RJ 1LWXA 1NM2A 5GMEA 4X64F 2CDQA 3VAMA 1RTJB 2PEBA 5A0YA 2J0WA 4RWWA 3OD2A 3N5FA 4A8OA 3LQVA 4FBTA 2VUGA 4HH0A 4G3IA 3D9BA 5KFOA 2H4WB 1NO8A 5IC6B 5KT3A 1TL5A 1PGZA 1CJUA 3W64A 5KFAA 1YI2S 1GQEA 2WK4A 3V6HA 2X3DA 3W2WA 3G71S 2CQIA 3FMBA 4DS4A 4OZ1A 2AX1A 3GCWP 5J2MB 2IBKA 1S49A 4UUXA 2LXUA 1VBXA 2AYBA 4P6QA 3Q2SC 3A3OB 1CJVA 4ER8A 2XM3A 1BQMB 1U1LA 3VAGA 5F8LA 2FLPA 2CG8A 2AT1B 2NUUG 1VRTB 1M5VC 1DTQB 3ET6B 1K1SA 3W9IA 1T03B 4ED0A 1Y5LB 3RBEA 4CTAA 5KFDA 3TVZA 1U25A 4HKQA 1S48A 1YLXA 2H3EB 4KAIA 4M5HA 4PYAA 1N32J 4DQSA 1NNDA 3MMBA 2DCUB 4DV4J 5D4OA 5CYJA 5E3CA 2EW9A 2CVEA 4N8OA 1Y5IB 2H65B 2Q66A 1YJVA 4LF1A 2N4DA 3G96A 2HURA 4USMA 4F3OA 2OPRB 5H9FK 3D1HA 3DLEB 1UVMA 1FWLA 1NJZA 1WC5A 2NQPA 3CIZA 5D0GA 1NDPA 1NLKL 2W4CA 1TZ0A 4ICLB 2K3IA 1FWPA 3BO2A 4JP8A 1P8GA 5FLXU 3R5JB 2NXJA 2KG0A 4AXJA 3OXGA 4Y3CA 4Q0BB 3KHRA 1Y00A 2W9CB 3T41A 5L1JA 1U24A 2J76E 3PV8A 3V5RA 2NLWA 3BKFA 1RWMB 2QLXA 3R9LA 1SIZA 4J9UE 5KFKA 2GIRA 2LYVA 1L3KA 2W4PA 2W9AA 3TVYA 3IGVA 3VGSA 2YY3A 3K5MA 4CCHA 1LKZA 3MM6A 1S0NA 3FMWA 2QA4G 3U27A 4DZDA 1SQEA 1RHJB 3VQSA 3H2VE 1GMVA 2DK2A 2C42A 3JSMB 2Y8YA 3M8PB 5IS2A 1YIJS 3HPOA 2E5LJ 2HZCA 1AFJA 2PE8A 1AB8A 1HNXF 2DNMA 5DETA 4P73A 3NCQA 3SFGA 5DJBA 4FKYA 2ALZA 3NMAA 2IMOA 4B9MA 5ETSA 2LXFA 4WYLA 5KG3A 2ASLA 4MKVA 4OV1A 5EWGA 3ILJA 3WDOA 2KB2A 1CULB 5I42B 3AT1B 1TVRA 4DSFA 1JXEA 2A6OA 4F25A 3MAHA 4C11B 3ZXWA 2LEBA 1BY9A 1UKUA 1YJNS 2ZVIA 2VPWB 2WONA 4LF6J 2PMHA 3CMQA 1ZYQA 4IUFA 4BC7A 4H4KA 2W4DA 3OTBA 4DV2J 4CLLA 1EIYB 3OXFA 2M88A 3HHLD 1S5ZA 1CEZA 3LP1B 4DXLA 3KLHA 3FEZA 3VGTA 1YHQS 2CQCA 3J7YI 4ECRA 4K7QA 4DN9A 2GC8A 1UP1A 1AUDA 2L08A 5F0UA 5KT4A 1Q0NA 2Z58B 1HQEB 2OAUA 2ZUGA 3BGRA 3DRXA 2WW8A 2VA2A 3S7RA 1AZSB 4M5KA 1X4AA 3WIUA 3PM9A 3Q8UA 3H98A 1S6QB 2YWEA 3JB9k 4I7FA 1TMJA 2B4PA 1TP7A 3NNAA 3MUVP 3EXCX 1RA6A 1K1QA 2BKPA 2K1RB 2X1AA 3UR0A 2Z2LA 3HFVA 2QMXA 4EGLA 1EETA 1SL2A 2O1PA 1MLAA 2MJNA 4GMKA 2OP5A 1P1TA 2GHVC 2IJRA 1XJWB 2R7SA 4Y28C 1LFPA 4OYMA 3R7SB 3GV8B 3A4TA 1SH0A 3MM8A 2CPDA 4BC9A 1VQPS 4DQQA 1NK0A 4JI5J 2HPUA 3OL6A 3IGNA 4ERDA 1V5IB 2WHOA 2PC6A 3OJUA 2HIQA 5LSOA 1UPPA 3MEEA 1XQIA 1U1NA 2B9XA 2EBGA 4NASA 1QE1A 1LEOA 3OTEA 4DL6A 4Z37A 2XY6A 3AHPA 4TU7A 4P2FA 2KM8B 4DOZA 3CJ8A 4WU2A 3S6EA 4EUVA 3SIPB 3FFIB 1SVDA 2VIHA 3PEJA 1T02A 1F6TA 4ITSA 5HI7A 1RWPB 2CPEA 1QAIA 2KFZA 4CM0A 4QR0A 3NBPA 3OTDA 4DR6F 2DEJA 1XIQA 2M0GB 4LBIA 2OPSA 1HL6A 2C2KB 4YHHF 2C1EB 4K59A 2NYIA 2HSEB 1M5OC 4P7TA 4HACB 3CPWR 4FNHA 3FDSA 2R7VA 3DRSB 2CPYA 3W65A 2W25A 1S79A 3NS7B 5B09A 1FKPA 4F67A 1YG0A 1U49A 1MWZA 2ATLA 4OHWA 2RNEA 3IM8A 2NUHA 1KDNA 4Q45A 2EFQA 3CW2C 3FRZA 1WC6A 4RW7B 3MCNA 1PJ7A 1HBOB 2HVZA 4Y2CA 2Y1RI 2UUCF 4GO5X 3DC2A 5EX3A 3L95X 3H5YA 4PUOA 4FXDA 1IM6A 2W7AA 4QWAA 4I69A 2BM0A 4KHRA 1QUPA 4TY8B 5CYQB 5THWA 4ILRA 2YWKA 3C14A 3L7PA 4PXBA 2UUAJ 2AKWB 5IT0A 3R1HA 2VPXB 1X4HA 3L3CA 2GVDB 4DZ6A 3W2VA 2KJVA 1CJKB 2AYMA 2KHCA 3PIPQ 2OFGX 1MROB 2C2RA 1D8YA 3OVSA 3KDOA 1VLYA 4RUBA 4Y6IA 3IRXA 2VDHA 2DGQA 1NSAA 4I6AA 2ZM6J 2VBXA 2DGSA 4LIRA 2LA6A 4N77A 4A8MP 4WFYA 1R43A 2IY5B 2Y8WA 4MTPA 1KOHA 4CP5A 3BQ1A 2M70A 1KVJA 2IYGA 4LF7F 2DPIA 4M5LA 2ZH2A 3M32B 1VRTA 2DO0A 4RW8B 4RW4B 1TL7B 3G82B 2HRTA 4QPTA 3ET6A 2A1BA 4GC7A 1PJ6A 4JV0A 2FGCA 2FTRA 5HMZA 1T03A 5KT5A 4EMDA 3BSAA 4CDIA 2XHCA 1HNWJ 3P96A 4DV0J 3OR2B 5CHCB 2FZCB 5JVHQ 4CRJA 1HMVB 2UXCJ 3B8HA 4NXNJ 3K5LA 4AQYF 1RHRB 4C8YA 2W2NP 4KYZA 1FRHA 4YR3A 1Q86T 2AV5A 4OX9J 2PN6A 3T9ZA 4B3SJ 3H8YA 2OEKA 2V4JB 2OPRA 2VHGA 1RTDA 2HHQA 1JK9B 3A3NB 3C15B 4Q5VA 4K4WA 3S1TA 2D7SA 1N5YA 3CVKA 2B3TB 3KFWX 3H7HB 4KR0B 1TKZA 2XB2D 3PX0A 1IR1A 3GPAA 2FGOA 3BF4A 4IG3B 2YXLA 3T6JA 3T6BA 1CSJA 3VCDA 1JLEB 4AL7A 1GTHA 2ZVSA 1FJGF 4DX6A 3T3FA 1BQNA 2V4QA 5LOQA 5HN0A 2OPPB 2R7QA 2YX4A 2X1GA 4DUYJ 2M52A 3BDPA 1IVZA 4DSIA 3QJPA 7FD1A 1XNQJ 4QCLA 3SDEB 3N6MA 3AD7C 1F5CA 3P5TL 4ES1A 2VQEF 1R6VA 4DL5A 3GP9A 1NZ8A 2HQ3A 1KQGB 2V34A 5LMNJ 3BGLA 2PIIA 4LIWA 2ZJQQ 1HPZB 2JEGA 4NA3A 5SUHA 4KO0B 3UN5A 1UW9A 1CPZA 5BYQA 1KR4A 1VBKA 1HBNB 2YX7A 4X4SA 2IFXA 1X4CA 1F9EB 2VASA 1MW7A 5I42A 2CYYA 3RTVA 3DN9A 4X64J 2L9WA 4C11A 3LW5C 2YKNB 2Z4PA 3VAHA 2QSWA 3IS9B 1I3OB 3CJ4A 2DNPA 2XS2A 1B64A 1R8HA 4MIWA 4CO0A 2VFRA 3WC0A 4Y2IA 4NA1A 3LPYA 2AU0A 5F8MA 2AGQA 4IR1A 2M5YA 2HBRB 1FXRA 2L9NA 1FRXA 5BR8F 2HZVA 4IO1A 1D9AA 3I55S 2LECA 2ASJA 1KFSA 4IRKA 2G9OA 3CO0P 3NRBA 4OFZA 4A8XA 4IDKB 4LF5F 3LAKA 4DR2F 1K0TA 3M2RA 2VC1A 4R8UB 1S9EB 3UDLA 1S4FA 3AFGA 3NGUA 2SXLA 3PG9A 1RT3B 3EDQB 3M8WA 1KLNA 3J81j 1NU4A 3ZTSA 1HQUB 4N56A 4R25A 1SI9A 3LP0B 3VV2B 3FCWA 2K1RA 3TX0A 3PIOQ 2R8IA 2MQLA 5U47A 2ZKUA 3FBCA 2BJ1A 3ISNC 1PIEA 4EEYA 1U8WA 1AW0A 1H98A 1O5JA 5BXIA 3MR5A 4RL1A 4K2JA 4YR2A 4AFFA 2IC3B 4HI2A 2N7CA 3EXYA 4DQRA 4KT0C 1T9WA 5KFTA 1Q8IA 4A8WA 1TUWA 4Y34A 1Q7LB 1SL0A 2HAIA 2KN4A 3L7OA 4NLRA 3OVAA 2W24A 7FDRA 1BWVA 3MUTP 3V6KA 2KH9A 2EC0A 2BW7A 4O3QA 4ZS6A 4CNYA 4TN2A 5DGBA 2IHR1 2W1BA 4RWXA 2AHOB 4DR4F 1F1BB 1IBKF 4KB7A 3K2YA 1N4LA 1RGVA 4P9SA 1PBUA 4DV5F 2VG7B 4IKAA 3M30B 3IO1A 2P2CB 2CWKA 2HVIA 1T8EA 3M8SA 1KC8T 3RR8A 2EFOA 2LQ8A 2YQ0A 5A6WA 4DV6F 5A2QY 5HQMA 3CJ0A 1WG4A 1RAGB 3BZQA 1RT6B 5LL6d 3NWRA 4KH0B 4Y2MA 4ECTA 4B9UA 3L9ZA 1M5KC 4ZLLA 1S1WA 1KN6A 2B9EA 1T95A 5KFLA 2MSSA 2BANA 3CGIA 3ISZA 4QOTA 2ADCA 2M9KA 3TX8A 3H90A 1T3OA 1RAAB 5AE3A 4HACA 3RZAA 1HQ2A 2X51A 2HS3A 2OPQB 2DHXA 3GZ7A 2F8EX 2KFNA 4ZPTR 1NPPA 3IP0A 1HNXJ 1MMLA 2J0QD 3IC1A 1IUJA 1U2RA 2DXEA 3CO9A 5AT1B 4K4VA 3EMTA 4O44B 4OZLA 1JIHA 3HKWA 1HLWA 1NSQA 3SSQA 3TANA 5E41A 3P3DA 2NXUA 4RW7A 4MYUA 3BPSP 4CH0S 2A3JA 3GIRA 1HBOA 1H7XA 2ZBQA 5F3TA 4Q7AA 3NP5A 4CH1A 3KLVA 1D0EA 5RUBA 1UEVA 4R0EA 4X84A 2C22A 4QW8A 3JXOA 1GT8A 5CYQA 3DMJA 1U1RA 1WI6A 4WZMA 4P75A 3PFOA 2XLJA 2Z56B 3TZXA 3MPDA 2XMUA 1XMBA 5A76A 2RJZA 1CJKA 3L4BC 1P9QC 3NAHA 1NHKL 2E44A 2HIYA 1QVGR 3C66A 1MROA 2E7VA 3DRYA 4M94A 4YOEA 1REVA 2ZKTA 2NXCA 2FHMA 3HSJA 1W26A 3KLIB 3W9JA 4IQMA 5KG5A 3W1YC 5HBMB 4ANEA 3OW2R 4YS2A 2NZCA 4J9RA 3CF5Q 2VDIA 2GCFA 2UVRA 1IKYB 4OHXA 1KQFB 3KHHA 3LA0A 5K14B 2FZKB 1UPMB 3LWMA 1RTIA 2RS8A 3M32A 4RW8A 1TL7A 2RHSB 2HK2A 5KFJA 2HK3A 4C98A 1QVFR 2WSCC 2JOQA 4J37A 3BH6B 1FTRA 3MR2A 2ASYA 2BRKA 1H6KX 3OR2A 4CI0B 1JKHB 2IVYA 2E5HA 1T05B 4OMFG 1R89A 2YQ3A 3QYYA 2YKMB 1FE4A 2N4CA 1NPRA 5KFRA 4ZPDA 1GXLA 1R8AA 2R2UA 2XWXA 3IR5B 3BGOP 2LCWA 1U1KA 4JV1A 1V5VA 4M5GA 4O0IA 4NXMF 2JEFA 3CCES 1U1QA 1Q53A 1S9GA 3M8RA 1S77D 4GKKF 1NJYA 3F56A 1NH8A 2DNZA 4I6YA 2V8GA 1RWKB 3C6UB 2M2BA 3TUIC 2N82B 2BQUA 2J8SA 5J1EB 4DR6J 4L3NA 3VGUA 1JLEA 1QSSA 1TKXB 4DG1B 2NREA 1X9WA 2IM2A 2QMUB 2XEXA 4DCOB 3HJVA 1FDNA 1YRTA 4YHHJ 3GWCA 2B6AB 1N8RT 1R0AB 1BQXA 1SH2A 4O3NA 1WC4A 2AZ1A 3OUYB 3SDEA 4B9TA 5L39A 4ZCIA 1SUQB 2QEXS 1BWEA 2DXDA 4LSNA 4P72A 4TQSA 1S6PA 3P5BP 2FY8A 1YBUA 2ZZNA 4OYOA 1D9DA 2C3UA 3QRPA 4O4RA 1HPZA 2DR9A 1BHNA 2XHWA 1WKJA 1RWOB 3R97A 2I9SA 1EKRA 2J7KA 4ECSA 3EDRB 3QT8A 2UUCJ 3NG8A 2H1YA 4XDCA 2NXEA 3DLGA 5IQ6A 1BMQB 3EUNA 2F1FA 4KPYA 2MKJA 3IS9A 5K8OA 1RT4B 5M2RA 3LP2B 1FTCA 3DU5A 1X4DA 2ZWPA 1C1CB 4NWBA 4USVA 5HVGA 2D9OA 4P52A 2MXYA 3R5DA 2M3DA 3IM9A 2ZJPQ 4QW9A 1WDDA 4R0JA 3E3XA 3MECB 4ZP7A 2DIUA 5MAOA 2OTLS 2ADBA 5DM7Q 4IR9A 3PXGa 5KFPA 1ZPVA 2WRMA 2XLKA 1IWAA 2OHDA 5ETTA 1C0TB 3RRGA 1XMOF 4R8UA 7AT1B 3FCHA 1IWGA 2QMWA 4N7TA 4G6VB 2NXNA 1RT3A 3ZZPA 3GSIA 2VBWA 4LF7J 1S57A 5DO2A 1HQUA 1HI1A 1VQ5S 5AXLA 4EWTA 1KSPA 3BYPA 3JTNA 1LV5A 2XS7A 1ZAXA 3G4SS 5KFFA 4Y00A 2BYCA 1RKJA 3R5CA 3OBIA 3X1LB 1YRXA 4JYAF 3M6UA 1R7IA 4I2PB 4CWBA 4DL4A 2UUTA 2KTQA 2IC3A 2EG1A 1N88A 2X1FA 1VQSA 3QT7A 2AYEA 1FD8A 2ROEA 3D4JA 2DR5A 1VIXA 4AQYJ 4O3PA 4U7UD 3KJQB 3KHLA 5T7LB 3JSBA 2A6MA 5F8GA 3JSRA 3RAXA 2CPZA 1PC4A 2HHPA 1J5EF 1F9HA 3W5ZA 3S8SA 1N54B 4W90B 3DYAA 5KFQA 3T5HA 2HBZB 1HBUB 3D1QA 2CJ9A 3DI6B 5H1SV 3EVOA 4ID5B 2GJIA 4PZVA 2DTJA 3RAQA 2VG7A 1FK9B 3NGDA 2I2YA 1URNA 2N7YA 4ZKAA 5HP1A 2MPUA 2KU7A 4NZ7A 2C2OB 2C2NA 2WB4A 1GNKA 5EUHA 1EX8A 1V3RA 4IG0B 1N33F 1O0PA 4PABA 2IVFB 1Z2LA 1FJGJ 2P6SA 4IFVB 3CT9A 1TKTB 4WKRA 1AT1B 1FO1A 2FJVA 4XO0A 4Q43A 4MJKA 4OZ2A 4XIUA 5IWAF 2H4YB 3MURP 2ZNZA 3M7VA 2VQEJ 4L3KA 1IBMF 2OPQA 5B0DA 4OYZA 3LGNA 4HH1A 3V4MA 5LXRA 1GMWD 3RB3A 2PFFB 5A8KB 1DQAA 2HHTA 1MN7A 4ZLPA 4JUZA 2DHHA 2KXHA 2C2MB 3B54A 1RWUA 4KGMA 2DBBA 4NLOA 4ZVRB 4RUHA 4O44A 3M1VA 3N5BA 5J2QA 2CJXB 2MQNA 2EFGA 2LMIA 1UJ4A 1LFWA 4QYZK 4I68A 1TL1A 1UVNA 2IAJB 2XNRA 5M2PA 4DQIA 1FESA 3HFZB 1X9SA 1OMSA 2XULA 5J1PA 2CZ4A 2G0JA 1RQ0A 4DUZF 1SJ4P 3FCVA 2UXDF 4LBPA 3W61A 1EB0A 2HZAA 3CMES 2I5JA 1YGYA 2J9DE 3Q24A 3AJ1A 2JNJA 2YWGA 3T1YF 4RBTA 5BR8J 5GAEI 1T9XA 4MKYA 2HYIB 2QA1A 1W2IA 2ZITA 5DG8A 3L7UA 3UI3A 4CO3A 1UJ5A 2V2VA 3HVAA 2IPOB 4LF5J 2XS5A 2LKZA 5F8IA 2J7WA 4DR2J 1U02A 4DEZA 2JFDA 5HBMA 2LQ9A 2QFIA 1SKSA 1CS4B 3UD3P 2Q6BA 2G2OA 1RLCL 2KT5A 1FKOB 1GTEA 3TZWA 2FUG9 3TAMB 3CCUS 3DFEA 1U47A 3IBWA 4LUBA 3CTRA 4G1PA 4P2SA 4RU2A 3LUYA 3QT5A 3FC9A 2QJ3A 3QIDA 3CJ2A 3EVMA 2JJ4D 4IH6A 2BKOA 3C2PA 4KC5A 1UEKA 2VG6A 4K4SA 1ZBTA 2HHXA 4NL5A 3BGUA 3F41A 1W2BR 1JKHA 1Q81T 2B5JB 4ZLJA 3MD1A 2CQHA 1T05A 3D5MA 2YKMA 1VFJA 4UOGA 1VHFA 3PYFA 4DMZA 5CH7B 2KZZA 4K4YA 2W2PP 3R1LA 1WACA 2CNNB 4ZVUB 1HBMA 4DR4J 1IBKJ 4YB5A 2J7UA 4KHPF 2KYZA 3M2VA 3SSRA 4DV5J 4P74A 5KG6A 3ZZOA 4CO1A 2WBMA 2PA3A 4TY9A 3SSSA 3PW4A 1RA7A 4DV6J 1H2TZ 1UFWA 3JQMA 2DNYA 1PYTA 1RT5B 2BBEA 4S0MA 3OSNA 4NCGB 4WFAQ 4TYAA 5SZTA 1M0SA 4QWDA 3TA0A 4B08A 3V4IB 5F8HA 3DU6A 2UXBF 1OY9A 3U7JA 3QZ8A 8RUCA 5I3UB 1Q5VA 3MPUB 1PAEX 2B6AA 1RI7A 1R0AA 2C3PA 1VYAA 3TVKA 3GJQB 3OUYA 2I38A 2BJDA 2QLJB 4WP8A 4P7VA 5CYMA 3QZ7A 5B0FA 3MEDA 2FC8A 3G86A 1JXVA 2QYGA 3W62A 4WFBQ 1LWFB 1SV5B 4ZIVA 3RBDA 3A12A 1S0VA 2WCXA 3UNYA 5DQHA 3PCOB 1ZTWA 1NKCA 2GW8A 3DDKA 4J7CA 1FRLA 4X4PA 2C3MA 1KHVA 3PKMA 5G0RB 5I3PA 4CQ1A 3VR1A 4PG6A 2OEMA 3PRDA 2RDIA 1NUEA 1ZETA 2QX0A 2VPYB 5AE1A 3ZC4A 4EO6A 1RB0A 3K7RA 1N0VC 5E3QA 2LXIA 4IO9Q 2U1AA 1XK8A 1RT4A 3LP2A 3O5TB 1C1CA 2ZH5A 4DF4A 2JDJA 1EP4B 3PR4A 4KKOA 1YJUA 3VQTA 2B51A 4U8YA 1FXLA 4U67Q 3MXHP 3QRQA 3KNAA 3G2XA 2ZJRQ 3TEHB 2DR7A 3QAEA 3JSYA 1MN9A 3FBBA 3I96A 3MECA 5KG2A 5KFUA 2GQCA 2WOMB 2HNZA 4IH5A 2IM0A 1MU2B 1LWEB 1TV6B 4H4OB 4DV3F 4GRSA 2V2QA 2B4OA 3D6FB 3BKUA 2O66A 3LAMA 1NJIT 1QAXA 2PGCA 1IKVB 1KP6A 3FSIA 2D1CA 2O67A 4ED3A 2PDAA 3DLKB 3MAQA 4M8LA 3BDEA 3ETMA 1FRKA 2HW3A 4USKA 3H42A 2JEJA 2H5JB 2EK6A 4NLDA 2KKHA 1YRUA 4RW9B 1L5UA 3GFXA 5E2QA 4A46A 4I2PA 1IQTA 4QIVA 3CIMA 1SC4B 2CPIA 2D41A 2V8HA 3CCRS 1VCTA 4B3TF 4PRFA 5T7LA 4XAKA 4X62F 4G65A 4NXMJ 4X4OA 4DR3F 1WKKA 2AEFA 2LU1A 2CIMA 5HROB 2LDYA 1Q8LA 3CNQP 3OFFA 4ZDNA 1EARA 2Z57B 5DG9A 4GVLA 2F7VA 4GKKJ 5JVGQ 3I6PA 2JC0A 4IFYB 3DXSX 1DHMA 5HVFA 3DI6A 2EI5A 1Y3JA 4ID5A 4LFCF 4B17A 5G4DA 1P1LA 4B9NA 2QV6A 1HYSB 1VQNS 3EGNA 4LSLA 4EBCA 4IQXA 3G9CA 1X9MA 4OYWA 4DLEA 2Y0BB 2CQ0A 4USWA 2FYXA 1XNRF 3IWNC 3KUGA 2PI4A 3T1AA 6FD1A 2ROPA 2Y1LB 2CZVC 1E6YB 1SIWB 3TAPA 2VL1A 5KFSA 1UA1A 3F0NA 5K8NA 3BQ0A 3AA8A 1HR0F 2DGOA 1H2VZ 3QO9B 2V63A 3MHYA 3SCLE 4NOHA 2ZH3A 5H9EK 5A8KA 1S12A 2OUGA 4M63A 4U96A 2W7OA 2BX6A 4TNOA 2HFUA 1XERA 4ETZA 3KK1B 2LQ5A 1X0PA 2DHGA 2G4BA 2N3OA 4TVAB 1U48A 4GC6A 3HMJG 5DQGA 3HSDA 4C9DA 3GCXP 1UZHA 1N36F 1F2GA 3OQ2A 5KG7A 1E6VB 2AEMA 3DRRA 4RKUC 4NA2A 2RRAA 4NCAA 3ZZZA 2RF2B 5ETRA 5DRKA 2EC2A 4DCJB 4ILLA 2MZJA 1S59A 3B82A 3K58A 4L6V3 5AJ3F 3N79A 4C3LA 4QQBA 4LF2A 2CQGA 2KYXA 4DFPA 4NLSA 5D8HB 3DGPA 1B0PA 1EJ7L 3MZIA 1RWNB 1WSVA 4ZVPB 3LALA 3KG1A 2CA9A 1WUUA 1FF2A 2HQFA 1U2CA 2YTCA 4ZK7M 3FZBA 5KFIA 1YJ7A 1LW2B 1DURA 3UD4P 3FBFA 1XMOJ 4OYPA 1T9YA 2DNNA 4RNMA 1C1BA 3SXLA 2BJ7A 1U1OA 3QAUA 4AT1B 4HDGA 2RB7A 4U7CA 1FKOA 3HVRA 4KGVB 3SMZA 3HULA 4K4UA 1CC7A 4DU7A 1S6OA 5ETPA 2GO8A 4CT9A 3DOLB 4EK2A 2KZMA 3D67A 1FDBA 3TZZA 5L9NA 3KK2B 3AXMA 4JYAJ 1GMWA 3G6YA 3M2UA 4BWJA 1F2HA 2PA8D 2YVSA 1WEXA 3KJFB 4P71A 1HIYA 3SCJE 6FDRA 2B43A 1FDDA 2B5JA 1BUXA 1N0UA 5C24B 2DXFA 4RUCA 2FZGB 4C7QA 4UF4A 1YDLA 1J5EJ 4RNNA 4HHHA 2XZWA 3MAAB 2XLIA 3IR7B 4Q8FA 3ADAC 5DDPC 4MK9A 4FDFA 1WHXA 2HNYB 2EFNA 1TR0A 3V2UC 4NMXA 3GQCA 2GA7A 3GR0A 4LQ9A 2OLWA 4ZN3A 1JLBB 3E01A 2HWIA 1BXNA 3Q0AA 2AF6A 4P2XA 2OH2A 1N33J 2A18A 4LVNP 2YX1A 3MD3A 4NCGA 4NI2B 1OIAA 1U1MA 1B4SA 4C97A 1FKAF 2XYHB 3V4IA 1RACB 2CJBA 3H5XA 4DPWA 1N52B 3HK2A 3BN4A 5I4MA 4Y65A 5IT9Y 3CJTA 3HDSA 4H4MA 2ZUAA 5IWAJ 2JSXA 4URSA 4F7VA 1NZAA 2IDEA 1IBMJ 3WIVA 2BQRA 1UVKA 5B0AA 1WJ9A 5KFVA 3WZ0A 4YEAA 1U0HB 1NK9A 1KVKA 2RE1A 5CCLA 3J80Y 1VLOA 5I3QA 1LWFA 1MWQA 1RWXB 4EFAC 4PWDA 1YZ7A 1SV5A 2RMLA 2WVBA 2YNHB 3QT6A 1DBDA 3BV8A 2MJUA 2K7JA 1HWLA 1REGX 1GK8A 2FJXA 2HEKA 1FI4A 1EHWA 3KLGA 2DH8A 3OTOF 1X5OA 3UDCA 3DHXA 4F0HA 2V9KA 5A2QU 2CWXA 2RRNA 5KFBA 2BMBA 2DNGA 1T9VA 3MMCA 3MFHA 4O3SA 3R5GA 1EZZB 4DUZJ 2C2EA 2UXDJ 4RW6A 2YKAA 1NK4A 2F4VF 2N3LA 3QNWB 1WKLA 1VR6A 1G2EA 1KD1T 4F2SA 3MMAA 2CNOB 5BYSA 3T1YJ 1QSYA 1EP4A 1SKUB 1WORA 2V8VA 1VQLS 2BW2A 3AA9A 4M5NA 1FA0A 1HARA 1PKUA 5DDOC 2DHAA 1S6UA 2GZOA 4U8VA 1VHIA 1WOOA 1NK5A 3BM7A 5CD4A 1MU2A 1YZ6A 2D3UA 4QWEA 1LWEA 1TV6A 4H4OA 1JLCA 2J8AA 4H4KC 5HO4A 3ITHA 1YBAA 4ETXA 4JV5F 1VISA 3QBCA 2HFNA 4WP9A 2CPHA 1X4GA 1PSDA 3DLKA 2RHQB 2P6TA 2GHPA 2VKRA 4U9RA 5L1IA 1M90T 4DR5F 4B3OA 4FNIA 4J9VA 1PYSB 4NZ0A 1NRKA 3F44A 4I0WA 4IH7A 2JLFA 2VQFF 1RKIA 1HFEL 3G6VA 2MKKA 3AJ2A 4RR5A 4YY3F 3UE2A 2RU9A 5IXUA 1CBKA 4AUKA 4HR2A 4G1QA 1AXQA 1UMJA 2WZ1A 4JBCA 4HDHA 4KHPJ 3NOCA 1OY6A 1T94A 2WVDA 2BM1A 5IV4A 3PYEA 4MMOA 4JI7F 2IJNA 2KT3A 1HYSA 3JAMU 1HA1A 2RS2A 3HT3A 4PXCA 4YQWA 4CT8A 3FQLA 1S1TA 2HRYA 4LQ3A 5A8WA 4NLQA 4JI3F 1Q16B 3OTCA 4MH8A 3QRRA 1R0CB 2UXBJ 5LXYA 3CD0A 3HVTB 2V9WA 4J5OA 2BKNA 1JLQB 3EWGA 3TW0A 3G8TA 3PJ9A 1NHVA 1CQMA 5B7WA 4K5SA 3MM5B 4NLGA 3C16A 5D6GA 3W5YA 5CZVA 3MEGA 3A3PB 3DXBA 4I2QA 3RB4A 1N5QA 1CJTA 1VS3A 3PW2A 2LEAA 4KHMA 2GAGC 4KY3A 4YB6A 2WB1D 3NNHA 4R5PA 1JJCB 2W01A 2YQ1A 1RAOA 1QY7A 1JNRB 4WTYA 3I5BA 5L9XA 3HHKA 4J9OA 4K0KF 4J9MA 2OJ3A 3KK1A 4OI3A 5KOWA 1RTHA 1RABB 3FK4A 1RHUB 3M9MB 4NX9A 3H5SA 2P9GA 3RRKA 4C3KA 3M8YA 2MY7A 4QU6A 1VRQC 5D0RA 3NGRA 4DJBA 3ZFVA 4ZVOB 1E6VA 1UA0A 3MDFA 2RF2A 4RJVA 1J5OA 4MKAA 1JWWA 1Y4ZB 2CPXA 2FDNA 4ECYA 1HNIB 2YKQA 4Q8EA 3O1LA 1VK3A 3MF5A 2W2OP 1YBTA 1SJQA 1EKSA 1TU0B 3GYNA 2HS0A 4ES2A 2HFVA 3ENWA 4NPOA 2ZE2B 3O2IA 5B0EA 1S1XB 2XZDB 3KLFB 4HTIA 4WE1B 1LW2A 3H20A 2RT3A 4AXIA 6AT1B 1S0OA 4DV3J 3MM7A 5HATA 4DR7F 4DPTA 5GAHI 1WF1A 2KO1A 4N41A 1FCAA 4URQU 1KQKA 1VI7A 5FJ4A 1TL3A 2C2DA 3W60A 4LVOP 5JJBA 3DGVA 4AL6A 2W7PA 3M6WA 4WZQA 5H9FJ 5EWFA 4QU7A 3NL0A 3DOLA 2QL5B 3IR6B 4FF2A 4I64A 5LT5A 1HI0P 3BO4A 3AB2B 3KK2A 1JNZB 3Q8SB 3DLLQ 3R27A 3D2WA 2LFVA 2ACYA 3SQGB 2JX2A 4LF9F 1NPKA 4Z7CA 2OSRA 5B0GA 3IBFB 2BABA 5MLCV 3OVBA 4B3TJ 1C4AA 4X62J 5KG1A 5C24A 1WG1A 2DT9A 5L38A 3EYZA 1I5OB 4DR1F 2DRDA 4DR3J 2RUSA 3MAAA 1D3WA 3SZ2A 2OGUA 3PX4A 4A47A 1L3SA 1VQ6S 4YDXA 4OX6A 4YP3A 3Q8VA 1RISA 2Z2MA 1JJ2R 3PDNA 3R5AA 1Z1ZA 2CQBA 2FHOB 1IJEB 2VJVA 5KFZA 4LFCJ 1G1XA 4USJC 2G2ZA 1JLBA 3IWLA 5A6PA 2FY1A 1S9FA 2BE2A 1WD6A 3V6JA 1MG7A 2L48A 1SJRA 5B0CA 1NK7A 3RB0A 1XNRJ 3BSCA 4OI2A 2RSQA 2ILYA 4NLVA 2R8KA 3EGZA 2KVIA 1WHWA 3VVUA 5A8RA 2YKOA 3CC2S 3W8GA 4QIFA 1HNVB 1HR0J 2GGPB 5E7OB 2VB6A 3P4UB 1VJQA 1Y0HA 1RT1A 4ZHRB 2JFKA 1RAJA 4F02A 1U0HA 1JJ4A 1SCJB 2AMCB 1S1VB 3CCWA 3J7AN 5L8RC 2YNHA 2QC3A 1WTFA 3VF0B 1JLFB 1R3NA 1PO6A 2DNKA 2YWWA 4DL0C 3ENQA 3CCLS 3ZZYA 4JI6F 1N36J 3BREA 3KJVA 3MOZA 4DUTA 5AXNA 4DSLA 2MZRA 4DF8A 2HS4A 3DOMB 1VC5A 4Y2KA 4ED7A 1L3VA 3NS6A 4A8YA 3ZTPA 1SC1B 4ZPBA 4FYYB 2K3KA 4UOHA 1DQ9A 5AJ3J 3H40A 3NCPA 1R8PA 4FF3A 4CLUA 4CNZA 5A0YB 3IA0A 2CQDA 1LW0A 2CQ2A 3FUYA 3PJWA 3CC7S 4EI2A 5LJ3Y 1IKXB 1RJJA 2W8LA 1V3SA 1FJ7A 4NEYA 1CJUB 2RU3A 3PKYA 1OWXA 2KXFA 3EZ5A 4GVBB 3W2WB 1KEKA 2W8KA 2XO7A 2BJEA 2HWHA 3KUHA 1C4CA 3ETOA 1NH7A 4JI0F 5GADI 4C8LA 4QIGA 2FJWA 2K06A 3QLHA 4ZA1A 1EQ0A 2NSCA 2HHSA 2OTJS 2RKIA 1RLDA 1CJVB 1N5TA 3ZNJ1 4PR6A 1N5SA 4MIBA 2YNIB 4HT5A 3OFGA 2YH0A 1FERA 1S10A 3TUPA 4WJBA 5HLFA 2J5AA 4O0NA 2HHWA 4PQUB 3R3TA 1QLNA 3OL9A 2HMIB 2E7WA 2UV8A 3AOCA 4FBUA 3PYDA 2CNKB 4CO4A 3KYLA 2J6UA 1RTJA 1XR7A 3QATA 1JX4A 1UETA 4ILMA 3TQ1A 3C46A 3EGVA 2R8JA 5J2NB 3MMBB 1WDTA 1RT7B 1X7VA 1X5SA 4YUDA 3UWTA 1VQ4S 1JXLA 1ZH5A 4K8RA 3VZIA 2VZ9A 5C2CA 2ZC3A 4C8KA 1F5AA 3HJFA 1RE1B 5J2MA 2MGZB 3ZTQA 4ZCLA 3ENAA 2X3GA 1SJ3P 3R7NB 3C19A 4JI8F 3LANA 4WU3A 3CCSS 4OHVA 1OY8A 4ZPAA 1TMMA 3NKYA 1BQMA 2ALYB 1FRIA 3CSKA 2AD9A 4KTQA 5E3PA 1VIOA 2VFTA 1X31C 1UWAA 2Y1JA 2FHJD 1DTQA 3DLBA 4DX7A 1M1HA 3O6QA 1Q5YA 1K0VA 2VFUA 1HWKA 3UQSA 4N5SA 3FGVA 4JI4F 5K5MA 4O3RA 4WXWA 3MM6B 2JHEA 4X66F 2KM8C 3HD1A 2BE9B 4FF1A 2V2KA 1OSCA 1FX4A 2YKPA 1SBRA 3GJRB 3CXCR 2XMWA 3ILLA 4KBIA 3HHLC 1AA1B 4RBUA 1O8BA 3FKBA 1FFSB 3DLEA 2X1BA 1FFGB 2G0IA 1OS5A 1A6LA 4ICLA 5FIIA 2ZBPA 1F5BA 3OTOJ 4ZLNA 1R0BG 2CJYB 1G3OA 4AD6A 4Q0BA 1WOSA 2W9CA 1RAFB 1X4FA 4LRBA 1FXDA 1TTHB 2E1MC 2H9ZA 3Q22A 2ZBRA 5L1KA 1TVRB 4TLRA 4PXEA 2XI2A 2F4VJ 1LXNA 3DNCA 1PILA 2WONB 3W7BA 4YMEA 3VAIA 1IBCB 1Q82T 2UUWA 2YNFB 2B7CB 1QDUB 2V0NA 3OLBA 5KAKA 5D78A 2I0XA 3CDWA 4UTGA 3KLHB 2WW4A 1SQFA 5KFNA 4MFBB 3JSMA 2ZE2A 2FLNA 1S0MA 3M8PA 1Q1KA 3KLFA 1HD1A 4L72B 4OJHA 3MTJA 4DU8A 5DGAA 4E0DA 3PEHA 1Y7PA 4WWSA 2FD2A 4ECUA 3AH6A 2DITA 2XSJB 5AXKA 1QAJA 1FNMA 1ZM4A 2LDIA 3EZOA 3CDEA 2P9CA 4JV5J 3OXLA 4C2MA 2FVRA 2KG1A 4I7FB 3EZUA 4A8FA 3HSGA 2AJ2A 2DGVA 4C6AA 3I5AA 4BCAA 1N6QB 3NMRA 1CULA 2GMJA 3TAQA 3N0VA 4DR5J 4DFJA 4Z7YA 4KGXB 2O3DA 3HFKA 2L41A 2G1HA 2CJKA 4EYHB 2CAJA 4PWWA 2XG8A 1EETB 2MHEA 3SQGA 1XTZA 2VQFJ 3U1NA 3QQCD 2EWHA 1J2VA 4OJ3A 3DDNA 2DKOB 2UU9F 2Z30B 4CO2A 4YY3J 2BJ8A 3LP1A 4LRDA 5CZXA 3HKZD 4A8SA 3S01A 2QA2A 3TA2A 1U6BA 5E3AA 1H0HB 2RQCA 2B7BB 2ZHAA 3R7BB 4EZ9A 1RAHB 1Z4UA 2QYCA 2E29A 3NY0A 3KMSA 3MEEB 1HQEA 2RAQA 1RCOB 1AZSA 4USIA 1QE1B 3VALA 4IOBA 1RHKB 5LMUF 4KV8B 1RT2B 3QMQA 4JI7J 2GNKA 3CCJS 1S6QA 1Q78A 2J6TA 2R4FA 2GAHC 2ZZTA 2KI2A 2MB0B 2HWTA 4JI3J 2UVWA 2A2DA 1GEHA 2AJ4A 5E0OA 4X4NA 3LF0A 4ZJLA 3NNCA 3TA1A 1U6ZA 1YX2A 2F8MA 5K9FA 2MKIA 2OPSB 1FJEB 3RJMB 3H4DA 1HNVA 5DZ7A 2GGPA 2E1CA 4J91A 1WEZA 2AJQA 1WI8A 3D3CJ 2EKNA 3IMQJ 3KXDA 1S1VA 2ZBIA 2R3VA 3AY0A 4K0KJ 3I32A 4AE5A 4TU9A 1NEEA 3Q2TC 5AXMA 4NLYA 1NMEB 2XY7A 1UFLA 2FLOA 2HHVA 2ZDPA 4ALZA 3WC2A 2MQPA 2E1RA 3FFIA 3GV7B 1HNZF 2V8DA 3PTWA 2WSEC 3QPIA 3GIIA 4WP3A 3DOMA 1H2UX 1WC3A 3D28A 4FVCA 4W92B 2EEYA 3OHAA 3PHTA 2AYGA 3MPYA 1NBEB 1GH8A 2FJEB 2HRUA 1QD1A 4UQGA 2GO9A 2XZTB 4M5IA 2E1AA 2FIUA 2IRYA 3C14B 2DNLA 2R7WA 3MTKA 2JLEA 1S7IA 1BD6A 1DAXA 2V4RA 2PT0A 5CA5A 3W2VB 2GMHA 1IKXA 2XYPB 2EXUA 2IJFA 2CG4A 3FRYA 3DRSA 4F04B 4NLUA 3NGKA 3ENVA 4GVBA 1TAQA 2JC1A 1IM4A 3IRXB 4DR7J 2CQ3A 2NS1B 1F0XA 4Y2AA 1I1GA 2BOAA 1N34F 1D9FA 1U4BA 4BS2A 1QSLA 2GVZB 4RNOA 1VBYA 3IAM9 1GX6A 1UZDA 3CDAA 3DM2B 4DL2A 2YNIA 1NKEA 3QGHA 1VQ7S 3SEOA 4LF8F 3TARA 4PQUA 1DZ5A 1UFKA 2HMIA 4F26A 1RHMB 4ECXA 3QFWA 4DFMA 4HVZA 4TY8A 3HX9A 4DSEA 1QTMA 4LF9J 3GV5B 2MMYA 1RWWB 4A4JA 2NPFA 4C4WA 4OYAA 2GVDA 5J2NA 5DM6Q 4HHUA 4C8MA 1B7FA 3THPA 1RT7A 1ZOTA 4DWIA 3CEDA 2Z0GA 4NMLA 4DR1J 1TQLA 4DBQA 8ATCB 2LLZA 1ZA1B 2V69A 3UCUP 2MTLA 4M95A 1KRPA 2CNLB 1LQ9A 1RAIB 5HMWA 1RTDB 2MGZA 4X4UA 3CJRA 4WK3A 3I56S 1XR6A 3E8OA 2V5HG 4Q2MA 2Y0SD 3NEKA 2GHWA 2C3OA 4ZJOA 1FJCA 1ROFA 3FJ2A 4X4TA 1N5YB 2IMWP 4OYIA 3JAMY 1DFDA 3U1MA 4LJMA 4M5JA 2IBOA 1TKZB 2RRBA 2CUYA 3P45B 2GJ2A 3FNNA 4MK8A 1MMDA 4RW4A 1I94F 1CC8A 4LF4F 3G82A 4NLTA 1PBAA 1MWYA 2OEJA 4L74A 1B0VA 5D0HA 1BQNB 1VGYA 2PI5A 3HVWA 4ZOSA 3P49B 3C8YA 1HMVA 4OZ5A 2VKZG 4K4XA 2DR8A 4OX8A 2VU5A 3GONA 3BR9A 4DSKA 2Z2YB 3A8IA 4GO7X 3G6XA 1AFIA 4LRAA 1BC6A 1I6JA 5ETVA 2AEJA 3PHEA 2R2TA 1RDRA 2V4JA 2D74B 4UUWA 2DD8S 2AX0A 2DEIA 4JI6J 4N76A 3C15A 3PJXA 4ANDA 4UOFA 1YTYA 4A8QA 3M9NB 2DH9A 4YR0A 4ECZA 2XMAA 4F50A 1QM9A 1RUSA 3UDEA 2VH7A 4XDDA 1D09B 2OMLA 4CLSA 1PC5A 4IG3A 4PKDB 1S4EA 2PD1A 2WAQD 4LMZA 3T5LA 5IT9U 2OPPA 2YNFA 2FVPA 2VBZA 2ZBCA 5HL7Q 2Q79A 5T41A 1FE0A 2FJBB 1ZM9A 4ANCA 4MFBA 3I4PA 3OLAA 2IVMA 2ZEJA 3J80U 1WG5A 4YN3B 5GAHU 4JI0J 1NK8A 4RU9A 4ZIWA 2LP4A 3OFHA 3CD7A 3RAMA 3QSIA 1KVIA 2FHJA 1YITS 2Q3PA 3M2RB 4LRFA 5KFWA 2DNOA 4KO0A 2XSJA 2JEIA 3ZZRA 5HQLA 3D3BJ 3LO3A 3J81U 2GIFA 3ZNUA 1HBNA 4ZPWR 2B4VA 2Y1IA 3GR1A 1N6QA 5F0WA 4USTA 3HM9A 4Z2XA 3X3UA 4TU8A 3BGFA 4DPOA 5DLGA 2YKNA 2CPFA 2JH3A 1TK5A 1SB6A 1JQGA 3NLCA 5KFEA 2VICA 5BJRA 1EAYC 1K9MT 3M9OB 5KFCA 3J7YU 3IXQA 1FDAA 4CLWA 4DPYA 3ZTOA 3I0SB 1WELA 2MKHA 5JMNA 3PX6A 3M05A 3UDVA 2XQCA 4W4MA 5IT4A 4IDKA 3N9UC 5HANA 4JI8J 3TUJC 1S1UB 3ZZTA 2DNHA 1DLOB 1RP5A 2ZH6A 3H0PA 1IR2A 1S9EA 1RT2A 4KV8A 1H3DA 2AP6A 1CLFA 4ZVSB 3MR7A 3RUBL 4O4GB 3LP0A 2IYIA 2ASDA 3HHLB 2RQKA 3TNVA 5ETOA 4ELVA 1S1WB 1JLGB 1HD0A 5K20B 4JI4J 4LR8A 1LNQA 2BANB 4X66J 2MKCA 3BBFA 2GMLA 3POTB 4B3MF 3GYXB 3K8WA 3FEXB 4ED6A 1RZMA 3D6HB 3CMAS 4PG4A 2VFSA 2QLBB 4CYUB 2OO4A 5IOLA 3K57A 3GIMA 2G1DA 2QSFA 3UO0A 1A0OB 3FSXA 4OLPA 1HWJA 1YK9A 1QTNB 1FFWB 3TI0A 3JS9A 4LFBF 1YJWS 1MMNA 2HGLA 3D6TB 2R7OA 1R27B 4U7UK 3LPEA 3M30A 3W3SA 5ADZA 5C42B 2BVZA 3ISND 4CLPA 4HYKA 2PFDA 3LOUA 2FVQA 3SV4A 1RT6A 1RBOB 1IR0A 2HG4A 3A13A 2OIHA 2E5GA 4V19J 3HT0A 2IM3A 2WVCA 2Q6CA 3N6LA 3J7A1 2XC9A 2P8IA 2DH7A 2YPYA 3MMJA 3DMJB 4ZVGA 4JI2F 5KFMA 3H2LA 4IOAQ 4JV2A 1K44A 5HQ8A 3FVYA 1ZAVA 1NKBA 4NLWA 3BS9A 3AOBA
chains in the Genus database with same CATH topology
5ETQA 3UD5A 1RAOA 1IM6A 4AD6A 1TMMA 1RTZA 2BMBA 3HSZA 3UDVA 4PZVA 1EQ0A 3KUEA 1KBRA 3MCNA 3ILOA 2F65A 5ETOA 3UDEA 3HT0A 4F7VA 4M5JA 3HD2A 2QX0A 3ILJA 1F9HA 1HKAA 3KUHA 1HQ2A 5ETPA 5ETMA 3QBCA 4M5IA 1DY3A 2CG8A 3KUGA 3HCXA 3ILLA 3MCOA 1EQMA 4M5LA 5ETRA 4M5MA 5ETSA 5ETVA 1RU1A 3MCMA 3ILIA 5ETLA 4M5NA 4CYUA 1Q0NA 1CBKA 4CYUB 4M5GA 4M5HA 1RB0A 5ETNA 4CRJA 3HD1A 1TMJA 1G4CA 1EX8A 5ETTA 3HSDA 3IP0A 2F63A 5ETKA 4CWBA 1RU2A 3HSGA 3HSJA 4M5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETQ A;  3UD5 A;  1RAO A;  1IM6 A;  4AD6 A;  1TMM A;  1RTZ A;  2BMB A;  3HSZ A;  3UDV A;  4PZV A;  1EQ0 A;  3KUE A;  1KBR A;  3MCN A;  3ILO A;  2F65 A;  5ETO A;  3UDE A;  3HT0 A;  4F7V A;  4M5J A;  3HD2 A;  2QX0 A;  3ILJ A;  1F9H A;  1HKA A;  3KUH A;  1HQ2 A;  5ETP A;  5ETM A;  3QBC A;  4M5I A;  1DY3 A;  2CG8 A;  3KUG A;  3HCX A;  3ILL A;  3MCO A;  1EQM A;  4M5L A;  5ETR A;  4M5M A;  5ETS A;  5ETV A;  1RU1 A;  3MCM A;  3ILI A;  5ETL A;  4M5N A;  4CYU A;  1Q0N A;  1CBK A;  4CYU B;  4M5G A;  4M5H A;  1RB0 A;  5ETN A;  4CRJ A;  3HD1 A;  1TMJ A;  1G4C A;  1EX8 A;  5ETT A;  3HSD A;  3IP0 A;  2F63 A;  5ETK A;  4CWB A;  1RU2 A;  3HSG A;  3HSJ A;  4M5K A; 
#chains in the Genus database with same CATH topology
 1TL4 A;  1RBL A;  3KHG A;  3BSN A;  4CLZ A;  2WVF A;  2UVV A;  3OFE A;  2ZOF A;  4URG A;  5GAD U;  1V3Z A;  2ZNY A;  1REV B;  2MYF A;  3B78 A;  1ZTT A;  3UW1 A;  4F3M A;  4KGZ B;  2FVS A;  4FYX B;  1GXU A;  4ZMM A;  1FX2 A;  2I6W A;  1M5H A;  3AOA A;  3BJY A;  3Q89 A;  3IN5 A;  2GVZ A;  1U09 A;  3HSZ A;  4C8O A;  3JQJ A;  2A10 A;  5EGY A;  3DM2 A;  1DQ8 A;  1B0T A;  1U7L A;  3PY8 A;  3PAC A;  1RTI B;  4BDP A;  3KLE B;  5JXS A;  3AD8 C;  2MEW A;  1B3T A;  3CC4 S;  4C8Z A;  4F0K A;  2J0X A;  5T14 A;  3J7Z 5;  2PMW A;  2FHK A;  4LR9 A;  3IRW P;  3KMQ A;  4OYB A;  1WTB A;  1SH3 A;  3HCX A;  4CLY A;  3O3L A;  1YJ9 S;  4ZIT A;  2UU9 J;  2J6S A;  2E66 A;  3BBC A;  1L3U A;  2IA0 A;  1W7W A;  3BO3 A;  2FVC A;  4UZC A;  3OL7 A;  1HKA A;  2HBY B;  1KWM A;  2BRL A;  3GSD A;  5LM7 E;  1FNO A;  4RO0 A;  4FS2 A;  4DX8 H;  3G8S A;  3KLI A;  3AXK A;  1RTZ A;  3KK3 B;  4QJV A;  1S9G B;  5LMU J;  2ZHO A;  8AT1 B;  4K2X A;  2XCP A;  1IKY A;  3UPF A;  3R2C J;  1VQY A;  2EKY A;  2HKE A;  1X5P A;  5J2P B;  1WOP A;  5K14 A;  4QR2 A;  3CD6 S;  2QT7 A;  2Z2Z A;  2HVD A;  3K59 A;  4J9P A;  1ARO P;  3R5B A;  3OT9 A;  4NYP A;  3PZP A;  2F4F A;  2EG2 A;  1L3T A;  3GFY A;  4P10 A;  1VQ9 S;  3A8J A;  1F3V A;  3OJS A;  4QYZ J;  5GMD A;  4NRU A;  1T9T A;  4DCP B;  4OI0 A;  2V50 A;  2D9P A;  1H7W A;  1LXJ A;  2QA4 S;  2HLT A;  2R7U A;  5L46 A;  3VAJ A;  2AGP A;  4WFZ A;  3CJ3 A;  3KDN A;  2GQQ A;  3JTP A;  2RQM A;  3GIJ A;  1DAR A;  3MM9 B;  4LSN B;  1S6P B;  1RU1 A;  3BKT A;  2YWH A;  3TYT A;  3O44 A;  4RX6 A;  1X5T A;  2IRX A;  1S97 A;  3K89 A;  2F40 A;  1HWU A;  4BHQ A;  3GIK A;  1VK8 A;  4CM2 A;  3Q8Y A;  1XBW A;  2PO4 A;  1HW9 A;  3DKD A;  4KE5 A;  2GS8 A;  1B70 B;  2RQ4 A;  5E33 A;  1HNZ J;  1Q8K A;  3C6U A;  1G4C A;  1NSP A;  1MSW D;  3A8K A;  4ZCK A;  1LWC B;  4DV1 F;  4RPF A;  2H5E A;  2XMT A;  1NHU A;  4OJ1 A;  3CUN A;  2OEL A;  1TFW A;  4NE9 C;  1VC6 A;  1K8A T;  4V1A k;  3LWL A;  2ZC4 A;  3DLG B;  1YJR A;  5J1E A;  1TKX A;  3LGH A;  4DG1 A;  3VTI A;  3UR3 C;  3MR3 A;  2BQ3 A;  2XMM A;  3KTQ A;  2QTW A;  3PR5 B;  3K0J A;  3QJJ A;  3VZH A;  2XWY A;  1PCA A;  1SUQ A;  2KL8 A;  1NAQ A;  5HJY A;  3HHN B;  5D77 A;  3MR6 A;  2MZS A;  4NCB A;  2RDJ A;  4YDD B;  2VOO A;  1IKW B;  4FXW A;  2I8E A;  1K47 A;  1N34 J;  4DV7 F;  2YPZ A;  3NOG A;  2YBV A;  5DDQ C;  3R8Y A;  1IN0 A;  3AD9 C;  3CCT A;  1M1K T;  5DG7 A;  5LJ5 Y;  2EPI A;  1VJW A;  5F9N A;  3Q86 A;  4ZJQ A;  1O51 A;  1RU2 A;  4LF8 J;  2VV5 A;  4RBV A;  2MZQ A;  4K4T A;  1T7P A;  4UY8 5;  2POK A;  4OZN A;  3GIL A;  1SC6 A;  5ETM A;  2EVZ A;  1NDK A;  4C8N A;  3CJK B;  2OD6 A;  4OL8 A;  4DHV A;  2KHD A;  3DRP B;  3K5N A;  1OQ6 A;  3BH7 B;  2ERR A;  1NSK L;  5D4P A;  4MKB A;  4QWC A;  4DN0 A;  2M7S A;  3RGI A;  2CZ9 A;  3DOK B;  4PEO A;  3I0S A;  2GX8 A;  1KOO A;  2P9E A;  2IRU A;  2RIL A;  2OSQ A;  4QIE A;  4B9L A;  5HVH A;  3SFU A;  1SL1 A;  1F60 B;  3DYA B;  3B6B A;  1C0T A;  1UJ6 A;  5L1L A;  1S1U A;  4WIQ A;  1DLO A;  2MHN A;  1KKH A;  2VG5 B;  2AJ1 A;  3V81 B;  5HP1 B;  2DNQ A;  2HQC A;  1NXI A;  2V94 A;  5B0B A;  1DTT B;  4O4G A;  2QGF B;  5FD1 A;  1I94 J;  4PPD A;  4LF4 J;  3HHL A;  2R7R A;  2Y3Y A;  1VQM S;  3KJN B;  4E8U A;  2UV8 G;  1RK8 A;  2Y9H A;  3KWM A;  5D15 A;  3RYL A;  3TEG A;  1JLG A;  5KOX A;  4FPI A;  2B56 A;  1B99 A;  2QN6 B;  3POT A;  5HMX A;  5ITH A;  1XC9 A;  4P2M A;  1N5V A;  1NB2 A;  3HXM A;  3PYG A;  3LTO A;  4ED5 A;  4U95 A;  3W66 A;  1X4E A;  4KQZ A;  4CYU A;  3KG0 A;  5KT7 A;  4KPC A;  4M5D B;  2BUN A;  2O5D A;  3IG1 B;  4OZ3 A;  3PFE A;  4L76 A;  2BXJ A;  4ENO A;  2UP1 A;  1HBU A;  2IDL A;  3M1V B;  5J2Q B;  1FK9 A;  1YQH A;  1Y9O A;  2R2R A;  3T5J A;  2H51 B;  3W8P A;  5EHH A;  5C42 A;  3KKF A;  2J0S D;  1TL1 B;  4ZVH A;  3V6D B;  4ECV A;  3H5U A;  5DDR C;  4IG0 A;  1NDL A;  3PRB A;  1M5S A;  3CDB A;  5DQI A;  2COL A;  3GFZ A;  4IFV A;  2VBY A;  4ZN1 A;  3Q8R B;  2HQG A;  1JLA B;  4USU A;  4CLT A;  1TKT A;  3UCG A;  4FYW B;  2ZH7 A;  5F3Z A;  4JI1 F;  3M8Q B;  2I5J B;  2RDD A;  3TWZ A;  1WEY A;  3RW6 A;  4WF9 Q;  3ZO7 A;  4CH7 A;  4FKX A;  4HT7 A;  1ICE B;  3JYT B;  1S72 S;  2XYG B;  1GXT A;  3AQO A;  4UQT A;  1TK8 A;  2HQD A;  4CZC A;  5KT2 A;  4PYD A;  5GAG I;  5D0E A;  5CCM A;  1HW8 A;  3FBE A;  1C0U B;  1ZA2 B;  2UZA A;  2B8Q A;  3NGT A;  2ROG A;  1U8S A;  3RR7 A;  5GMK a;  3HHD A;  2DGW A;  4KJI A;  3TP2 A;  4PG5 A;  2CPJ A;  1ELO A;  4NEZ A;  3TJ9 A;  1IXK A;  1KQS R;  4X65 F;  4LFA F;  3SI8 A;  1OQ3 A;  2IAJ A;  3CE8 A;  4KH1 B;  1UEU A;  3KLE A;  2CJQ A;  2J9C A;  1CQN A;  2HFO A;  1VOM A;  2F65 A;  1QJH A;  1TUV A;  2QFJ A;  3MEK A;  2VG6 B;  4BBY A;  1RXO B;  1S76 D;  2EK1 A;  2ZH9 A;  3UFC X;  3I4H X;  3TUZ C;  2D69 A;  3BYR A;  3I31 A;  3TOQ A;  3GU0 A;  1Q7Y T;  4GKJ F;  2JVO A;  2OI2 A;  2M8D B;  4OI4 A;  2U2F A;  4QR1 A;  5KFG A;  3B4D A;  2HBQ B;  1NK6 A;  1FHT A;  2XBP A;  3D1O A;  3UVJ B;  4OZJ A;  4NLP A;  1HBM B;  2G13 A;  4RLE A;  4DFK A;  3KK3 A;  1XEZ A;  1VRU B;  3M2V B;  2IA6 A;  4CLK A;  1CS4 A;  3SCI E;  3EPI A;  1IQZ A;  1X0F A;  5FLX Y;  4HLB A;  2ILZ A;  5H9E J;  3QWP A;  5J2P A;  2RUG A;  3TAM A;  1KLM B;  4FYV B;  3EX7 B;  3C6T B;  2Q43 A;  2MLY A;  3HZE A;  5M2U A;  2XMV A;  4FN5 A;  2OFH X;  2VOD A;  2XGQ A;  3O8W A;  3WQP A;  1VQO S;  4B3M J;  1ULR A;  4PQA A;  1RYS A;  4LBH A;  2JLG A;  3PRV A;  4E98 A;  3UCZ P;  2R7X A;  5E3R A;  1FRJ A;  5IV3 A;  1JMT A;  4Q44 A;  2KJW A;  1XR5 A;  3G8Q A;  4Q2L A;  4KFB B;  5CYM B;  5CD4 H;  1XWL A;  4DPU A;  2JZ5 A;  3MED B;  4E2F B;  4WTO B;  4PWU A;  2MQQ A;  3N4W A;  3MM9 A;  3HI9 A;  3CCQ S;  1U2F A;  2BA9 A;  1SPB P;  4LFB J;  5E5N A;  5HAO A;  2M8H A;  4EU0 A;  2CVI A;  4OX7 A;  4KIA A;  2HQI A;  3HD2 A;  1YWX A;  4ED4 A;  1UTA A;  2HAF A;  2QLW A;  2C28 A;  3NWG A;  4YB1 P;  2FPH X;  3ULH A;  2DNR A;  5ETN A;  2BEF A;  2E5J A;  4LRE A;  1XMQ F;  2PSZ A;  1LWC A;  3W63 A;  3QIP B;  1RT5 A;  1FD2 A;  4D3G A;  4EBD A;  2R8G A;  1RCX B;  4DX5 A;  3CB4 A;  1TKD A;  2CDR B;  2W9B B;  4JI2 J;  4OIX A;  5ETQ A;  4X4R A;  2BJ3 A;  2BR0 A;  4RNF A;  5I3U A;  2F8H A;  1GFW B;  4KKO B;  2B9W A;  1OPZ A;  4ZVT B;  3QFH A;  3L09 A;  5J1N A;  2GV1 A;  1H74 A;  5EX0 A;  3UN2 A;  5IC4 B;  2DGX A;  5HJX A;  2H5I B;  3GLJ A;  5DS7 A;  4I56 A;  2HNZ B;  3CJQ A;  1P9Y A;  1OSD A;  1IKW A;  3T5K A;  5IM0 B;  1D8Z A;  4C48 A;  4F4Y A;  3I87 A;  4WFN Q;  3RRH A;  2F3J A;  2NYH A;  2FJA B;  4HHJ A;  4K5R A;  1ZZN A;  1RWV B;  3PO4 A;  4A8K A;  1Y10 A;  4F4X A;  3J81 Y;  1AYE A;  2XI3 A;  5KFH A;  1SKW A;  3H59 A;  1M5P C;  1JJH A;  1R8B A;  5G0R A;  3KOA A;  1Q95 G;  3EIC A;  2DY1 A;  4KGK A;  4DPX A;  1GX5 A;  1OJ4 A;  3J7Z T;  2MST A;  1U1P A;  1F9F A;  1KBR A;  2DJW A;  2AW0 A;  4I4B A;  3PVX A;  4FXV A;  1Q79 A;  2FC9 A;  4N8N A;  2K8G A;  1SKR A;  2EFP A;  1BGX T;  4X4V A;  3CJK A;  1FEH A;  1WSR A;  4D3H A;  3DRP A;  4I67 A;  4HTJ A;  3N6N A;  2E7X A;  1HHQ A;  4ES3 A;  3LH2 S;  2MKS A;  3DOK A;  4PPZ A;  3I9Z A;  1I51 B;  3OSP A;  4F36 A;  3MFI A;  1W25 A;  3KUE A;  2ZD1 B;  2WOM A;  3CCV S;  2DIS A;  3Q8P B;  1VQK S;  1AUS L;  4ED2 A;  4LSZ B;  4MT1 A;  1FVQ A;  3QJL A;  2BV3 A;  3W5X A;  3TZY A;  2ZH8 A;  1FT8 A;  5HMY A;  2B4U A;  4WKY A;  2VG5 A;  3V81 A;  2HHH F;  1XN9 A;  5C25 B;  1IKV A;  1DTT A;  3HLU A;  4DI6 A;  4IRC A;  4ZPC A;  4LSL B;  2UVU A;  2Q1L A;  1ZPW X;  1J27 A;  1WNE A;  3G87 A;  4DQP A;  1HI8 A;  4OJG A;  1QAY A;  4TLQ A;  4RW9 A;  2AWZ A;  3WX4 A;  1U26 A;  1WHY A;  3I82 A;  4J9N A;  3QGP A;  2YWF A;  3DHW C;  3TJ8 A;  2H54 B;  4ELT A;  4G1I A;  4ZPV R;  1X4B A;  2UUB F;  4ZP8 A;  4OZ0 A;  4J9S A;  2R2S A;  2XGP A;  3PW7 A;  4M5D A;  1RAE B;  2ATC B;  2F63 A;  1S99 A;  1H38 A;  3OV7 A;  3IG1 A;  3CWJ A;  4XK8 C;  1SQG A;  3CUL A;  5HRO A;  1QUV A;  1FWK A;  2ZOM A;  2YH1 A;  4IFY A;  5CAB A;  3RU0 A;  2VOP A;  1SC3 B;  1VQ8 S;  2QL9 B;  2DIV A;  3UN3 A;  2XMK A;  2QO3 A;  4DV1 J;  1Y5N B;  3P8B B;  2J9E A;  4KRW A;  2BJ9 A;  2QLF B;  3DRR B;  4M5M A;  3V6D A;  5LSL A;  1IBL F;  2QG9 B;  1T3N A;  2AGO A;  3UD5 A;  1Q8B A;  4X2B A;  3A8E A;  4WXO A;  5LSR A;  1CG2 A;  3MPV A;  1JLA A;  4HI1 A;  2YNG B;  2MZ1 A;  3M4X A;  4AYB D;  2QZ8 A;  2MKY A;  3FSY A;  1KS2 A;  3T1H F;  1HHS A;  3M8Q A;  1E6Y A;  1R31 A;  3DGP B;  5KFY A;  3NS5 A;  3VAF A;  2VON A;  3IAS 9;  1WC1 A;  2BE7 D;  2CQ1 A;  1YJT A;  3PO5 A;  3JYT A;  2WSF C;  3QO9 A;  3OHB A;  4OV6 A;  1RHQ B;  4ZVQ B;  3T19 A;  2HGM A;  3D54 A;  5FDL B;  3K8V A;  4A48 A;  4RZR A;  1OO0 B;  9RUB A;  3BSO A;  4DV7 J;  1C0U A;  1YSJ A;  1SJF A;  3KG4 A;  4F3Q A;  1EQM A;  1C1B B;  4C0O C;  3CDU A;  3D0H E;  1PG5 B;  2VPZ B;  3AJD A;  1H72 C;  1SJ1 A;  5JUM A;  3R6L B;  3EVW A;  4UY8 T;  3CJ5 A;  1C2P A;  4TQR A;  2DY9 A;  4F0M A;  3P6Y C;  2AIR B;  5HK4 A;  2NZ4 A;  1K73 T;  4OHY A;  2DCL A;  3GB0 A;  3EJM A;  3IWX A;  2KXN B;  3AAW B;  2BAC A;  4FYD A;  1P27 B;  3M2U B;  4B3R F;  1NCL A;  4IOC Q;  3SQO P;  5DZ6 A;  2XMJ A;  5GAE U;  3BN7 A;  3FEY B;  1G6B A;  1NB7 A;  1UL3 A;  1WF2 A;  2NPI A;  2AQ4 A;  4I1T A;  2ZWO A;  4FZV A;  3AB4 B;  3VGV A;  1FNX H;  2GQ2 A;  1ZM2 A;  2DYA A;  1S7H A;  3TJA A;  4ECQ A;  3UVJ A;  1UVL A;  2B9Y A;  5EDW A;  4DL3 A;  3W9H A;  2LA4 A;  4CO5 A;  3QWU A;  1VRU A;  2K7K A;  4PG7 A;  4LRC A;  2XCA A;  3WX8 A;  3D66 A;  1P6T A;  3RBZ A;  4PG8 A;  2ZH4 A;  3CD5 A;  3E01 B;  1KLM A;  3MWB A;  2OKQ A;  2AJF E;  3NXZ A;  3C6T A;  5KT6 A;  2FLL A;  4F8R A;  4DL7 A;  2MLZ A;  2F5G A;  3THV A;  3GG0 A;  3D0I E;  4B02 A;  4ZP6 A;  2JRS A;  3QSY B;  5D3G B;  3I9V 9;  1H73 A;  2QL7 B;  1GMU A;  4PCQ A;  4C0B A;  4NYO A;  5K8P A;  4H4M B;  2HGN A;  2R8H A;  3M6V A;  4FF4 A;  2KFY A;  3KNG A;  2F9J A;  1N32 F;  2E9R X;  3GJS B;  4MK7 A;  4KFB A;  2JWN A;  4UOC A;  3EPG A;  4DV4 F;  2LEP A;  3TRG A;  3IBC B;  1UW4 A;  2CJA A;  4WPA A;  3HO1 A;  3OR1 B;  2BOP A;  4PWD B;  5F41 A;  3U1L A;  5IQQ A;  2HNY A;  1HWI A;  3NGS A;  4QPX A;  2B8P A;  2D3Z A;  4U6P A;  2F9D A;  3E51 A;  2AZ3 A;  3WHI A;  1GAO A;  5F8J A;  3KLG B;  2MZT A;  5D4N A;  4HL9 A;  3ICL A;  3Q83 A;  3M8Z A;  4J9K A;  3PNI A;  3QIP A;  1KTQ A;  4ZP9 A;  1KON A;  2MQO A;  3MMC B;  1PAU B;  4TXS A;  4MIA A;  5AE2 A;  4NI2 A;  1R8C A;  1UCN A;  2W9B A;  1APS A;  4W98 A;  2VFV A;  3AOD A;  4RW6 B;  4JI1 J;  3R6G B;  5CXT A;  2J9D A;  1X8D A;  2V8P A;  1BE4 A;  2DR6 A;  1U0S A;  3MMA B;  3NCR A;  5K8M A;  3VAK A;  3A1Y G;  4OLO A;  1ZAW A;  4DLG A;  1NJW A;  4WCE Q;  4L73 A;  3I0R B;  3DCA A;  2HND B;  2EBE A;  4PAA A;  2O01 C;  2QIF A;  2E5L F;  2ZHB A;  5IM0 A;  2MQM A;  3JQK A;  5D4L A;  1VDH A;  1JLC B;  4B9V A;  4OYX A;  1UWB B;  2D3O R;  3ZZ0 A;  3GYG A;  3MI7 X;  4ATN A;  2XY5 A;  3ITH B;  4X65 J;  2WVE A;  4LFA J;  3MCS A;  2ZDO A;  1WC0 A;  4J9Q A;  2R7T A;  1OYE A;  5F9L A;  2DO4 A;  1JB0 C;  2OD4 A;  1G7C B;  4F4A A;  1TFY A;  4NLX A;  1VC0 A;  2VF3 A;  4QIW D;  5HSP A;  1ACM B;  1N48 A;  2V68 A;  2GFF A;  1KFD A;  4OI6 A;  3EE3 A;  3PW5 A;  4J90 A;  3K5P A;  1YVF A;  3NAI A;  4B3O B;  1V9O A;  4J9L A;  1U6F A;  3BPD A;  2R9L A;  2Z8Q A;  4DSJ A;  4LF6 F;  3BBB A;  4ED8 A;  2WBR A;  2A0F B;  1FRM A;  1HHT P;  4GKJ J;  3E2E A;  4DV2 F;  2L9D A;  4ID8 A;  3CCZ A;  4IRD A;  1RBA A;  1V6H A;  4MAK A;  1RAD B;  3BEG B;  4FPR A;  2CKW A;  4G1Q B;  1F3F A;  1NDC A;  2ZD1 A;  3DLJ A;  1OYD A;  2RH3 A;  1RYR A;  4ECW A;  2KRB A;  2HVE A;  2V2Z A;  4WBF A;  5CAA A;  1Q4R A;  4YB7 A;  2ZH1 A;  3C3L A;  4RUA A;  1UVI A;  1M1G A;  3ILO A;  4WII A;  4ELU A;  5C25 A;  1D1U A;  3LGM A;  5C7P A;  3ONQ A;  1U45 A;  5ETL A;  3N28 A;  1S1T B;  3QGI A;  5EN1 A;  5A8W B;  3BB5 A;  5ETK A;  2XO6 A;  4OQJ A;  1UAW A;  2L3M A;  2EFV A;  2C3Y A;  4I6W A;  2DPJ A;  2VA3 A;  1A9N B;  3R2D J;  4CIO A;  1LK5 A;  2CRL A;  4CTA B;  3GJT B;  3Q8Q B;  1ZZF A;  3C16 B;  1A7G E;  2E1P A;  4ZVE A;  4FVM A;  2FB0 A;  3MEG B;  4I2Q B;  1CJT B;  2XTJ P;  3GFH A;  2CFX A;  3I5C A;  1ITP A;  3THT A;  2W2M P;  4L75 A;  4K4Z A;  4JI5 F;  4WK1 A;  3GE9 A;  2FQQ B;  4R5P B;  4EYI B;  2FJD B;  4EZ6 A;  2LVW A;  1OPI A;  4M1K A;  4F4W A;  1T0T V;  2W2Q P;  3EM1 A;  1DY3 A;  3RB6 A;  2H48 B;  1RTH B;  5BYR A;  2D3O 1;  4NZ6 A;  2KVQ E;  4O3O A;  1TK0 A;  1XMQ J;  1KNZ A;  2JL9 A;  1FVS A;  5KFX A;  3D6M B;  3MPW A;  5EWE A;  1J5O B;  4FP9 A;  2G2Y A;  4FS1 A;  3HVT A;  1JLQ A;  2HFS A;  2YNG A;  1RSC A;  3RW7 A;  1VBZ A;  3MM5 A;  2C2Z B;  1BLU A;  4UZB A;  2KDO A;  1WF0 A;  4C3M A;  2VC0 A;  3K5O A;  3D0G E;  3H2U B;  4NYZ A;  2ZOG A;  2KT2 A;  4IYQ A;  4YFU A;  5F8N A;  5GAG U;  2CAD A;  4ED1 A;  1O6X A;  4UT4 A;  1CVJ A;  2ZZM A;  5FDL A;  4XPE A;  3N01 A;  2AJ0 A;  3EGW B;  2PMZ D;  4JB8 B;  2VD3 A;  3RBX A;  2DRA A;  3MM7 B;  1VMB A;  2GJF A;  4MYT A;  3GTY X;  2QRR A;  9ATC B;  2MQ8 A;  1Z2Z A;  4N47 A;  5KG4 A;  1TL3 B;  4PXD A;  1DRZ A;  2E5I A;  1FEE A;  2GIQ A;  1ZS6 A;  2IM1 A;  3K17 A;  2DHS A;  2HFZ A;  2ZFH A;  5C5J A;  2OMO A;  1HNI A;  3HP6 A;  4KSE B;  3HHE A;  5IZH A;  2DRB A;  3D68 A;  4QBU A;  1PYO B;  2UUA F;  5IFM A;  1ZM3 A;  2HLU A;  2CQ4 A;  3UNG C;  3F73 A;  2DB1 A;  1TUG B;  4WFX A;  3SBM A;  4Y0F A;  4OI1 A;  2DVI A;  1X60 A;  3ZTR A;  2KRR A;  2BZ2 A;  3H4B A;  1S1X A;  3ZZU A;  3MCO A;  1TEL A;  4WE1 A;  2NR0 A;  2NSB A;  1UVJ A;  2I1R A;  3BGR B;  5DLF A;  2DGU A;  3MUM P;  4RNH A;  3FQK A;  4XTT A;  3G6E S;  4H54 A;  3CCM S;  2VJU A;  1LOU A;  4USH A;  1KHW A;  4WYW A;  4UW2 A;  2HHH J;  2ZM6 F;  1B7Y B;  3MCM A;  2HVH A;  3OPK A;  1WWH A;  5B08 A;  4V19 X;  3AQP A;  3DDI A;  2BE2 B;  5C2G A;  3TQE A;  3QGG A;  2ABY A;  3SV3 A;  3HF5 A;  2LU2 A;  2JVR A;  4TYB A;  3BQ2 A;  2BDP A;  4AL5 A;  3ILI A;  2CXE A;  5D3G A;  3TR5 A;  3MGJ A;  4K50 A;  2R42 A;  4ZVF A;  2P5V A;  5A8R B;  1NJX A;  1HNW F;  4DV0 F;  2UUB J;  3OL8 A;  2CQP A;  3VHQ A;  3GMG A;  2UXC F;  1LK7 A;  2ACM A;  2HHU A;  3BR8 A;  1RT1 B;  3MM8 B;  3ELH A;  3US5 A;  4NXN F;  4BLG A;  2A2C A;  4CLF A;  3M6X A;  5CQG A;  2XSF A;  3U02 A;  2MDA A;  2B0G A;  3OR1 A;  2MLX A;  3PW0 A;  1IJF B;  3JTO A;  3HZG A;  4OX9 F;  2APO A;  1KTV A;  4B3S F;  4X4Q A;  2PEH A;  3T9N A;  3WBZ A;  2V67 A;  4DDF A;  5KTQ A;  3KJV B;  4OHZ A;  3B4M A;  3H25 A;  1IBL J;  3IFE A;  1MNE A;  2LQB A;  2G0C A;  4QWB A;  5GVQ A;  2K2P A;  2DGT A;  4QYR A;  4XPC A;  3NBP B;  2V6A A;  2E9Z A;  2RIJ A;  4F2R A;  3T1H J;  1R6Y A;  3SYZ A;  1SXL A;  1LW0 B;  4TKT A;  1YKW A;  4NRT A;  4EO8 A;  4DUY F;  3TO8 A;  1WHV A;  4HEA 9;  4ZHR A;  1XNQ F;  4QZV B;  2LQJ A;  3VVT A;  1Y3K A;  1DJ0 A;  2QE5 A;  3I0R A;  4LR7 A;  2HND A;  1FKP B;  3D7S B;  4F4K A;  1URR A;  5LMN F;  1PJ5 A;  5KG0 A;  3FZ2 A;  1JLF A;  4ZCM A;  4B9S A;  3QLH B;  2IIH A;  4O23 A;  1UWB A;  4BWM A;  1T9U A;  2RVJ A;  1N56 A;  3Q23 A;  2RKI B;  1Y11 A;  4DS5 A;  2MY8 A;  1T11 A;  3SCK E;  3MOJ B;  3RG6 A;  3VWS A;  1TAU A;  3CJS A;  2M4M A;  4PUO B;  5HLF B;  4LT6 A;  3GG1 A;  4JOU A;  2WTF A;  4F4Z A;  2NCK L;  2RD5 C;  4EBE A;  4C0H A;  3DLH A;  2E9T A;  2XNQ A;  2X7I A;  4B3R J;  1LWX A;  1NM2 A;  5GME A;  4X64 F;  2CDQ A;  3VAM A;  1RTJ B;  2PEB A;  5A0Y A;  2J0W A;  4RWW A;  3OD2 A;  3N5F A;  4A8O A;  3LQV A;  4FBT A;  2VUG A;  4HH0 A;  4G3I A;  3D9B A;  5KFO A;  2H4W B;  1NO8 A;  5IC6 B;  5KT3 A;  1TL5 A;  1PGZ A;  1CJU A;  3W64 A;  5KFA A;  1YI2 S;  1GQE A;  2WK4 A;  3V6H A;  2X3D A;  3W2W A;  3G71 S;  2CQI A;  3FMB A;  4DS4 A;  4OZ1 A;  2AX1 A;  3GCW P;  5J2M B;  2IBK A;  1S49 A;  4UUX A;  2LXU A;  1VBX A;  2AYB A;  4P6Q A;  3Q2S C;  3A3O B;  1CJV A;  4ER8 A;  2XM3 A;  1BQM B;  1U1L A;  3VAG A;  5F8L A;  2FLP A;  2CG8 A;  2AT1 B;  2NUU G;  1VRT B;  1M5V C;  1DTQ B;  3ET6 B;  1K1S A;  3W9I A;  1T03 B;  4ED0 A;  1Y5L B;  3RBE A;  4CTA A;  5KFD A;  3TVZ A;  1U25 A;  4HKQ A;  1S48 A;  1YLX A;  2H3E B;  4KAI A;  4M5H A;  4PYA A;  1N32 J;  4DQS A;  1NND A;  3MMB A;  2DCU B;  4DV4 J;  5D4O A;  5CYJ A;  5E3C A;  2EW9 A;  2CVE A;  4N8O A;  1Y5I B;  2H65 B;  2Q66 A;  1YJV A;  4LF1 A;  2N4D A;  3G96 A;  2HUR A;  4USM A;  4F3O A;  2OPR B;  5H9F K;  3D1H A;  3DLE B;  1UVM A;  1FWL A;  1NJZ A;  1WC5 A;  2NQP A;  3CIZ A;  5D0G A;  1NDP A;  1NLK L;  2W4C A;  1TZ0 A;  4ICL B;  2K3I A;  1FWP A;  3BO2 A;  4JP8 A;  1P8G A;  5FLX U;  3R5J B;  2NXJ A;  2KG0 A;  4AXJ A;  3OXG A;  4Y3C A;  4Q0B B;  3KHR A;  1Y00 A;  2W9C B;  3T41 A;  5L1J A;  1U24 A;  2J76 E;  3PV8 A;  3V5R A;  2NLW A;  3BKF A;  1RWM B;  2QLX A;  3R9L A;  1SIZ A;  4J9U E;  5KFK A;  2GIR A;  2LYV A;  1L3K A;  2W4P A;  2W9A A;  3TVY A;  3IGV A;  3VGS A;  2YY3 A;  3K5M A;  4CCH A;  1LKZ A;  3MM6 A;  1S0N A;  3FMW A;  2QA4 G;  3U27 A;  4DZD A;  1SQE A;  1RHJ B;  3VQS A;  3H2V E;  1GMV A;  2DK2 A;  2C42 A;  3JSM B;  2Y8Y A;  3M8P B;  5IS2 A;  1YIJ S;  3HPO A;  2E5L J;  2HZC A;  1AFJ A;  2PE8 A;  1AB8 A;  1HNX F;  2DNM A;  5DET A;  4P73 A;  3NCQ A;  3SFG A;  5DJB A;  4FKY A;  2ALZ A;  3NMA A;  2IMO A;  4B9M A;  5ETS A;  2LXF A;  4WYL A;  5KG3 A;  2ASL A;  4MKV A;  4OV1 A;  5EWG A;  3ILJ A;  3WDO A;  2KB2 A;  1CUL B;  5I42 B;  3AT1 B;  1TVR A;  4DSF A;  1JXE A;  2A6O A;  4F25 A;  3MAH A;  4C11 B;  3ZXW A;  2LEB A;  1BY9 A;  1UKU A;  1YJN S;  2ZVI A;  2VPW B;  2WON A;  4LF6 J;  2PMH A;  3CMQ A;  1ZYQ A;  4IUF A;  4BC7 A;  4H4K A;  2W4D A;  3OTB A;  4DV2 J;  4CLL A;  1EIY B;  3OXF A;  2M88 A;  3HHL D;  1S5Z A;  1CEZ A;  3LP1 B;  4DXL A;  3KLH A;  3FEZ A;  3VGT A;  1YHQ S;  2CQC A;  3J7Y I;  4ECR A;  4K7Q A;  4DN9 A;  2GC8 A;  1UP1 A;  1AUD A;  2L08 A;  5F0U A;  5KT4 A;  1Q0N A;  2Z58 B;  1HQE B;  2OAU A;  2ZUG A;  3BGR A;  3DRX A;  2WW8 A;  2VA2 A;  3S7R A;  1AZS B;  4M5K A;  1X4A A;  3WIU A;  3PM9 A;  3Q8U A;  3H98 A;  1S6Q B;  2YWE A;  3JB9 k;  4I7F A;  1TMJ A;  2B4P A;  1TP7 A;  3NNA A;  3MUV P;  3EXC X;  1RA6 A;  1K1Q A;  2BKP A;  2K1R B;  2X1A A;  3UR0 A;  2Z2L A;  3HFV A;  2QMX A;  4EGL A;  1EET A;  1SL2 A;  2O1P A;  1MLA A;  2MJN A;  4GMK A;  2OP5 A;  1P1T A;  2GHV C;  2IJR A;  1XJW B;  2R7S A;  4Y28 C;  1LFP A;  4OYM A;  3R7S B;  3GV8 B;  3A4T A;  1SH0 A;  3MM8 A;  2CPD A;  4BC9 A;  1VQP S;  4DQQ A;  1NK0 A;  4JI5 J;  2HPU A;  3OL6 A;  3IGN A;  4ERD A;  1V5I B;  2WHO A;  2PC6 A;  3OJU A;  2HIQ A;  5LSO A;  1UPP A;  3MEE A;  1XQI A;  1U1N A;  2B9X A;  2EBG A;  4NAS A;  1QE1 A;  1LEO A;  3OTE A;  4DL6 A;  4Z37 A;  2XY6 A;  3AHP A;  4TU7 A;  4P2F A;  2KM8 B;  4DOZ A;  3CJ8 A;  4WU2 A;  3S6E A;  4EUV A;  3SIP B;  3FFI B;  1SVD A;  2VIH A;  3PEJ A;  1T02 A;  1F6T A;  4ITS A;  5HI7 A;  1RWP B;  2CPE A;  1QAI A;  2KFZ A;  4CM0 A;  4QR0 A;  3NBP A;  3OTD A;  4DR6 F;  2DEJ A;  1XIQ A;  2M0G B;  4LBI A;  2OPS A;  1HL6 A;  2C2K B;  4YHH F;  2C1E B;  4K59 A;  2NYI A;  2HSE B;  1M5O C;  4P7T A;  4HAC B;  3CPW R;  4FNH A;  3FDS A;  2R7V A;  3DRS B;  2CPY A;  3W65 A;  2W25 A;  1S79 A;  3NS7 B;  5B09 A;  1FKP A;  4F67 A;  1YG0 A;  1U49 A;  1MWZ A;  2ATL A;  4OHW A;  2RNE A;  3IM8 A;  2NUH A;  1KDN A;  4Q45 A;  2EFQ A;  3CW2 C;  3FRZ A;  1WC6 A;  4RW7 B;  3MCN A;  1PJ7 A;  1HBO B;  2HVZ A;  4Y2C A;  2Y1R I;  2UUC F;  4GO5 X;  3DC2 A;  5EX3 A;  3L95 X;  3H5Y A;  4PUO A;  4FXD A;  1IM6 A;  2W7A A;  4QWA A;  4I69 A;  2BM0 A;  4KHR A;  1QUP A;  4TY8 B;  5CYQ B;  5THW A;  4ILR A;  2YWK A;  3C14 A;  3L7P A;  4PXB A;  2UUA J;  2AKW B;  5IT0 A;  3R1H A;  2VPX B;  1X4H A;  3L3C A;  2GVD B;  4DZ6 A;  3W2V A;  2KJV A;  1CJK B;  2AYM A;  2KHC A;  3PIP Q;  2OFG X;  1MRO B;  2C2R A;  1D8Y A;  3OVS A;  3KDO A;  1VLY A;  4RUB A;  4Y6I A;  3IRX A;  2VDH A;  2DGQ A;  1NSA A;  4I6A A;  2ZM6 J;  2VBX A;  2DGS A;  4LIR A;  2LA6 A;  4N77 A;  4A8M P;  4WFY A;  1R43 A;  2IY5 B;  2Y8W A;  4MTP A;  1KOH A;  4CP5 A;  3BQ1 A;  2M70 A;  1KVJ A;  2IYG A;  4LF7 F;  2DPI A;  4M5L A;  2ZH2 A;  3M32 B;  1VRT A;  2DO0 A;  4RW8 B;  4RW4 B;  1TL7 B;  3G82 B;  2HRT A;  4QPT A;  3ET6 A;  2A1B A;  4GC7 A;  1PJ6 A;  4JV0 A;  2FGC A;  2FTR A;  5HMZ A;  1T03 A;  5KT5 A;  4EMD A;  3BSA A;  4CDI A;  2XHC A;  1HNW J;  3P96 A;  4DV0 J;  3OR2 B;  5CHC B;  2FZC B;  5JVH Q;  4CRJ A;  1HMV B;  2UXC J;  3B8H A;  4NXN J;  3K5L A;  4AQY F;  1RHR B;  4C8Y A;  2W2N P;  4KYZ A;  1FRH A;  4YR3 A;  1Q86 T;  2AV5 A;  4OX9 J;  2PN6 A;  3T9Z A;  4B3S J;  3H8Y A;  2OEK A;  2V4J B;  2OPR A;  2VHG A;  1RTD A;  2HHQ A;  1JK9 B;  3A3N B;  3C15 B;  4Q5V A;  4K4W A;  3S1T A;  2D7S A;  1N5Y A;  3CVK A;  2B3T B;  3KFW X;  3H7H B;  4KR0 B;  1TKZ A;  2XB2 D;  3PX0 A;  1IR1 A;  3GPA A;  2FGO A;  3BF4 A;  4IG3 B;  2YXL A;  3T6J A;  3T6B A;  1CSJ A;  3VCD A;  1JLE B;  4AL7 A;  1GTH A;  2ZVS A;  1FJG F;  4DX6 A;  3T3F A;  1BQN A;  2V4Q A;  5LOQ A;  5HN0 A;  2OPP B;  2R7Q A;  2YX4 A;  2X1G A;  4DUY J;  2M52 A;  3BDP A;  1IVZ A;  4DSI A;  3QJP A;  7FD1 A;  1XNQ J;  4QCL A;  3SDE B;  3N6M A;  3AD7 C;  1F5C A;  3P5T L;  4ES1 A;  2VQE F;  1R6V A;  4DL5 A;  3GP9 A;  1NZ8 A;  2HQ3 A;  1KQG B;  2V34 A;  5LMN J;  3BGL A;  2PII A;  4LIW A;  2ZJQ Q;  1HPZ B;  2JEG A;  4NA3 A;  5SUH A;  4KO0 B;  3UN5 A;  1UW9 A;  1CPZ A;  5BYQ A;  1KR4 A;  1VBK A;  1HBN B;  2YX7 A;  4X4S A;  2IFX A;  1X4C A;  1F9E B;  2VAS A;  1MW7 A;  5I42 A;  2CYY A;  3RTV A;  3DN9 A;  4X64 J;  2L9W A;  4C11 A;  3LW5 C;  2YKN B;  2Z4P A;  3VAH A;  2QSW A;  3IS9 B;  1I3O B;  3CJ4 A;  2DNP A;  2XS2 A;  1B64 A;  1R8H A;  4MIW A;  4CO0 A;  2VFR A;  3WC0 A;  4Y2I A;  4NA1 A;  3LPY A;  2AU0 A;  5F8M A;  2AGQ A;  4IR1 A;  2M5Y A;  2HBR B;  1FXR A;  2L9N A;  1FRX A;  5BR8 F;  2HZV A;  4IO1 A;  1D9A A;  3I55 S;  2LEC A;  2ASJ A;  1KFS A;  4IRK A;  2G9O A;  3CO0 P;  3NRB A;  4OFZ A;  4A8X A;  4IDK B;  4LF5 F;  3LAK A;  4DR2 F;  1K0T A;  3M2R A;  2VC1 A;  4R8U B;  1S9E B;  3UDL A;  1S4F A;  3AFG A;  3NGU A;  2SXL A;  3PG9 A;  1RT3 B;  3EDQ B;  3M8W A;  1KLN A;  3J81 j;  1NU4 A;  3ZTS A;  1HQU B;  4N56 A;  4R25 A;  1SI9 A;  3LP0 B;  3VV2 B;  3FCW A;  2K1R A;  3TX0 A;  3PIO Q;  2R8I A;  2MQL A;  5U47 A;  2ZKU A;  3FBC A;  2BJ1 A;  3ISN C;  1PIE A;  4EEY A;  1U8W A;  1AW0 A;  1H98 A;  1O5J A;  5BXI A;  3MR5 A;  4RL1 A;  4K2J A;  4YR2 A;  4AFF A;  2IC3 B;  4HI2 A;  2N7C A;  3EXY A;  4DQR A;  4KT0 C;  1T9W A;  5KFT A;  1Q8I A;  4A8W A;  1TUW A;  4Y34 A;  1Q7L B;  1SL0 A;  2HAI A;  2KN4 A;  3L7O A;  4NLR A;  3OVA A;  2W24 A;  7FDR A;  1BWV A;  3MUT P;  3V6K A;  2KH9 A;  2EC0 A;  2BW7 A;  4O3Q A;  4ZS6 A;  4CNY A;  4TN2 A;  5DGB A;  2IHR 1;  2W1B A;  4RWX A;  2AHO B;  4DR4 F;  1F1B B;  1IBK F;  4KB7 A;  3K2Y A;  1N4L A;  1RGV A;  4P9S A;  1PBU A;  4DV5 F;  2VG7 B;  4IKA A;  3M30 B;  3IO1 A;  2P2C B;  2CWK A;  2HVI A;  1T8E A;  3M8S A;  1KC8 T;  3RR8 A;  2EFO A;  2LQ8 A;  2YQ0 A;  5A6W A;  4DV6 F;  5A2Q Y;  5HQM A;  3CJ0 A;  1WG4 A;  1RAG B;  3BZQ A;  1RT6 B;  5LL6 d;  3NWR A;  4KH0 B;  4Y2M A;  4ECT A;  4B9U A;  3L9Z A;  1M5K C;  4ZLL A;  1S1W A;  1KN6 A;  2B9E A;  1T95 A;  5KFL A;  2MSS A;  2BAN A;  3CGI A;  3ISZ A;  4QOT A;  2ADC A;  2M9K A;  3TX8 A;  3H90 A;  1T3O A;  1RAA B;  5AE3 A;  4HAC A;  3RZA A;  1HQ2 A;  2X51 A;  2HS3 A;  2OPQ B;  2DHX A;  3GZ7 A;  2F8E X;  2KFN A;  4ZPT R;  1NPP A;  3IP0 A;  1HNX J;  1MML A;  2J0Q D;  3IC1 A;  1IUJ A;  1U2R A;  2DXE A;  3CO9 A;  5AT1 B;  4K4V A;  3EMT A;  4O44 B;  4OZL A;  1JIH A;  3HKW A;  1HLW A;  1NSQ A;  3SSQ A;  3TAN A;  5E41 A;  3P3D A;  2NXU A;  4RW7 A;  4MYU A;  3BPS P;  4CH0 S;  2A3J A;  3GIR A;  1HBO A;  1H7X A;  2ZBQ A;  5F3T A;  4Q7A A;  3NP5 A;  4CH1 A;  3KLV A;  1D0E A;  5RUB A;  1UEV A;  4R0E A;  4X84 A;  2C22 A;  4QW8 A;  3JXO A;  1GT8 A;  5CYQ A;  3DMJ A;  1U1R A;  1WI6 A;  4WZM A;  4P75 A;  3PFO A;  2XLJ A;  2Z56 B;  3TZX A;  3MPD A;  2XMU A;  1XMB A;  5A76 A;  2RJZ A;  1CJK A;  3L4B C;  1P9Q C;  3NAH A;  1NHK L;  2E44 A;  2HIY A;  1QVG R;  3C66 A;  1MRO A;  2E7V A;  3DRY A;  4M94 A;  4YOE A;  1REV A;  2ZKT A;  2NXC A;  2FHM A;  3HSJ A;  1W26 A;  3KLI B;  3W9J A;  4IQM A;  5KG5 A;  3W1Y C;  5HBM B;  4ANE A;  3OW2 R;  4YS2 A;  2NZC A;  4J9R A;  3CF5 Q;  2VDI A;  2GCF A;  2UVR A;  1IKY B;  4OHX A;  1KQF B;  3KHH A;  3LA0 A;  5K14 B;  2FZK B;  1UPM B;  3LWM A;  1RTI A;  2RS8 A;  3M32 A;  4RW8 A;  1TL7 A;  2RHS B;  2HK2 A;  5KFJ A;  2HK3 A;  4C98 A;  1QVF R;  2WSC C;  2JOQ A;  4J37 A;  3BH6 B;  1FTR A;  3MR2 A;  2ASY A;  2BRK A;  1H6K X;  3OR2 A;  4CI0 B;  1JKH B;  2IVY A;  2E5H A;  1T05 B;  4OMF G;  1R89 A;  2YQ3 A;  3QYY A;  2YKM B;  1FE4 A;  2N4C A;  1NPR A;  5KFR A;  4ZPD A;  1GXL A;  1R8A A;  2R2U A;  2XWX A;  3IR5 B;  3BGO P;  2LCW A;  1U1K A;  4JV1 A;  1V5V A;  4M5G A;  4O0I A;  4NXM F;  2JEF A;  3CCE S;  1U1Q A;  1Q53 A;  1S9G A;  3M8R A;  1S77 D;  4GKK F;  1NJY A;  3F56 A;  1NH8 A;  2DNZ A;  4I6Y A;  2V8G A;  1RWK B;  3C6U B;  2M2B A;  3TUI C;  2N82 B;  2BQU A;  2J8S A;  5J1E B;  4DR6 J;  4L3N A;  3VGU A;  1JLE A;  1QSS A;  1TKX B;  4DG1 B;  2NRE A;  1X9W A;  2IM2 A;  2QMU B;  2XEX A;  4DCO B;  3HJV A;  1FDN A;  1YRT A;  4YHH J;  3GWC A;  2B6A B;  1N8R T;  1R0A B;  1BQX A;  1SH2 A;  4O3N A;  1WC4 A;  2AZ1 A;  3OUY B;  3SDE A;  4B9T A;  5L39 A;  4ZCI A;  1SUQ B;  2QEX S;  1BWE A;  2DXD A;  4LSN A;  4P72 A;  4TQS A;  1S6P A;  3P5B P;  2FY8 A;  1YBU A;  2ZZN A;  4OYO A;  1D9D A;  2C3U A;  3QRP A;  4O4R A;  1HPZ A;  2DR9 A;  1BHN A;  2XHW A;  1WKJ A;  1RWO B;  3R97 A;  2I9S A;  1EKR A;  2J7K A;  4ECS A;  3EDR B;  3QT8 A;  2UUC J;  3NG8 A;  2H1Y A;  4XDC A;  2NXE A;  3DLG A;  5IQ6 A;  1BMQ B;  3EUN A;  2F1F A;  4KPY A;  2MKJ A;  3IS9 A;  5K8O A;  1RT4 B;  5M2R A;  3LP2 B;  1FTC A;  3DU5 A;  1X4D A;  2ZWP A;  1C1C B;  4NWB A;  4USV A;  5HVG A;  2D9O A;  4P52 A;  2MXY A;  3R5D A;  2M3D A;  3IM9 A;  2ZJP Q;  4QW9 A;  1WDD A;  4R0J A;  3E3X A;  3MEC B;  4ZP7 A;  2DIU A;  5MAO A;  2OTL S;  2ADB A;  5DM7 Q;  4IR9 A;  3PXG a;  5KFP A;  1ZPV A;  2WRM A;  2XLK A;  1IWA A;  2OHD A;  5ETT A;  1C0T B;  3RRG A;  1XMO F;  4R8U A;  7AT1 B;  3FCH A;  1IWG A;  2QMW A;  4N7T A;  4G6V B;  2NXN A;  1RT3 A;  3ZZP A;  3GSI A;  2VBW A;  4LF7 J;  1S57 A;  5DO2 A;  1HQU A;  1HI1 A;  1VQ5 S;  5AXL A;  4EWT A;  1KSP A;  3BYP A;  3JTN A;  1LV5 A;  2XS7 A;  1ZAX A;  3G4S S;  5KFF A;  4Y00 A;  2BYC A;  1RKJ A;  3R5C A;  3OBI A;  3X1L B;  1YRX A;  4JYA F;  3M6U A;  1R7I A;  4I2P B;  4CWB A;  4DL4 A;  2UUT A;  2KTQ A;  2IC3 A;  2EG1 A;  1N88 A;  2X1F A;  1VQS A;  3QT7 A;  2AYE A;  1FD8 A;  2ROE A;  3D4J A;  2DR5 A;  1VIX A;  4AQY J;  4O3P A;  4U7U D;  3KJQ B;  3KHL A;  5T7L B;  3JSB A;  2A6M A;  5F8G A;  3JSR A;  3RAX A;  2CPZ A;  1PC4 A;  2HHP A;  1J5E F;  1F9H A;  3W5Z A;  3S8S A;  1N54 B;  4W90 B;  3DYA A;  5KFQ A;  3T5H A;  2HBZ B;  1HBU B;  3D1Q A;  2CJ9 A;  3DI6 B;  5H1S V;  3EVO A;  4ID5 B;  2GJI A;  4PZV A;  2DTJ A;  3RAQ A;  2VG7 A;  1FK9 B;  3NGD A;  2I2Y A;  1URN A;  2N7Y A;  4ZKA A;  5HP1 A;  2MPU A;  2KU7 A;  4NZ7 A;  2C2O B;  2C2N A;  2WB4 A;  1GNK A;  5EUH A;  1EX8 A;  1V3R A;  4IG0 B;  1N33 F;  1O0P A;  4PAB A;  2IVF B;  1Z2L A;  1FJG J;  2P6S A;  4IFV B;  3CT9 A;  1TKT B;  4WKR A;  1AT1 B;  1FO1 A;  2FJV A;  4XO0 A;  4Q43 A;  4MJK A;  4OZ2 A;  4XIU A;  5IWA F;  2H4Y B;  3MUR P;  2ZNZ A;  3M7V A;  2VQE J;  4L3K A;  1IBM F;  2OPQ A;  5B0D A;  4OYZ A;  3LGN A;  4HH1 A;  3V4M A;  5LXR A;  1GMW D;  3RB3 A;  2PFF B;  5A8K B;  1DQA A;  2HHT A;  1MN7 A;  4ZLP A;  4JUZ A;  2DHH A;  2KXH A;  2C2M B;  3B54 A;  1RWU A;  4KGM A;  2DBB A;  4NLO A;  4ZVR B;  4RUH A;  4O44 A;  3M1V A;  3N5B A;  5J2Q A;  2CJX B;  2MQN A;  2EFG A;  2LMI A;  1UJ4 A;  1LFW A;  4QYZ K;  4I68 A;  1TL1 A;  1UVN A;  2IAJ B;  2XNR A;  5M2P A;  4DQI A;  1FES A;  3HFZ B;  1X9S A;  1OMS A;  2XUL A;  5J1P A;  2CZ4 A;  2G0J A;  1RQ0 A;  4DUZ F;  1SJ4 P;  3FCV A;  2UXD F;  4LBP A;  3W61 A;  1EB0 A;  2HZA A;  3CME S;  2I5J A;  1YGY A;  2J9D E;  3Q24 A;  3AJ1 A;  2JNJ A;  2YWG A;  3T1Y F;  4RBT A;  5BR8 J;  5GAE I;  1T9X A;  4MKY A;  2HYI B;  2QA1 A;  1W2I A;  2ZIT A;  5DG8 A;  3L7U A;  3UI3 A;  4CO3 A;  1UJ5 A;  2V2V A;  3HVA A;  2IPO B;  4LF5 J;  2XS5 A;  2LKZ A;  5F8I A;  2J7W A;  4DR2 J;  1U02 A;  4DEZ A;  2JFD A;  5HBM A;  2LQ9 A;  2QFI A;  1SKS A;  1CS4 B;  3UD3 P;  2Q6B A;  2G2O A;  1RLC L;  2KT5 A;  1FKO B;  1GTE A;  3TZW A;  2FUG 9;  3TAM B;  3CCU S;  3DFE A;  1U47 A;  3IBW A;  4LUB A;  3CTR A;  4G1P A;  4P2S A;  4RU2 A;  3LUY A;  3QT5 A;  3FC9 A;  2QJ3 A;  3QID A;  3CJ2 A;  3EVM A;  2JJ4 D;  4IH6 A;  2BKO A;  3C2P A;  4KC5 A;  1UEK A;  2VG6 A;  4K4S A;  1ZBT A;  2HHX A;  4NL5 A;  3BGU A;  3F41 A;  1W2B R;  1JKH A;  1Q81 T;  2B5J B;  4ZLJ A;  3MD1 A;  2CQH A;  1T05 A;  3D5M A;  2YKM A;  1VFJ A;  4UOG A;  1VHF A;  3PYF A;  4DMZ A;  5CH7 B;  2KZZ A;  4K4Y A;  2W2P P;  3R1L A;  1WAC A;  2CNN B;  4ZVU B;  1HBM A;  4DR4 J;  1IBK J;  4YB5 A;  2J7U A;  4KHP F;  2KYZ A;  3M2V A;  3SSR A;  4DV5 J;  4P74 A;  5KG6 A;  3ZZO A;  4CO1 A;  2WBM A;  2PA3 A;  4TY9 A;  3SSS A;  3PW4 A;  1RA7 A;  4DV6 J;  1H2T Z;  1UFW A;  3JQM A;  2DNY A;  1PYT A;  1RT5 B;  2BBE A;  4S0M A;  3OSN A;  4NCG B;  4WFA Q;  4TYA A;  5SZT A;  1M0S A;  4QWD A;  3TA0 A;  4B08 A;  3V4I B;  5F8H A;  3DU6 A;  2UXB F;  1OY9 A;  3U7J A;  3QZ8 A;  8RUC A;  5I3U B;  1Q5V A;  3MPU B;  1PAE X;  2B6A A;  1RI7 A;  1R0A A;  2C3P A;  1VYA A;  3TVK A;  3GJQ B;  3OUY A;  2I38 A;  2BJD A;  2QLJ B;  4WP8 A;  4P7V A;  5CYM A;  3QZ7 A;  5B0F A;  3MED A;  2FC8 A;  3G86 A;  1JXV A;  2QYG A;  3W62 A;  4WFB Q;  1LWF B;  1SV5 B;  4ZIV A;  3RBD A;  3A12 A;  1S0V A;  2WCX A;  3UNY A;  5DQH A;  3PCO B;  1ZTW A;  1NKC A;  2GW8 A;  3DDK A;  4J7C A;  1FRL A;  4X4P A;  2C3M A;  1KHV A;  3PKM A;  5G0R B;  5I3P A;  4CQ1 A;  3VR1 A;  4PG6 A;  2OEM A;  3PRD A;  2RDI A;  1NUE A;  1ZET A;  2QX0 A;  2VPY B;  5AE1 A;  3ZC4 A;  4EO6 A;  1RB0 A;  3K7R A;  1N0V C;  5E3Q A;  2LXI A;  4IO9 Q;  2U1A A;  1XK8 A;  1RT4 A;  3LP2 A;  3O5T B;  1C1C A;  2ZH5 A;  4DF4 A;  2JDJ A;  1EP4 B;  3PR4 A;  4KKO A;  1YJU A;  3VQT A;  2B51 A;  4U8Y A;  1FXL A;  4U67 Q;  3MXH P;  3QRQ A;  3KNA A;  3G2X A;  2ZJR Q;  3TEH B;  2DR7 A;  3QAE A;  3JSY A;  1MN9 A;  3FBB A;  3I96 A;  3MEC A;  5KG2 A;  5KFU A;  2GQC A;  2WOM B;  2HNZ A;  4IH5 A;  2IM0 A;  1MU2 B;  1LWE B;  1TV6 B;  4H4O B;  4DV3 F;  4GRS A;  2V2Q A;  2B4O A;  3D6F B;  3BKU A;  2O66 A;  3LAM A;  1NJI T;  1QAX A;  2PGC A;  1IKV B;  1KP6 A;  3FSI A;  2D1C A;  2O67 A;  4ED3 A;  2PDA A;  3DLK B;  3MAQ A;  4M8L A;  3BDE A;  3ETM A;  1FRK A;  2HW3 A;  4USK A;  3H42 A;  2JEJ A;  2H5J B;  2EK6 A;  4NLD A;  2KKH A;  1YRU A;  4RW9 B;  1L5U A;  3GFX A;  5E2Q A;  4A46 A;  4I2P A;  1IQT A;  4QIV A;  3CIM A;  1SC4 B;  2CPI A;  2D41 A;  2V8H A;  3CCR S;  1VCT A;  4B3T F;  4PRF A;  5T7L A;  4XAK A;  4X62 F;  4G65 A;  4NXM J;  4X4O A;  4DR3 F;  1WKK A;  2AEF A;  2LU1 A;  2CIM A;  5HRO B;  2LDY A;  1Q8L A;  3CNQ P;  3OFF A;  4ZDN A;  1EAR A;  2Z57 B;  5DG9 A;  4GVL A;  2F7V A;  4GKK J;  5JVG Q;  3I6P A;  2JC0 A;  4IFY B;  3DXS X;  1DHM A;  5HVF A;  3DI6 A;  2EI5 A;  1Y3J A;  4ID5 A;  4LFC F;  4B17 A;  5G4D A;  1P1L A;  4B9N A;  2QV6 A;  1HYS B;  1VQN S;  3EGN A;  4LSL A;  4EBC A;  4IQX A;  3G9C A;  1X9M A;  4OYW A;  4DLE A;  2Y0B B;  2CQ0 A;  4USW A;  2FYX A;  1XNR F;  3IWN C;  3KUG A;  2PI4 A;  3T1A A;  6FD1 A;  2ROP A;  2Y1L B;  2CZV C;  1E6Y B;  1SIW B;  3TAP A;  2VL1 A;  5KFS A;  1UA1 A;  3F0N A;  5K8N A;  3BQ0 A;  3AA8 A;  1HR0 F;  2DGO A;  1H2V Z;  3QO9 B;  2V63 A;  3MHY A;  3SCL E;  4NOH A;  2ZH3 A;  5H9E K;  5A8K A;  1S12 A;  2OUG A;  4M63 A;  4U96 A;  2W7O A;  2BX6 A;  4TNO A;  2HFU A;  1XER A;  4ETZ A;  3KK1 B;  2LQ5 A;  1X0P A;  2DHG A;  2G4B A;  2N3O A;  4TVA B;  1U48 A;  4GC6 A;  3HMJ G;  5DQG A;  3HSD A;  4C9D A;  3GCX P;  1UZH A;  1N36 F;  1F2G A;  3OQ2 A;  5KG7 A;  1E6V B;  2AEM A;  3DRR A;  4RKU C;  4NA2 A;  2RRA A;  4NCA A;  3ZZZ A;  2RF2 B;  5ETR A;  5DRK A;  2EC2 A;  4DCJ B;  4ILL A;  2MZJ A;  1S59 A;  3B82 A;  3K58 A;  4L6V 3;  5AJ3 F;  3N79 A;  4C3L A;  4QQB A;  4LF2 A;  2CQG A;  2KYX A;  4DFP A;  4NLS A;  5D8H B;  3DGP A;  1B0P A;  1EJ7 L;  3MZI A;  1RWN B;  1WSV A;  4ZVP B;  3LAL A;  3KG1 A;  2CA9 A;  1WUU A;  1FF2 A;  2HQF A;  1U2C A;  2YTC A;  4ZK7 M;  3FZB A;  5KFI A;  1YJ7 A;  1LW2 B;  1DUR A;  3UD4 P;  3FBF A;  1XMO J;  4OYP A;  1T9Y A;  2DNN A;  4RNM A;  1C1B A;  3SXL A;  2BJ7 A;  1U1O A;  3QAU A;  4AT1 B;  4HDG A;  2RB7 A;  4U7C A;  1FKO A;  3HVR A;  4KGV B;  3SMZ A;  3HUL A;  4K4U A;  1CC7 A;  4DU7 A;  1S6O A;  5ETP A;  2GO8 A;  4CT9 A;  3DOL B;  4EK2 A;  2KZM A;  3D67 A;  1FDB A;  3TZZ A;  5L9N A;  3KK2 B;  3AXM A;  4JYA J;  1GMW A;  3G6Y A;  3M2U A;  4BWJ A;  1F2H A;  2PA8 D;  2YVS A;  1WEX A;  3KJF B;  4P71 A;  1HIY A;  3SCJ E;  6FDR A;  2B43 A;  1FDD A;  2B5J A;  1BUX A;  1N0U A;  5C24 B;  2DXF A;  4RUC A;  2FZG B;  4C7Q A;  4UF4 A;  1YDL A;  1J5E J;  4RNN A;  4HHH A;  2XZW A;  3MAA B;  2XLI A;  3IR7 B;  4Q8F A;  3ADA C;  5DDP C;  4MK9 A;  4FDF A;  1WHX A;  2HNY B;  2EFN A;  1TR0 A;  3V2U C;  4NMX A;  3GQC A;  2GA7 A;  3GR0 A;  4LQ9 A;  2OLW A;  4ZN3 A;  1JLB B;  3E01 A;  2HWI A;  1BXN A;  3Q0A A;  2AF6 A;  4P2X A;  2OH2 A;  1N33 J;  2A18 A;  4LVN P;  2YX1 A;  3MD3 A;  4NCG A;  4NI2 B;  1OIA A;  1U1M A;  1B4S A;  4C97 A;  1FKA F;  2XYH B;  3V4I A;  1RAC B;  2CJB A;  3H5X A;  4DPW A;  1N52 B;  3HK2 A;  3BN4 A;  5I4M A;  4Y65 A;  5IT9 Y;  3CJT A;  3HDS A;  4H4M A;  2ZUA A;  5IWA J;  2JSX A;  4URS A;  4F7V A;  1NZA A;  2IDE A;  1IBM J;  3WIV A;  2BQR A;  1UVK A;  5B0A A;  1WJ9 A;  5KFV A;  3WZ0 A;  4YEA A;  1U0H B;  1NK9 A;  1KVK A;  2RE1 A;  5CCL A;  3J80 Y;  1VLO A;  5I3Q A;  1LWF A;  1MWQ A;  1RWX B;  4EFA C;  4PWD A;  1YZ7 A;  1SV5 A;  2RML A;  2WVB A;  2YNH B;  3QT6 A;  1DBD A;  3BV8 A;  2MJU A;  2K7J A;  1HWL A;  1REG X;  1GK8 A;  2FJX A;  2HEK A;  1FI4 A;  1EHW A;  3KLG A;  2DH8 A;  3OTO F;  1X5O A;  3UDC A;  3DHX A;  4F0H A;  2V9K A;  5A2Q U;  2CWX A;  2RRN A;  5KFB A;  2BMB A;  2DNG A;  1T9V A;  3MMC A;  3MFH A;  4O3S A;  3R5G A;  1EZZ B;  4DUZ J;  2C2E A;  2UXD J;  4RW6 A;  2YKA A;  1NK4 A;  2F4V F;  2N3L A;  3QNW B;  1WKL A;  1VR6 A;  1G2E A;  1KD1 T;  4F2S A;  3MMA A;  2CNO B;  5BYS A;  3T1Y J;  1QSY A;  1EP4 A;  1SKU B;  1WOR A;  2V8V A;  1VQL S;  2BW2 A;  3AA9 A;  4M5N A;  1FA0 A;  1HAR A;  1PKU A;  5DDO C;  2DHA A;  1S6U A;  2GZO A;  4U8V A;  1VHI A;  1WOO A;  1NK5 A;  3BM7 A;  5CD4 A;  1MU2 A;  1YZ6 A;  2D3U A;  4QWE A;  1LWE A;  1TV6 A;  4H4O A;  1JLC A;  2J8A A;  4H4K C;  5HO4 A;  3ITH A;  1YBA A;  4ETX A;  4JV5 F;  1VIS A;  3QBC A;  2HFN A;  4WP9 A;  2CPH A;  1X4G A;  1PSD A;  3DLK A;  2RHQ B;  2P6T A;  2GHP A;  2VKR A;  4U9R A;  5L1I A;  1M90 T;  4DR5 F;  4B3O A;  4FNI A;  4J9V A;  1PYS B;  4NZ0 A;  1NRK A;  3F44 A;  4I0W A;  4IH7 A;  2JLF A;  2VQF F;  1RKI A;  1HFE L;  3G6V A;  2MKK A;  3AJ2 A;  4RR5 A;  4YY3 F;  3UE2 A;  2RU9 A;  5IXU A;  1CBK A;  4AUK A;  4HR2 A;  4G1Q A;  1AXQ A;  1UMJ A;  2WZ1 A;  4JBC A;  4HDH A;  4KHP J;  3NOC A;  1OY6 A;  1T94 A;  2WVD A;  2BM1 A;  5IV4 A;  3PYE A;  4MMO A;  4JI7 F;  2IJN A;  2KT3 A;  1HYS A;  3JAM U;  1HA1 A;  2RS2 A;  3HT3 A;  4PXC A;  4YQW A;  4CT8 A;  3FQL A;  1S1T A;  2HRY A;  4LQ3 A;  5A8W A;  4NLQ A;  4JI3 F;  1Q16 B;  3OTC A;  4MH8 A;  3QRR A;  1R0C B;  2UXB J;  5LXY A;  3CD0 A;  3HVT B;  2V9W A;  4J5O A;  2BKN A;  1JLQ B;  3EWG A;  3TW0 A;  3G8T A;  3PJ9 A;  1NHV A;  1CQM A;  5B7W A;  4K5S A;  3MM5 B;  4NLG A;  3C16 A;  5D6G A;  3W5Y A;  5CZV A;  3MEG A;  3A3P B;  3DXB A;  4I2Q A;  3RB4 A;  1N5Q A;  1CJT A;  1VS3 A;  3PW2 A;  2LEA A;  4KHM A;  2GAG C;  4KY3 A;  4YB6 A;  2WB1 D;  3NNH A;  4R5P A;  1JJC B;  2W01 A;  2YQ1 A;  1RAO A;  1QY7 A;  1JNR B;  4WTY A;  3I5B A;  5L9X A;  3HHK A;  4J9O A;  4K0K F;  4J9M A;  2OJ3 A;  3KK1 A;  4OI3 A;  5KOW A;  1RTH A;  1RAB B;  3FK4 A;  1RHU B;  3M9M B;  4NX9 A;  3H5S A;  2P9G A;  3RRK A;  4C3K A;  3M8Y A;  2MY7 A;  4QU6 A;  1VRQ C;  5D0R A;  3NGR A;  4DJB A;  3ZFV A;  4ZVO B;  1E6V A;  1UA0 A;  3MDF A;  2RF2 A;  4RJV A;  1J5O A;  4MKA A;  1JWW A;  1Y4Z B;  2CPX A;  2FDN A;  4ECY A;  1HNI B;  2YKQ A;  4Q8E A;  3O1L A;  1VK3 A;  3MF5 A;  2W2O P;  1YBT A;  1SJQ A;  1EKS A;  1TU0 B;  3GYN A;  2HS0 A;  4ES2 A;  2HFV A;  3ENW A;  4NPO A;  2ZE2 B;  3O2I A;  5B0E A;  1S1X B;  2XZD B;  3KLF B;  4HTI A;  4WE1 B;  1LW2 A;  3H20 A;  2RT3 A;  4AXI A;  6AT1 B;  1S0O A;  4DV3 J;  3MM7 A;  5HAT A;  4DR7 F;  4DPT A;  5GAH I;  1WF1 A;  2KO1 A;  4N41 A;  1FCA A;  4URQ U;  1KQK A;  1VI7 A;  5FJ4 A;  1TL3 A;  2C2D A;  3W60 A;  4LVO P;  5JJB A;  3DGV A;  4AL6 A;  2W7P A;  3M6W A;  4WZQ A;  5H9F J;  5EWF A;  4QU7 A;  3NL0 A;  3DOL A;  2QL5 B;  3IR6 B;  4FF2 A;  4I64 A;  5LT5 A;  1HI0 P;  3BO4 A;  3AB2 B;  3KK2 A;  1JNZ B;  3Q8S B;  3DLL Q;  3R27 A;  3D2W A;  2LFV A;  2ACY A;  3SQG B;  2JX2 A;  4LF9 F;  1NPK A;  4Z7C A;  2OSR A;  5B0G A;  3IBF B;  2BAB A;  5MLC V;  3OVB A;  4B3T J;  1C4A A;  4X62 J;  5KG1 A;  5C24 A;  1WG1 A;  2DT9 A;  5L38 A;  3EYZ A;  1I5O B;  4DR1 F;  2DRD A;  4DR3 J;  2RUS A;  3MAA A;  1D3W A;  3SZ2 A;  2OGU A;  3PX4 A;  4A47 A;  1L3S A;  1VQ6 S;  4YDX A;  4OX6 A;  4YP3 A;  3Q8V A;  1RIS A;  2Z2M A;  1JJ2 R;  3PDN A;  3R5A A;  1Z1Z A;  2CQB A;  2FHO B;  1IJE B;  2VJV A;  5KFZ A;  4LFC J;  1G1X A;  4USJ C;  2G2Z A;  1JLB A;  3IWL A;  5A6P A;  2FY1 A;  1S9F A;  2BE2 A;  1WD6 A;  3V6J A;  1MG7 A;  2L48 A;  1SJR A;  5B0C A;  1NK7 A;  3RB0 A;  1XNR J;  3BSC A;  4OI2 A;  2RSQ A;  2ILY A;  4NLV A;  2R8K A;  3EGZ A;  2KVI A;  1WHW A;  3VVU A;  5A8R A;  2YKO A;  3CC2 S;  3W8G A;  4QIF A;  1HNV B;  1HR0 J;  2GGP B;  5E7O B;  2VB6 A;  3P4U B;  1VJQ A;  1Y0H A;  1RT1 A;  4ZHR B;  2JFK A;  1RAJ A;  4F02 A;  1U0H A;  1JJ4 A;  1SCJ B;  2AMC B;  1S1V B;  3CCW A;  3J7A N;  5L8R C;  2YNH A;  2QC3 A;  1WTF A;  3VF0 B;  1JLF B;  1R3N A;  1PO6 A;  2DNK A;  2YWW A;  4DL0 C;  3ENQ A;  3CCL S;  3ZZY A;  4JI6 F;  1N36 J;  3BRE A;  3KJV A;  3MOZ A;  4DUT A;  5AXN A;  4DSL A;  2MZR A;  4DF8 A;  2HS4 A;  3DOM B;  1VC5 A;  4Y2K A;  4ED7 A;  1L3V A;  3NS6 A;  4A8Y A;  3ZTP A;  1SC1 B;  4ZPB A;  4FYY B;  2K3K A;  4UOH A;  1DQ9 A;  5AJ3 J;  3H40 A;  3NCP A;  1R8P A;  4FF3 A;  4CLU A;  4CNZ A;  5A0Y B;  3IA0 A;  2CQD A;  1LW0 A;  2CQ2 A;  3FUY A;  3PJW A;  3CC7 S;  4EI2 A;  5LJ3 Y;  1IKX B;  1RJJ A;  2W8L A;  1V3S A;  1FJ7 A;  4NEY A;  1CJU B;  2RU3 A;  3PKY A;  1OWX A;  2KXF A;  3EZ5 A;  4GVB B;  3W2W B;  1KEK A;  2W8K A;  2XO7 A;  2BJE A;  2HWH A;  3KUH A;  1C4C A;  3ETO A;  1NH7 A;  4JI0 F;  5GAD I;  4C8L A;  4QIG A;  2FJW A;  2K06 A;  3QLH A;  4ZA1 A;  1EQ0 A;  2NSC A;  2HHS A;  2OTJ S;  2RKI A;  1RLD A;  1CJV B;  1N5T A;  3ZNJ 1;  4PR6 A;  1N5S A;  4MIB A;  2YNI B;  4HT5 A;  3OFG A;  2YH0 A;  1FER A;  1S10 A;  3TUP A;  4WJB A;  5HLF A;  2J5A A;  4O0N A;  2HHW A;  4PQU B;  3R3T A;  1QLN A;  3OL9 A;  2HMI B;  2E7W A;  2UV8 A;  3AOC A;  4FBU A;  3PYD A;  2CNK B;  4CO4 A;  3KYL A;  2J6U A;  1RTJ A;  1XR7 A;  3QAT A;  1JX4 A;  1UET A;  4ILM A;  3TQ1 A;  3C46 A;  3EGV A;  2R8J A;  5J2N B;  3MMB B;  1WDT A;  1RT7 B;  1X7V A;  1X5S A;  4YUD A;  3UWT A;  1VQ4 S;  1JXL A;  1ZH5 A;  4K8R A;  3VZI A;  2VZ9 A;  5C2C A;  2ZC3 A;  4C8K A;  1F5A A;  3HJF A;  1RE1 B;  5J2M A;  2MGZ B;  3ZTQ A;  4ZCL A;  3ENA A;  2X3G A;  1SJ3 P;  3R7N B;  3C19 A;  4JI8 F;  3LAN A;  4WU3 A;  3CCS S;  4OHV A;  1OY8 A;  4ZPA A;  1TMM A;  3NKY A;  1BQM A;  2ALY B;  1FRI A;  3CSK A;  2AD9 A;  4KTQ A;  5E3P A;  1VIO A;  2VFT A;  1X31 C;  1UWA A;  2Y1J A;  2FHJ D;  1DTQ A;  3DLB A;  4DX7 A;  1M1H A;  3O6Q A;  1Q5Y A;  1K0V A;  2VFU A;  1HWK A;  3UQS A;  4N5S A;  3FGV A;  4JI4 F;  5K5M A;  4O3R A;  4WXW A;  3MM6 B;  2JHE A;  4X66 F;  2KM8 C;  3HD1 A;  2BE9 B;  4FF1 A;  2V2K A;  1OSC A;  1FX4 A;  2YKP A;  1SBR A;  3GJR B;  3CXC R;  2XMW A;  3ILL A;  4KBI A;  3HHL C;  1AA1 B;  4RBU A;  1O8B A;  3FKB A;  1FFS B;  3DLE A;  2X1B A;  1FFG B;  2G0I A;  1OS5 A;  1A6L A;  4ICL A;  5FII A;  2ZBP A;  1F5B A;  3OTO J;  4ZLN A;  1R0B G;  2CJY B;  1G3O A;  4AD6 A;  4Q0B A;  1WOS A;  2W9C A;  1RAF B;  1X4F A;  4LRB A;  1FXD A;  1TTH B;  2E1M C;  2H9Z A;  3Q22 A;  2ZBR A;  5L1K A;  1TVR B;  4TLR A;  4PXE A;  2XI2 A;  2F4V J;  1LXN A;  3DNC A;  1PIL A;  2WON B;  3W7B A;  4YME A;  3VAI A;  1IBC B;  1Q82 T;  2UUW A;  2YNF B;  2B7C B;  1QDU B;  2V0N A;  3OLB A;  5KAK A;  5D78 A;  2I0X A;  3CDW A;  4UTG A;  3KLH B;  2WW4 A;  1SQF A;  5KFN A;  4MFB B;  3JSM A;  2ZE2 A;  2FLN A;  1S0M A;  3M8P A;  1Q1K A;  3KLF A;  1HD1 A;  4L72 B;  4OJH A;  3MTJ A;  4DU8 A;  5DGA A;  4E0D A;  3PEH A;  1Y7P A;  4WWS A;  2FD2 A;  4ECU A;  3AH6 A;  2DIT A;  2XSJ B;  5AXK A;  1QAJ A;  1FNM A;  1ZM4 A;  2LDI A;  3EZO A;  3CDE A;  2P9C A;  4JV5 J;  3OXL A;  4C2M A;  2FVR A;  2KG1 A;  4I7F B;  3EZU A;  4A8F A;  3HSG A;  2AJ2 A;  2DGV A;  4C6A A;  3I5A A;  4BCA A;  1N6Q B;  3NMR A;  1CUL A;  2GMJ A;  3TAQ A;  3N0V A;  4DR5 J;  4DFJ A;  4Z7Y A;  4KGX B;  2O3D A;  3HFK A;  2L41 A;  2G1H A;  2CJK A;  4EYH B;  2CAJ A;  4PWW A;  2XG8 A;  1EET B;  2MHE A;  3SQG A;  1XTZ A;  2VQF J;  3U1N A;  3QQC D;  2EWH A;  1J2V A;  4OJ3 A;  3DDN A;  2DKO B;  2UU9 F;  2Z30 B;  4CO2 A;  4YY3 J;  2BJ8 A;  3LP1 A;  4LRD A;  5CZX A;  3HKZ D;  4A8S A;  3S01 A;  2QA2 A;  3TA2 A;  1U6B A;  5E3A A;  1H0H B;  2RQC A;  2B7B B;  2ZHA A;  3R7B B;  4EZ9 A;  1RAH B;  1Z4U A;  2QYC A;  2E29 A;  3NY0 A;  3KMS A;  3MEE B;  1HQE A;  2RAQ A;  1RCO B;  1AZS A;  4USI A;  1QE1 B;  3VAL A;  4IOB A;  1RHK B;  5LMU F;  4KV8 B;  1RT2 B;  3QMQ A;  4JI7 J;  2GNK A;  3CCJ S;  1S6Q A;  1Q78 A;  2J6T A;  2R4F A;  2GAH C;  2ZZT A;  2KI2 A;  2MB0 B;  2HWT A;  4JI3 J;  2UVW A;  2A2D A;  1GEH A;  2AJ4 A;  5E0O A;  4X4N A;  3LF0 A;  4ZJL A;  3NNC A;  3TA1 A;  1U6Z A;  1YX2 A;  2F8M A;  5K9F A;  2MKI A;  2OPS B;  1FJE B;  3RJM B;  3H4D A;  1HNV A;  5DZ7 A;  2GGP A;  2E1C A;  4J91 A;  1WEZ A;  2AJQ A;  1WI8 A;  3D3C J;  2EKN A;  3IMQ J;  3KXD A;  1S1V A;  2ZBI A;  2R3V A;  3AY0 A;  4K0K J;  3I32 A;  4AE5 A;  4TU9 A;  1NEE A;  3Q2T C;  5AXM A;  4NLY A;  1NME B;  2XY7 A;  1UFL A;  2FLO A;  2HHV A;  2ZDP A;  4ALZ A;  3WC2 A;  2MQP A;  2E1R A;  3FFI A;  3GV7 B;  1HNZ F;  2V8D A;  3PTW A;  2WSE C;  3QPI A;  3GII A;  4WP3 A;  3DOM A;  1H2U X;  1WC3 A;  3D28 A;  4FVC A;  4W92 B;  2EEY A;  3OHA A;  3PHT A;  2AYG A;  3MPY A;  1NBE B;  1GH8 A;  2FJE B;  2HRU A;  1QD1 A;  4UQG A;  2GO9 A;  2XZT B;  4M5I A;  2E1A A;  2FIU A;  2IRY A;  3C14 B;  2DNL A;  2R7W A;  3MTK A;  2JLE A;  1S7I A;  1BD6 A;  1DAX A;  2V4R A;  2PT0 A;  5CA5 A;  3W2V B;  2GMH A;  1IKX A;  2XYP B;  2EXU A;  2IJF A;  2CG4 A;  3FRY A;  3DRS A;  4F04 B;  4NLU A;  3NGK A;  3ENV A;  4GVB A;  1TAQ A;  2JC1 A;  1IM4 A;  3IRX B;  4DR7 J;  2CQ3 A;  2NS1 B;  1F0X A;  4Y2A A;  1I1G A;  2BOA A;  1N34 F;  1D9F A;  1U4B A;  4BS2 A;  1QSL A;  2GVZ B;  4RNO A;  1VBY A;  3IAM 9;  1GX6 A;  1UZD A;  3CDA A;  3DM2 B;  4DL2 A;  2YNI A;  1NKE A;  3QGH A;  1VQ7 S;  3SEO A;  4LF8 F;  3TAR A;  4PQU A;  1DZ5 A;  1UFK A;  2HMI A;  4F26 A;  1RHM B;  4ECX A;  3QFW A;  4DFM A;  4HVZ A;  4TY8 A;  3HX9 A;  4DSE A;  1QTM A;  4LF9 J;  3GV5 B;  2MMY A;  1RWW B;  4A4J A;  2NPF A;  4C4W A;  4OYA A;  2GVD A;  5J2N A;  5DM6 Q;  4HHU A;  4C8M A;  1B7F A;  3THP A;  1RT7 A;  1ZOT A;  4DWI A;  3CED A;  2Z0G A;  4NML A;  4DR1 J;  1TQL A;  4DBQ A;  8ATC B;  2LLZ A;  1ZA1 B;  2V69 A;  3UCU P;  2MTL A;  4M95 A;  1KRP A;  2CNL B;  1LQ9 A;  1RAI B;  5HMW A;  1RTD B;  2MGZ A;  4X4U A;  3CJR A;  4WK3 A;  3I56 S;  1XR6 A;  3E8O A;  2V5H G;  4Q2M A;  2Y0S D;  3NEK A;  2GHW A;  2C3O A;  4ZJO A;  1FJC A;  1ROF A;  3FJ2 A;  4X4T A;  1N5Y B;  2IMW P;  4OYI A;  3JAM Y;  1DFD A;  3U1M A;  4LJM A;  4M5J A;  2IBO A;  1TKZ B;  2RRB A;  2CUY A;  3P45 B;  2GJ2 A;  3FNN A;  4MK8 A;  1MMD A;  4RW4 A;  1I94 F;  1CC8 A;  4LF4 F;  3G82 A;  4NLT A;  1PBA A;  1MWY A;  2OEJ A;  4L74 A;  1B0V A;  5D0H A;  1BQN B;  1VGY A;  2PI5 A;  3HVW A;  4ZOS A;  3P49 B;  3C8Y A;  1HMV A;  4OZ5 A;  2VKZ G;  4K4X A;  2DR8 A;  4OX8 A;  2VU5 A;  3GON A;  3BR9 A;  4DSK A;  2Z2Y B;  3A8I A;  4GO7 X;  3G6X A;  1AFI A;  4LRA A;  1BC6 A;  1I6J A;  5ETV A;  2AEJ A;  3PHE A;  2R2T A;  1RDR A;  2V4J A;  2D74 B;  4UUW A;  2DD8 S;  2AX0 A;  2DEI A;  4JI6 J;  4N76 A;  3C15 A;  3PJX A;  4AND A;  4UOF A;  1YTY A;  4A8Q A;  3M9N B;  2DH9 A;  4YR0 A;  4ECZ A;  2XMA A;  4F50 A;  1QM9 A;  1RUS A;  3UDE A;  2VH7 A;  4XDD A;  1D09 B;  2OML A;  4CLS A;  1PC5 A;  4IG3 A;  4PKD B;  1S4E A;  2PD1 A;  2WAQ D;  4LMZ A;  3T5L A;  5IT9 U;  2OPP A;  2YNF A;  2FVP A;  2VBZ A;  2ZBC A;  5HL7 Q;  2Q79 A;  5T41 A;  1FE0 A;  2FJB B;  1ZM9 A;  4ANC A;  4MFB A;  3I4P A;  3OLA A;  2IVM A;  2ZEJ A;  3J80 U;  1WG5 A;  4YN3 B;  5GAH U;  4JI0 J;  1NK8 A;  4RU9 A;  4ZIW A;  2LP4 A;  3OFH A;  3CD7 A;  3RAM A;  3QSI A;  1KVI A;  2FHJ A;  1YIT S;  2Q3P A;  3M2R B;  4LRF A;  5KFW A;  2DNO A;  4KO0 A;  2XSJ A;  2JEI A;  3ZZR A;  5HQL A;  3D3B J;  3LO3 A;  3J81 U;  2GIF A;  3ZNU A;  1HBN A;  4ZPW R;  2B4V A;  2Y1I A;  3GR1 A;  1N6Q A;  5F0W A;  4UST A;  3HM9 A;  4Z2X A;  3X3U A;  4TU8 A;  3BGF A;  4DPO A;  5DLG A;  2YKN A;  2CPF A;  2JH3 A;  1TK5 A;  1SB6 A;  1JQG A;  3NLC A;  5KFE A;  2VIC A;  5BJR A;  1EAY C;  1K9M T;  3M9O B;  5KFC A;  3J7Y U;  3IXQ A;  1FDA A;  4CLW A;  4DPY A;  3ZTO A;  3I0S B;  1WEL A;  2MKH A;  5JMN A;  3PX6 A;  3M05 A;  3UDV A;  2XQC A;  4W4M A;  5IT4 A;  4IDK A;  3N9U C;  5HAN A;  4JI8 J;  3TUJ C;  1S1U B;  3ZZT A;  2DNH A;  1DLO B;  1RP5 A;  2ZH6 A;  3H0P A;  1IR2 A;  1S9E A;  1RT2 A;  4KV8 A;  1H3D A;  2AP6 A;  1CLF A;  4ZVS B;  3MR7 A;  3RUB L;  4O4G B;  3LP0 A;  2IYI A;  2ASD A;  3HHL B;  2RQK A;  3TNV A;  5ETO A;  4ELV A;  1S1W B;  1JLG B;  1HD0 A;  5K20 B;  4JI4 J;  4LR8 A;  1LNQ A;  2BAN B;  4X66 J;  2MKC A;  3BBF A;  2GML A;  3POT B;  4B3M F;  3GYX B;  3K8W A;  3FEX B;  4ED6 A;  1RZM A;  3D6H B;  3CMA S;  4PG4 A;  2VFS A;  2QLB B;  4CYU B;  2OO4 A;  5IOL A;  3K57 A;  3GIM A;  2G1D A;  2QSF A;  3UO0 A;  1A0O B;  3FSX A;  4OLP A;  1HWJ A;  1YK9 A;  1QTN B;  1FFW B;  3TI0 A;  3JS9 A;  4LFB F;  1YJW S;  1MMN A;  2HGL A;  3D6T B;  2R7O A;  1R27 B;  4U7U K;  3LPE A;  3M30 A;  3W3S A;  5ADZ A;  5C42 B;  2BVZ A;  3ISN D;  4CLP A;  4HYK A;  2PFD A;  3LOU A;  2FVQ A;  3SV4 A;  1RT6 A;  1RBO B;  1IR0 A;  2HG4 A;  3A13 A;  2OIH A;  2E5G A;  4V19 J;  3HT0 A;  2IM3 A;  2WVC A;  2Q6C A;  3N6L A;  3J7A 1;  2XC9 A;  2P8I A;  2DH7 A;  2YPY A;  3MMJ A;  3DMJ B;  4ZVG A;  4JI2 F;  5KFM A;  3H2L A;  4IOA Q;  4JV2 A;  1K44 A;  5HQ8 A;  3FVY A;  1ZAV A;  1NKB A;  4NLW A;  3BS9 A;  3AOB A; 
#chains in the Genus database with same CATH homology
 5ETQ A;  3UD5 A;  1RAO A;  1IM6 A;  4AD6 A;  1TMM A;  1RTZ A;  2BMB A;  3HSZ A;  3UDV A;  4PZV A;  1EQ0 A;  3KUE A;  1KBR A;  3MCN A;  3ILO A;  2F65 A;  5ETO A;  3UDE A;  3HT0 A;  4F7V A;  4M5J A;  3HD2 A;  2QX0 A;  3ILJ A;  1F9H A;  1HKA A;  3KUH A;  1HQ2 A;  5ETP A;  5ETM A;  3QBC A;  4M5I A;  1DY3 A;  2CG8 A;  3KUG A;  3HCX A;  3ILL A;  3MCO A;  1EQM A;  4M5L A;  5ETR A;  4M5M A;  5ETS A;  5ETV A;  1RU1 A;  3MCM A;  3ILI A;  5ETL A;  4M5N A;  4CYU A;  1Q0N A;  1CBK A;  4CYU B;  4M5G A;  4M5H A;  1RB0 A;  5ETN A;  4CRJ A;  3HD1 A;  1TMJ A;  1G4C A;  1EX8 A;  5ETT A;  3HSD A;  3IP0 A;  2F63 A;  5ETK A;  4CWB A;  1RU2 A;  3HSG A;  3HSJ A;  4M5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...