1CBKA

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase from haemophilus influenzae
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
MITAYIALGSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAKIETELSPLKLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-PYROPHOSPHOKINASE
publication title The structure and function of the 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 1999-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1cbkA00
5ETVA 4CYUA 1CBKA 1EX8A 2BMBA 4M5HA 3IP0A 3HCXA 5ETNA 3HSZA 3MCMA 4M5MA 3MCNA 1IM6A 1TMJA 4F7VA 5ETLA 2F65A 3MCOA 5ETRA 3KUHA 1RU1A 4AD6A 3UDEA 4M5JA 4M5IA 5ETKA 1EQ0A 3UDVA 1TMMA 3HD1A 1RU2A 1Q0NA 3HD2A 3HSJA 4M5LA 3QBCA 3ILOA 1RTZA 4PZVA 1F9HA 3KUGA 5ETQA 1EQMA 5ETOA 4M5GA 2CG8A 1RB0A 1RAOA 3KUEA 3HT0A 5ETPA 3ILIA 4M5NA 4CRJA 4CWBA 2QX0A 5ETTA 4M5KA 2F63A 1HQ2A 5ETMA 5ETSA 3UD5A 4CYUB 3HSGA 3ILJA 1G4CA 1KBRA 1DY3A 3HSDA 3ILLA 1HKAA
chains in the Genus database with same CATH superfamily
1KVJA 5KFUA 2IM3A 1SH0A 2FB0A 3HHLD 2HHWA 1S0VA 1YSJA 3NNAA 5J2MA 4DR3F 3HM9A 5B7WA 3CULA 1MN7A 4RU2A 1ZAXA 1MW7A 7AT1B 2HURA 4J5OA 1HHSA 1KD1T 3ISND 3DRPB 4JI1F 2KJVA 4M5IA 4ZPTR 4J9QA 1QDUB 2KTQA 1D9DA 1TFYA 1S6PA 3UO0A 5DQGA 1SXLA 1U02A 3MMAB 5FLXY 3MMJA 3PYFA 1QSLA 2XI3A 5DQHA 4DS4A 4ZP6A 1R8AA 3UCZP 1P1LA 4A4JA 1M5KC 2XMMA 3AXKA 5CD4A 3BR9A 1RBAA 3EUNA 1S5ZA 4KV8A 2KZZA 1S79A 4F26A 4FF2A 1B0VA 3QJJA 3NRBA 4XPEA 4ZJQA 3WX8A 2MZTA 5F0WA 1U7LA 4DR7J 2WB4A 1FE4A 3EVWA 4PQUB 4HHJA 2C2EA 4TQRA 2GZOA 1EQMA 1JKHB 1V3RA 4RPFA 3GV7B 4UZBA 1UVMA 3WHIA 4DV2F 4LF7J 1CVJA 1JWWA 4IFYA 3UNYA 3N5FA 1G1XA 1XMQF 3CCVS 4KRWA 2FJVA 3FCVA 2K2PA 2HQ3A 3W64A 3D3BJ 1LXJA 3VZHA 3UR3C 1DARA 3FC9A 3I0RA 3LWMA 4LF4J 3KLGB 3DOMA 1XWLA 2BANA 2OLWA 2JWNA 1IM4A 1B0TA 1LWXA 3QIPA 4KKOA 1XR7A 1O0PA 3FEZA 2BKOA 3RBEA 4YB6A 2GNKA 5KFJA 4NI2B 2AMCB 1T7PA 1FK9B 3MEGA 4P72A 4A8OA 4CQ1A 4JI8F 4DPUA 2X7IA 4KR0B 1MROB 3MM9A 4OHYA 5IQQA 1TFWA 4X64F 3KHHA 2ILZA 2R8JA 3MEEB 1KNZA 2DPJA 2VF3A 3J7YI 1Y5LB 3QZ7A 2VBZA 2E5GA 4CO4A 2X1AA 1DTTA 3KNAA 3Q2SC 1SL1A 4G65A 2HBYB 2CXEA 4B3RJ 4C48A 4NLWA 1XN9A 3OUYB 1SQEA 3AA9A 2K8GA 1HARA 2EK6A 4WE1A 3UN2A 2UXDJ 2KN4A 3ZZYA 2RU9A 2HS4A 2O01C 5HMZA 3V81B 4DSFA 3T1AA 1GMUA 4CH7A 1TMMA 3GLJA 1S0MA 3TVKA 1RWWB 3MMBB 2R7UA 2JLGA 1YG0A 2UV8G 1Q78A 3V6DA 2FPHX 2GJFA 3MR7A 2P2CB 3PVXA 4I7FA 1N88A 2QLXA 3ZTRA 1YJ7A 4MFBA 2PI5A 4K0KF 4X2BA 1PG5B 2V9KA 2DNMA 1Y10A 3PHEA 3SQGA 3GB0A 3PFOA 3TZYA 1L3TA 2XI2A 4OZ1A 4RL1A 3UCUP 3NGTA 2C3PA 1AUSL 1MWZA 1WKLA 3OVBA 2DNOA 5KFSA 4N7TA 2H65B 4J7CA 2R2UA 4KHRA 4TY8B 1TL1B 1FJEB 1L3SA 1M0SA 2J0XA 5B0EA 4O0NA 4PWDA 1LW0A 5GAHU 4YB5A 1VBZA 2C42A 1UVLA 3KLHA 2P6TA 5KG3A 1KSPA 2R2RA 1S0NA 2J0QD 5KAKA 3CJKB 5K8MA 2MQQA 2HFSA 4ZVHA 3LP0B 4CLFA 2GGPA 2JVRA 1VS3A 1T05B 3M8RA 4QPXA 1N6QB 1S9EB 3MPVA 1C4CA 1HI1A 4TU9A 4K4WA 2DIUA 2G0JA 4DS5A 3QFHA 4KC5A 3SIPB 1HQ2A 2GO9A 4ED1A 1FXRA 3BO3A 2B6AA 2CQDA 1QLNA 4ANDA 4QIGA 1YTYA 2F1FA 2WOMB 1UFWA 1RHRB 1RT2B 4F3OA 3SCIE 4Z2XA 1FTRA 2D1CA 3SFGA 3LALA 2V8HA 4QR2A 2XY5A 3RB6A 3LANA 3W3SA 5L1LA 2XGPA 4CLWA 1R8PA 3T5HA 4YP3A 2ZH2A 3BKFA 2FC9A 1UTAA 3G96A 4OYAA 2QL9B 4CT9A 4OZJA 2XB2D 2FYXA 4DHVA 3CIMA 2V4JB 5IC6B 1P9YA 2DNKA 3C66A 4ZVQB 1KR4A 2LDYA 1A6LA 3ZO7A 3J81U 4OHXA 3TQ1A 1Y4ZB 1ULRA 1FD8A 4KE5A 1RBOB 5LM7E 1KQFB 4EI2A 3GYGA 2CQGA 3C16B 4MK8A 4CLZA 3PYGA 2HHPA 3LPYA 1RZMA 3PYEA 3ZTPA 2CJAA 2RSQA 4NWBA 2JEIA 3Q24A 5KFRA 1WHWA 2CQIA 3R1LA 5GADI 4G1QA 4LFCF 1R6VA 2IM1A 1N5YA 2B4VA 2MKIA 1I5OB 3QSIA 1XNQJ 4LR8A 3DM2B 2AJ0A 3CJ0A 4LQ3A 1NXIA 2JLEA 4M95A 2B8QA 4UOCA 5LL6d 2HIYA 2YNIA 3TX8A 3JSMA 2PIIA 1LWEB 4WTOB 2DH7A 2C3OA 2O3DA 2HNDB 3PEJA 4UTGA 3BEGB 4NLPA 4IRCA 2KH9A 1RT1B 2F5GA 4RNMA 4H4MB 4HVZA 1PKUA 2JSXA 4DWIA 4YY3J 5H9EK 3PO5A 2HFNA 2PT0A 2EFPA 4NYOA 3QRPA 2XYGB 4Y2MA 2D69A 1IJFB 4LVOP 4I67A 3DLGA 4KGVB 3DLLQ 3PXGa 2NSCA 1T11A 4A8KA 4DV1J 3KDNA 1Q5YA 2LVWA 2C2ZB 3E3XA 1E6VB 3BN7A 4Y00A 5LSLA 3QJPA 3AQPA 2AGQA 4LIRA 2XNQA 2YNHB 3I9V9 2MB0B 3I4HX 1J5EF 3H25A 4DI6A 3VGVA 1DAXA 4ZPVR 4K4ZA 4OX8A 2KM8C 3X1LB 3WBZA 4AUKA 1QUVA 3A8IA 1YDLA 4L3KA 3VV2B 3NOGA 4ID5B 2IHR1 5F8JA 5J2QA 3Q8RB 1U48A 1SQFA 4DV4F 2NXEA 2ATLA 2HZVA 4B9SA 3QRQA 1RTIB 1MLAA 5DDRC 1YJTA 1W25A 5I3QA 3P45B 2RQ4A 3VAHA 1N32J 2DNZA 2FDNA 1U0HA 3MI7X 1H72C 3C6TA 2J6TA 2XO6A 4ETXA 3UE2A 2MQLA 5DGAA 3M30B 4I2PA 1RLCL 3I5AA 2DHAA 2P9CA 2K3IA 2OHDA 5AXMA 3GG1A 2LA6A 3QATA 4DSIA 4O3SA 3SCJE 3ILJA 2AEMA 2YKOA 1NJXA 3FSXA 3IP0A 2JEFA 2CUYA 2Y0SD 2QN6B 4C8OA 1M5VC 2I2YA 1UAWA 1UWBB 2V68A 4U7UD 3KLEA 3BYRA 2HNZB 3L95X 4X62J 2PA3A 1N48A 4QU6A 1I94J 4X66F 2RU3A 2F8MA 1K8AT 4HDGA 2HK3A 1PIEA 5DDPC 2JEJA 5KFTA 1YLXA 3EXCX 3CDAA 1NKBA 1CJKB 1RSCA 3M8PB 2UUCF 2X1FA 2VH7A 2ZH7A 5KFHA 1UPPA 3AAWB 2R7SA 4Q8FA 3H59A 3FK4A 4F2SA 1RDRA 3TZZA 2AGOA 4KGZB 1BHNA 5ETOA 2MZRA 1JLFB 3T5LA 1VIXA 2EBEA 4P10A 4U6PA 2OPSB 4WJBA 5ETPA 2ADCA 2JH3A 1RT6A 1HI8A 1CS4B 4Y2IA 3ILOA 1OSCA 2ZUAA 2A6MA 3Q8VA 5C2CA 1R8BA 2HHHF 1PBUA 2C28A 4X4TA 1UP1A 1WC0A 1WG5A 3MM8A 1FKOB 4M8LA 4ZK7M 3DOKA 2IVMA 2YX7A 4FYWB 1NB2A 3SFUA 2MEWA 2R8KA 2XZWA 1GTHA 1N36F 3PHTA 3BPSP 2KT2A 2G4BA 2IJFA 3B4DA 3FEXB 2FLNA 4FF3A 2A0FB 4E2FB 4I2QB 2XMAA 1NU4A 3FDSA 1SUQB 4TU7A 4GKKJ 3I56S 1Y7PA 1S1XA 2G2YA 3H98A 1VRTA 4NLUA 5D0EA 1V3SA 5HJYA 2AD9A 2FHJD 4I68A 3CD5A 2B4OA 4B9MA 4YR2A 1YZ6A 3IRWP 3T3FA 2AWZA 4XTTA 3G71S 1I51B 1TVRA 3UN3A 3MECB 2DK2A 3VAGA 1NEEA 2F3JA 2KHCA 1VBKA 2DCLA 2HK2A 3A3NB 2HNYA 2ZITA 2ASDA 2O1PA 3CF5Q 3BGFA 3FJ2A 3GCXP 2IMOA 2AYEA 1JXLA 3MOJB 4GMKA 1T03B 2XMKA 3US5A 1VQYA 3THTA 3R97A 4HR2A 2FZCB 3UD5A 3PZPA 1BD6A 2WONA 2ZBRA 1MN9A 3H42A 4ECVA 3QGPA 3KUGA 4JI6F 4W4MA 4OI3A 1QUPA 2XMJA 4TN2A 1HNZJ 4IUFA 2E44A 1H7WA 2R7TA 3K5LA 2ZC4A 4YB7A 3G8QA 1MU2B 3JB9k 1V5IB 4DL3A 4JUZA 2J7KA 4GKJF 1FRIA 2EFNA 2GMHA 2ZDOA 4C2MA 1LW2A 4ZLJA 1BC6A 3O8WA 2N4CA 3LP2A 2HG4A 4MIAA 4NCBA 1LWFB 1PJ6A 2Z56B 4AQYJ 1VJWA 1FJGF 5KT4A 4JI5F 2NPFA 1OPZA 3EVOA 2V67A 2ZHBA 4EBDA 4IFYB 1FDNA 3MF5A 4QJVA 2HFOA 3VQSA 1KHWA 3QLHA 2M52A 1IKYA 3K57A 3ZZOA 4DLGA 3BBBA 5D6GA 3I5CA 2GHWA 3TJ9A 3GJQB 4FKXA 2KT5A 3I0RB 2CG4A 3MR3A 4EZ9A 2ZKUA 1PC5A 1SC1B 5CAAA 1REGX 3IO1A 2BANB 3P4UB 4DUZJ 2B7BB 1GMWD 3T5KA 3DRRA 2OPQB 3K5OA 3K0JA 2VBWA 3CCES 4KKOB 4C3MA 2MGZB 2FLOA 2UUBF 4J9SA 4DU8A 1U2CA 5KFIA 2DYAA 2G2ZA 3KK2B 1G4CA 1U8WA 2VQEF 1JLQA 3HK2A 2FZKB 4G1PA 3LPEA 1UA0A 1C1BB 4TYBA 4IG3A 2IM0A 4G6VB 4A8YA 1LK7A 2M8HA 4K4SA 4ICLB 2GFFA 5DG8A 3GR0A 3I9ZA 4QWAA 3MM9B 1IJEB 2DR6A 4GO7X 4NXMF 2GMJA 3OW2R 5KFFA 5A8KB 2OAUA 2L3MA 3G8TA 2HQDA 4LF6J 1DTTB 4FXDA 1FRLA 2UP1A 2BYCA 1PGZA 2HMIA 1RQ0A 2OP5A 1KFDA 3NEKA 2YNGA 3VAIA 4WE1B 4FVMA 1C0UA 5J2PA 8RUCA 3DDIA 1A7GE 5K20B 1EX8A 3TARA 5LMNF 2HSEB 2GVZB 3B6BA 1RTJA 2IYGA 1FFSB 2W4DA 1Z2ZA 2PSZA 1NCLA 1HBMA 4ZVOB 2VKZG 2RE1A 3RRHA 4O44A 2K1RA 2AYMA 5KFLA 1TK5A 1RAEB 4OZNA 4MFBB 3IBCB 4PYAA 2ZH8A 2ROPA 1NH7A 1Q82T 5CCMA 2YKMA 3CWJA 3SQGB 4AL7A 2UXCJ 2H9ZA 3QQCD 3FVYA 4NLYA 1HBNB 2JFKA 5ETLA 1DQ8A 4LVNP 1QVFR 4WFXA 3FFIA 2QC3A 4UOHA 3FBBA 3FNNA 2JNJA 3J7YU 4HDHA 3GMGA 4FF1A 2J6UA 4NA1A 4DUYJ 2UVUA 4ERDA 4PWDB 1QY7A 1RTHB 1LW0B 4WYLA 1NK9A 3F41A 2W9BB 3M2RB 1NK0A 5DM6Q 1S76D 4OZ5A 3NWGA 3WX4A 4YDDB 2VPWB 2CJ9A 1T9YA 1JIHA 3NGKA 4M5GA 1Y3JA 3HT0A 4Q5VA 2CKWA 1GNKA 2GGPB 3G6VA 3KOAA 3Q8UA 4I64A 2DO0A 1M5PC 4MH8A 4DSJA 4KO0B 4E98A 3D1QA 1X4BA 4ALZA 4J9RA 4OX9J 2DR7A 4M1KA 1SIWB 1X8DA 3GQCA 1RAHB 4DBQA 2FTRA 1JLCB 2D3OR 3DU5A 2NREA 3KHLA 4DDFA 2DNHA 1IXKA 4GVBA 2IIHA 4NXNF 4HL9A 2WSCC 1NAQA 4ZN3A 3CCTA 3H90A 4U7CA 5E2QA 1PAEX 3V6HA 4F4YA 2VFSA 1XMOJ 2RDDA 3R5BA 1SB6A 2DGOA 5L8RC 1QSYA 1UL3A 4ZKAA 3DRSB 3HVTB 5DLGA 1N0VC 2W1BA 2RRBA 2HBQB 2X3GA 4ZHRA 1Z2LA 2DTJA 3KHRA 2CIMA 3H5SA 2JL9A 1NK5A 3D66A 3M32A 4NZ7A 2AV5A 4RW8B 3C46A 5ITHA 2IA0A 5CA5A 4DV5J 4OV1A 2QL5B 3PRBA 1C4AA 2VBYA 2HQCA 2GS8A 2XHCA 3UI3A 3PO4A 2NXUA 3AXMA 3T1YJ 3R1HA 4DV0F 3K7RA 3R5CA 5JJBA 2I38A 5GAEU 2FJXA 1RHJB 1BQMB 3QAUA 4FS2A 3SQOP 2A6OA 4QWDA 2LU2A 2UXBF 2ZVIA 1IM6A 2YNIB 3GSIA 1MSWD 3CD0A 3BSNA 3EE3A 1NPPA 2DGVA 3NGRA 1Q79A 1CJTB 3OFFA 5D15A 4FYXB 3QWPA 3BM7A 3VR1A 4NE9C 2AJ4A 3LP1B 1FFWB 4E0DA 4RWXA 3D1HA 1R43A 2MQPA 6FDRA 4K4XA 3IR6B 1R8HA 1SJ4P 5KTQA 3RG6A 3QT6A 1LFPA 2NLWA 3N9UC 3MM7A 5C24B 5IOLA 5E33A 2ZBQA 5C25B 5L39A 5CZVA 2AZ3A 3R27A 3KK1A 4A8SA 5HROA 3C3LA 2RUSA 3LAKA 2CPXA 3K8VA 5DG9A 1URNA 4Z7CA 3QT5A 4BHQA 3CO9A 4K4UA 3GCWP 2OKQA 1X0FA 1U1MA 1IWAA 1EP4B 4LFAJ 4J90A 2PGCA 4JV5J 3D4JA 3H20A 4NLRA 1F9HA 4WZQA 4HACA 1SQGA 1EARA 1IKVA 3KJQB 4I2PB 2BQUA 3A4TA 3KXDA 5G0RA 1WC5A 2Z2YB 1TV6A 3MD1A 3R5AA 3U7JA 3OL9A 4DR2F 2IDLA 5KFDA 2HFUA 3DLJA 3T19A 2WVDA 1HHQA 3W62A 4U95A 4NL5A 4ED0A 2ROGA 4EZ6A 3AD7C 2J5AA 4FXVA 4M63A 3MPDA 3HHEA 1U47A 3QO9A 2PC6A 4XIUA 4O0IA 3V6KA 2L9NA 2CAJA 3OTEA 1X4CA 1NJYA 1IBKF 3CMES 4C3LA 4D3GA 2O67A 1ITPA 3D67A 2V50A 4DV3F 3G4SS 4LQ9A 2FLLA 1WSVA 2ROEA 2KKHA 2PMHA 4RW6B 2Y8WA 5I42A 2MJUA 4Q0BA 2OSQA 5GAGI 2KI2A 2AHOB 4RW4A 2HYIB 5FIIA 3H0PA 4LREA 2RF2A 2ZH5A 2DBBA 3KFWX 4F36A 5F9NA 1X4DA 1VBYA 2UZAA 1NZAA 2D3UA 3OJUA 2BX6A 1UETA 2HVZA 5IWAJ 2NYIA 2VU5A 2HHXA 1FF2A 1JJCB 1HW9A 1VQKS 1SL2A 4KH1B 3KDOA 2AJFE 4RW9B 2HVHA 1I3OB 4OI2A 4F4XA 2F4VJ 2CDRB 1VOMA 4JI4J 4C11A 3ETMA 1ZOTA 3D68A 1S9FA 2V6AA 5IT9Y 3D6HB 4DXLA 4DR5J 2PO4A 3B78A 1KQSR 3HHLC 3TQEA 4PG6A 2AQ4A 1VQ9S 4O3PA 5HSPA 4C8ZA 2F7VA 1TKZA 1Q16B 4J9LA 3OTDA 3IS9B 2W9CA 4RR5A 1R0BG 4B08A 4KPCA 3K2YA 2MMYA 1WTBA 5J1EB 3FSIA 1P8GA 2IM2A 1RWVB 4U96A 4USTA 2PEHA 2DEJA 1NDPA 5DDOC 5D3GB 4R0EA 2ZH4A 4C97A 2HW3A 5D4NA 1PC4A 3QBCA 2JX2A 1YJRA 2EI5A 3UDCA 4CNYA 4TY9A 2KO1A 4Q2MA 1VQ7S 4RZRA 1NK6A 1NB7A 5D0RA 3BBCA 1WEXA 4N8OA 2RH3A 5LSRA 4DR6F 2ZOMA 2ZE2A 2HNYB 1YJNS 4PZVA 1UMJA 1KP6A 4ZCLA 4P75A 4L74A 5J2NA 3DNCA 4IDKA 3TX0A 3PR5B 5EHHA 4UZCA 4CT8A 2QRRA 3GTYX 3A8EA 1HLWA 4B02A 4R8UB 2EFGA 4YDXA 3BGUA 3AH6A 2XY7A 1YX2A 4ETZA 2MZJA 2FY8A 3ZFVA 2RRAA 3SCKE 3RRGA 3HKWA 1Q8BA 3I31A 3RGIA 3ENVA 3FQLA 4CTAB 2G13A 4JI3F 3PX6A 2DGXA 2HZAA 3PJ9A 4RW7A 1QTNB 4IR1A 4N56A 2Y8YA 1CJUA 1U24A 4OYXA 4EBEA 5E7OB 5K14A 4O4GB 4PXBA 3PY8A 3KLFA 1RU1A 4YQWA 4MKVA 1N34J 2E9RX 4JYAJ 3DOLA 1T95A 4QU7A 3PX0A 3JYTA 1K9MT 1R27B 3FRYA 2LEBA 3G6ES 2BJ8A 3U1LA 1SJRA 1KVKA 1T94A 5GMEA 4F3MA 3HD1A 2E5HA 2MSSA 1LWCA 3DU6A 5KT7A 2QA2A 2VV5A 2ZWOA 5HJXA 2CYYA 1SJQA 2HHTA 3OFGA 4UT4A 1DRZA 1T3OA 2ZM6J 1NJZA 3IC1A 4FZVA 3G86A 4C8LA 4X84A 5JMNA 4DX5A 5AJ3F 5ETRA 2KG0A 4C3KA 2RQCA 2Y9HA 1RTZA 2VPYB 3DHXA 1EKRA 2BEFA 2OJ3A 5CYQA 2IDEA 3OR2A 4BS2A 4H4OA 3EWGA 4RJVA 2CQBA 3G6YA 4P6QA 3V6JA 4M5DB 3D54A 4OHWA 2YY3A 1T9UA 3J7AN 4W90B 1T9XA 3BQ0A 4HTIA 5FD1A 2K7JA 1DY3A 1SKSA 5A6WA 3MCMA 1JX4A 4IG3B 2H1YA 2QLBB 2Z8QA 3CO0P 1P1TA 2ACMA 7FDRA 5F8HA 4USIA 2AYGA 1OYDA 1RHKB 4DV6F 7FD1A 3PW5A 1YKWA 1FI4A 3QFWA 2YKAA 3ETOA 5JXSA 1JMTA 1RYRA 2VQFJ 2KFNA 1NH8A 5KOXA 2RKIB 1S97A 3TEHB 1XTZA 5CYMB 4TXSA 3BN4A 4DV7F 3W2WA 2DNQA 1OMSA 1S1UA 2XMVA 4ZPAA 5EDWA 4OJ3A 4MIBA 2J0WA 3M2VB 3NGDA 4FP9A 1VQMS 1W26A 3TAMA 2MKSA 3DHWC 3VAJA 1VRQC 4LR9A 5DO2A 5F8MA 5KT3A 4DR1J 2V94A 1XIQA 3DXSX 5HAOA 2C22A 4Y2KA 1HBMB 1ZM4A 4LR7A 1NHVA 4O44B 4B9VA 2M5YA 2Q3PA 2CPIA 5LMUF 3EGVA 3DLEB 2OEKA 5KFGA 2DXEA 1OSDA 1A0OB 3H7HB 4QIFA 4JBCA 1UJ5A 1S48A 3MCSA 1E6YA 3IR7B 3MXHP 3BGLA 4HI1A 3RAQA 1BMQB 3LGNA 2FJEB 1TL3B 2LQBA 4QIEA 1TL7A 4NCGA 3WC2A 3K89A 2Y0BB 1REVB 1B0PA 5D0HA 2X1GA 3W65A 2JJ4D 4B3MF 2RB7A 3DMJA 4UY85 4CYUA 1FJ7A 1IQZA 4ANCA 2D3ZA 2GJ2A 2BE2A 2AGPA 1RT3B 4WKYA 3NCRA 1VQLS 4DSEA 2H5JB 3CE8A 2BM0A 2YX1A 3LQVA 3VAKA 3M8QA 3QZ8A 4ILLA 2JOQA 3FUYA 1X9MA 4DQPA 2KM8B 4PAAA 1Q86T 3ZTSA 4Z37A 2FJWA 2F63A 2HHSA 1RU2A 3IRXB 1ZTWA 3W61A 2OH2A 1OWXA 3EDQB 4DCJB 1PBAA 1VYAA 4IFVA 1ELOA 4OZ2A 3HZGA 4AXIA 3MR5A 3CDUA 3FMWA 1HBUA 1BWEA 5FDLA 2QO3A 2J9DA 4Y2AA 1RT7A 1HNXF 4ZIVA 2VA3A 2AEJA 3ZXWA 4PWUA 2DHSA 1U45A 3EZUA 2AEFA 3UPFA 5E0OA 2N82B 1OY6A 1T02A 2MKJA 4CLTA 4U7UK 3V4MA 4QW9A 3NMAA 2OTJS 5KFMA 3OPKA 4WXWA 2WCXA 1KONA 5HBMA 1WOOA 3MAAA 2ZEJA 2BOAA 1BQNA 4PUOA 4PPZA 4J9NA 3KK3A 4JV1A 3J81j 4KBIA 4WFYA 5LXRA 2H48B 2VFUA 3D0IE 1U4BA 2OD4A 1TELA 1P9QC 3QJLA 4QR1A 2DY1A 1EJ7L 2W4PA 1C1CA 2JEGA 1WC3A 3EXYA 3CJQA 1NJIT 4RNOA 1TUGB 5KFXA 1KVIA 1MWQA 3OTOJ 4LSLB 1AB8A 1X5TA 2ZJQQ 3TVZA 4RBVA 5AE3A 2UVRA 1YJ9S 4LRBA 4HI2A 2XYHB 1H2UX 5HLFB 1X4FA 4X4VA 3D5MA 4ZITA 1A9NB 4F4WA 3ZZTA 1YJWS 3PCOB 2N4DA 2ZBIA 4DL0C 4M5KA 1GQEA 2I9SA 5A8WA 1KTVA 2QMWA 3CUNA 3OL7A 2W8LA 4NLSA 1W2BR 1IBLF 3KTQA 3SZ2A 1B4SA 1XNRF 3HD2A 5CD4H 1PO6A 1VHIA 3ITHB 1WHXA 2B8PA 4QYZJ 4TLRA 3GR1A 2OPRB 4WWSA 5KFAA 2Q6CA 4M5MA 2DHXA 4ZPBA 1LK5A 3HHLA 3MM6B 1V9OA 2W01A 1LNQA 4B3SF 3MR6A 3TP2A 1YWXA 2OMLA 4OL8A 2GVDA 3DI6B 5H9FJ 1HWKA 1XEZA 3C8YA 3NAHA 2DR8A 4KGMA 2OPPA 1U6ZA 1N4LA 3I0SA 3GJSB 3MTKA 1TMJA 3C6UA 3FQKA 2R7RA 2B56A 4F8RA 4C98A 1HPZA 3JQKA 4ECSA 4V1Ak 1D8ZA 2P6SA 3KG1A 5DGBA 3DLKA 5EWGA 1JLBB 1U25A 2HBZB 2QA4S 2OIHA 4N47A 1UFLA 5HROB 1DTQA 2C3YA 4Y6IA 4FNHA 1TUVA 2BJ7A 4ZIWA 1J5OB 2DH9A 3L3CA 3GIKA 2XSJB 3MPYA 4F7VA 1HIYA 3D3CJ 5EX3A 1UFKA 2KVIA 2HIQA 1NUEA 1SIZA 2R2TA 2MPUA 2XGQA 3D9BA 2XCAA 1N0UA 2CJYB 4OMFG 2H5EA 1TKTB 2D41A 2BJ3A 5HK4A 4DSKA 3LAMA 1HWUA 2LXUA 2HGLA 2ZUGA 2K06A 2YKQA 4B9NA 3NBPA 1TKDA 2M88A 1H3DA 1R0CB 4DR7F 3FCHA 2GIFA 3IG1A 5BR8J 4AL5A 2JFDA 2WVEA 3R5GA 3OVAA 1WD6A 4F04B 2WTFA 2GQQA 1HNIB 4QWCA 3G82B 3AB2B 4LF8J 3GIJA 3NXZA 1T3NA 4OYOA 2QLWA 4ED2A 4LF7F 3IWNC 4LFBJ 4OYPA 2IY5B 1EETA 1X4GA 2QJ3A 4M5NA 1NBEB 2MKKA 1Y5IB 2E7XA 3POTB 1HNWJ 3CMAS 1ROFA 4BBYA 1WC4A 5A0YA 3S01A 4LF4F 5HP1A 3L7OA 3IAS9 4RW4B 2EW9A 2FGOA 4XK8C 1B7YB 1CLFA 4X4OA 4YOEA 4C8MA 5A8RB 2XLKA 2C2OB 1U1QA 1S1WB 1NSQA 3T1HJ 4RNNA 3DLBA 2R7WA 2KXFA 2QEXS 2L48A 4C11B 5DLFA 4OZ3A 2IJRA 1XR5A 5B08A 2BJ9A 3RB3A 2FVPA 2XZDB 2N7YA 2ASJA 3EGNA 3M9NB 3A1YG 3DLHA 3V4IB 1CC8A 5KG2A 4DMZA 5GMDA 3HFZB 4IG0A 1FKPB 2NSBA 4R5PB 2EWHA 3L09A 1RHQB 3W2VB 3N0VA 2PN6A 1FCAA 1NSAA 4RWWA 2P9GA 4AT1B 5EX0A 3H2LA 2BMBA 4B3RF 2LDIA 2BJ1A 3DYAA 3B54A 4ES3A 3QRRA 2PDAA 4NA3A 5B0GA 2LA4A 3Q23A 3PDNA 5D4PA 2ZBPA 3NG8A 1HKAA 3J81Y 1JLEA 1RABB 1SKUB 3MM5A 2W7PA 3CSKA 1WDDA 5CQGA 1RTDA 2YQ1A 3I96A 1RT4B 4DN0A 1DZ5A 5T7LA 2FJDB 2IAJB 3MMCA 2CQ4A 1KDNA 1RHMB 3MD3A 2BABA 3BH6B 3AA8A 3BSOA 4LIWA 3FBEA 4DF8A 3DXBA 1CJVB 4NPOA 4EYIB 1BUXA 2KB2A 5LXYA 4BLGA 3RAXA 2EPIA 3UFCX 3LF0A 1HNVA 1JLAA 2XYPB 1X31C 2V34A 1Q1KA 5HMYA 2MLXA 4JI7J 3OFHA 1EAYC 1JQGA 3JYTB 2RDJA 1WUUA 2GIQA 2G1HA 4RKUC 1S6QB 2E1RA 3PG9A 3T9NA 1HFEL 4ECZA 4N5SA 4RX6A 5G4DA 2FVCA 2LKZA 2HAFA 3TAPA 3GJTB 1IKXA 1CULB 4RO0A 1VC5A 1V6HA 3RTVA 4JI2J 3BO2A 1VQ5S 3ILIA 2FHKA 4I69A 5D77A 4C8KA 4Y34A 2BUNA 1RBLA 4EUVA 2NYHA 1SH3A 3K5PA 2HQIA 2EG1A 2R8GA 2QYGA 1IWGA 2I0XA 4DG1B 2DNYA 2VFRA 5KFKA 2DNRA 4ZN1A 3KJNB 4CO2A 3MMAA 3KJFB 4AD6A 2B4PA 1IN0A 3AOAA 3OXFA 1G2EA 1VR6A 5I3UB 1QAYA 3H4BA 4JB8B 4XDCA 2KU7A 1KOHA 4WKRA 5L1JA 1FESA 2ZOGA 1VHFA 1DLOB 5KG7A 2VKRA 5LJ5Y 1AW0A 1WKKA 3N6NA 2HBRB 5E3AA 3EM1A 4B3TJ 4PQUA 3WQPA 1C2PA 4F02A 3J80U 1IUJA 2VFVA 4OYWA 1JKHA 1X4EA 2VUGA 2FC8A 1R89A 3DGPB 2AW0A 5KG4A 4CNZA 2IMWP 2DKOB 3HPOA 1H6KX 1S1UB 3N4WA 3R8YA 2KYZA 3T6JA 5HMWA 1XNQF 3UDVA 3GFZA 2E9TA 1R7IA 4NRTA 2V4RA 1VQ4S 1OIAA 4I6AA 1GX5A 4WCEQ 2I5JA 1LEOA 4OI1A 2EG2A 3SV4A 2YBVA 3GZ7A 1U2FA 1YJVA 3FKBA 1K1QA 3H2VE 4DX6A 5KFZA 1T8EA 1FWKA 1KC8T 2QSWA 2LXIA 3A8KA 1JNZB 3C14B 3PACA 4YY3F 3G9CA 3T41A 2LMIA 1YGYA 4DQSA 3KJVA 2M8DB 2BDPA 5B0DA 4CO1A 1Z4UA 4DV1F 2LQ5A 1Z1ZA 4Y0FA 1X7VA 2GC8A 1FK9A 2DXFA 2YWFA 1WG1A 2B3TB 5IM0B 2ZZMA 4GRSA 2J9EA 2E1AA 4ZJLA 1TQLA 2BJDA 1M90T 3MEEA 2ZHOA 4J9KA 4IO9Q 3GIRA 3M8QB 4UUWA 4NEYA 2DNNA 2YNFB 3BREA 2CVIA 2YPYA 2NZCA 5HQ8A 3HDSA 2D3O1 3TR5A 5GAHI 2CG8A 3OUYA 3CCRS 2E1PA 1B70B 2QL7B 3JXOA 2H51B 5KG1A 1CC7A 4MIWA 3NNCA 4WZMA 1YI2S 1N32F 2ZJPQ 3V81A 4G3IA 2OGUA 2HAIA 4DR6J 1Y11A 2DGWA 1S1VA 1HBUB 3MMBA 1O51A 5FDLB 3EGZA 4FNIA 4CLLA 5AXNA 5HO4A 4LF9J 2LEAA 4USUA 2IPOB 4U8VA 1SV5B 4OYMA 2B9YA 1H2TZ 2SXLA 5KFEA 2CJBA 3RR7A 1OY9A 3U27A 5B0FA 2AIRB 4DSLA 2HWIA 2IC3B 3KK3B 4J9UE 2DRDA 4D3HA 4FBUA 2ERRA 1N5VA 1R0AB 2ZNYA 2VBXA 2YKNB 1UA1A 3S6EA 2JC0A 1I94F 1X5SA 3UDLA 2GX8A 5F41A 2M4MA 3HKZD 4B9TA 2JLFA 3LWLA 1C1CB 5KFYA 4Q8EA 2VJUA 2V8VA 4X65J 2VDHA 2W8KA 1K1SA 4TY8A 1BLUA 4WPAA 1TL1A 4OYZA 2VG7A 1WACA 1RHUB 4TQSA 1C0TB 2Z30B 1T9VA 2PMZD 1FEEA 1HD0A 3W60A 4PG4A 2JZ5A 2JC1A 2U2FA 3CJKA 1CPZA 5JUMA 2M7SA 2MKCA 1Q7LB 4H54A 3LP0A 1BGXT 4OV6A 1T05A 3K17A 4YHHJ 3CC2S 2BZ2A 1N6QA 1S9EA 3R6LB 3TANA 3PTWA 4UY8T 1S12A 3TUZC 1KLMB 2FIUA 5IT9U 2EC0A 2WBMA 2ZH1A 4IOBA 1VLOA 5CYJA 3O44A 3DCAA 2WOMA 3BF4A 5K5MA 1HQUB 1RAJA 2IBKA 2RIJA 2W2NP 1VDHA 2EFOA 4L6V3 2RVJA 4QZVB 3TVYA 3NKYA 3HHLB 2UU9J 3PV8A 2O5DA 4WK3A 2HHVA 3UQSA 9ATCB 2FHJA 1J27A 3THVA 3OTBA 2ADBA 1WC6A 4Y65A 3X3UA 3SEOA 1VK8A 4GKKF 2A3JA 3NP5A 2V4JA 5C42B 4DPTA 5IFMA 1ZZNA 2W2MP 3QSYB 3LW5C 3BBFA 4WU3A 2WRMA 3H4DA 4KFBB 5E3RA 2C2NA 2NXCA 4DFKA 3GIIA 1QJHA 4AYBD 3C6UB 1J2VA 4OJGA 2GQCA 1HPZB 3WC0A 2OUGA 1ZPWX 1L3KA 2DR5A 3MFIA 2C2KB 3C16A 4JOUA 5EGYA 2Y1IA 5D4LA 2R8IA 2UUAJ 3HCXA 4OZLA 3MURP 4JI0J 2R7OA 2MZQA 4X4RA 2ASLA 4EMDA 2ZH6A 4ED6A 3WIUA 3EICA 5IV3A 2VG5B 4ID8A 2YX4A 4OYIA 1ZA1B 4MYTA 3KHGA 1HR0J 2KVQE 5T41A 1DJ0A 1R3NA 3DM2A 1N33J 5KFCA 3VALA 1YQHA 1QAXA 2E5LJ 4BC7A 1LWEA 4HTJA 1VRUA 2HNDA 1S0OA 1X9SA 1HNZF 3C15B 3CGIA 2OSRA 1DBDA 3SSQA 2VC0A 1WI6A 2CQPA 3NBPB 1AZSB 4U67Q 1RT1A 2M9KA 2R8HA 4H4MA 3GIMA 1K47A 2Y1JA 4E8UA 2MQ8A 3CJ5A 2GAGC 2GAHC 1SJ3P 3D1OA 2EKYA 1B99A 2L08A 1QM9A 2B5JB 4MTPA 1HD1A 1RAIB 2Z2MA 2BRLA 4AQYF 3PR4A 5KT5A 3FBFA 1EHWA 5F8IA 1E6VA 2VIHA 2CNOB 4TLQA 2E5IA 3CC7S 2YNHA 2GQ2A 1QE1B 4IOCQ 1GMWA 4CO5A 3GONA 2CJQA 3R2DJ 1IKWB 3L9ZA 1RI7A 2B9XA 5A0YB 5B0BA 2E9ZA 2V8GA 2Z2ZA 4GC6A 4OLOA 2RS2A 2QG9B 4DUZF 4ECYA 4ID5A 1KN6A 3QNWB 2ZFHA 3VWSA 4NASA 4CWBA 5C7PA 1VGYA 1NLKL 2NUUG 3H5YA 3AODA 2BJEA 1RTIA 1JLGB 3C2PA 4DFMA 3CDEA 1RISA 3W9IA 4DOZA 3ZZUA 3A3OB 2ZZTA 1VLYA 2FZGB 2XLIA 3FGVA 4AFFA 2CPFA 4B3OB 2QMUB 4F3QA 3AJ2A 1N5SA 3TAQA 2QTWA 3M30A 2QT7A 2WK4A 2MQOA 1R6YA 2YTCA 5KFWA 4FKYA 3U1MA 2UVVA 4IG0B 4KHPF 1RWXB 2JDJA 5CXTA 2RUGA 3Q0AA 4MJKA 1MMLA 4LF6F 3E01A 1DURA 3HI9A 3M2UA 2H4YB 3DDNA 1WG4A 3KUEA 1GXTA 3ZNJ1 5J2MB 3IGNA 3W7BA 1MNEA 1R31A 5HL7Q 2F8EX 3MCNA 2HLUA 1UWAA 3IN5A 2AYBA 2OEJA 4WIQA 3VGSA 1RGVA 2XY6A 1QAJA 1V5VA 2ABYA 3JAMU 4KJIA 4F4ZA 1GH8A 4PCQA 2DNGA 3R5DA 4NOHA 1GEHA 1OO0B 3EJMA 4L76A 3ULHA 3IBFB 3SDEA 4DU7A 3MM5B 3O1LA 1ZM3A 3PRDA 3Q8SB 1WEYA 1RYSA 1S6PB 1CJKA 2PI4A 2DXDA 4O3OA 3M8PA 1VIOA 1RCOB 4UOGA 1RP5A 4OIXA 3OL6A 5IXUA 2VPXB 3ISZA 1OQ3A 3QAEA 4UW2A 4ES1A 2UXCF 1JLFA 4L72B 4CIOA 4Q7AA 1Y5NB 1WOPA 3M7VA 4DZDA 4KV8B 1VQPS 1FRHA 1WSRA 1RKIA 1IBMJ 4NEZA 2MLYA 1CS4A 1KHVA 2VDIA 4ELUA 3NOCA 1AFIA 2ZD1A 1NK8A 4YEAA 4DUYF 4ZOSA 5B0AA 3MPUB 1U6BA 4HLBA 2R3VA 1H98A 1GMVA 4NYPA 2E7VA 2IJNA 1NKCA 3BSAA 2AJ1A 4B3SJ 3PW0A 1YBAA 4IH5A 1M1GA 2A18A 2QIFA 2QZ8A 4I2QA 4NLXA 1SUQA 4A8XA 3K8WA 1IKXB 4ZP9A 3NCQA 4BDPA 3RRKA 4PKDB 3V5RA 1OS5A 2XC9A 3NWRA 1U8SA 4OX9F 5LJ3Y 3DOMB 3MECA 3MEDA 3L4BC 2FVQA 2UVWA 1AA1B 2F40A 4YR0A 4DPXA 4LF1A 1T9WA 3TZXA 3QIPB 4FN5A 4TNOA 4ATNA 3LGMA 1F5CA 5CABA 1T03A 4FDFA 4CLPA 2NUHA 2E1CA 4CP5A 4ED7A 2BQ3A 4MK9A 4B9UA 2W2PP 3ICLA 1FRMA 1Y9OA 4UF4A 3UVJA 5D4OA 1XMOF 1UZHA 3MEGB 3MPWA 4RNHA 2AJQA 3SCLE 3F73A 4TU8A 1S77D 3JTOA 4XO0A 4BWJA 1Y00A 2KYXA 3ZZPA 4ECUA 3IXQA 5M2PA 3RBDA 2APOA 1NHKL 1IR1A 2XCPA 1KEKA 2MZ1A 1FJCA 1U1PA 1R8CA 2P5VA 2I6WA 2PA8D 3SV3A 4OX7A 3D2WA 3RYLA 2DH8A 1MU2A 4WFBQ 4P71A 2H54B 2ZZNA 3CCSS 4DV5F 2BBEA 3BO4A 2HS0A 2JHEA 2V9WA 1JXVA 1D09B 4HH1A 3HLUA 1LWFA 1AROP 3RBZA 3CC4S 1P6TA 4A8MP 3T1YF 3I87A 1WJ9A 4LF5J 3CW2C 3NAIA 2BA9A 2B9EA 2MSTA 3V6DB 2QE5A 2D9PA 1JXEA 4I7FB 2I5JB 4G1IA 3P8BB 2U1AA 5E41A 2HLTA 1X5PA 4ZVUB 4B9LA 5IZHA 2V8DA 5IQ6A 3NGUA 2CFXA 4CRJA 1TL5A 4J91A 1G7CB 1N52B 1ZAWA 4H4KA 3RJMB 2XMUA 2GA7A 4USWA 2OPQA 2YH1A 1WF1A 1VI7A 3KJVB 1FDAA 2MGZA 2V2KA 4WFZA 4FPRA 2HQFA 3KK2A 2K7KA 2DJWA 2MZSA 3AQOA 2Z58B 3GSDA 1C1BA 3FZ2A 2WVBA 1U09A 1NMEB 3M1VA 4OI4A 3CXCR 4MMOA 4ICLA 2ZC3A 3CDWA 5M2RA 1X4AA 1ZZFA 3D0GE 3KLHB 2AX0A 2LXFA 1SC6A 3LOUA 1HL6A 5A2QY 5A8KA 5MAOA 3W9HA 2V69A 4URSA 2RS8A 2IYIA 4DR3J 1U1KA 2H5IB 5E3QA 4DFJA 3LH2S 5KFOA 2F9JA 2X3DA 2B6AB 2L41A 2V4QA 5AXKA 4LFAF 1BWVA 4JV5F 3CCMS 3AD8C 2BE7D 1TU0B 3IM8A 2GVZA 4JI1J 3VGUA 2X51A 1S1VB 1RB0A 1T0TV 3BQ2A 2Z57B 4WBFA 1WORA 5SZTA 2QLFB 1FWPA 1H7XA 1XMBA 2W24A 3LO3A 4BCAA 4LBIA 4FYYB 4ELTA 2V0NA 3KMQA 4ZVTB 1TTHB 5A76A 1HBNA 2VICA 2RNEA 2CPEA 2A2CA 2YWEA 3RUBL 1Q0NA 4M5LA 2J8SA 3B82A 5AE1A 2EK1A 3PFEA 3MEKA 4IQMA 4QWEA 1LQ9A 5EWFA 2RQMA 1Q53A 1ZM9A 2VB6A 3ILLA 1F2GA 4RUAA 3HHDA 2XG8A 2WHOA 2OTLS 4OI0A 3GPAA 2OFGX 5A6PA 4HHHA 5KT2A 3H40A 4QWBA 2HEKA 1Q8KA 4K5SA 5KG5A 4NA2A 3DGVA 2VG7B 4X4QA 1DQAA 1RTHA 2KXHA 3PNIA 2R4FA 2W9BA 3M2RA 4IQXA 3D6TB 3RBXA 3CJSA 1RAAB 4DV2J 4G1QB 2KFZA 2B4UA 2XLJA 2C2DA 4YR3A 3R5JB 3JTPA 1WOSA 1N5YB 1CQMA 4ANEA 4DQQA 1Q5VA 1XMQJ 1Y3KA 1LXNA 3VAFA 2WVCA 5RUBA 3VF0B 2CWXA 5EWEA 5HVGA 3JSMB 4EWTA 3TO8A 2GV1A 1AFJA 5IWAF 4KO0A 2B51A 1M5OC 2I1RA 3C19A 4YFUA 3OBIA 2IBOA 3NGSA 4BWMA 2F4VF 1YVFA 4JI4F 3OSNA 1K0TA 1S59A 4L3NA 4PXDA 2WZ1A 5GAEI 1QSSA 4DR5F 3QGGA 1JLCA 1NPRA 1GX6A 2MTLA 2HWHA 3DLGB 1U6FA 1Y0HA 4UQTA 4PXCA 2D7SA 4KQZA 4U8YA 3G6XA 4I56A 1FDDA 3W8GA 4NYZA 1M5SA 1FX2A 1GK8A 1RA7A 4J9MA 3MAHA 2HS3A 3DRSA 3HVTA 4JI8J 3CJRA 1B3TA 4X4UA 3CCWA 3ET6A 4X64J 3I55S 2FVSA 5F0UA 2YQ3A 3RB0A 3I82A 5CH7B 3G8SA 4CH1A 3CCJS 4P2MA 5CZXA 5GADU 2CQ2A 5HQLA 4OZ0A 5J2QB 3EZ5A 2CPYA 3R9LA 4Q2LA 1U49A 4O3NA 2ZKTA 1PJ5A 2MY8A 4CLUA 1RCXB 5FLXU 4RW8A 2FLPA 4PQAA 1UVNA 5K8NA 4P52A 4ZPDA 4P2SA 1ICEB 2RILA 4ZVGA 3HHKA 1L5UA 2YPZA 1PILA 2ILYA 3D6MB 3VAMA 2CZ9A 3CB4A 1U0HB 3VHQA 4YB1P 3FSYA 3C6TB 5GMKa 2LU1A 5HMXA 2BKNA 1BQMA 3OFEA 2H4WB 4WFNQ 1U1RA 2HWTA 2KRBA 2W4CA 5KFQA 3W5YA 4QIVA 1VRUB 4C6AA 2RHQB 4USMA 5ETTA 4K0KJ 1UJ6A 3IA0A 2GCFA 2RAQA 2XWXA 4ZS6A 1N34F 4ECRA 1RACB 4FF4A 4JYAF 1FVSA 4DPOA 3SYZA 3QIDA 5HN0A 3IWXA 3KLEB 4U9RA 2HVIA 3MFHA 3G87A 3CPWR 2QSFA 1YRXA 1CJTA 5KT6A 2CJKA 3O5TB 1AT1B 3A13A 3EYZA 1IR0A 3AOCA 3LP1A 1FERA 5H9EJ 4OJHA 1OYEA 2HKEA 2QGFB 3RB4A 1QD1A 8AT1B 3IM9A 2W2OP 3PW7A 4DQIA 1K44A 2KT3A 5C24A 1B7FA 4AL6A 4X4NA 1TUWA 2ZM6F 4FYVB 2C2MB 5C25A 3L7PA 2RQKA 3MGJA 4PEOA 1WC1A 1RJJA 2Q1LA 4CM2A 4HKQA 2B0GA 2ZHAA 1WWHA 3B8HA 4EEYA 1F0XA 3PX4A 3D28A 4LMZA 2QYCA 4DX8H 3GWCA 2AT1B 5ETNA 1RT6B 3BR8A 3TRGA 3UNGC 1EP4A 2HRTA 3FMBA 3HHNB 3RZAA 3Q8YA 2L9DA 5B0CA 3GV5B 1RKJA 2MKYA 2XS5A 4Z7YA 4DQRA 2BQRA 4KB7A 3N6MA 1LKZA 3A12A 3MM8B 3CCLS 3HSZA 3DOKB 3OHAA 1RAFB 2N3LA 2HVEA 4F25A 2GJIA 1O8BA 3EPIA 3PJXA 4NLGA 1VC6A 2ZOFA 1RE1B 1S1XB 3O2IA 2VQFF 3E01B 1EQ0A 1VRTB 3ISNC 3M2UB 4DF4A 2I8EA 4HH0A 4Y28C 3TA2A 4XAKA 1IVZA 1U1OA 1K0VA 2PMWA 1TVRB 4OI6A 1WF2A 2HGMA 2QA1A 4BC9A 4B17A 4EBCA 1UEKA 1XERA 4ILMA 2RJZA 4P7TA 1UJ4A 1D9AA 2PFFB 1W7WA 2NQPA 2HZCA 4L73A 4PXEA 1VCTA 3HF5A 1UCNA 1DHMA 2FGCA 1KQGB 2BM1A 3M8ZA 3SDEB 4DR1F 2R7VA 2P9EA 3W5XA 1F3FA 4RW6A 2HFVA 1FFGB 1S4EA 1GT8A 2IRUA 3N5BA 4IH6A 3HT3A 2WONB 2XULA 4LFCJ 1CG2A 4K2XA 2W25A 3HFVA 4A48A 3OJSA 3I5BA 3BDPA 3NMRA 2CQHA 4DX7A 1FVQA 2CQ0A 2YXLA 1IQTA 1S9GA 3Q86A 3VGTA 1IBCB 1VJQA 2IFXA 3ZNUA 3W63A 2G0IA 1FRKA 4RW9A 4Q44A 1ZM2A 1UEVA 1NKEA 4XDDA 4IRKA 2AZ1A 3KG4A 4FVCA 3ZC4A 2QX0A 2B7CB 2A2DA 3BGOP 3MUMP 6AT1B 2ZD1B 4PPDA 3OTCA 2FQQB 2DGUA 1LW2B 3TNVA 4QYRA 2VASA 1OQ6A 4DLEA 3IS9A 3LP2B 3PRVA 1CQNA 3BDEA 2M0GB 5IT0A 1TKXA 3WZ0A 2AJ2A 2H3EB 4ZA1A 2BV3A 5J1EA 2Q43A 1H38A 1KOOA 1KLNA 4IH7A 1N8RT 3QLHB 1IKYB 1FHTA 3MR2A 5D3GA 2XBPA 3DRXA 1J5EJ 5D78A 1RXOB 3LA0A 3P96A 3BZQA 3M05A 4WP3A 4LRDA 2UUTA 5AT1B 1U2RA 2W7OA 4IRDA 1YK9A 2G0CA 3HVAA 2R2SA 3GYNA 4N77A 4F2RA 3MEDB 4A8WA 4KIAA 1B64A 4ZP7A 2CPZA 5HATA 4LF2A 1D1UA 5IS2A 4DV4J 3DRRB 1VFJA 4NMLA 1D8YA 3D7SB 2KRRA 3FRZA 1VBXA 2WSEC 3BYPA 5JVGQ 4X4PA 4R8UA 4K7QA 2DISA 1SPBP 4JV0A 1F5BA 3CCZA 1U0SA 1VQ6S 4FS1A 1JLQB 3NS6A 2DD8S 4MYUA 4EU0A 4MKAA 6FD1A 2MXYA 3UVJB 5L38A 4K4YA 4CTAA 1HWLA 2ZWPA 3OLBA 3O6QA 4PWWA 2EFQA 5ETVA 2V8PA 3VCDA 1VMBA 4O4GA 3CTRA 3PYDA 4I0WA 2HMIB 3GJRB 2Q79A 3OTOF 3K5MA 4LSNA 5L9NA 4QCLA 2YNGB 1NO8A 1TP7A 4NLOA 1VQNS 2XS2A 4X66J 4EO6A 4P2XA 1C0UB 2J0SD 5J2PB 3CD7A 1S99A 1LV5A 2RMLA 1HHTP 4USJC 3CVKA 1U1NA 2HHUA 4DL5A 3UD3P 3TUJC 2CADA 1JB0C 2EBGA 1RTJB 4ZMMA 4AXJA 1XC9A 3BPDA 1HYSA 2VONA 4CLSA 2DCUB 1UZDA 1VQOS 3BGRA 2UUCJ 2K1RB 1HQEA 2XZTB 3R7BB 1GXUA 3UCGA 4ZJOA 4ES2A 5DJBA 1URRA 2NPIA 1HMVA 4PYDA 5L1IA 2PEBA 1VK3A 3ADAC 3MZIA 2EC2A 2YKMB 3JQMA 4P7VA 4EFAC 4NMXA 1DFDA 3R2CJ 3FFIB 4M5JA 4L75A 3M9OB 4CM0A 4M5DA 3S7RA 5JVHQ 2E1MC 4C0OC 2FY1A 4V19X 1HW8A 3UD4P 2UV8A 2MDAA 3Q89A 2HHHJ 1FE0A 3Q2TC 1YBTA 2MHNA 3M1VB 1H74A 1XK8A 2V5HG 5DZ7A 5DG7A 2Q6BA 2HRUA 1N36J 4DL6A 4KHPJ 2NS1B 1RAGB 3W5ZA 5EUHA 4CLKA 2NXJA 4OFZA 4LSZB 1ZTTA 2PD1A 4PG7A 4RUCA 4QW8A 1HBOA 1P27B 4MT1A 2RKIA 1U26A 4RUHA 3M8YA 5CYMA 3NLCA 2GW8A 4ECXA 4K4TA 1F60B 1ZS6A 3M2VA 5IC4B 3HXMA 5DZ6A 2F65A 3DRYA 1WEZA 3HVWA 4WYWA 3V2UC 4RBTA 4GVBB 2HHQA 1Q8LA 5BYQA 2QA4G 2NXNA 4IKAA 4K8RA 2B43A 2YWHA 3WDOA 2ZH9A 3Q83A 5LT5A 3DLEA 1KFSA 4EO8A 2FHMA 3DFEA 1KWMA 1F5AA 2XMTA 4W98A 5H1SV 1FX4A 3M8WA 4LBHA 4JI6J 5BR8F 3NNHA 1XBWA 2C3MA 3WIVA 1NDCA 4ZHRB 4DR4F 3GFHA 1TL3A 1MWYA 3Q8PB 1HI0P 5KOWA 5C2GA 4LF8F 4NZ0A 2ZH3A 1REVA 5AE2A 3M32B 1F6TA 3UR0A 4LFBF 5BYRA 5K9FA 2RT3A 4ZVFA 1LOUA 2DITA 2OELA 3LTOA 4GKJJ 2WBRA 2E29A 2J6SA 1WELA 2RHSB 4NLVA 1JJ4A 1RT3A 1BQXA 1HNWF 4I6WA 5GVQA 1FJGJ 4JI5J 4P9SA 2OMOA 2W9AA 2AU0A 3EZOA 4QOTA 3DKDA 1ZPVA 8ATCB 3CJ8A 1FEHA 4QYZK 2EXUA 1X0PA 3GFYA 1EIYB 1UVKA 1VISA 1PYSB 3CDBA 3IRXA 5HVHA 2DR9A 3HULA 5B09A 3T1HF 1SC4B 2VOPA 1MMDA 1ACMB 3PM9A 3TA1A 5H9FK 3OD2A 3HO1A 2ATCB 1Q8IA 1L3VA 2G9OA 2K3KA 1AUDA 2UUBJ 1T9TA 3IBWA 4FPIA 3F0NA 2BACA 1S10A 4N76A 5T14A 3QMQA 2VQEJ 2LECA 2LP4A 3ZTQA 3MUTP 5CCLA 4PG8A 3PW4A 2ASYA 4FXWA 5F8NA 4DZ6A 1IR2A 4EYHB 2DIVA 2M2BA 2VODA 1U1LA 3MM7B 2XSFA 1N54B 2ZBCA 4GO5X 4C0BA 3BV8A 3ET6B 3JSYA 3SSRA 4NXMJ 1X5OA 2HPUA 3QT7A 3KK1B 4ZVSB 4WFAQ 2CPJA 1S57A 4QPTA 2RRNA 5KFBA 2G1DA 1FNXH 4JV2A 3MCOA 4LSLA 3TJAA 2E66A 3PKMA 1F9EB 2CPDA 3NL0A 4ECTA 2X1BA 2EFVA 4CZCA 1GAOA 4DEZA 4WK1A 3UWTA 3BJYA 3M9MB 3J80Y 4ZPWR 4DPYA 5LMNJ 5F3TA 5HLFA 1FA0A 4HACB 4ZVEA 4A8QA 4J37A 3J7Z5 3T5JA 4USHA 1RWNB 1IKVB 1TZ0A 2LEPA 4WF9Q 5ETMA 3GYXB 3AFGA 4PR6A 1FWLA 5G0RB 3SXLA 4UOFA 1TV6B 3HSJA 1FT8A 3AJDA 4F0KA 1S1TA 2AX1A 3NCPA 1S6UA 5HVFA 3SBMA 2FVRA 3HSGA 3ITHA 2CRLA 2BR0A 2Y3YA 2OPRA 3VVTA 4JI7F 1M1HA 1N56A 2DRAA 3CD6S 4C7QA 4I4BA 3MM6A 3E8OA 1RWUA 4P73A 1NK4A 3SMZA 3EVMA 3Q22A 3SI8A 4IR9A 4J9VA 3QO9B 2RDIA 3OR1A 2V2ZA 1X9WA 1SCJB 2MYFA 1YITS 2J8AA 2CA9A 4A8FA 2DEIA 2J7WA 1ZA2B 4TKTA 3DI6A 2ZNZA 2V63A 1PSDA 3M6WA 2J9CA 1NDKA 2MKHA 3RAMA 1CBKA 5I42B 4WU2A 2IVFB 4Q0BB 3BS9A 4JI2F 4MK7A 2LLZA 4YN3B 4YUDA 4AE5A 2RF2B 4I1TA 2PFDA 1OY8A 3KLIA 3HSDA 2CPHA 4KGXB 3H5UA 1JLBA 2V2VA 4N8NA 4PRFA 2CJXB 1NNDA 2B9WA 2BXJA 3CNQP 2VL1A 4DUTA 4HT5A 1ZAVA 1Q7YT 3W8PA 3PEHA 1J5OA 3KUHA 2XSJA 2CQ3A 1AYEA 1XQIA 2XNRA 5U47A 1RAOA 4YMEA 1SJFA 5DDQC 4UUXA 1TKZB 2VA2A 2LYVA 2XHWA 3OQ2A 1TKTA 2W9CB 4NXNJ 5J1PA 2VOOA 3R6GB 2OI2A 3A3PB 2LQJA 1YRTA 2Y1RI 2KFYA 4Y3CA 3OL8A 3CT9A 2RD5C 3ONQA 2HQGA 5CHCB 2LFVA 4ER8A 3QYYA 4B3TF 5K8OA 1YZ7A 2J9DE 2OFHX 3DN9A 3OT9A 2UXDF 2JVOA 2DRBA 1H73A 1RWKB 3P49B 3HFKA 1HNIA 5GAGU 3G82A 1RWOB 2QMXA 3HZEA 2ZE2B 1SVDA 1Q95G 2CQCA 3CEDA 4KH0B 4QBUA 5J2NB 4MKYA 4NLQA 4IDKB 1K73T 5J1NA 2VG6A 1W2IA 3TI0A 2OEMA 2DNPA 2Y1LB 2FUG9 4NX9A 1NRKA 3POTA 5ETKA 5LOQA 1H2VZ 1UW4A 2YWKA 1OJ4A 3UN5A 1ZH5A 4DV0J 2VD3A 1F3VA 5THWA 1RT5A 3ZZZA 4ECQA 2UXBJ 3JS9A 3G2XA 1FNMA 4RW7B 1WKJA 1S9GB 5A8RA 1CJUB 1KQKA 3T9ZA 2CWKA 3PIOQ 4O3RA 4KGKA 3PW2A 2ZVSA 2XQCA 3CCUS 2CNNB 1S1WA 4NZ6A 5K14B 3TJ8A 3KLFB 1NM2A 2XTJP 3IFEA 3BKTA 2MQNA 3KWMA 1I1GA 3DOLB 4J9OA 2QV6A 3IGVA 3QWUA 2XEXA 5FJ4A 1UEUA 2WVFA 1LFWA 3AOBA 5F3ZA 5MLCV 5A2QU 3V4IA 1S7IA 5D8HB 2IA6A 1FKPA 1LWCB 3JTNA 4R5PA 2G2OA 3GG0A 1TKXB 3W2VA 4A46A 4WTYA 4K5RA 1NK7A 3CJ4A 2LCWA 4HT7A 3RW7A 3GE9A 1SH2A 3LGHA 5SUHA 4C8YA 3N79A 5AXLA 4LUBA 3D6FB 5ADZA 3CCQS 1RWMB 1YIJS 1TK0A 2IRXA 2W7AA 3AT1B 3GFXA 4ZCMA 2C3UA 3QGIA 1BY9A 4O23A 1G6BA 2QFJA 3DRPA 3J7A1 3E51A 4R0JA 3CIZA 5CYQB 3OR2B 2GIRA 4H4OB 3TUIC 4ZVRB 4IYQA 4R25A 4DL7A 4DCOB 1PCAA 3F56A 3W1YC 4LF9F 5KG0A 3OVSA 2CZVC 3I6PA 4URGA 4XPCA 1RT4A 1DQ9A 3P3DA 4F0HA 3UW1A 4S0MA 2KL8A 3OXLA 2QFIA 1RADB 4ITSA 1CEZA 4V19J 2BE9B 3A8JA 3EX7B 4FBTA 1GTEA 3AB4B 2IAJA 3CJTA 1KTQA 1MMNA 2A10A 3E2EA 4F0MA 2DGTA 1F2HA 2AKWB 2YWGA 4DR2J 1AXQA 4CDIA 1CJVA 1I6JA 3B4MA 4ZPCA 2DNLA 1HWJA 1VC0A 4X65F 1JK9B 5E5NA 1OPIA 4DCPB 4CH0S 2ALYB 4LSNB 5KFVA 2CVEA 3ENWA 3W2WB 1TAUA 1S6QA 4O4RA 2J76E 4KHMA 4CI0B 4C4WA 4QIWD 2KZMA 3TAMB 4Y2CA 2NR0A 4F50A 1IBKJ 4ED4A 2COLA 2F4FA 4DV3J 1UW9A 1CULA 4YHHF 5KG6A 1HYSB 2LQ8A 3BH7B 3RU0A 5I3PA 1YBUA 3BGRB 4LT6A 1HQEB 5BYSA 3KLGA 3R7SB 2F8HA 3D0HE 4OQJA 3HX9A 1HMVB 1WTFA 1NSKL 4LJMA 3M4XA 2M3DA 2DGQA 2FJBB 2YVSA 1E6YB 4Q43A 2J7UA 3HJVA 2KG1A 4DG1A 4C0HA 2WB1D 4K59A 3IWLA 1TL7B 2UU9F 2NCKL 4NCGB 4EGLA 3AJ1A 3Q8QB 3R7NB 5E3CA 1EB0A 4J9PA 1BE4A 3DMJB 1L3UA 4NI2A 4CYUB 4ED5A 3IR5B 5ETSA 2DGSA 1FDBA 4N41A 4ZLPA 1NHUA 3AY0A 5I3UA 1MROA 1WNEA 4RNFA 2BE2B 1S6OA 2HRYA 4ZP8A 1N5TA 4C9DA 2MQMA 1FTCA 1RWPB 5KFPA 4QQBA 1FXDA 4CCHA 1DLOA 5EN1A 1Q81T 4EK2A 1PYOB 1D9FA 4LRCA 2V2QA 4CO3A 4ED3A 1UVIA 3ELHA 4NLTA 1HBOB 3HP6A 3K5NA 2UUAF 3JQJA 4HHUA 5F9LA 3AHPA 3T6BA 4KYZA 4ZLNA 4JI0F 1SKWA 3DGPA 1GFWB 4K4VA 4IFVB 1SKRA 1S7HA 2M70A 3N01A 4W92B 2YWWA 2IVYA 1KS2A 2XMWA 2ALZA 4NLDA 1RT7B 1HR0F 3KLVA 2EKNA 2BVZA 2R7XA 4ILRA 2DT9A 3JAMY 1N33F 3BSCA 4DJBA 2E5LF 4PG5A 3DC2A 2BKPA 2VPZB 1D0EA 1VQSA 2CZ4A 3OHBA 5DQIA 4KY3A 1NDLA 5HBMB 1BXNA 2VJVA 3MAAB 1UPMB 1BQNB 4PUOB 2WAQD 3PIPQ 4TYAA 4O3QA 4LRFA 5BJRA 5L1KA 4JI3J 4RUBA 3C14A 2E5JA 1RK8A 3TOQA 1FKAF 4X62F 1SJ1A 3W9JA 2CQ1A 4WP9A 5L46A 3TYTA 3I32A 2XM3A 1WF0A 3ENAA 4USKA 3TZWA 1TR0A 4OYBA 2WW8A 3OXGA 1S49A 3FCWA 4F4AA 4FYDA 2A1BA 3CJ3A 3ENQA 3VQTA 1XJWB 3U02A 5IM0A 1SL0A 2N3OA 4KT0C 3H5XA 1FD2A 3AD9C 3OSPA 1UVJA 4QR0A 4M94A 2HVDA 5DM7Q 2HGNA 5IV4A 2YNFA 1UKUA 1YHQS 3HVRA 1FNOA 4ZCIA 5A8WB 3OLAA 3N6LA 2MLZA 4KSEB 1ZYQA 3M6VA 4ED8A 1S4FA 4ZCKA 3SSSA 5AJ3J 1O5JA 5L9XA 1YRUA 1RT2A 4H4KC 2DB1A 2D74B 1SC3B 1KBRA 3I4PA 1F1BB 3ZTOA 3ZZ0A 2R42A 3MOZA 2HFZA 3GV8B 3TWZA 4ENOA 3M6XA 1TK8A 2QLJB 4CO0A 4CLYA 3UDEA 5HANA 1HWIA 1PYTA 5ETQA 2VC1A 2OO4A 1WI8A 2O66A 2EEYA 3F44A 4C8NA 1SV5A 2VHGA 3EPGA 2D9OA 1NPKA 2GVDB 4MKBA 2DHGA 2Z4PA 3DDKA 3IMQJ 2N7CA 2IC3A 2OPPB 2KJWA 1NZ8A 3I0SB 1R0AA 1FRJA 4OX6A 2CDQA 2YKNA 3VVUA 3O3LA 4P2FA 4KAIA 3JSRA 4DV6J 2YQ0A 4TVAB 3K58A 3DLKB 3EDRB 5DS7A 3QPIA 4LBPA 3KNGA 1DTQB 1M1KT 1X4HA 4RLEA 3EGWB 4DV7J 4DL4A 2XWYA 3U1NA 2R9LA 4MAKA 5DRKA 1C0TA 4GC7A 1RA6A 4WIIA 1QVGR 3P5TL 1EZZB 3NS7B 4OHVA 4PABA 2BW7A 4P74A 5K8PA 4ZLLA 1H0HB 2E7WA 2IRYA 3CJ2A 2BOPA 1MG7A 1APSA 3QT8A 3FBCA 3TA0A 2DO4A 3HMJG 3KYLA 3H2UB 1NJWA 1N5QA 3OV7A 1KRPA 4DPWA 1KLMA 2FHOB 5LMUJ 1QAIA 1CSJA 1IBMF 4ECWA 1S1TB 3CMQA 2F9DA 3BQ1A 1S72S 2POKA 2KDOA 4JP8A 3IG1B 4NCAA 1HQUA 4IOAQ 1PAUB 4K50A 2LQ9A 5M2UA 2GHPA 3KG0A 1JJHA 3THPA 2GHVC 1YJUA 3MHYA 1FO1A 1O6XA 3QGHA 4DN9A 2C2RA 3OR1B 2DVIA 3NY0A 4B3MJ 3FEYB 5DETA 1EETB 2ZDPA 1Q4RA 1WDTA 1VQ8S 2YKPA 2XS7A 4DFPA 2UUWA 5C42A 4X4SA 2Z0GA 2OD6A 2YH0A 1WHYA 1D3WA 4KFBA 4F67A 3RR8A 3BB5A 3S1TA 3P6YC 4ZDNA 2MY7A 5HP1B 3M8SA 1G3OA 3KLIB 4GVLA 3W66A 3TEGA 2KXNB 3NS5A 3MAQA 1RLDA 5F8LA 3K59A 2WW4A 3PKYA 3PJWA 3IAM9 3N28A 3R3TA 4URQU 4Q45A 2PE8A 5LSOA 1ZETA 2Z2LA 1FXLA 3BKUA 4RU9A 1SBRA 2VG5A 4WXOA 4M5HA 4HEA9 3TW0A 3MTJA 2DHHA 1HNXJ 3GP9A 2JRSA 5KFNA 2R7QA 3HJFA 2EVZA 1JNRB 9RUBA 3GU0A 4OHZA 1KKHA 3C15A 1M5HA 3VZIA 1GXLA 2GMLA 1WHVA 2DY9A 1X60A 3VTIA 2VZ9A 5I4MA 1FRXA 4DL2A 4ELVA 2BRKA 3RW6A 1RUSA 2MHEA 4NRUA 4KTQA 1AZSA 1UWBA 2FJAB 3KKFA 2DPIA 3S8SA 3DYAB 1EKSA 4LRAA 2HNZA 3J7ZT 2ACYA 5E3PA 4IO1A 3P5BP 4K2JA 2L9WA 5C5JA 4DR4J 2B5JA 1TL4A 1QTMA 4USVA 1JJ2R 3KMSA 5HQMA 5D0GA 2XO7A 1JLEB 1V3ZA 2AF6A 2CNLB 1PJ7A 1SI9A 4LF5F 2GO8A 3H8YA 3M6UA 4RBUA 1QE1A 2WSFC 1RTDB 4HYKA 2VG6B 4WP8A 4ZVPB 1IKWA 1ZBTA 3ZZRA 1TAQA 5T7LB 4YS2A 3MUVP 2Q66A 3MDFA 4OLPA 1NSPA 5BXIA 1RT5B 3LUYA 2KHDA 1HA1A 3MMCB 5IT4A 2OPSA 3TUPA 2NZ4A 5F8GA 1XR6A 3L7UA 2BW2A 4F4KA 1IBLJ 4OJ1A 1JLGA 4KPYA 2C1EB 2VFTA 1XNRJ 3EMTA 3JSBA 1F9FA 2FD2A 2MJNA 1HNVB 1JLAB 3FZBA 2W2QP 4B3OA 1FKOA 4UQGA 2AP6A 4I6YA 3GILA 2ZJRQ 3MWBA 5HI7A 4A47A 2CNKB 2P8IA
chains in the Genus database with same CATH topology
5ETVA 4CYUA 1CBKA 1EX8A 2BMBA 4M5HA 3IP0A 3HCXA 5ETNA 3HSZA 3MCMA 4M5MA 3MCNA 1IM6A 1TMJA 4F7VA 5ETLA 2F65A 3MCOA 5ETRA 3KUHA 1RU1A 4AD6A 3UDEA 4M5JA 4M5IA 5ETKA 1EQ0A 3UDVA 1TMMA 3HD1A 1RU2A 1Q0NA 3HD2A 3HSJA 4M5LA 3QBCA 3ILOA 1RTZA 4PZVA 1F9HA 3KUGA 5ETQA 1EQMA 5ETOA 4M5GA 2CG8A 1RB0A 1RAOA 3KUEA 3HT0A 5ETPA 3ILIA 4M5NA 4CRJA 4CWBA 2QX0A 5ETTA 4M5KA 2F63A 1HQ2A 5ETMA 5ETSA 3UD5A 4CYUB 3HSGA 3ILJA 1G4CA 1KBRA 1DY3A 3HSDA 3ILLA 1HKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETV A;  4CYU A;  1CBK A;  1EX8 A;  2BMB A;  4M5H A;  3IP0 A;  3HCX A;  5ETN A;  3HSZ A;  3MCM A;  4M5M A;  3MCN A;  1IM6 A;  1TMJ A;  4F7V A;  5ETL A;  2F65 A;  3MCO A;  5ETR A;  3KUH A;  1RU1 A;  4AD6 A;  3UDE A;  4M5J A;  4M5I A;  5ETK A;  1EQ0 A;  3UDV A;  1TMM A;  3HD1 A;  1RU2 A;  1Q0N A;  3HD2 A;  3HSJ A;  4M5L A;  3QBC A;  3ILO A;  1RTZ A;  4PZV A;  1F9H A;  3KUG A;  5ETQ A;  1EQM A;  5ETO A;  4M5G A;  2CG8 A;  1RB0 A;  1RAO A;  3KUE A;  3HT0 A;  5ETP A;  3ILI A;  4M5N A;  4CRJ A;  4CWB A;  2QX0 A;  5ETT A;  4M5K A;  2F63 A;  1HQ2 A;  5ETM A;  5ETS A;  3UD5 A;  4CYU B;  3HSG A;  3ILJ A;  1G4C A;  1KBR A;  1DY3 A;  3HSD A;  3ILL A;  1HKA A; 
#chains in the Genus database with same CATH topology
 1KVJ A;  5KFU A;  2IM3 A;  1SH0 A;  2FB0 A;  3HHL D;  2HHW A;  1S0V A;  1YSJ A;  3NNA A;  5J2M A;  4DR3 F;  3HM9 A;  5B7W A;  3CUL A;  1MN7 A;  4RU2 A;  1ZAX A;  1MW7 A;  7AT1 B;  2HUR A;  4J5O A;  1HHS A;  1KD1 T;  3ISN D;  3DRP B;  4JI1 F;  2KJV A;  4M5I A;  4ZPT R;  4J9Q A;  1QDU B;  2KTQ A;  1D9D A;  1TFY A;  1S6P A;  3UO0 A;  5DQG A;  1SXL A;  1U02 A;  3MMA B;  5FLX Y;  3MMJ A;  3PYF A;  1QSL A;  2XI3 A;  5DQH A;  4DS4 A;  4ZP6 A;  1R8A A;  3UCZ P;  1P1L A;  4A4J A;  1M5K C;  2XMM A;  3AXK A;  5CD4 A;  3BR9 A;  1RBA A;  3EUN A;  1S5Z A;  4KV8 A;  2KZZ A;  1S79 A;  4F26 A;  4FF2 A;  1B0V A;  3QJJ A;  3NRB A;  4XPE A;  4ZJQ A;  3WX8 A;  2MZT A;  5F0W A;  1U7L A;  4DR7 J;  2WB4 A;  1FE4 A;  3EVW A;  4PQU B;  4HHJ A;  2C2E A;  4TQR A;  2GZO A;  1EQM A;  1JKH B;  1V3R A;  4RPF A;  3GV7 B;  4UZB A;  1UVM A;  3WHI A;  4DV2 F;  4LF7 J;  1CVJ A;  1JWW A;  4IFY A;  3UNY A;  3N5F A;  1G1X A;  1XMQ F;  3CCV S;  4KRW A;  2FJV A;  3FCV A;  2K2P A;  2HQ3 A;  3W64 A;  3D3B J;  1LXJ A;  3VZH A;  3UR3 C;  1DAR A;  3FC9 A;  3I0R A;  3LWM A;  4LF4 J;  3KLG B;  3DOM A;  1XWL A;  2BAN A;  2OLW A;  2JWN A;  1IM4 A;  1B0T A;  1LWX A;  3QIP A;  4KKO A;  1XR7 A;  1O0P A;  3FEZ A;  2BKO A;  3RBE A;  4YB6 A;  2GNK A;  5KFJ A;  4NI2 B;  2AMC B;  1T7P A;  1FK9 B;  3MEG A;  4P72 A;  4A8O A;  4CQ1 A;  4JI8 F;  4DPU A;  2X7I A;  4KR0 B;  1MRO B;  3MM9 A;  4OHY A;  5IQQ A;  1TFW A;  4X64 F;  3KHH A;  2ILZ A;  2R8J A;  3MEE B;  1KNZ A;  2DPJ A;  2VF3 A;  3J7Y I;  1Y5L B;  3QZ7 A;  2VBZ A;  2E5G A;  4CO4 A;  2X1A A;  1DTT A;  3KNA A;  3Q2S C;  1SL1 A;  4G65 A;  2HBY B;  2CXE A;  4B3R J;  4C48 A;  4NLW A;  1XN9 A;  3OUY B;  1SQE A;  3AA9 A;  2K8G A;  1HAR A;  2EK6 A;  4WE1 A;  3UN2 A;  2UXD J;  2KN4 A;  3ZZY A;  2RU9 A;  2HS4 A;  2O01 C;  5HMZ A;  3V81 B;  4DSF A;  3T1A A;  1GMU A;  4CH7 A;  1TMM A;  3GLJ A;  1S0M A;  3TVK A;  1RWW B;  3MMB B;  2R7U A;  2JLG A;  1YG0 A;  2UV8 G;  1Q78 A;  3V6D A;  2FPH X;  2GJF A;  3MR7 A;  2P2C B;  3PVX A;  4I7F A;  1N88 A;  2QLX A;  3ZTR A;  1YJ7 A;  4MFB A;  2PI5 A;  4K0K F;  4X2B A;  1PG5 B;  2V9K A;  2DNM A;  1Y10 A;  3PHE A;  3SQG A;  3GB0 A;  3PFO A;  3TZY A;  1L3T A;  2XI2 A;  4OZ1 A;  4RL1 A;  3UCU P;  3NGT A;  2C3P A;  1AUS L;  1MWZ A;  1WKL A;  3OVB A;  2DNO A;  5KFS A;  4N7T A;  2H65 B;  4J7C A;  2R2U A;  4KHR A;  4TY8 B;  1TL1 B;  1FJE B;  1L3S A;  1M0S A;  2J0X A;  5B0E A;  4O0N A;  4PWD A;  1LW0 A;  5GAH U;  4YB5 A;  1VBZ A;  2C42 A;  1UVL A;  3KLH A;  2P6T A;  5KG3 A;  1KSP A;  2R2R A;  1S0N A;  2J0Q D;  5KAK A;  3CJK B;  5K8M A;  2MQQ A;  2HFS A;  4ZVH A;  3LP0 B;  4CLF A;  2GGP A;  2JVR A;  1VS3 A;  1T05 B;  3M8R A;  4QPX A;  1N6Q B;  1S9E B;  3MPV A;  1C4C A;  1HI1 A;  4TU9 A;  4K4W A;  2DIU A;  2G0J A;  4DS5 A;  3QFH A;  4KC5 A;  3SIP B;  1HQ2 A;  2GO9 A;  4ED1 A;  1FXR A;  3BO3 A;  2B6A A;  2CQD A;  1QLN A;  4AND A;  4QIG A;  1YTY A;  2F1F A;  2WOM B;  1UFW A;  1RHR B;  1RT2 B;  4F3O A;  3SCI E;  4Z2X A;  1FTR A;  2D1C A;  3SFG A;  3LAL A;  2V8H A;  4QR2 A;  2XY5 A;  3RB6 A;  3LAN A;  3W3S A;  5L1L A;  2XGP A;  4CLW A;  1R8P A;  3T5H A;  4YP3 A;  2ZH2 A;  3BKF A;  2FC9 A;  1UTA A;  3G96 A;  4OYA A;  2QL9 B;  4CT9 A;  4OZJ A;  2XB2 D;  2FYX A;  4DHV A;  3CIM A;  2V4J B;  5IC6 B;  1P9Y A;  2DNK A;  3C66 A;  4ZVQ B;  1KR4 A;  2LDY A;  1A6L A;  3ZO7 A;  3J81 U;  4OHX A;  3TQ1 A;  1Y4Z B;  1ULR A;  1FD8 A;  4KE5 A;  1RBO B;  5LM7 E;  1KQF B;  4EI2 A;  3GYG A;  2CQG A;  3C16 B;  4MK8 A;  4CLZ A;  3PYG A;  2HHP A;  3LPY A;  1RZM A;  3PYE A;  3ZTP A;  2CJA A;  2RSQ A;  4NWB A;  2JEI A;  3Q24 A;  5KFR A;  1WHW A;  2CQI A;  3R1L A;  5GAD I;  4G1Q A;  4LFC F;  1R6V A;  2IM1 A;  1N5Y A;  2B4V A;  2MKI A;  1I5O B;  3QSI A;  1XNQ J;  4LR8 A;  3DM2 B;  2AJ0 A;  3CJ0 A;  4LQ3 A;  1NXI A;  2JLE A;  4M95 A;  2B8Q A;  4UOC A;  5LL6 d;  2HIY A;  2YNI A;  3TX8 A;  3JSM A;  2PII A;  1LWE B;  4WTO B;  2DH7 A;  2C3O A;  2O3D A;  2HND B;  3PEJ A;  4UTG A;  3BEG B;  4NLP A;  4IRC A;  2KH9 A;  1RT1 B;  2F5G A;  4RNM A;  4H4M B;  4HVZ A;  1PKU A;  2JSX A;  4DWI A;  4YY3 J;  5H9E K;  3PO5 A;  2HFN A;  2PT0 A;  2EFP A;  4NYO A;  3QRP A;  2XYG B;  4Y2M A;  2D69 A;  1IJF B;  4LVO P;  4I67 A;  3DLG A;  4KGV B;  3DLL Q;  3PXG a;  2NSC A;  1T11 A;  4A8K A;  4DV1 J;  3KDN A;  1Q5Y A;  2LVW A;  2C2Z B;  3E3X A;  1E6V B;  3BN7 A;  4Y00 A;  5LSL A;  3QJP A;  3AQP A;  2AGQ A;  4LIR A;  2XNQ A;  2YNH B;  3I9V 9;  2MB0 B;  3I4H X;  1J5E F;  3H25 A;  4DI6 A;  3VGV A;  1DAX A;  4ZPV R;  4K4Z A;  4OX8 A;  2KM8 C;  3X1L B;  3WBZ A;  4AUK A;  1QUV A;  3A8I A;  1YDL A;  4L3K A;  3VV2 B;  3NOG A;  4ID5 B;  2IHR 1;  5F8J A;  5J2Q A;  3Q8R B;  1U48 A;  1SQF A;  4DV4 F;  2NXE A;  2ATL A;  2HZV A;  4B9S A;  3QRQ A;  1RTI B;  1MLA A;  5DDR C;  1YJT A;  1W25 A;  5I3Q A;  3P45 B;  2RQ4 A;  3VAH A;  1N32 J;  2DNZ A;  2FDN A;  1U0H A;  3MI7 X;  1H72 C;  3C6T A;  2J6T A;  2XO6 A;  4ETX A;  3UE2 A;  2MQL A;  5DGA A;  3M30 B;  4I2P A;  1RLC L;  3I5A A;  2DHA A;  2P9C A;  2K3I A;  2OHD A;  5AXM A;  3GG1 A;  2LA6 A;  3QAT A;  4DSI A;  4O3S A;  3SCJ E;  3ILJ A;  2AEM A;  2YKO A;  1NJX A;  3FSX A;  3IP0 A;  2JEF A;  2CUY A;  2Y0S D;  2QN6 B;  4C8O A;  1M5V C;  2I2Y A;  1UAW A;  1UWB B;  2V68 A;  4U7U D;  3KLE A;  3BYR A;  2HNZ B;  3L95 X;  4X62 J;  2PA3 A;  1N48 A;  4QU6 A;  1I94 J;  4X66 F;  2RU3 A;  2F8M A;  1K8A T;  4HDG A;  2HK3 A;  1PIE A;  5DDP C;  2JEJ A;  5KFT A;  1YLX A;  3EXC X;  3CDA A;  1NKB A;  1CJK B;  1RSC A;  3M8P B;  2UUC F;  2X1F A;  2VH7 A;  2ZH7 A;  5KFH A;  1UPP A;  3AAW B;  2R7S A;  4Q8F A;  3H59 A;  3FK4 A;  4F2S A;  1RDR A;  3TZZ A;  2AGO A;  4KGZ B;  1BHN A;  5ETO A;  2MZR A;  1JLF B;  3T5L A;  1VIX A;  2EBE A;  4P10 A;  4U6P A;  2OPS B;  4WJB A;  5ETP A;  2ADC A;  2JH3 A;  1RT6 A;  1HI8 A;  1CS4 B;  4Y2I A;  3ILO A;  1OSC A;  2ZUA A;  2A6M A;  3Q8V A;  5C2C A;  1R8B A;  2HHH F;  1PBU A;  2C28 A;  4X4T A;  1UP1 A;  1WC0 A;  1WG5 A;  3MM8 A;  1FKO B;  4M8L A;  4ZK7 M;  3DOK A;  2IVM A;  2YX7 A;  4FYW B;  1NB2 A;  3SFU A;  2MEW A;  2R8K A;  2XZW A;  1GTH A;  1N36 F;  3PHT A;  3BPS P;  2KT2 A;  2G4B A;  2IJF A;  3B4D A;  3FEX B;  2FLN A;  4FF3 A;  2A0F B;  4E2F B;  4I2Q B;  2XMA A;  1NU4 A;  3FDS A;  1SUQ B;  4TU7 A;  4GKK J;  3I56 S;  1Y7P A;  1S1X A;  2G2Y A;  3H98 A;  1VRT A;  4NLU A;  5D0E A;  1V3S A;  5HJY A;  2AD9 A;  2FHJ D;  4I68 A;  3CD5 A;  2B4O A;  4B9M A;  4YR2 A;  1YZ6 A;  3IRW P;  3T3F A;  2AWZ A;  4XTT A;  3G71 S;  1I51 B;  1TVR A;  3UN3 A;  3MEC B;  2DK2 A;  3VAG A;  1NEE A;  2F3J A;  2KHC A;  1VBK A;  2DCL A;  2HK2 A;  3A3N B;  2HNY A;  2ZIT A;  2ASD A;  2O1P A;  3CF5 Q;  3BGF A;  3FJ2 A;  3GCX P;  2IMO A;  2AYE A;  1JXL A;  3MOJ B;  4GMK A;  1T03 B;  2XMK A;  3US5 A;  1VQY A;  3THT A;  3R97 A;  4HR2 A;  2FZC B;  3UD5 A;  3PZP A;  1BD6 A;  2WON A;  2ZBR A;  1MN9 A;  3H42 A;  4ECV A;  3QGP A;  3KUG A;  4JI6 F;  4W4M A;  4OI3 A;  1QUP A;  2XMJ A;  4TN2 A;  1HNZ J;  4IUF A;  2E44 A;  1H7W A;  2R7T A;  3K5L A;  2ZC4 A;  4YB7 A;  3G8Q A;  1MU2 B;  3JB9 k;  1V5I B;  4DL3 A;  4JUZ A;  2J7K A;  4GKJ F;  1FRI A;  2EFN A;  2GMH A;  2ZDO A;  4C2M A;  1LW2 A;  4ZLJ A;  1BC6 A;  3O8W A;  2N4C A;  3LP2 A;  2HG4 A;  4MIA A;  4NCB A;  1LWF B;  1PJ6 A;  2Z56 B;  4AQY J;  1VJW A;  1FJG F;  5KT4 A;  4JI5 F;  2NPF A;  1OPZ A;  3EVO A;  2V67 A;  2ZHB A;  4EBD A;  4IFY B;  1FDN A;  3MF5 A;  4QJV A;  2HFO A;  3VQS A;  1KHW A;  3QLH A;  2M52 A;  1IKY A;  3K57 A;  3ZZO A;  4DLG A;  3BBB A;  5D6G A;  3I5C A;  2GHW A;  3TJ9 A;  3GJQ B;  4FKX A;  2KT5 A;  3I0R B;  2CG4 A;  3MR3 A;  4EZ9 A;  2ZKU A;  1PC5 A;  1SC1 B;  5CAA A;  1REG X;  3IO1 A;  2BAN B;  3P4U B;  4DUZ J;  2B7B B;  1GMW D;  3T5K A;  3DRR A;  2OPQ B;  3K5O A;  3K0J A;  2VBW A;  3CCE S;  4KKO B;  4C3M A;  2MGZ B;  2FLO A;  2UUB F;  4J9S A;  4DU8 A;  1U2C A;  5KFI A;  2DYA A;  2G2Z A;  3KK2 B;  1G4C A;  1U8W A;  2VQE F;  1JLQ A;  3HK2 A;  2FZK B;  4G1P A;  3LPE A;  1UA0 A;  1C1B B;  4TYB A;  4IG3 A;  2IM0 A;  4G6V B;  4A8Y A;  1LK7 A;  2M8H A;  4K4S A;  4ICL B;  2GFF A;  5DG8 A;  3GR0 A;  3I9Z A;  4QWA A;  3MM9 B;  1IJE B;  2DR6 A;  4GO7 X;  4NXM F;  2GMJ A;  3OW2 R;  5KFF A;  5A8K B;  2OAU A;  2L3M A;  3G8T A;  2HQD A;  4LF6 J;  1DTT B;  4FXD A;  1FRL A;  2UP1 A;  2BYC A;  1PGZ A;  2HMI A;  1RQ0 A;  2OP5 A;  1KFD A;  3NEK A;  2YNG A;  3VAI A;  4WE1 B;  4FVM A;  1C0U A;  5J2P A;  8RUC A;  3DDI A;  1A7G E;  5K20 B;  1EX8 A;  3TAR A;  5LMN F;  2HSE B;  2GVZ B;  3B6B A;  1RTJ A;  2IYG A;  1FFS B;  2W4D A;  1Z2Z A;  2PSZ A;  1NCL A;  1HBM A;  4ZVO B;  2VKZ G;  2RE1 A;  3RRH A;  4O44 A;  2K1R A;  2AYM A;  5KFL A;  1TK5 A;  1RAE B;  4OZN A;  4MFB B;  3IBC B;  4PYA A;  2ZH8 A;  2ROP A;  1NH7 A;  1Q82 T;  5CCM A;  2YKM A;  3CWJ A;  3SQG B;  4AL7 A;  2UXC J;  2H9Z A;  3QQC D;  3FVY A;  4NLY A;  1HBN B;  2JFK A;  5ETL A;  1DQ8 A;  4LVN P;  1QVF R;  4WFX A;  3FFI A;  2QC3 A;  4UOH A;  3FBB A;  3FNN A;  2JNJ A;  3J7Y U;  4HDH A;  3GMG A;  4FF1 A;  2J6U A;  4NA1 A;  4DUY J;  2UVU A;  4ERD A;  4PWD B;  1QY7 A;  1RTH B;  1LW0 B;  4WYL A;  1NK9 A;  3F41 A;  2W9B B;  3M2R B;  1NK0 A;  5DM6 Q;  1S76 D;  4OZ5 A;  3NWG A;  3WX4 A;  4YDD B;  2VPW B;  2CJ9 A;  1T9Y A;  1JIH A;  3NGK A;  4M5G A;  1Y3J A;  3HT0 A;  4Q5V A;  2CKW A;  1GNK A;  2GGP B;  3G6V A;  3KOA A;  3Q8U A;  4I64 A;  2DO0 A;  1M5P C;  4MH8 A;  4DSJ A;  4KO0 B;  4E98 A;  3D1Q A;  1X4B A;  4ALZ A;  4J9R A;  4OX9 J;  2DR7 A;  4M1K A;  1SIW B;  1X8D A;  3GQC A;  1RAH B;  4DBQ A;  2FTR A;  1JLC B;  2D3O R;  3DU5 A;  2NRE A;  3KHL A;  4DDF A;  2DNH A;  1IXK A;  4GVB A;  2IIH A;  4NXN F;  4HL9 A;  2WSC C;  1NAQ A;  4ZN3 A;  3CCT A;  3H90 A;  4U7C A;  5E2Q A;  1PAE X;  3V6H A;  4F4Y A;  2VFS A;  1XMO J;  2RDD A;  3R5B A;  1SB6 A;  2DGO A;  5L8R C;  1QSY A;  1UL3 A;  4ZKA A;  3DRS B;  3HVT B;  5DLG A;  1N0V C;  2W1B A;  2RRB A;  2HBQ B;  2X3G A;  4ZHR A;  1Z2L A;  2DTJ A;  3KHR A;  2CIM A;  3H5S A;  2JL9 A;  1NK5 A;  3D66 A;  3M32 A;  4NZ7 A;  2AV5 A;  4RW8 B;  3C46 A;  5ITH A;  2IA0 A;  5CA5 A;  4DV5 J;  4OV1 A;  2QL5 B;  3PRB A;  1C4A A;  2VBY A;  2HQC A;  2GS8 A;  2XHC A;  3UI3 A;  3PO4 A;  2NXU A;  3AXM A;  3T1Y J;  3R1H A;  4DV0 F;  3K7R A;  3R5C A;  5JJB A;  2I38 A;  5GAE U;  2FJX A;  1RHJ B;  1BQM B;  3QAU A;  4FS2 A;  3SQO P;  2A6O A;  4QWD A;  2LU2 A;  2UXB F;  2ZVI A;  1IM6 A;  2YNI B;  3GSI A;  1MSW D;  3CD0 A;  3BSN A;  3EE3 A;  1NPP A;  2DGV A;  3NGR A;  1Q79 A;  1CJT B;  3OFF A;  5D15 A;  4FYX B;  3QWP A;  3BM7 A;  3VR1 A;  4NE9 C;  2AJ4 A;  3LP1 B;  1FFW B;  4E0D A;  4RWX A;  3D1H A;  1R43 A;  2MQP A;  6FDR A;  4K4X A;  3IR6 B;  1R8H A;  1SJ4 P;  5KTQ A;  3RG6 A;  3QT6 A;  1LFP A;  2NLW A;  3N9U C;  3MM7 A;  5C24 B;  5IOL A;  5E33 A;  2ZBQ A;  5C25 B;  5L39 A;  5CZV A;  2AZ3 A;  3R27 A;  3KK1 A;  4A8S A;  5HRO A;  3C3L A;  2RUS A;  3LAK A;  2CPX A;  3K8V A;  5DG9 A;  1URN A;  4Z7C A;  3QT5 A;  4BHQ A;  3CO9 A;  4K4U A;  3GCW P;  2OKQ A;  1X0F A;  1U1M A;  1IWA A;  1EP4 B;  4LFA J;  4J90 A;  2PGC A;  4JV5 J;  3D4J A;  3H20 A;  4NLR A;  1F9H A;  4WZQ A;  4HAC A;  1SQG A;  1EAR A;  1IKV A;  3KJQ B;  4I2P B;  2BQU A;  3A4T A;  3KXD A;  5G0R A;  1WC5 A;  2Z2Y B;  1TV6 A;  3MD1 A;  3R5A A;  3U7J A;  3OL9 A;  4DR2 F;  2IDL A;  5KFD A;  2HFU A;  3DLJ A;  3T19 A;  2WVD A;  1HHQ A;  3W62 A;  4U95 A;  4NL5 A;  4ED0 A;  2ROG A;  4EZ6 A;  3AD7 C;  2J5A A;  4FXV A;  4M63 A;  3MPD A;  3HHE A;  1U47 A;  3QO9 A;  2PC6 A;  4XIU A;  4O0I A;  3V6K A;  2L9N A;  2CAJ A;  3OTE A;  1X4C A;  1NJY A;  1IBK F;  3CME S;  4C3L A;  4D3G A;  2O67 A;  1ITP A;  3D67 A;  2V50 A;  4DV3 F;  3G4S S;  4LQ9 A;  2FLL A;  1WSV A;  2ROE A;  2KKH A;  2PMH A;  4RW6 B;  2Y8W A;  5I42 A;  2MJU A;  4Q0B A;  2OSQ A;  5GAG I;  2KI2 A;  2AHO B;  4RW4 A;  2HYI B;  5FII A;  3H0P A;  4LRE A;  2RF2 A;  2ZH5 A;  2DBB A;  3KFW X;  4F36 A;  5F9N A;  1X4D A;  1VBY A;  2UZA A;  1NZA A;  2D3U A;  3OJU A;  2BX6 A;  1UET A;  2HVZ A;  5IWA J;  2NYI A;  2VU5 A;  2HHX A;  1FF2 A;  1JJC B;  1HW9 A;  1VQK S;  1SL2 A;  4KH1 B;  3KDO A;  2AJF E;  4RW9 B;  2HVH A;  1I3O B;  4OI2 A;  4F4X A;  2F4V J;  2CDR B;  1VOM A;  4JI4 J;  4C11 A;  3ETM A;  1ZOT A;  3D68 A;  1S9F A;  2V6A A;  5IT9 Y;  3D6H B;  4DXL A;  4DR5 J;  2PO4 A;  3B78 A;  1KQS R;  3HHL C;  3TQE A;  4PG6 A;  2AQ4 A;  1VQ9 S;  4O3P A;  5HSP A;  4C8Z A;  2F7V A;  1TKZ A;  1Q16 B;  4J9L A;  3OTD A;  3IS9 B;  2W9C A;  4RR5 A;  1R0B G;  4B08 A;  4KPC A;  3K2Y A;  2MMY A;  1WTB A;  5J1E B;  3FSI A;  1P8G A;  2IM2 A;  1RWV B;  4U96 A;  4UST A;  2PEH A;  2DEJ A;  1NDP A;  5DDO C;  5D3G B;  4R0E A;  2ZH4 A;  4C97 A;  2HW3 A;  5D4N A;  1PC4 A;  3QBC A;  2JX2 A;  1YJR A;  2EI5 A;  3UDC A;  4CNY A;  4TY9 A;  2KO1 A;  4Q2M A;  1VQ7 S;  4RZR A;  1NK6 A;  1NB7 A;  5D0R A;  3BBC A;  1WEX A;  4N8O A;  2RH3 A;  5LSR A;  4DR6 F;  2ZOM A;  2ZE2 A;  2HNY B;  1YJN S;  4PZV A;  1UMJ A;  1KP6 A;  4ZCL A;  4P75 A;  4L74 A;  5J2N A;  3DNC A;  4IDK A;  3TX0 A;  3PR5 B;  5EHH A;  4UZC A;  4CT8 A;  2QRR A;  3GTY X;  3A8E A;  1HLW A;  4B02 A;  4R8U B;  2EFG A;  4YDX A;  3BGU A;  3AH6 A;  2XY7 A;  1YX2 A;  4ETZ A;  2MZJ A;  2FY8 A;  3ZFV A;  2RRA A;  3SCK E;  3RRG A;  3HKW A;  1Q8B A;  3I31 A;  3RGI A;  3ENV A;  3FQL A;  4CTA B;  2G13 A;  4JI3 F;  3PX6 A;  2DGX A;  2HZA A;  3PJ9 A;  4RW7 A;  1QTN B;  4IR1 A;  4N56 A;  2Y8Y A;  1CJU A;  1U24 A;  4OYX A;  4EBE A;  5E7O B;  5K14 A;  4O4G B;  4PXB A;  3PY8 A;  3KLF A;  1RU1 A;  4YQW A;  4MKV A;  1N34 J;  2E9R X;  4JYA J;  3DOL A;  1T95 A;  4QU7 A;  3PX0 A;  3JYT A;  1K9M T;  1R27 B;  3FRY A;  2LEB A;  3G6E S;  2BJ8 A;  3U1L A;  1SJR A;  1KVK A;  1T94 A;  5GME A;  4F3M A;  3HD1 A;  2E5H A;  2MSS A;  1LWC A;  3DU6 A;  5KT7 A;  2QA2 A;  2VV5 A;  2ZWO A;  5HJX A;  2CYY A;  1SJQ A;  2HHT A;  3OFG A;  4UT4 A;  1DRZ A;  1T3O A;  2ZM6 J;  1NJZ A;  3IC1 A;  4FZV A;  3G86 A;  4C8L A;  4X84 A;  5JMN A;  4DX5 A;  5AJ3 F;  5ETR A;  2KG0 A;  4C3K A;  2RQC A;  2Y9H A;  1RTZ A;  2VPY B;  3DHX A;  1EKR A;  2BEF A;  2OJ3 A;  5CYQ A;  2IDE A;  3OR2 A;  4BS2 A;  4H4O A;  3EWG A;  4RJV A;  2CQB A;  3G6Y A;  4P6Q A;  3V6J A;  4M5D B;  3D54 A;  4OHW A;  2YY3 A;  1T9U A;  3J7A N;  4W90 B;  1T9X A;  3BQ0 A;  4HTI A;  5FD1 A;  2K7J A;  1DY3 A;  1SKS A;  5A6W A;  3MCM A;  1JX4 A;  4IG3 B;  2H1Y A;  2QLB B;  2Z8Q A;  3CO0 P;  1P1T A;  2ACM A;  7FDR A;  5F8H A;  4USI A;  2AYG A;  1OYD A;  1RHK B;  4DV6 F;  7FD1 A;  3PW5 A;  1YKW A;  1FI4 A;  3QFW A;  2YKA A;  3ETO A;  5JXS A;  1JMT A;  1RYR A;  2VQF J;  2KFN A;  1NH8 A;  5KOX A;  2RKI B;  1S97 A;  3TEH B;  1XTZ A;  5CYM B;  4TXS A;  3BN4 A;  4DV7 F;  3W2W A;  2DNQ A;  1OMS A;  1S1U A;  2XMV A;  4ZPA A;  5EDW A;  4OJ3 A;  4MIB A;  2J0W A;  3M2V B;  3NGD A;  4FP9 A;  1VQM S;  1W26 A;  3TAM A;  2MKS A;  3DHW C;  3VAJ A;  1VRQ C;  4LR9 A;  5DO2 A;  5F8M A;  5KT3 A;  4DR1 J;  2V94 A;  1XIQ A;  3DXS X;  5HAO A;  2C22 A;  4Y2K A;  1HBM B;  1ZM4 A;  4LR7 A;  1NHV A;  4O44 B;  4B9V A;  2M5Y A;  2Q3P A;  2CPI A;  5LMU F;  3EGV A;  3DLE B;  2OEK A;  5KFG A;  2DXE A;  1OSD A;  1A0O B;  3H7H B;  4QIF A;  4JBC A;  1UJ5 A;  1S48 A;  3MCS A;  1E6Y A;  3IR7 B;  3MXH P;  3BGL A;  4HI1 A;  3RAQ A;  1BMQ B;  3LGN A;  2FJE B;  1TL3 B;  2LQB A;  4QIE A;  1TL7 A;  4NCG A;  3WC2 A;  3K89 A;  2Y0B B;  1REV B;  1B0P A;  5D0H A;  2X1G A;  3W65 A;  2JJ4 D;  4B3M F;  2RB7 A;  3DMJ A;  4UY8 5;  4CYU A;  1FJ7 A;  1IQZ A;  4ANC A;  2D3Z A;  2GJ2 A;  2BE2 A;  2AGP A;  1RT3 B;  4WKY A;  3NCR A;  1VQL S;  4DSE A;  2H5J B;  3CE8 A;  2BM0 A;  2YX1 A;  3LQV A;  3VAK A;  3M8Q A;  3QZ8 A;  4ILL A;  2JOQ A;  3FUY A;  1X9M A;  4DQP A;  2KM8 B;  4PAA A;  1Q86 T;  3ZTS A;  4Z37 A;  2FJW A;  2F63 A;  2HHS A;  1RU2 A;  3IRX B;  1ZTW A;  3W61 A;  2OH2 A;  1OWX A;  3EDQ B;  4DCJ B;  1PBA A;  1VYA A;  4IFV A;  1ELO A;  4OZ2 A;  3HZG A;  4AXI A;  3MR5 A;  3CDU A;  3FMW A;  1HBU A;  1BWE A;  5FDL A;  2QO3 A;  2J9D A;  4Y2A A;  1RT7 A;  1HNX F;  4ZIV A;  2VA3 A;  2AEJ A;  3ZXW A;  4PWU A;  2DHS A;  1U45 A;  3EZU A;  2AEF A;  3UPF A;  5E0O A;  2N82 B;  1OY6 A;  1T02 A;  2MKJ A;  4CLT A;  4U7U K;  3V4M A;  4QW9 A;  3NMA A;  2OTJ S;  5KFM A;  3OPK A;  4WXW A;  2WCX A;  1KON A;  5HBM A;  1WOO A;  3MAA A;  2ZEJ A;  2BOA A;  1BQN A;  4PUO A;  4PPZ A;  4J9N A;  3KK3 A;  4JV1 A;  3J81 j;  4KBI A;  4WFY A;  5LXR A;  2H48 B;  2VFU A;  3D0I E;  1U4B A;  2OD4 A;  1TEL A;  1P9Q C;  3QJL A;  4QR1 A;  2DY1 A;  1EJ7 L;  2W4P A;  1C1C A;  2JEG A;  1WC3 A;  3EXY A;  3CJQ A;  1NJI T;  4RNO A;  1TUG B;  5KFX A;  1KVI A;  1MWQ A;  3OTO J;  4LSL B;  1AB8 A;  1X5T A;  2ZJQ Q;  3TVZ A;  4RBV A;  5AE3 A;  2UVR A;  1YJ9 S;  4LRB A;  4HI2 A;  2XYH B;  1H2U X;  5HLF B;  1X4F A;  4X4V A;  3D5M A;  4ZIT A;  1A9N B;  4F4W A;  3ZZT A;  1YJW S;  3PCO B;  2N4D A;  2ZBI A;  4DL0 C;  4M5K A;  1GQE A;  2I9S A;  5A8W A;  1KTV A;  2QMW A;  3CUN A;  3OL7 A;  2W8L A;  4NLS A;  1W2B R;  1IBL F;  3KTQ A;  3SZ2 A;  1B4S A;  1XNR F;  3HD2 A;  5CD4 H;  1PO6 A;  1VHI A;  3ITH B;  1WHX A;  2B8P A;  4QYZ J;  4TLR A;  3GR1 A;  2OPR B;  4WWS A;  5KFA A;  2Q6C A;  4M5M A;  2DHX A;  4ZPB A;  1LK5 A;  3HHL A;  3MM6 B;  1V9O A;  2W01 A;  1LNQ A;  4B3S F;  3MR6 A;  3TP2 A;  1YWX A;  2OML A;  4OL8 A;  2GVD A;  3DI6 B;  5H9F J;  1HWK A;  1XEZ A;  3C8Y A;  3NAH A;  2DR8 A;  4KGM A;  2OPP A;  1U6Z A;  1N4L A;  3I0S A;  3GJS B;  3MTK A;  1TMJ A;  3C6U A;  3FQK A;  2R7R A;  2B56 A;  4F8R A;  4C98 A;  1HPZ A;  3JQK A;  4ECS A;  4V1A k;  1D8Z A;  2P6S A;  3KG1 A;  5DGB A;  3DLK A;  5EWG A;  1JLB B;  1U25 A;  2HBZ B;  2QA4 S;  2OIH A;  4N47 A;  1UFL A;  5HRO B;  1DTQ A;  2C3Y A;  4Y6I A;  4FNH A;  1TUV A;  2BJ7 A;  4ZIW A;  1J5O B;  2DH9 A;  3L3C A;  3GIK A;  2XSJ B;  3MPY A;  4F7V A;  1HIY A;  3D3C J;  5EX3 A;  1UFK A;  2KVI A;  2HIQ A;  1NUE A;  1SIZ A;  2R2T A;  2MPU A;  2XGQ A;  3D9B A;  2XCA A;  1N0U A;  2CJY B;  4OMF G;  2H5E A;  1TKT B;  2D41 A;  2BJ3 A;  5HK4 A;  4DSK A;  3LAM A;  1HWU A;  2LXU A;  2HGL A;  2ZUG A;  2K06 A;  2YKQ A;  4B9N A;  3NBP A;  1TKD A;  2M88 A;  1H3D A;  1R0C B;  4DR7 F;  3FCH A;  2GIF A;  3IG1 A;  5BR8 J;  4AL5 A;  2JFD A;  2WVE A;  3R5G A;  3OVA A;  1WD6 A;  4F04 B;  2WTF A;  2GQQ A;  1HNI B;  4QWC A;  3G82 B;  3AB2 B;  4LF8 J;  3GIJ A;  3NXZ A;  1T3N A;  4OYO A;  2QLW A;  4ED2 A;  4LF7 F;  3IWN C;  4LFB J;  4OYP A;  2IY5 B;  1EET A;  1X4G A;  2QJ3 A;  4M5N A;  1NBE B;  2MKK A;  1Y5I B;  2E7X A;  3POT B;  1HNW J;  3CMA S;  1ROF A;  4BBY A;  1WC4 A;  5A0Y A;  3S01 A;  4LF4 F;  5HP1 A;  3L7O A;  3IAS 9;  4RW4 B;  2EW9 A;  2FGO A;  4XK8 C;  1B7Y B;  1CLF A;  4X4O A;  4YOE A;  4C8M A;  5A8R B;  2XLK A;  2C2O B;  1U1Q A;  1S1W B;  1NSQ A;  3T1H J;  4RNN A;  3DLB A;  2R7W A;  2KXF A;  2QEX S;  2L48 A;  4C11 B;  5DLF A;  4OZ3 A;  2IJR A;  1XR5 A;  5B08 A;  2BJ9 A;  3RB3 A;  2FVP A;  2XZD B;  2N7Y A;  2ASJ A;  3EGN A;  3M9N B;  3A1Y G;  3DLH A;  3V4I B;  1CC8 A;  5KG2 A;  4DMZ A;  5GMD A;  3HFZ B;  4IG0 A;  1FKP B;  2NSB A;  4R5P B;  2EWH A;  3L09 A;  1RHQ B;  3W2V B;  3N0V A;  2PN6 A;  1FCA A;  1NSA A;  4RWW A;  2P9G A;  4AT1 B;  5EX0 A;  3H2L A;  2BMB A;  4B3R F;  2LDI A;  2BJ1 A;  3DYA A;  3B54 A;  4ES3 A;  3QRR A;  2PDA A;  4NA3 A;  5B0G A;  2LA4 A;  3Q23 A;  3PDN A;  5D4P A;  2ZBP A;  3NG8 A;  1HKA A;  3J81 Y;  1JLE A;  1RAB B;  1SKU B;  3MM5 A;  2W7P A;  3CSK A;  1WDD A;  5CQG A;  1RTD A;  2YQ1 A;  3I96 A;  1RT4 B;  4DN0 A;  1DZ5 A;  5T7L A;  2FJD B;  2IAJ B;  3MMC A;  2CQ4 A;  1KDN A;  1RHM B;  3MD3 A;  2BAB A;  3BH6 B;  3AA8 A;  3BSO A;  4LIW A;  3FBE A;  4DF8 A;  3DXB A;  1CJV B;  4NPO A;  4EYI B;  1BUX A;  2KB2 A;  5LXY A;  4BLG A;  3RAX A;  2EPI A;  3UFC X;  3LF0 A;  1HNV A;  1JLA A;  2XYP B;  1X31 C;  2V34 A;  1Q1K A;  5HMY A;  2MLX A;  4JI7 J;  3OFH A;  1EAY C;  1JQG A;  3JYT B;  2RDJ A;  1WUU A;  2GIQ A;  2G1H A;  4RKU C;  1S6Q B;  2E1R A;  3PG9 A;  3T9N A;  1HFE L;  4ECZ A;  4N5S A;  4RX6 A;  5G4D A;  2FVC A;  2LKZ A;  2HAF A;  3TAP A;  3GJT B;  1IKX A;  1CUL B;  4RO0 A;  1VC5 A;  1V6H A;  3RTV A;  4JI2 J;  3BO2 A;  1VQ5 S;  3ILI A;  2FHK A;  4I69 A;  5D77 A;  4C8K A;  4Y34 A;  2BUN A;  1RBL A;  4EUV A;  2NYH A;  1SH3 A;  3K5P A;  2HQI A;  2EG1 A;  2R8G A;  2QYG A;  1IWG A;  2I0X A;  4DG1 B;  2DNY A;  2VFR A;  5KFK A;  2DNR A;  4ZN1 A;  3KJN B;  4CO2 A;  3MMA A;  3KJF B;  4AD6 A;  2B4P A;  1IN0 A;  3AOA A;  3OXF A;  1G2E A;  1VR6 A;  5I3U B;  1QAY A;  3H4B A;  4JB8 B;  4XDC A;  2KU7 A;  1KOH A;  4WKR A;  5L1J A;  1FES A;  2ZOG A;  1VHF A;  1DLO B;  5KG7 A;  2VKR A;  5LJ5 Y;  1AW0 A;  1WKK A;  3N6N A;  2HBR B;  5E3A A;  3EM1 A;  4B3T J;  4PQU A;  3WQP A;  1C2P A;  4F02 A;  3J80 U;  1IUJ A;  2VFV A;  4OYW A;  1JKH A;  1X4E A;  2VUG A;  2FC8 A;  1R89 A;  3DGP B;  2AW0 A;  5KG4 A;  4CNZ A;  2IMW P;  2DKO B;  3HPO A;  1H6K X;  1S1U B;  3N4W A;  3R8Y A;  2KYZ A;  3T6J A;  5HMW A;  1XNQ F;  3UDV A;  3GFZ A;  2E9T A;  1R7I A;  4NRT A;  2V4R A;  1VQ4 S;  1OIA A;  4I6A A;  1GX5 A;  4WCE Q;  2I5J A;  1LEO A;  4OI1 A;  2EG2 A;  3SV4 A;  2YBV A;  3GZ7 A;  1U2F A;  1YJV A;  3FKB A;  1K1Q A;  3H2V E;  4DX6 A;  5KFZ A;  1T8E A;  1FWK A;  1KC8 T;  2QSW A;  2LXI A;  3A8K A;  1JNZ B;  3C14 B;  3PAC A;  4YY3 F;  3G9C A;  3T41 A;  2LMI A;  1YGY A;  4DQS A;  3KJV A;  2M8D B;  2BDP A;  5B0D A;  4CO1 A;  1Z4U A;  4DV1 F;  2LQ5 A;  1Z1Z A;  4Y0F A;  1X7V A;  2GC8 A;  1FK9 A;  2DXF A;  2YWF A;  1WG1 A;  2B3T B;  5IM0 B;  2ZZM A;  4GRS A;  2J9E A;  2E1A A;  4ZJL A;  1TQL A;  2BJD A;  1M90 T;  3MEE A;  2ZHO A;  4J9K A;  4IO9 Q;  3GIR A;  3M8Q B;  4UUW A;  4NEY A;  2DNN A;  2YNF B;  3BRE A;  2CVI A;  2YPY A;  2NZC A;  5HQ8 A;  3HDS A;  2D3O 1;  3TR5 A;  5GAH I;  2CG8 A;  3OUY A;  3CCR S;  2E1P A;  1B70 B;  2QL7 B;  3JXO A;  2H51 B;  5KG1 A;  1CC7 A;  4MIW A;  3NNC A;  4WZM A;  1YI2 S;  1N32 F;  2ZJP Q;  3V81 A;  4G3I A;  2OGU A;  2HAI A;  4DR6 J;  1Y11 A;  2DGW A;  1S1V A;  1HBU B;  3MMB A;  1O51 A;  5FDL B;  3EGZ A;  4FNI A;  4CLL A;  5AXN A;  5HO4 A;  4LF9 J;  2LEA A;  4USU A;  2IPO B;  4U8V A;  1SV5 B;  4OYM A;  2B9Y A;  1H2T Z;  2SXL A;  5KFE A;  2CJB A;  3RR7 A;  1OY9 A;  3U27 A;  5B0F A;  2AIR B;  4DSL A;  2HWI A;  2IC3 B;  3KK3 B;  4J9U E;  2DRD A;  4D3H A;  4FBU A;  2ERR A;  1N5V A;  1R0A B;  2ZNY A;  2VBX A;  2YKN B;  1UA1 A;  3S6E A;  2JC0 A;  1I94 F;  1X5S A;  3UDL A;  2GX8 A;  5F41 A;  2M4M A;  3HKZ D;  4B9T A;  2JLF A;  3LWL A;  1C1C B;  5KFY A;  4Q8E A;  2VJU A;  2V8V A;  4X65 J;  2VDH A;  2W8K A;  1K1S A;  4TY8 A;  1BLU A;  4WPA A;  1TL1 A;  4OYZ A;  2VG7 A;  1WAC A;  1RHU B;  4TQS A;  1C0T B;  2Z30 B;  1T9V A;  2PMZ D;  1FEE A;  1HD0 A;  3W60 A;  4PG4 A;  2JZ5 A;  2JC1 A;  2U2F A;  3CJK A;  1CPZ A;  5JUM A;  2M7S A;  2MKC A;  1Q7L B;  4H54 A;  3LP0 A;  1BGX T;  4OV6 A;  1T05 A;  3K17 A;  4YHH J;  3CC2 S;  2BZ2 A;  1N6Q A;  1S9E A;  3R6L B;  3TAN A;  3PTW A;  4UY8 T;  1S12 A;  3TUZ C;  1KLM B;  2FIU A;  5IT9 U;  2EC0 A;  2WBM A;  2ZH1 A;  4IOB A;  1VLO A;  5CYJ A;  3O44 A;  3DCA A;  2WOM A;  3BF4 A;  5K5M A;  1HQU B;  1RAJ A;  2IBK A;  2RIJ A;  2W2N P;  1VDH A;  2EFO A;  4L6V 3;  2RVJ A;  4QZV B;  3TVY A;  3NKY A;  3HHL B;  2UU9 J;  3PV8 A;  2O5D A;  4WK3 A;  2HHV A;  3UQS A;  9ATC B;  2FHJ A;  1J27 A;  3THV A;  3OTB A;  2ADB A;  1WC6 A;  4Y65 A;  3X3U A;  3SEO A;  1VK8 A;  4GKK F;  2A3J A;  3NP5 A;  2V4J A;  5C42 B;  4DPT A;  5IFM A;  1ZZN A;  2W2M P;  3QSY B;  3LW5 C;  3BBF A;  4WU3 A;  2WRM A;  3H4D A;  4KFB B;  5E3R A;  2C2N A;  2NXC A;  4DFK A;  3GII A;  1QJH A;  4AYB D;  3C6U B;  1J2V A;  4OJG A;  2GQC A;  1HPZ B;  3WC0 A;  2OUG A;  1ZPW X;  1L3K A;  2DR5 A;  3MFI A;  2C2K B;  3C16 A;  4JOU A;  5EGY A;  2Y1I A;  5D4L A;  2R8I A;  2UUA J;  3HCX A;  4OZL A;  3MUR P;  4JI0 J;  2R7O A;  2MZQ A;  4X4R A;  2ASL A;  4EMD A;  2ZH6 A;  4ED6 A;  3WIU A;  3EIC A;  5IV3 A;  2VG5 B;  4ID8 A;  2YX4 A;  4OYI A;  1ZA1 B;  4MYT A;  3KHG A;  1HR0 J;  2KVQ E;  5T41 A;  1DJ0 A;  1R3N A;  3DM2 A;  1N33 J;  5KFC A;  3VAL A;  1YQH A;  1QAX A;  2E5L J;  4BC7 A;  1LWE A;  4HTJ A;  1VRU A;  2HND A;  1S0O A;  1X9S A;  1HNZ F;  3C15 B;  3CGI A;  2OSR A;  1DBD A;  3SSQ A;  2VC0 A;  1WI6 A;  2CQP A;  3NBP B;  1AZS B;  4U67 Q;  1RT1 A;  2M9K A;  2R8H A;  4H4M A;  3GIM A;  1K47 A;  2Y1J A;  4E8U A;  2MQ8 A;  3CJ5 A;  2GAG C;  2GAH C;  1SJ3 P;  3D1O A;  2EKY A;  1B99 A;  2L08 A;  1QM9 A;  2B5J B;  4MTP A;  1HD1 A;  1RAI B;  2Z2M A;  2BRL A;  4AQY F;  3PR4 A;  5KT5 A;  3FBF A;  1EHW A;  5F8I A;  1E6V A;  2VIH A;  2CNO B;  4TLQ A;  2E5I A;  3CC7 S;  2YNH A;  2GQ2 A;  1QE1 B;  4IOC Q;  1GMW A;  4CO5 A;  3GON A;  2CJQ A;  3R2D J;  1IKW B;  3L9Z A;  1RI7 A;  2B9X A;  5A0Y B;  5B0B A;  2E9Z A;  2V8G A;  2Z2Z A;  4GC6 A;  4OLO A;  2RS2 A;  2QG9 B;  4DUZ F;  4ECY A;  4ID5 A;  1KN6 A;  3QNW B;  2ZFH A;  3VWS A;  4NAS A;  4CWB A;  5C7P A;  1VGY A;  1NLK L;  2NUU G;  3H5Y A;  3AOD A;  2BJE A;  1RTI A;  1JLG B;  3C2P A;  4DFM A;  3CDE A;  1RIS A;  3W9I A;  4DOZ A;  3ZZU A;  3A3O B;  2ZZT A;  1VLY A;  2FZG B;  2XLI A;  3FGV A;  4AFF A;  2CPF A;  4B3O B;  2QMU B;  4F3Q A;  3AJ2 A;  1N5S A;  3TAQ A;  2QTW A;  3M30 A;  2QT7 A;  2WK4 A;  2MQO A;  1R6Y A;  2YTC A;  5KFW A;  4FKY A;  3U1M A;  2UVV A;  4IG0 B;  4KHP F;  1RWX B;  2JDJ A;  5CXT A;  2RUG A;  3Q0A A;  4MJK A;  1MML A;  4LF6 F;  3E01 A;  1DUR A;  3HI9 A;  3M2U A;  2H4Y B;  3DDN A;  1WG4 A;  3KUE A;  1GXT A;  3ZNJ 1;  5J2M B;  3IGN A;  3W7B A;  1MNE A;  1R31 A;  5HL7 Q;  2F8E X;  3MCN A;  2HLU A;  1UWA A;  3IN5 A;  2AYB A;  2OEJ A;  4WIQ A;  3VGS A;  1RGV A;  2XY6 A;  1QAJ A;  1V5V A;  2ABY A;  3JAM U;  4KJI A;  4F4Z A;  1GH8 A;  4PCQ A;  2DNG A;  3R5D A;  4NOH A;  1GEH A;  1OO0 B;  3EJM A;  4L76 A;  3ULH A;  3IBF B;  3SDE A;  4DU7 A;  3MM5 B;  3O1L A;  1ZM3 A;  3PRD A;  3Q8S B;  1WEY A;  1RYS A;  1S6P B;  1CJK A;  2PI4 A;  2DXD A;  4O3O A;  3M8P A;  1VIO A;  1RCO B;  4UOG A;  1RP5 A;  4OIX A;  3OL6 A;  5IXU A;  2VPX B;  3ISZ A;  1OQ3 A;  3QAE A;  4UW2 A;  4ES1 A;  2UXC F;  1JLF A;  4L72 B;  4CIO A;  4Q7A A;  1Y5N B;  1WOP A;  3M7V A;  4DZD A;  4KV8 B;  1VQP S;  1FRH A;  1WSR A;  1RKI A;  1IBM J;  4NEZ A;  2MLY A;  1CS4 A;  1KHV A;  2VDI A;  4ELU A;  3NOC A;  1AFI A;  2ZD1 A;  1NK8 A;  4YEA A;  4DUY F;  4ZOS A;  5B0A A;  3MPU B;  1U6B A;  4HLB A;  2R3V A;  1H98 A;  1GMV A;  4NYP A;  2E7V A;  2IJN A;  1NKC A;  3BSA A;  2AJ1 A;  4B3S J;  3PW0 A;  1YBA A;  4IH5 A;  1M1G A;  2A18 A;  2QIF A;  2QZ8 A;  4I2Q A;  4NLX A;  1SUQ A;  4A8X A;  3K8W A;  1IKX B;  4ZP9 A;  3NCQ A;  4BDP A;  3RRK A;  4PKD B;  3V5R A;  1OS5 A;  2XC9 A;  3NWR A;  1U8S A;  4OX9 F;  5LJ3 Y;  3DOM B;  3MEC A;  3MED A;  3L4B C;  2FVQ A;  2UVW A;  1AA1 B;  2F40 A;  4YR0 A;  4DPX A;  4LF1 A;  1T9W A;  3TZX A;  3QIP B;  4FN5 A;  4TNO A;  4ATN A;  3LGM A;  1F5C A;  5CAB A;  1T03 A;  4FDF A;  4CLP A;  2NUH A;  2E1C A;  4CP5 A;  4ED7 A;  2BQ3 A;  4MK9 A;  4B9U A;  2W2P P;  3ICL A;  1FRM A;  1Y9O A;  4UF4 A;  3UVJ A;  5D4O A;  1XMO F;  1UZH A;  3MEG B;  3MPW A;  4RNH A;  2AJQ A;  3SCL E;  3F73 A;  4TU8 A;  1S77 D;  3JTO A;  4XO0 A;  4BWJ A;  1Y00 A;  2KYX A;  3ZZP A;  4ECU A;  3IXQ A;  5M2P A;  3RBD A;  2APO A;  1NHK L;  1IR1 A;  2XCP A;  1KEK A;  2MZ1 A;  1FJC A;  1U1P A;  1R8C A;  2P5V A;  2I6W A;  2PA8 D;  3SV3 A;  4OX7 A;  3D2W A;  3RYL A;  2DH8 A;  1MU2 A;  4WFB Q;  4P71 A;  2H54 B;  2ZZN A;  3CCS S;  4DV5 F;  2BBE A;  3BO4 A;  2HS0 A;  2JHE A;  2V9W A;  1JXV A;  1D09 B;  4HH1 A;  3HLU A;  1LWF A;  1ARO P;  3RBZ A;  3CC4 S;  1P6T A;  4A8M P;  3T1Y F;  3I87 A;  1WJ9 A;  4LF5 J;  3CW2 C;  3NAI A;  2BA9 A;  2B9E A;  2MST A;  3V6D B;  2QE5 A;  2D9P A;  1JXE A;  4I7F B;  2I5J B;  4G1I A;  3P8B B;  2U1A A;  5E41 A;  2HLT A;  1X5P A;  4ZVU B;  4B9L A;  5IZH A;  2V8D A;  5IQ6 A;  3NGU A;  2CFX A;  4CRJ A;  1TL5 A;  4J91 A;  1G7C B;  1N52 B;  1ZAW A;  4H4K A;  3RJM B;  2XMU A;  2GA7 A;  4USW A;  2OPQ A;  2YH1 A;  1WF1 A;  1VI7 A;  3KJV B;  1FDA A;  2MGZ A;  2V2K A;  4WFZ A;  4FPR A;  2HQF A;  3KK2 A;  2K7K A;  2DJW A;  2MZS A;  3AQO A;  2Z58 B;  3GSD A;  1C1B A;  3FZ2 A;  2WVB A;  1U09 A;  1NME B;  3M1V A;  4OI4 A;  3CXC R;  4MMO A;  4ICL A;  2ZC3 A;  3CDW A;  5M2R A;  1X4A A;  1ZZF A;  3D0G E;  3KLH B;  2AX0 A;  2LXF A;  1SC6 A;  3LOU A;  1HL6 A;  5A2Q Y;  5A8K A;  5MAO A;  3W9H A;  2V69 A;  4URS A;  2RS8 A;  2IYI A;  4DR3 J;  1U1K A;  2H5I B;  5E3Q A;  4DFJ A;  3LH2 S;  5KFO A;  2F9J A;  2X3D A;  2B6A B;  2L41 A;  2V4Q A;  5AXK A;  4LFA F;  1BWV A;  4JV5 F;  3CCM S;  3AD8 C;  2BE7 D;  1TU0 B;  3IM8 A;  2GVZ A;  4JI1 J;  3VGU A;  2X51 A;  1S1V B;  1RB0 A;  1T0T V;  3BQ2 A;  2Z57 B;  4WBF A;  1WOR A;  5SZT A;  2QLF B;  1FWP A;  1H7X A;  1XMB A;  2W24 A;  3LO3 A;  4BCA A;  4LBI A;  4FYY B;  4ELT A;  2V0N A;  3KMQ A;  4ZVT B;  1TTH B;  5A76 A;  1HBN A;  2VIC A;  2RNE A;  2CPE A;  2A2C A;  2YWE A;  3RUB L;  1Q0N A;  4M5L A;  2J8S A;  3B82 A;  5AE1 A;  2EK1 A;  3PFE A;  3MEK A;  4IQM A;  4QWE A;  1LQ9 A;  5EWF A;  2RQM A;  1Q53 A;  1ZM9 A;  2VB6 A;  3ILL A;  1F2G A;  4RUA A;  3HHD A;  2XG8 A;  2WHO A;  2OTL S;  4OI0 A;  3GPA A;  2OFG X;  5A6P A;  4HHH A;  5KT2 A;  3H40 A;  4QWB A;  2HEK A;  1Q8K A;  4K5S A;  5KG5 A;  4NA2 A;  3DGV A;  2VG7 B;  4X4Q A;  1DQA A;  1RTH A;  2KXH A;  3PNI A;  2R4F A;  2W9B A;  3M2R A;  4IQX A;  3D6T B;  3RBX A;  3CJS A;  1RAA B;  4DV2 J;  4G1Q B;  2KFZ A;  2B4U A;  2XLJ A;  2C2D A;  4YR3 A;  3R5J B;  3JTP A;  1WOS A;  1N5Y B;  1CQM A;  4ANE A;  4DQQ A;  1Q5V A;  1XMQ J;  1Y3K A;  1LXN A;  3VAF A;  2WVC A;  5RUB A;  3VF0 B;  2CWX A;  5EWE A;  5HVG A;  3JSM B;  4EWT A;  3TO8 A;  2GV1 A;  1AFJ A;  5IWA F;  4KO0 A;  2B51 A;  1M5O C;  2I1R A;  3C19 A;  4YFU A;  3OBI A;  2IBO A;  3NGS A;  4BWM A;  2F4V F;  1YVF A;  4JI4 F;  3OSN A;  1K0T A;  1S59 A;  4L3N A;  4PXD A;  2WZ1 A;  5GAE I;  1QSS A;  4DR5 F;  3QGG A;  1JLC A;  1NPR A;  1GX6 A;  2MTL A;  2HWH A;  3DLG B;  1U6F A;  1Y0H A;  4UQT A;  4PXC A;  2D7S A;  4KQZ A;  4U8Y A;  3G6X A;  4I56 A;  1FDD A;  3W8G A;  4NYZ A;  1M5S A;  1FX2 A;  1GK8 A;  1RA7 A;  4J9M A;  3MAH A;  2HS3 A;  3DRS A;  3HVT A;  4JI8 J;  3CJR A;  1B3T A;  4X4U A;  3CCW A;  3ET6 A;  4X64 J;  3I55 S;  2FVS A;  5F0U A;  2YQ3 A;  3RB0 A;  3I82 A;  5CH7 B;  3G8S A;  4CH1 A;  3CCJ S;  4P2M A;  5CZX A;  5GAD U;  2CQ2 A;  5HQL A;  4OZ0 A;  5J2Q B;  3EZ5 A;  2CPY A;  3R9L A;  4Q2L A;  1U49 A;  4O3N A;  2ZKT A;  1PJ5 A;  2MY8 A;  4CLU A;  1RCX B;  5FLX U;  4RW8 A;  2FLP A;  4PQA A;  1UVN A;  5K8N A;  4P52 A;  4ZPD A;  4P2S A;  1ICE B;  2RIL A;  4ZVG A;  3HHK A;  1L5U A;  2YPZ A;  1PIL A;  2ILY A;  3D6M B;  3VAM A;  2CZ9 A;  3CB4 A;  1U0H B;  3VHQ A;  4YB1 P;  3FSY A;  3C6T B;  5GMK a;  2LU1 A;  5HMX A;  2BKN A;  1BQM A;  3OFE A;  2H4W B;  4WFN Q;  1U1R A;  2HWT A;  2KRB A;  2W4C A;  5KFQ A;  3W5Y A;  4QIV A;  1VRU B;  4C6A A;  2RHQ B;  4USM A;  5ETT A;  4K0K J;  1UJ6 A;  3IA0 A;  2GCF A;  2RAQ A;  2XWX A;  4ZS6 A;  1N34 F;  4ECR A;  1RAC B;  4FF4 A;  4JYA F;  1FVS A;  4DPO A;  3SYZ A;  3QID A;  5HN0 A;  3IWX A;  3KLE B;  4U9R A;  2HVI A;  3MFH A;  3G87 A;  3CPW R;  2QSF A;  1YRX A;  1CJT A;  5KT6 A;  2CJK A;  3O5T B;  1AT1 B;  3A13 A;  3EYZ A;  1IR0 A;  3AOC A;  3LP1 A;  1FER A;  5H9E J;  4OJH A;  1OYE A;  2HKE A;  2QGF B;  3RB4 A;  1QD1 A;  8AT1 B;  3IM9 A;  2W2O P;  3PW7 A;  4DQI A;  1K44 A;  2KT3 A;  5C24 A;  1B7F A;  4AL6 A;  4X4N A;  1TUW A;  2ZM6 F;  4FYV B;  2C2M B;  5C25 A;  3L7P A;  2RQK A;  3MGJ A;  4PEO A;  1WC1 A;  1RJJ A;  2Q1L A;  4CM2 A;  4HKQ A;  2B0G A;  2ZHA A;  1WWH A;  3B8H A;  4EEY A;  1F0X A;  3PX4 A;  3D28 A;  4LMZ A;  2QYC A;  4DX8 H;  3GWC A;  2AT1 B;  5ETN A;  1RT6 B;  3BR8 A;  3TRG A;  3UNG C;  1EP4 A;  2HRT A;  3FMB A;  3HHN B;  3RZA A;  3Q8Y A;  2L9D A;  5B0C A;  3GV5 B;  1RKJ A;  2MKY A;  2XS5 A;  4Z7Y A;  4DQR A;  2BQR A;  4KB7 A;  3N6M A;  1LKZ A;  3A12 A;  3MM8 B;  3CCL S;  3HSZ A;  3DOK B;  3OHA A;  1RAF B;  2N3L A;  2HVE A;  4F25 A;  2GJI A;  1O8B A;  3EPI A;  3PJX A;  4NLG A;  1VC6 A;  2ZOF A;  1RE1 B;  1S1X B;  3O2I A;  2VQF F;  3E01 B;  1EQ0 A;  1VRT B;  3ISN C;  3M2U B;  4DF4 A;  2I8E A;  4HH0 A;  4Y28 C;  3TA2 A;  4XAK A;  1IVZ A;  1U1O A;  1K0V A;  2PMW A;  1TVR B;  4OI6 A;  1WF2 A;  2HGM A;  2QA1 A;  4BC9 A;  4B17 A;  4EBC A;  1UEK A;  1XER A;  4ILM A;  2RJZ A;  4P7T A;  1UJ4 A;  1D9A A;  2PFF B;  1W7W A;  2NQP A;  2HZC A;  4L73 A;  4PXE A;  1VCT A;  3HF5 A;  1UCN A;  1DHM A;  2FGC A;  1KQG B;  2BM1 A;  3M8Z A;  3SDE B;  4DR1 F;  2R7V A;  2P9E A;  3W5X A;  1F3F A;  4RW6 A;  2HFV A;  1FFG B;  1S4E A;  1GT8 A;  2IRU A;  3N5B A;  4IH6 A;  3HT3 A;  2WON B;  2XUL A;  4LFC J;  1CG2 A;  4K2X A;  2W25 A;  3HFV A;  4A48 A;  3OJS A;  3I5B A;  3BDP A;  3NMR A;  2CQH A;  4DX7 A;  1FVQ A;  2CQ0 A;  2YXL A;  1IQT A;  1S9G A;  3Q86 A;  3VGT A;  1IBC B;  1VJQ A;  2IFX A;  3ZNU A;  3W63 A;  2G0I A;  1FRK A;  4RW9 A;  4Q44 A;  1ZM2 A;  1UEV A;  1NKE A;  4XDD A;  4IRK A;  2AZ1 A;  3KG4 A;  4FVC A;  3ZC4 A;  2QX0 A;  2B7C B;  2A2D A;  3BGO P;  3MUM P;  6AT1 B;  2ZD1 B;  4PPD A;  3OTC A;  2FQQ B;  2DGU A;  1LW2 B;  3TNV A;  4QYR A;  2VAS A;  1OQ6 A;  4DLE A;  3IS9 A;  3LP2 B;  3PRV A;  1CQN A;  3BDE A;  2M0G B;  5IT0 A;  1TKX A;  3WZ0 A;  2AJ2 A;  2H3E B;  4ZA1 A;  2BV3 A;  5J1E A;  2Q43 A;  1H38 A;  1KOO A;  1KLN A;  4IH7 A;  1N8R T;  3QLH B;  1IKY B;  1FHT A;  3MR2 A;  5D3G A;  2XBP A;  3DRX A;  1J5E J;  5D78 A;  1RXO B;  3LA0 A;  3P96 A;  3BZQ A;  3M05 A;  4WP3 A;  4LRD A;  2UUT A;  5AT1 B;  1U2R A;  2W7O A;  4IRD A;  1YK9 A;  2G0C A;  3HVA A;  2R2S A;  3GYN A;  4N77 A;  4F2R A;  3MED B;  4A8W A;  4KIA A;  1B64 A;  4ZP7 A;  2CPZ A;  5HAT A;  4LF2 A;  1D1U A;  5IS2 A;  4DV4 J;  3DRR B;  1VFJ A;  4NML A;  1D8Y A;  3D7S B;  2KRR A;  3FRZ A;  1VBX A;  2WSE C;  3BYP A;  5JVG Q;  4X4P A;  4R8U A;  4K7Q A;  2DIS A;  1SPB P;  4JV0 A;  1F5B A;  3CCZ A;  1U0S A;  1VQ6 S;  4FS1 A;  1JLQ B;  3NS6 A;  2DD8 S;  4MYU A;  4EU0 A;  4MKA A;  6FD1 A;  2MXY A;  3UVJ B;  5L38 A;  4K4Y A;  4CTA A;  1HWL A;  2ZWP A;  3OLB A;  3O6Q A;  4PWW A;  2EFQ A;  5ETV A;  2V8P A;  3VCD A;  1VMB A;  4O4G A;  3CTR A;  3PYD A;  4I0W A;  2HMI B;  3GJR B;  2Q79 A;  3OTO F;  3K5M A;  4LSN A;  5L9N A;  4QCL A;  2YNG B;  1NO8 A;  1TP7 A;  4NLO A;  1VQN S;  2XS2 A;  4X66 J;  4EO6 A;  4P2X A;  1C0U B;  2J0S D;  5J2P B;  3CD7 A;  1S99 A;  1LV5 A;  2RML A;  1HHT P;  4USJ C;  3CVK A;  1U1N A;  2HHU A;  4DL5 A;  3UD3 P;  3TUJ C;  2CAD A;  1JB0 C;  2EBG A;  1RTJ B;  4ZMM A;  4AXJ A;  1XC9 A;  3BPD A;  1HYS A;  2VON A;  4CLS A;  2DCU B;  1UZD A;  1VQO S;  3BGR A;  2UUC J;  2K1R B;  1HQE A;  2XZT B;  3R7B B;  1GXU A;  3UCG A;  4ZJO A;  4ES2 A;  5DJB A;  1URR A;  2NPI A;  1HMV A;  4PYD A;  5L1I A;  2PEB A;  1VK3 A;  3ADA C;  3MZI A;  2EC2 A;  2YKM B;  3JQM A;  4P7V A;  4EFA C;  4NMX A;  1DFD A;  3R2C J;  3FFI B;  4M5J A;  4L75 A;  3M9O B;  4CM0 A;  4M5D A;  3S7R A;  5JVH Q;  2E1M C;  4C0O C;  2FY1 A;  4V19 X;  1HW8 A;  3UD4 P;  2UV8 A;  2MDA A;  3Q89 A;  2HHH J;  1FE0 A;  3Q2T C;  1YBT A;  2MHN A;  3M1V B;  1H74 A;  1XK8 A;  2V5H G;  5DZ7 A;  5DG7 A;  2Q6B A;  2HRU A;  1N36 J;  4DL6 A;  4KHP J;  2NS1 B;  1RAG B;  3W5Z A;  5EUH A;  4CLK A;  2NXJ A;  4OFZ A;  4LSZ B;  1ZTT A;  2PD1 A;  4PG7 A;  4RUC A;  4QW8 A;  1HBO A;  1P27 B;  4MT1 A;  2RKI A;  1U26 A;  4RUH A;  3M8Y A;  5CYM A;  3NLC A;  2GW8 A;  4ECX A;  4K4T A;  1F60 B;  1ZS6 A;  3M2V A;  5IC4 B;  3HXM A;  5DZ6 A;  2F65 A;  3DRY A;  1WEZ A;  3HVW A;  4WYW A;  3V2U C;  4RBT A;  4GVB B;  2HHQ A;  1Q8L A;  5BYQ A;  2QA4 G;  2NXN A;  4IKA A;  4K8R A;  2B43 A;  2YWH A;  3WDO A;  2ZH9 A;  3Q83 A;  5LT5 A;  3DLE A;  1KFS A;  4EO8 A;  2FHM A;  3DFE A;  1KWM A;  1F5A A;  2XMT A;  4W98 A;  5H1S V;  1FX4 A;  3M8W A;  4LBH A;  4JI6 J;  5BR8 F;  3NNH A;  1XBW A;  2C3M A;  3WIV A;  1NDC A;  4ZHR B;  4DR4 F;  3GFH A;  1TL3 A;  1MWY A;  3Q8P B;  1HI0 P;  5KOW A;  5C2G A;  4LF8 F;  4NZ0 A;  2ZH3 A;  1REV A;  5AE2 A;  3M32 B;  1F6T A;  3UR0 A;  4LFB F;  5BYR A;  5K9F A;  2RT3 A;  4ZVF A;  1LOU A;  2DIT A;  2OEL A;  3LTO A;  4GKJ J;  2WBR A;  2E29 A;  2J6S A;  1WEL A;  2RHS B;  4NLV A;  1JJ4 A;  1RT3 A;  1BQX A;  1HNW F;  4I6W A;  5GVQ A;  1FJG J;  4JI5 J;  4P9S A;  2OMO A;  2W9A A;  2AU0 A;  3EZO A;  4QOT A;  3DKD A;  1ZPV A;  8ATC B;  3CJ8 A;  1FEH A;  4QYZ K;  2EXU A;  1X0P A;  3GFY A;  1EIY B;  1UVK A;  1VIS A;  1PYS B;  3CDB A;  3IRX A;  5HVH A;  2DR9 A;  3HUL A;  5B09 A;  3T1H F;  1SC4 B;  2VOP A;  1MMD A;  1ACM B;  3PM9 A;  3TA1 A;  5H9F K;  3OD2 A;  3HO1 A;  2ATC B;  1Q8I A;  1L3V A;  2G9O A;  2K3K A;  1AUD A;  2UUB J;  1T9T A;  3IBW A;  4FPI A;  3F0N A;  2BAC A;  1S10 A;  4N76 A;  5T14 A;  3QMQ A;  2VQE J;  2LEC A;  2LP4 A;  3ZTQ A;  3MUT P;  5CCL A;  4PG8 A;  3PW4 A;  2ASY A;  4FXW A;  5F8N A;  4DZ6 A;  1IR2 A;  4EYH B;  2DIV A;  2M2B A;  2VOD A;  1U1L A;  3MM7 B;  2XSF A;  1N54 B;  2ZBC A;  4GO5 X;  4C0B A;  3BV8 A;  3ET6 B;  3JSY A;  3SSR A;  4NXM J;  1X5O A;  2HPU A;  3QT7 A;  3KK1 B;  4ZVS B;  4WFA Q;  2CPJ A;  1S57 A;  4QPT A;  2RRN A;  5KFB A;  2G1D A;  1FNX H;  4JV2 A;  3MCO A;  4LSL A;  3TJA A;  2E66 A;  3PKM A;  1F9E B;  2CPD A;  3NL0 A;  4ECT A;  2X1B A;  2EFV A;  4CZC A;  1GAO A;  4DEZ A;  4WK1 A;  3UWT A;  3BJY A;  3M9M B;  3J80 Y;  4ZPW R;  4DPY A;  5LMN J;  5F3T A;  5HLF A;  1FA0 A;  4HAC B;  4ZVE A;  4A8Q A;  4J37 A;  3J7Z 5;  3T5J A;  4USH A;  1RWN B;  1IKV B;  1TZ0 A;  2LEP A;  4WF9 Q;  5ETM A;  3GYX B;  3AFG A;  4PR6 A;  1FWL A;  5G0R B;  3SXL A;  4UOF A;  1TV6 B;  3HSJ A;  1FT8 A;  3AJD A;  4F0K A;  1S1T A;  2AX1 A;  3NCP A;  1S6U A;  5HVF A;  3SBM A;  2FVR A;  3HSG A;  3ITH A;  2CRL A;  2BR0 A;  2Y3Y A;  2OPR A;  3VVT A;  4JI7 F;  1M1H A;  1N56 A;  2DRA A;  3CD6 S;  4C7Q A;  4I4B A;  3MM6 A;  3E8O A;  1RWU A;  4P73 A;  1NK4 A;  3SMZ A;  3EVM A;  3Q22 A;  3SI8 A;  4IR9 A;  4J9V A;  3QO9 B;  2RDI A;  3OR1 A;  2V2Z A;  1X9W A;  1SCJ B;  2MYF A;  1YIT S;  2J8A A;  2CA9 A;  4A8F A;  2DEI A;  2J7W A;  1ZA2 B;  4TKT A;  3DI6 A;  2ZNZ A;  2V63 A;  1PSD A;  3M6W A;  2J9C A;  1NDK A;  2MKH A;  3RAM A;  1CBK A;  5I42 B;  4WU2 A;  2IVF B;  4Q0B B;  3BS9 A;  4JI2 F;  4MK7 A;  2LLZ A;  4YN3 B;  4YUD A;  4AE5 A;  2RF2 B;  4I1T A;  2PFD A;  1OY8 A;  3KLI A;  3HSD A;  2CPH A;  4KGX B;  3H5U A;  1JLB A;  2V2V A;  4N8N A;  4PRF A;  2CJX B;  1NND A;  2B9W A;  2BXJ A;  3CNQ P;  2VL1 A;  4DUT A;  4HT5 A;  1ZAV A;  1Q7Y T;  3W8P A;  3PEH A;  1J5O A;  3KUH A;  2XSJ A;  2CQ3 A;  1AYE A;  1XQI A;  2XNR A;  5U47 A;  1RAO A;  4YME A;  1SJF A;  5DDQ C;  4UUX A;  1TKZ B;  2VA2 A;  2LYV A;  2XHW A;  3OQ2 A;  1TKT A;  2W9C B;  4NXN J;  5J1P A;  2VOO A;  3R6G B;  2OI2 A;  3A3P B;  2LQJ A;  1YRT A;  2Y1R I;  2KFY A;  4Y3C A;  3OL8 A;  3CT9 A;  2RD5 C;  3ONQ A;  2HQG A;  5CHC B;  2LFV A;  4ER8 A;  3QYY A;  4B3T F;  5K8O A;  1YZ7 A;  2J9D E;  2OFH X;  3DN9 A;  3OT9 A;  2UXD F;  2JVO A;  2DRB A;  1H73 A;  1RWK B;  3P49 B;  3HFK A;  1HNI A;  5GAG U;  3G82 A;  1RWO B;  2QMX A;  3HZE A;  2ZE2 B;  1SVD A;  1Q95 G;  2CQC A;  3CED A;  4KH0 B;  4QBU A;  5J2N B;  4MKY A;  4NLQ A;  4IDK B;  1K73 T;  5J1N A;  2VG6 A;  1W2I A;  3TI0 A;  2OEM A;  2DNP A;  2Y1L B;  2FUG 9;  4NX9 A;  1NRK A;  3POT A;  5ETK A;  5LOQ A;  1H2V Z;  1UW4 A;  2YWK A;  1OJ4 A;  3UN5 A;  1ZH5 A;  4DV0 J;  2VD3 A;  1F3V A;  5THW A;  1RT5 A;  3ZZZ A;  4ECQ A;  2UXB J;  3JS9 A;  3G2X A;  1FNM A;  4RW7 B;  1WKJ A;  1S9G B;  5A8R A;  1CJU B;  1KQK A;  3T9Z A;  2CWK A;  3PIO Q;  4O3R A;  4KGK A;  3PW2 A;  2ZVS A;  2XQC A;  3CCU S;  2CNN B;  1S1W A;  4NZ6 A;  5K14 B;  3TJ8 A;  3KLF B;  1NM2 A;  2XTJ P;  3IFE A;  3BKT A;  2MQN A;  3KWM A;  1I1G A;  3DOL B;  4J9O A;  2QV6 A;  3IGV A;  3QWU A;  2XEX A;  5FJ4 A;  1UEU A;  2WVF A;  1LFW A;  3AOB A;  5F3Z A;  5MLC V;  5A2Q U;  3V4I A;  1S7I A;  5D8H B;  2IA6 A;  1FKP A;  1LWC B;  3JTN A;  4R5P A;  2G2O A;  3GG0 A;  1TKX B;  3W2V A;  4A46 A;  4WTY A;  4K5R A;  1NK7 A;  3CJ4 A;  2LCW A;  4HT7 A;  3RW7 A;  3GE9 A;  1SH2 A;  3LGH A;  5SUH A;  4C8Y A;  3N79 A;  5AXL A;  4LUB A;  3D6F B;  5ADZ A;  3CCQ S;  1RWM B;  1YIJ S;  1TK0 A;  2IRX A;  2W7A A;  3AT1 B;  3GFX A;  4ZCM A;  2C3U A;  3QGI A;  1BY9 A;  4O23 A;  1G6B A;  2QFJ A;  3DRP A;  3J7A 1;  3E51 A;  4R0J A;  3CIZ A;  5CYQ B;  3OR2 B;  2GIR A;  4H4O B;  3TUI C;  4ZVR B;  4IYQ A;  4R25 A;  4DL7 A;  4DCO B;  1PCA A;  3F56 A;  3W1Y C;  4LF9 F;  5KG0 A;  3OVS A;  2CZV C;  3I6P A;  4URG A;  4XPC A;  1RT4 A;  1DQ9 A;  3P3D A;  4F0H A;  3UW1 A;  4S0M A;  2KL8 A;  3OXL A;  2QFI A;  1RAD B;  4ITS A;  1CEZ A;  4V19 J;  2BE9 B;  3A8J A;  3EX7 B;  4FBT A;  1GTE A;  3AB4 B;  2IAJ A;  3CJT A;  1KTQ A;  1MMN A;  2A10 A;  3E2E A;  4F0M A;  2DGT A;  1F2H A;  2AKW B;  2YWG A;  4DR2 J;  1AXQ A;  4CDI A;  1CJV A;  1I6J A;  3B4M A;  4ZPC A;  2DNL A;  1HWJ A;  1VC0 A;  4X65 F;  1JK9 B;  5E5N A;  1OPI A;  4DCP B;  4CH0 S;  2ALY B;  4LSN B;  5KFV A;  2CVE A;  3ENW A;  3W2W B;  1TAU A;  1S6Q A;  4O4R A;  2J76 E;  4KHM A;  4CI0 B;  4C4W A;  4QIW D;  2KZM A;  3TAM B;  4Y2C A;  2NR0 A;  4F50 A;  1IBK J;  4ED4 A;  2COL A;  2F4F A;  4DV3 J;  1UW9 A;  1CUL A;  4YHH F;  5KG6 A;  1HYS B;  2LQ8 A;  3BH7 B;  3RU0 A;  5I3P A;  1YBU A;  3BGR B;  4LT6 A;  1HQE B;  5BYS A;  3KLG A;  3R7S B;  2F8H A;  3D0H E;  4OQJ A;  3HX9 A;  1HMV B;  1WTF A;  1NSK L;  4LJM A;  3M4X A;  2M3D A;  2DGQ A;  2FJB B;  2YVS A;  1E6Y B;  4Q43 A;  2J7U A;  3HJV A;  2KG1 A;  4DG1 A;  4C0H A;  2WB1 D;  4K59 A;  3IWL A;  1TL7 B;  2UU9 F;  2NCK L;  4NCG B;  4EGL A;  3AJ1 A;  3Q8Q B;  3R7N B;  5E3C A;  1EB0 A;  4J9P A;  1BE4 A;  3DMJ B;  1L3U A;  4NI2 A;  4CYU B;  4ED5 A;  3IR5 B;  5ETS A;  2DGS A;  1FDB A;  4N41 A;  4ZLP A;  1NHU A;  3AY0 A;  5I3U A;  1MRO A;  1WNE A;  4RNF A;  2BE2 B;  1S6O A;  2HRY A;  4ZP8 A;  1N5T A;  4C9D A;  2MQM A;  1FTC A;  1RWP B;  5KFP A;  4QQB A;  1FXD A;  4CCH A;  1DLO A;  5EN1 A;  1Q81 T;  4EK2 A;  1PYO B;  1D9F A;  4LRC A;  2V2Q A;  4CO3 A;  4ED3 A;  1UVI A;  3ELH A;  4NLT A;  1HBO B;  3HP6 A;  3K5N A;  2UUA F;  3JQJ A;  4HHU A;  5F9L A;  3AHP A;  3T6B A;  4KYZ A;  4ZLN A;  4JI0 F;  1SKW A;  3DGP A;  1GFW B;  4K4V A;  4IFV B;  1SKR A;  1S7H A;  2M70 A;  3N01 A;  4W92 B;  2YWW A;  2IVY A;  1KS2 A;  2XMW A;  2ALZ A;  4NLD A;  1RT7 B;  1HR0 F;  3KLV A;  2EKN A;  2BVZ A;  2R7X A;  4ILR A;  2DT9 A;  3JAM Y;  1N33 F;  3BSC A;  4DJB A;  2E5L F;  4PG5 A;  3DC2 A;  2BKP A;  2VPZ B;  1D0E A;  1VQS A;  2CZ4 A;  3OHB A;  5DQI A;  4KY3 A;  1NDL A;  5HBM B;  1BXN A;  2VJV A;  3MAA B;  1UPM B;  1BQN B;  4PUO B;  2WAQ D;  3PIP Q;  4TYA A;  4O3Q A;  4LRF A;  5BJR A;  5L1K A;  4JI3 J;  4RUB A;  3C14 A;  2E5J A;  1RK8 A;  3TOQ A;  1FKA F;  4X62 F;  1SJ1 A;  3W9J A;  2CQ1 A;  4WP9 A;  5L46 A;  3TYT A;  3I32 A;  2XM3 A;  1WF0 A;  3ENA A;  4USK A;  3TZW A;  1TR0 A;  4OYB A;  2WW8 A;  3OXG A;  1S49 A;  3FCW A;  4F4A A;  4FYD A;  2A1B A;  3CJ3 A;  3ENQ A;  3VQT A;  1XJW B;  3U02 A;  5IM0 A;  1SL0 A;  2N3O A;  4KT0 C;  3H5X A;  1FD2 A;  3AD9 C;  3OSP A;  1UVJ A;  4QR0 A;  4M94 A;  2HVD A;  5DM7 Q;  2HGN A;  5IV4 A;  2YNF A;  1UKU A;  1YHQ S;  3HVR A;  1FNO A;  4ZCI A;  5A8W B;  3OLA A;  3N6L A;  2MLZ A;  4KSE B;  1ZYQ A;  3M6V A;  4ED8 A;  1S4F A;  4ZCK A;  3SSS A;  5AJ3 J;  1O5J A;  5L9X A;  1YRU A;  1RT2 A;  4H4K C;  2DB1 A;  2D74 B;  1SC3 B;  1KBR A;  3I4P A;  1F1B B;  3ZTO A;  3ZZ0 A;  2R42 A;  3MOZ A;  2HFZ A;  3GV8 B;  3TWZ A;  4ENO A;  3M6X A;  1TK8 A;  2QLJ B;  4CO0 A;  4CLY A;  3UDE A;  5HAN A;  1HWI A;  1PYT A;  5ETQ A;  2VC1 A;  2OO4 A;  1WI8 A;  2O66 A;  2EEY A;  3F44 A;  4C8N A;  1SV5 A;  2VHG A;  3EPG A;  2D9O A;  1NPK A;  2GVD B;  4MKB A;  2DHG A;  2Z4P A;  3DDK A;  3IMQ J;  2N7C A;  2IC3 A;  2OPP B;  2KJW A;  1NZ8 A;  3I0S B;  1R0A A;  1FRJ A;  4OX6 A;  2CDQ A;  2YKN A;  3VVU A;  3O3L A;  4P2F A;  4KAI A;  3JSR A;  4DV6 J;  2YQ0 A;  4TVA B;  3K58 A;  3DLK B;  3EDR B;  5DS7 A;  3QPI A;  4LBP A;  3KNG A;  1DTQ B;  1M1K T;  1X4H A;  4RLE A;  3EGW B;  4DV7 J;  4DL4 A;  2XWY A;  3U1N A;  2R9L A;  4MAK A;  5DRK A;  1C0T A;  4GC7 A;  1RA6 A;  4WII A;  1QVG R;  3P5T L;  1EZZ B;  3NS7 B;  4OHV A;  4PAB A;  2BW7 A;  4P74 A;  5K8P A;  4ZLL A;  1H0H B;  2E7W A;  2IRY A;  3CJ2 A;  2BOP A;  1MG7 A;  1APS A;  3QT8 A;  3FBC A;  3TA0 A;  2DO4 A;  3HMJ G;  3KYL A;  3H2U B;  1NJW A;  1N5Q A;  3OV7 A;  1KRP A;  4DPW A;  1KLM A;  2FHO B;  5LMU J;  1QAI A;  1CSJ A;  1IBM F;  4ECW A;  1S1T B;  3CMQ A;  2F9D A;  3BQ1 A;  1S72 S;  2POK A;  2KDO A;  4JP8 A;  3IG1 B;  4NCA A;  1HQU A;  4IOA Q;  1PAU B;  4K50 A;  2LQ9 A;  5M2U A;  2GHP A;  3KG0 A;  1JJH A;  3THP A;  2GHV C;  1YJU A;  3MHY A;  1FO1 A;  1O6X A;  3QGH A;  4DN9 A;  2C2R A;  3OR1 B;  2DVI A;  3NY0 A;  4B3M J;  3FEY B;  5DET A;  1EET B;  2ZDP A;  1Q4R A;  1WDT A;  1VQ8 S;  2YKP A;  2XS7 A;  4DFP A;  2UUW A;  5C42 A;  4X4S A;  2Z0G A;  2OD6 A;  2YH0 A;  1WHY A;  1D3W A;  4KFB A;  4F67 A;  3RR8 A;  3BB5 A;  3S1T A;  3P6Y C;  4ZDN A;  2MY7 A;  5HP1 B;  3M8S A;  1G3O A;  3KLI B;  4GVL A;  3W66 A;  3TEG A;  2KXN B;  3NS5 A;  3MAQ A;  1RLD A;  5F8L A;  3K59 A;  2WW4 A;  3PKY A;  3PJW A;  3IAM 9;  3N28 A;  3R3T A;  4URQ U;  4Q45 A;  2PE8 A;  5LSO A;  1ZET A;  2Z2L A;  1FXL A;  3BKU A;  4RU9 A;  1SBR A;  2VG5 A;  4WXO A;  4M5H A;  4HEA 9;  3TW0 A;  3MTJ A;  2DHH A;  1HNX J;  3GP9 A;  2JRS A;  5KFN A;  2R7Q A;  3HJF A;  2EVZ A;  1JNR B;  9RUB A;  3GU0 A;  4OHZ A;  1KKH A;  3C15 A;  1M5H A;  3VZI A;  1GXL A;  2GML A;  1WHV A;  2DY9 A;  1X60 A;  3VTI A;  2VZ9 A;  5I4M A;  1FRX A;  4DL2 A;  4ELV A;  2BRK A;  3RW6 A;  1RUS A;  2MHE A;  4NRU A;  4KTQ A;  1AZS A;  1UWB A;  2FJA B;  3KKF A;  2DPI A;  3S8S A;  3DYA B;  1EKS A;  4LRA A;  2HNZ A;  3J7Z T;  2ACY A;  5E3P A;  4IO1 A;  3P5B P;  4K2J A;  2L9W A;  5C5J A;  4DR4 J;  2B5J A;  1TL4 A;  1QTM A;  4USV A;  1JJ2 R;  3KMS A;  5HQM A;  5D0G A;  2XO7 A;  1JLE B;  1V3Z A;  2AF6 A;  2CNL B;  1PJ7 A;  1SI9 A;  4LF5 F;  2GO8 A;  3H8Y A;  3M6U A;  4RBU A;  1QE1 A;  2WSF C;  1RTD B;  4HYK A;  2VG6 B;  4WP8 A;  4ZVP B;  1IKW A;  1ZBT A;  3ZZR A;  1TAQ A;  5T7L B;  4YS2 A;  3MUV P;  2Q66 A;  3MDF A;  4OLP A;  1NSP A;  5BXI A;  1RT5 B;  3LUY A;  2KHD A;  1HA1 A;  3MMC B;  5IT4 A;  2OPS A;  3TUP A;  2NZ4 A;  5F8G A;  1XR6 A;  3L7U A;  2BW2 A;  4F4K A;  1IBL J;  4OJ1 A;  1JLG A;  4KPY A;  2C1E B;  2VFT A;  1XNR J;  3EMT A;  3JSB A;  1F9F A;  2FD2 A;  2MJN A;  1HNV B;  1JLA B;  3FZB A;  2W2Q P;  4B3O A;  1FKO A;  4UQG A;  2AP6 A;  4I6Y A;  3GIL A;  2ZJR Q;  3MWB A;  5HI7 A;  4A47 A;  2CNK B;  2P8I A; 
#chains in the Genus database with same CATH homology
 5ETV A;  4CYU A;  1CBK A;  1EX8 A;  2BMB A;  4M5H A;  3IP0 A;  3HCX A;  5ETN A;  3HSZ A;  3MCM A;  4M5M A;  3MCN A;  1IM6 A;  1TMJ A;  4F7V A;  5ETL A;  2F65 A;  3MCO A;  5ETR A;  3KUH A;  1RU1 A;  4AD6 A;  3UDE A;  4M5J A;  4M5I A;  5ETK A;  1EQ0 A;  3UDV A;  1TMM A;  3HD1 A;  1RU2 A;  1Q0N A;  3HD2 A;  3HSJ A;  4M5L A;  3QBC A;  3ILO A;  1RTZ A;  4PZV A;  1F9H A;  3KUG A;  5ETQ A;  1EQM A;  5ETO A;  4M5G A;  2CG8 A;  1RB0 A;  1RAO A;  3KUE A;  3HT0 A;  5ETP A;  3ILI A;  4M5N A;  4CRJ A;  4CWB A;  2QX0 A;  5ETT A;  4M5K A;  2F63 A;  1HQ2 A;  5ETM A;  5ETS A;  3UD5 A;  4CYU B;  3HSG A;  3ILJ A;  1G4C A;  1KBR A;  1DY3 A;  3HSD A;  3ILL A;  1HKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...