1CBKA

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase from haemophilus influenzae
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
b'MITAYIALGSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAKIETELSPLKLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-PYROPHOSPHOKINASE
publication title The structure and function of the 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 1999-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1cbkA00
1EX8A 1EQ0A 1RAOA 4M5LA 5ETMA 3HD1A 4M5IA 3MCOA 3UDVA 3HSJA 1RB0A 1KBRA 5ETOA 3HSDA 3MCNA 5ETSA 3ILOA 5ETKA 1HKAA 2F65A 5ETQA 1RU1A 1RTZA 4M5KA 4M5GA 4M5JA 3HCXA 4AD6A 3QBCA 2CG8A 1HQ2A 3KUEA 3HD2A 1DY3A 2QX0A 4M5HA 3KUHA 5ETPA 1CBKA 1G4CA 5ETTA 1IM6A 3ILIA 4CYUA 1RU2A 4F7VA 3UDEA 2BMBA 5ETRA 1EQMA 3UD5A 4CYUB 4M5MA 3IP0A 5ETLA 2F63A 1F9HA 3HSZA 4PZVA 5ETNA 5ETVA 3MCMA 1TMJA 3KUGA 3ILLA 3HSGA 4CRJA 4CWBA 3HT0A 1TMMA 4M5NA 3ILJA 1Q0NA
chains in the Genus database with same CATH superfamily
1R43A 3O6QA 2OD6A 2DXEA 2E9TA 4OI3A 1S77D 1KVIA 4ECWA 6FD1A 1ICEB 1RTHA 1WC1A 1RTHB 4EMDA 2QC3A 3RTVA 2BXJA 1FRLA 2QFIA 3NS7B 2RB7A 1OY9A 1N52B 1KQFB 4O44A 2DNLA 2QTWA 2Q6CA 3G8SA 2XULA 2PFDA 4O44B 3QWPA 3H20A 3KMQA 5ETOA 4I69A 2QL5B 1UJ4A 3GPAA 1NDPA 2NR0A 1TUVA 3BGOP 2AIRB 2KYXA 1G2EA 2XYHB 4DX7A 2MJNA 1XMQJ 1GFWB 1X7VA 2AYBA 2YX7A 1K9MT 2MQ8A 1QAJA 5DG7A 4OJGA 1S0OA 1OO0B 5KG3A 4N8NA 3N01A 4LR9A 4CNZA 3GV5B 3HSJA 3THPA 4LF6J 4GKKJ 2C2DA 2P9GA 3H59A 4BC7A 5B7WA 2W2OP 1YZ6A 4L76A 3TZXA 4HKQA 4NL5A 1JNRB 1ZM4A 1NSPA 2RF2A 4LFCJ 1KLMA 2R7RA 3RW6A 2HHHF 2RF2B 3CMAS 1KLMB 4NASA 2HIQA 2D9PA 4NLXA 4MAKA 3IXQA 4DV7J 2KT3A 3MEEA 2XWYA 3ZZTA 3MEEB 2FPHX 4QWBA 2JHEA 5HI7A 4RBUA 4RNOA 5CCMA 2J0XA 2ZD1A 4RUBA 2YX1A 3IS9A 2V67A 2ZD1B 1RBOB 2YY3A 1ZETA 3IS9B 1YRXA 4CH7A 2A18A 4PG8A 4CLTA 3QYYA 4YOEA 3NLCA 7AT1B 1HHSA 2DHSA 2PDAA 3MURP 4IFYA 3W2VA 2W7PA 4IFYB 3W2VB 3T9ZA 4DSIA 5KFYA 2AMCB 4O23A 2IHR1 4X4TA 4WP3A 1ZAWA 3MF5A 3RB3A 3QAUA 4K8RA 2A2DA 3LAMA 2AEFA 2HWTA 4X4RA 5EWGA 1FRKA 3I9ZA 1ZTWA 2LXIA 1NHVA 1VDHA 2MGZA 3GJTB 1VQYA 2MGZB 3CCJS 4V19X 2NUHA 3CCUS 1XMOF 2W24A 3R27A 1GQEA 2NXEA 3JXOA 1YRTA 4DXLA 2K3IA 2XNRA 4DSEA 2BRLA 1NUEA 4IR1A 3HHLD 4G65A 2BOPA 3BZQA 1HNWF 2EPIA 1GMWD 3LF0A 4WYLA 2VH7A 3FRZA 3I0SA 1CJKA 5L8RC 2P6TA 3I0SB 1CJKB 5E3QA 4QW9A 2N4CA 4FXVA 2KXFA 1TL4A 2C2RA 3P5BP 5F3ZA 4ETXA 5C24A 3CJSA 4MYUA 3CO0P 3HULA 3UE2A 5C24B 5KFTA 4WF9Q 1FEEA 2DYAA 5E7OB 3QSYB 4C8ZA 4OHWA 3IR5B 1AUSL 1JX4A 5IXUA 2CQBA 2HBYB 4ZMMA 2DR5A 2OLWA 3D6FB 1VJWA 5LT5A 4L73A 2CWKA 1T0TV 3OVAA 1TFYA 3PR5B 1K1QA 3MTKA 3NGTA 4DQIA 2J6TA 6AT1B 3CVKA 1H3DA 1T9XA 3MEGA 5HN0A 3MEGB 4P7VA 3JSYA 4CH0S 1PCAA 1JIHA 1T9UA 1CQMA 2IAJA 3HF5A 2FZGB 1CPZA 4DZDA 4TQSA 2IAJB 1RXOB 1FNMA 4EBDA 1W25A 3MAQA 3Q8VA 3MPVA 3KDNA 1AB8A 1UJ6A 2R2TA 2VQEF 2ZOFA 2E5LF 2AF6A 4KQZA 3TAMA 3C2PA 3BO2A 3EXCX 5CABA 3TAMB 2NXNA 3MMBA 5KFMA 2CPXA 2YH0A 1BXNA 1TUGB 3MMBB 1BQNA 3ZTSA 4AQYF 4MYTA 4HEA9 1BQNB 2ZH3A 2EI5A 2CFXA 4F02A 4XK8C 3QGIA 2HS4A 2CADA 2UXCJ 2Y1LB 2RT3A 2LVWA 2LQBA 4Y2CA 3DYAA 1Y0HA 1U1PA 1YJNS 3WDOA 3DYAB 4B9VA 1OS5A 1MROA 1X9SA 2FHJD 1MROB 3CDBA 1RHUB 2W8KA 3OLAA 1AROP 2B51A 2D9OA 4R0JA 3RJMB 2IM3A 3L3CA 2FLNA 3HDSA 3IRXA 3TX0A 1KQSR 3IRXB 3DDKA 3D68A 2YNHA 1T9VA 2YNHB 3BF4A 2DH7A 2FB0A 1HD0A 2N4DA 1RJJA 3PYGA 4NLTA 1Z2ZA 2RH3A 1PYSB 4NLYA 1O8BA 5D15A 1X4CA 1FDDA 2KG1A 1VLYA 3PXGa 4QR2A 4XAKA 1N5YA 3M6XA 2WSEC 4GO7X 1N5YB 4NYPA 4OJ3A 2O67A 3T5JA 3PHEA 3AD9C 3KLVA 4MKVA 5CA5A 2ZHBA 3EGZA 1V3SA 2R9LA 2R8HA 2B9YA 4A8YA 3N6MA 4BBYA 1X4AA 5DQGA 4USHA 3C3LA 4K4TA 2ASLA 1NPRA 2IC3A 2IC3B 5CHCB 4Y2MA 4G1IA 3NG8A 1SXLA 4ZPTR 1SIZA 1XTZA 2RRBA 2D3OR 2E1AA 3QMQA 5GVQA 1KWMA 4QYRA 2LQ9A 1GXTA 1RT7A 2VF3A 1RT7B 3MUVP 2DEIA 3ILOA 5GAGU 2HEKA 3FBEA 3ZZZA 3QT8A 1U1RA 2F8EX 4PZVA 3M32A 2HG4A 2Z58B 3HVAA 3M32B 4DPTA 3AQPA 3NGKA 3KJVA 1TZ0A 2RDDA 4LIRA 1JWWA 3KJVB 4RR5A 1DY3A 1XR6A 3IFEA 3THTA 3LUYA 5DLGA 1PBAA 4ZVQB 4ANDA 4J91A 3TI0A 4Z7YA 5ETQA 2ZBQA 3A3PB 4OYPA 4HHJA 5HJYA 3MM7A 1S49A 2M5YA 1RHQB 2EKYA 3MM7B 4DR6F 1QAYA 4IKAA 1WC4A 4B9SA 3O2IA 3IBWA 2W8LA 3O44A 4BDPA 3EICA 4ZPCA 2LU1A 4JI0J 5IWAJ 3TUZC 1XC9A 5KFGA 2ASYA 2E7XA 5L39A 3E2EA 1V5IB 4X4PA 5U47A 2V8VA 2C2ZB 2NZ4A 1N33F 1IVZA 3LQVA 4KPCA 1R8HA 1RISA 3RYLA 4QZVB 3OSNA 4ZVPB 1HL6A 3BQ2A 2LDIA 3T6BA 1D9FA 2JVOA 4E0DA 3T19A 3CSKA 2ZKTA 4ED5A 4DF4A 5KFIA 3Q8PB 5GAEU 2FQQB 4DPXA 3J7AN 2YVSA 1RWPB 3CCSS 5D8HB 2H5EA 1F5BA 5KFVA 2ZH4A 1GX6A 3C16A 1U24A 3TUIC 1SB6A 2Z2LA 3C16B 3MR5A 4B08A 2RDJA 1P1LA 3PNIA 3GJRB 1TKDA 4X4UA 1FT8A 3PRDA 4KHRA 3M2VA 1FWPA 2B8PA 2VFRA 3M2VB 9ATCB 4GO5X 1LFWA 4DPWA 1C4AA 4YB5A 2MLZA 2OEKA 4IR9A 5E3CA 3ZZOA 2BE2A 3MUMP 2BE2B 4UUWA 2IVMA 1OJ4A 2V8PA 4B3TJ 3MEDA 4F2RA 3MEDB 5LL6d 3A1YG 1UVKA 3QNWB 1KONA 3M8SA 4P2MA 3G6ES 2ILZA 2ALYB 4RNFA 2BVZA 2MMYA 4PPDA 2JWNA 2MKKA 2FGCA 4Y6IA 3FCWA 1R27B 4F4ZA 3NRBA 3FZBA 2GZOA 5RUBA 2BEFA 2LFVA 2J9DA 1Q5YA 4DN9A 1HW8A 4JI8J 3SIPB 2ZC4A 3SQOP 5FD1A 4JBCA 2ASDA 5KFOA 2V2KA 4M95A 4DR3F 5DDQC 1RLDA 2HQFA 4DU7A 5KFHA 2WSFC 2BJ9A 1GH8A 3HLUA 2AZ3A 4JI6J 2Y1IA 4IQMA 2ZZTA 3ZZYA 4LFBJ 1Q16B 1FDAA 2YWEA 1I3OB 4ANEA 1HWUA 3LW5C 4P6QA 3UR3C 1M5PC 1S1UA 3DU5A 5CQGA 1S1UB 4GC6A 5F9LA 2C22A 1RP5A 1Q86T 1LWFA 1LWFB 3ETOA 3NP5A 2M2BA 3G82A 2RS8A 1EAYC 3G82B 1C0TA 2B4VA 4NWBA 1QTMA 1C0TB 2G0JA 1VQ9S 3LWMA 3MMCA 3GIKA 4ZPVR 3MMCB 2QSFA 4U96A 4KGMA 4WIQA 1Q8KA 4CRJA 1SJ3P 4LREA 2J0SD 3VQSA 3TP2A 3RR8A 4DBQA 3H5UA 5E41A 1RABB 5H9FJ 3H4BA 4FXDA 2AGPA 3X3UA 4EZ6A 4AXIA 2XMVA 2ZH6A 5C7PA 3PW4A 4GRSA 4EO6A 1RK8A 2GA7A 3BB5A 3ZFVA 2ZM6J 4B3MJ 2CZ4A 2P9CA 2EK1A 4MKAA 3HSGA 4N76A 2GJFA 4K4UA 2C2MB 4WFNQ 3RZAA 2YQ1A 2XS5A 3NWGA 3ZZPA 8RUCA 3M9NB 1WOOA 4MMOA 2HAIA 4NLPA 4ZVOB 2QMWA 3PRVA 4P10A 4LBIA 2A6MA 3NOCA 3O5TB 4DL4A 2PA3A 1Q81T 1HQUA 2KVQE 1HQUB 1BQMA 4J9VA 3ONQA 1BQMB 2RD5C 5ETPA 2MZQA 3ICLA 1FFGB 1AW0A 2HS3A 1S1WA 5IQ6A 4C8MA 5HVFA 1S1WB 1EB0A 5D4PA 2QIFA 3PKYA 1J5EF 3QSIA 3MOJB 1VIOA 3M9MB 4OZ1A 4WCEQ 1S4FA 3W9IA 2X1BA 3PW7A 5HJXA 4ZOSA 3CIZA 2GW8A 3CJ0A 3IGVA 3EDRB 2VQFF 4I1TA 4USTA 1B3TA 3ISNC 1J5OA 2KM8C 2OAUA 1DTQA 1J5OB 1WJ9A 1DTQB 2E66A 5K5MA 3CCLS 4IDKA 3JSBA 4IDKB 5F3TA 2CNNB 2KFYA 1NCLA 2NQPA 4YB1P 4O3SA 3ZC4A 3QRPA 2R2SA 3GCWP 3TANA 1KNZA 2HIYA 1KHWA 4M5LA 2AGOA 3ZZUA 1X4GA 3UWTA 4WK3A 2FTRA 4FNIA 4RPFA 1UWBA 4F4KA 1WHYA 1UWBB 1K44A 4DCOB 3KG1A 3BH7B 2GJIA 3IWLA 4IH7A 2P9EA 1LKZA 2ZKUA 2M0GB 2ZDPA 2CJAA 2UUCJ 2W9AA 4DZ6A 2LMIA 3C6TA 1N5SA 4UQTA 1V3RA 2ZUAA 4HH1A 3TX8A 2CIMA 3C6TB 4HACA 2VG6A 2BANA 4HACB 4URSA 2VG6B 2BANB 4DQQA 1D1UA 3H90A 1NK9A 2UVVA 1FXDA 1RADB 3B4MA 5HMWA 2U2FA 2KDOA 5CYQA 2JVRA 3VVUA 5CYQB 1F5AA 5KOXA 1S0MA 4DX8H 5BXIA 3J7YU 4M5HA 4KT0C 2XO6A 2O3DA 3SSRA 3Q83A 2XZDB 1EP4A 2YKPA 4NYZA 1EP4B 2GQQA 2Y1RI 1NNDA 4NOHA 2UXBJ 4ENOA 4QWDA 4WK1A 4NEYA 2WW8A 2FLPA 2CVIA 2E5IA 3CTRA 4OHVA 2QMUB 4Y2KA 1SI9A 3T1YF 3DRYA 4C8LA 3IBFB 2ALZA 3QFHA 3NCPA 2FJDB 3QT7A 3RRHA 5B0CA 1BUXA 4DL5A 3GSIA 2BJDA 1UEVA 3N5BA 5ETLA 2DO0A 2MSTA 2MZJA 4ECXA 1KTVA 4LBPA 3D1OA 1TL7A 4LJMA 1TL7B 2HFOA 4AL6A 1QTNB 2ABYA 3FJ2A 2ZBCA 5B0BA 2H54B 4CM0A 2CQCA 3W65A 2W9BA 1JJHA 2W9BB 3POTA 5GMEA 1HWLA 3POTB 2PEBA 2BE7D 4WFAQ 1S97A 1F3VA 2F8MA 3DCAA 4NLWA 2NYHA 1IKVA 2QSWA 1IKVB 2R7UA 4DPYA 2C3OA 2H51B 4JV1A 2PD1A 5DLFA 3D67A 2YTCA 4DPUA 1RT3A 1I1GA 4ELTA 1URRA 3FRYA 1RT3B 2WBRA 4USIA 3DXBA 2WHOA 2KVIA 4BC9A 2FVRA 1Y4ZB 1C0UA 3K57A 1HBMA 1VBYA 2CQ2A 4FVCA 1C0UB 1HBMB 4OMFG 4DV0F 1ZM2A 1M90T 1OPIA 1P9QC 2QYGA 2W2NP 4ZN1A 2DIUA 3M9OB 4L3NA 1ZPVA 2DGXA 4FF4A 2H48B 4RL1A 1UVNA 3CGIA 1LQ9A 1LOUA 1S76D 2XSJA 4YUDA 2XSJB 1UCNA 2LDYA 3WHIA 5A8KA 5M2PA 1S48A 5A8KB 2E5HA 5KFQA 1Q53A 3CC7S 4U8VA 3CD7A 4HTIA 1UVJA 1VQ6S 3OL7A 3F41A 3GR1A 4C98A 2C28A 1DTTA 2IVYA 3VAHA 1IKWA 1DTTB 1NK6A 1R3NA 1IKWB 2CAJA 4FYWB 2KI2A 4GKJF 2YWKA 1XNRJ 1GMUA 5T7LA 5T7LB 1NLKL 4ZCIA 2YNIA 1SVDA 4D3HA 2YNIB 1S72S 3C15A 3ZTRA 2ROEA 3C15B 2CJQA 2X1FA 4DR7F 4MT1A 2B9XA 3O8WA 1EETA 2WVEA 2A6OA 1EETB 3RBEA 1VC6A 4TQRA 1UZDA 3KOAA 3HZGA 1IR0A 4NLSA 4K5SA 1UL3A 4OZ2A 2XMJA 1IKXA 4U8YA 4DV1F 1IKXB 1OY8A 2XWXA 3N79A 1L3VA 5DZ6A 3GG1A 2HHTA 3GLJA 3HVWA 1HI8A 4O0NA 1NSAA 2OGUA 2LEBA 5D6GA 2KZMA 2VG5A 2VG5B 4W98A 4CLLA 4KH0B 2J9DE 2D7SA 2E5GA 3DMJA 1ZZFA 3BQ1A 3DMJB 1H7WA 1KP6A 2EW9A 4K59A 3IAM9 3I4HX 2IVFB 1SBRA 2POKA 4DUZJ 4P7TA 4DDFA 3MM6A 4I2QA 3MM6B 4I2QB 5DETA 3GSDA 5HMYA 4UY85 1YWXA 4DSFA 5KFNA 1U02A 3N0VA 1NHKL 4KIAA 1W7WA 1N0UA 4KBIA 4USJC 2QO3A 1U6ZA 2BACA 4JI3F 2OKQA 3VAMA 2MZRA 4H4OA 2XSFA 3V4IA 4DR4F 4NXMF 4H4OB 4RW7A 3V4IB 3DDIA 2HK3A 4RW7B 4P9SA 2VPZB 1HNXJ 4K4YA 3FNNA 1GEHA 2UUBJ 4AUKA 1NKCA 3HO1A 3OR1A 4QCLA 3EUNA 3OR1B 2R8GA 2CA9A 4RKUC 4LSLA 2DGSA 3HVTA 4LSLB 3T3FA 3HVTB 4WYWA 1X4DA 4RNMA 4Y2AA 2JL9A 1JLCA 2ZOMA 4UZBA 1U2FA 5BR8F 1JLCB 2GAGC 1P1TA 4LRBA 2W25A 2DHGA 3FMWA 3IP0A 3CCES 2ZJQQ 4JI4F 3KLFA 1R0BG 2GVDA 2RUSA 3KLFB 3L4BC 2GVDB 4OFZA 2Y8YA 3TEGA 3CCZA 3CDEA 3FCHA 1Q7LB 2DRDA 4A4JA 3KNAA 1S10A 4L74A 4B3OA 2KYZA 4B3OB 2XGQA 1GNKA 3KG0A 4TU8A 2J7KA 4YDDB 1WC6A 1PAUB 4LF7F 4A8SA 2G2YA 4RZRA 5HQLA 3HM9A 3U27A 4ZLNA 4RNNA 2NPFA 1G7CB 5DM7Q 2G2OA 2YNFA 2LKZA 4DJBA 9RUBA 2L48A 1NB7A 2YNFB 3HX9A 4EK2A 1HI0P 4M5NA 3P4UB 2AJ0A 2HVDA 3G86A 2FC8A 1WTBA 1QSSA 3RB0A 1ITPA 1KVKA 2DH8A 4RUHA 5CD4H 1YBUA 3SEOA 3M05A 2XLJA 2DVIA 2CYYA 3BBFA 2JX2A 2F4VF 2BUNA 1LFPA 4EYIB 2LYVA 4XIUA 3D4JA 4OIXA 3HHDA 3H0PA 3CJ3A 3HI9A 1WC3A 3BGLA 4TYAA 4KGKA 1LW0A 2AX0A 5D4LA 1LW0B 2UVRA 5ETNA 3KLHA 1UJ5A 2VJVA 4OZ3A 3KLHB 4X66F 4Q43A 2ATCB 2FVQA 3JTOA 4KGXB 2C3PA 5HVGA 3GIIA 2XEXA 2WK4A 2KJWA 3ZXWA 1F2GA 2HFNA 2MLYA 4LR8A 4QIWD 3BGFA 4DX6A 3O1LA 3UDVA 1TAQA 3HFVA 2R4FA 3UNYA 1RWKB 1E6VA 1XR5A 3CD0A 3F73A 1E6VB 2QZ8A 2LQ8A 4C3KA 1VBZA 4BS2A 5JJBA 3RAMA 3G2XA 4W90B 3CF5Q 1RU1A 3H8YA 3CCVS 1JB0C 2XLIA 2DBBA 2MQMA 3CIMA 3OTCA 2HQ3A 1QJHA 4OQJA 4BHQA 4NRUA 2HBZB 3TUJC 2QLBB 1SPBP 4DV6F 3DOMA 2RU3A 4Y00A 2K3KA 3DOMB 4ES2A 4U7UK 2N82B 2OEJA 4PQUA 3MUTP 1IM6A 1QD1A 4PQUB 1VK3A 4ECRA 1WI6A 4LF9J 3W61A 2AEJA 1NJWA 1YJVA 4I6YA 4G1QA 3RBZA 3R6LB 4G1QB 4ED0A 1KHVA 3K89A 1SH2A 4QQBA 2VG7A 2OD4A 1FXRA 3UN5A 2RS2A 2FVCA 2VG7B 3PJXA 1HR0J 4BLGA 4F36A 1VRUA 2I6WA 5IT9Y 3NKYA 1VRUB 2FDNA 3ILJA 4BCAA 4J9NA 1CLFA 4MKBA 2AP6A 1HFEL 4JV0A 5KG4A 4FP9A 3DC2A 1U4BA 1I94J 2HGMA 2I1RA 4ER8A 2CNLB 3CT9A 1T9YA 2O5DA 1XMQF 3C46A 3EDQB 1RHRB 3TAQA 5AE2A 4OHYA 4ZKAA 2G2ZA 4J90A 3BKUA 1U6FA 4DX5A 5HLFA 3DM2A 2IMOA 5HLFB 3DM2B 4LF6F 4GKKF 3GCXP 3D6TB 4DV3J 1M1GA 3MM8A 3A3NB 4NLQA 3MM8B 2HGLA 4RUAA 3ZNJ1 4LFCF 1WI8A 1S1VA 1RAJA 3PACA 3CWJA 1S1VB 3AY0A 4H4MA 3AQOA 3D66A 4H4MB 2D41A 2IRXA 3R6GB 1Y7PA 3CCTA 4J9RA 2VIHA 4ED7A 5F8JA 2Y8WA 3TJAA 5J2NA 5B09A 2EBGA 5J2NB 2DT9A 3FDSA 1HWKA 1PGZA 2GGPA 2DCUB 1IBMJ 2GGPB 4UF4A 1FWLA 2QEXS 1DARA 1TK5A 2XCAA 5L9XA 4JYAJ 3CO9A 1UA1A 3ZNUA 2C1EB 4ED2A 3A12A 3NCQA 3L7PA 1U09A 4H54A 1IBKF 2GO9A 1FKAF 2WW4A 3IC1A 3NCRA 3BGUA 1RE1B 5LXYA 4LF8F 5K8NA 3ULHA 2R8KA 4OYZA 2OJ3A 2ZDOA 5FIIA 4FPIA 4EFAC 4KAIA 4L72B 3H2LA 2X1GA 3LH2S 2BDPA 2RQCA 1WWHA 1NSQA 2Z2MA 3R5DA 2CUYA 3DLGA 4DSKA 3VAJA 1RWWB 3DLGB 4HI2A 4OJ1A 5ETKA 1I5OB 3V81A 1BGXT 3TVYA 2J8SA 3V81B 4DR2J 1VR6A 1T9TA 4B02A 1SL0A 1LWEA 3BPDA 3SSQA 1JLFA 1LWEB 2VFTA 1JLFB 5KFLA 2E1CA 4CDIA 2PT0A 2JOQA 4EZ9A 1NEEA 2I5JA 4WPAA 3GQCA 1H2UX 3L95X 2I5JB 3VR1A 4V19J 2G9OA 1NDCA 4H4KC 3BEGB 4N41A 3AFGA 2VQEJ 2JJ4D 3AHPA 3ZO7A 5D0EA 1VISA 1YJTA 4LF4J 1HHQA 1VRQC 1NK8A 3NGDA 1IQTA 4CTAA 5HO4A 4CTAB 1DQ8A 2MKYA 3GFYA 3FFIA 3Q22A 3U1MA 1C4CA 3FFIB 3HFKA 3QIPA 5FDLA 4ECVA 3QIPB 5FDLB 3A8KA 2QYCA 4K2XA 1MWQA 1AT1B 1P9YA 1R8BA 3AA8A 1TQLA 4X65J 2XNQA 3QJJA 1U25A 4CO5A 3PJWA 4ZVGA 3MWBA 1MMLA 3EZOA 2DR6A 1NK4A 2ACMA 3VGUA 4RBVA 2FHOB 3EE3A 4X4NA 4X4OA 4XTTA 1OMSA 3OPKA 4PXEA 4P75A 4DL0C 4JI7J 1NJXA 3BSOA 1U1LA 1QSYA 1G3OA 4NLUA 3UN3A 1WACA 2RKIA 1L3TA 5IT9U 2RKIB 1YRUA 1VQOS 2QL7B 4WKYA 4JP8A 4IOBA 1WKJA 4QIEA 5D3GA 2HFZA 5EDWA 5D3GB 3W8PA 1WHVA 2OHDA 3OFFA 2JC0A 3X1LB 4YB7A 4QPTA 4FBUA 4KE5A 1RA6A 1RHKB 1YVFA 1ZM3A 1YBTA 5DDOC 2KM8B 1N56A 4Y28C 2GFFA 4A8XA 2OP5A 2N3OA 2J76E 2XMWA 1J27A 1TL1A 2UXCF 3V5RA 1TL1B 1WG1A 3HHEA 2H3EB 5LMUJ 2X7IA 2VONA 1HNZJ 4USMA 2V9WA 2DR7A 4F4YA 2XI2A 5JVGQ 4LSZB 1X4BA 4JI1J 4ED8A 2ACYA 4NMLA 4RJVA 2K7KA 2Z2YB 4F4XA 2QA4S 3DGVA 3OW2R 4DFKA 1NRKA 1NKBA 2EFVA 4QYZK 1TK8A 4I67A 2GMJA 1CJTA 4MIWA 1PYOB 2A1BA 1X31C 2MKCA 1CJTB 1AUDA 1S57A 2YH1A 3FQKA 2FJXA 1T02A 3FCVA 2W01A 1FJGJ 2QA2A 2ZBIA 4JI5J 1Q95G 2VFVA 3LO3A 3V6KA 1RHMB 4JV2A 3SMZA 3MD3A 1H7XA 4L3KA 3DDNA 1X4HA 2HZAA 4CT8A 2R8IA 2HQIA 4XDCA 5KG6A 1D9AA 5KFUA 3CD5A 2CPZA 1O6XA 5A0YA 1W2IA 5A0YB 1TP7A 2MHEA 3SXLA 2ZEJA 5EWEA 3OXGA 3MM5A 2EK6A 2F1FA 2VICA 2DO4A 3MM5B 1YGYA 4WE1A 3IR6B 3OT9A 4WE1B 3CW2C 3EXYA 3AJ2A 1CQNA 5B0EA 4NA2A 1NK7A 3AOBA 3SCIE 3R2CJ 3LALA 4USVA 2V2QA 3Q0AA 2APOA 2IM0A 5F8GA 5DDRC 2AD9A 3U7JA 2COLA 2HHXA 1CEZA 1AFIA 2JC1A 1GMVA 4RWXA 2HYIB 3PX4A 5H9EK 3CJ4A 1RAGB 1VFJA 3AD7C 4NLVA 5E2QA 4U7UD 1X4EA 2WVFA 3I32A 1FEHA 1RT4A 1RI7A 3BYPA 1PC5A 1T03A 1RT4B 2ZH7A 1T03B 1MWYA 2G13A 4F25A 2RVJA 1S5ZA 3QGGA 1BLUA 4HYKA 2L08A 3S01A 3CJ8A 2VKZG 3GYNA 2DITA 4F4AA 1B70B 3ILIA 2Q6BA 4OX8A 2XCPA 3BO4A 3IN5A 2ZVSA 3Q2TC 3TWZA 3ZTQA 4RLEA 1TELA 2GMHA 5C5JA 1VQMS 1RWOB 2XBPA 3KUHA 2C2EA 1QSLA 4ALZA 2L9DA 2D69A 3D0HE 4FYDA 4OV6A 1FDNA 2GV1A 1G1XA 2V8DA 2HLTA 2AGQA 1HNIA 4QR1A 2MHNA 2DH9A 4PYAA 1HNIB 3JSRA 2DY1A 1HQ2A 3KFWX 4JI0F 5IWAF 2WCXA 5GADU 2AX1A 3JS9A 1WUUA 2YKAA 1NK0A 4PCQA 1F1BB 2KXNB 3HPOA 1IM4A 4FYVB 2V2VA 4UW2A 2OPRA 3HT0A 2HSEB 2OPRB 1UWAA 2AT1B 3BKFA 1H38A 1BC6A 2DRBA 3H5XA 4OI4A 1KC8T 4A8MP 2ZH8A 1IJEB 4ZP8A 3V6HA 3KKFA 1XMBA 4C9DA 1FF2A 2WOMA 1R89A 1QAIA 3D54A 2WOMB 4F0HA 2B7BB 3DHWC 2CJBA 1IN0A 2GMLA 2ZOGA 3MPDA 4EEYA 4TVAB 1N5VA 3IO1A 3PEJA 3GFHA 3AD8C 1U6BA 1JLEA 3PZPA 3W9HA 1JLEB 5L1LA 1BWEA 3LAKA 2RRAA 4CO3A 5E3RA 1L3KA 4IRKA 3T41A 5DQHA 4PAAA 3D7SB 2MKSA 3WC0A 2DB1A 3GV8B 4ED6A 1CJUA 3KJFB 2PE8A 3T5LA 1CJUB 2PI4A 3MD1A 3B54A 1U2CA 2CG8A 2IRUA 3IMQJ 1RU2A 1WSVA 1TVRA 5I3UA 2BOAA 4LUBA 1TVRB 2MKJA 4CO2A 2R8JA 5I3UB 3QPIA 2PFFB 2YKQA 1A6LA 3UD4P 1OQ3A 2BJEA 5THWA 1N54B 4FS2A 4KGZB 2K06A 5I3PA 3PO4A 3MGJA 3FSXA 4C0HA 4WTOB 1AA1B 1Y3JA 2C3YA 2GO8A 2VBWA 1UVIA 2D3ZA 4JI8F 3W5ZA 4C2MA 1JXEA 3MAHA 5C2GA 4OI0A 2CRLA 4OX6A 1TMJA 4J9KA 1R31A 2H9ZA 3LA0A 1RUSA 3FVYA 5AJ3J 4C8KA 2VPWB 1HWJA 4A8FA 4I7FA 4X4SA 3DN9A 3AB4B 4I7FB 4MTPA 4JI6F 2IA0A 1K0TA 5L1KA 2FC9A 2AKWB 4CLSA 2ZVIA 1PKUA 1N8RT 2Z30B 4AE5A 2VBXA 4LFBF 1EKSA 5K8PA 1VJQA 1VQ8S 4RNHA 5E3PA 1D9DA 3MECA 1IXKA 3MECB 4CO0A 4PKDB 2UU9J 4J5OA 2HFUA 5F9NA 1YK9A 3QO9A 1X5PA 3PV8A 2ATLA 3QO9B 2HAFA 2B4OA 3NAIA 4UZCA 2VASA 2N7YA 1NBEB 1M5VC 2OTLS 4Q2LA 3MCMA 3RG6A 2VDIA 3R5GA 1WNEA 4YEAA 4G3IA 1H0HB 3E8OA 2ZE2A 1YKWA 1FNXH 2ZE2B 5J1EA 1N34F 1RTIA 5J1EB 1RTIB 3C14A 4R8UA 4DU8A 3C14B 4R8UB 2XLKA 4XPCA 1Y5NB 3EX7B 5HVHA 2P5VA 5LSLA 5LMNJ 3NEKA 2VZ9A 2VQFJ 1X5SA 3DLEA 2KZZA 3BKTA 1HHTP 1JJ4A 3DLEB 3SYZA 1Y5IB 1T3NA 1FFWB 2FJBB 3GMGA 3R7SB 5JXSA 1VQSA 1ZM9A 1ZA2B 3I4PA 2ROPA 1WDTA 3DOKA 5MAOA 3MDFA 3DOKB 2ZM6F 4B3MF 2PIIA 4AT1B 3Q89A 3EM1A 5L9NA 3DFEA 1VQLS 1D8YA 3D5MA 3DOLA 4P74A 2XS2A 1YJUA 3DOLB 1B0VA 2KU7A 2BABA 4B3SJ 2HWIA 3BPSP 5BYRA 4HVZA 3GIJA 5KT6A 1OPZA 3OTEA 3JAMY 1FI4A 2E1PA 1JJCB 2E1MC 4HHHA 5IT0A 1U1KA 3I6PA 1KSPA 3M8YA 4A47A 5GAHU 1QY7A 2QX0A 4ED4A 1NU4A 1O51A 1X0PA 1U1MA 1SC3B 4QJVA 1RAFB 4Q5VA 6FDRA 4USKA 3UO0A 2XZTB 4I56A 3MCNA 3LOUA 5EUHA 3H25A 3W7BA 3CNQP 1X9WA 4JV5J 3LP2A 2DNQA 2IPOB 3LP2B 3Q86A 1NZAA 1WF0A 4YY3F 2N3LA 3SBMA 2YWGA 3RAXA 4X4VA 3ENQA 1H73A 4ZPAA 3KLGA 3PIPQ 3KLGB 4I4BA 1E6YA 3PHTA 3HHLC 1E6YB 2XY6A 3W60A 2J6SA 4GVLA 3DI6A 3MPYA 4YHHJ 3DI6B 1N36J 3PX6A 2ZWOA 3R7BB 3I55S 4PXCA 1SC6A 3FK4A 4KYZA 3PW2A 1WEXA 4WIIA 1S9GA 1S9GB 1R6VA 2UUCF 3ZTOA 1LNQA 3M6UA 4M5JA 2C3UA 3AB2B 2J0WA 1Q8BA 5ETTA 4RX6A 3EVMA 3TEHB 4DFPA 3MCOA 3UN2A 2D3UA 1CG2A 3LP1A 4TNOA 2QN6B 2KG0A 3LP1B 3P45B 4B9UA 4WXWA 1TTHB 4DUYJ 5DGAA 3D0GE 2RQMA 5AXMA 1IKYA 1KBRA 1M5KC 4KH1B 1IKYB 2L9NA 3H4DA 5IC6B 3D3CJ 1HWIA 2H5IB 1YG0A 1NO8A 2M52A 1H74A 3PDNA 1ZS6A 2UXBF 2CZ9A 3HHKA 2VJUA 3NNAA 3PO5A 2BJ3A 3UFCX 4WFBQ 4DS5A 2XGPA 3I56S 1DRZA 1R7IA 4CLFA 1VI7A 5DG8A 4GVBA 3IR7B 4GVBB 1G6BA 1S6QA 2W7OA 1FRIA 4KSEB 3DRSA 3OFGA 1RDRA 1S6QB 1Y00A 3DRSB 4PWDA 4QWEA 2FYXA 1OIAA 4OJHA 4PWDB 2DNYA 3KHHA 3UCZP 1EIYB 3HP6A 3EGWB 2E9ZA 3OBIA 4KV8A 5A2QY 4MJKA 4AYBD 4KV8B 4B17A 2CG4A 5JVHQ 4EWTA 1PJ6A 1REVA 1FESA 3K5MA 1KOHA 1REVB 2RAQA 1MN9A 5HMXA 3Q8UA 3MXHP 4PEOA 4K4WA 3CULA 5F0UA 2X3GA 1Q8IA 1VK8A 1NMEB 1SKUB 3WX8A 2WAQD 4NYOA 3UDLA 1IR1A 1ELOA 2Q1LA 2NREA 4ZLPA 2EFGA 2VU5A 3K5PA 1F9FA 4OX9J 3R8YA 3E01A 2EC0A 3E01B 1DQAA 4WKRA 4GKJJ 3TZWA 2CKWA 2HNDA 3TJ9A 3JAMU 1XQIA 2HNDB 4PABA 4FNHA 4DLGA 2B9EA 1XR7A 2WSCC 3N6NA 3UNGC 2OO4A 3VF0B 4OHXA 3RAQA 1C1CA 2XMKA 3OHAA 1C1CB 4DR7J 4IYQA 3TRGA 2LLZA 1S0NA 1VBKA 3VGTA 5A8WA 5JMNA 1NPPA 4A8QA 5A8WB 2H4YB 1RWXB 4DQSA 1S0VA 1QUPA 3KUGA 4OX7A 4K0KJ 5LJ3Y 1HYSA 1Y5LB 2DGQA 4ZJQA 2XYGB 1HYSB 3M8QA 4DV1J 1TU0B 3RU0A 3M8QB 2FIUA 3ISZA 3G4SS 4M5DA 4M5DB 3GJQB 3BV8A 2BM0A 1N5TA 3A8EA 3M1VA 4O3QA 2WVCA 3M1VB 3A8JA 2JLGA 4LFAJ 1H2VZ 2B8QA 1PC4A 4F0MA 1KEKA 5AXLA 2CXEA 5HANA 2HK2A 1UFWA 3LGNA 1HBUA 3UVJA 1HBUB 4K2JA 3UVJB 3TARA 2HHUA 5ETSA 1PILA 3MFHA 1XNRF 2YKOA 2O1PA 1JKHA 3CCWA 3K5OA 1UKUA 1BY9A 2CQGA 1JKHB 2CJ9A 2XYPB 4LF5J 3U1LA 4B3RJ 2I9SA 1U49A 3KG4A 3CCRS 2XI3A 2WRMA 2J7WA 3N28A 1UETA 1GT8A 3VAIA 3DNCA 3IWXA 5KT4A 1S9FA 2HVHA 4JI3J 2OPPA 2UXDF 1X60A 2HHVA 2OPPB 3MZIA 1KQKA 1F60B 3PFOA 3R2DJ 1XIQA 3A3OB 2R7WA 4H4KA 1ZYQA 5LM7E 1W2BR 4DV5F 4R0EA 1NJYA 2MZTA 3OXFA 4ILRA 1A7GE 2J7UA 1NB2A 3KDOA 1IQZA 3E51A 3PM9A 2HFVA 2F40A 3Q8RB 3K5NA 5FLXY 3RBDA 1YJ9S 2QLJB 2CWXA 4OYMA 4OZ0A 3CJQA 2LQJA 3TUPA 4I0WA 1F3FA 3VZIA 5BR8J 5MLCV 2B4PA 1Q78A 5I42A 1TFWA 2VBZA 2ZBRA 5L1JA 5I42B 3CEDA 3D0IE 1FVQA 5E33A 1T7PA 2QL9B 4F26A 2DNGA 3HCXA 4QIVA 2DK2A 4DUZF 2YWHA 4IH5A 2UUAJ 2R3VA 3CDUA 4N47A 1P27B 2NLWA 5A2QU 3M8WA 4QOTA 4CT9A 2FZKB 2Q66A 4LF7J 3GYGA 5DS7A 2GJ2A 2ZC3A 3MAAA 1DFDA 3MAAB 2DR8A 4Q7AA 2V68A 3PW0A 5IV4A 4Z2XA 2KH9A 1K8AT 1HD1A 5F8LA 2VPYB 4HR2A 5F8HA 2K2PA 1F9HA 2KRRA 1HNXF 1SH3A 1WHXA 3J7Z5 3R3TA 3NOGA 3I96A 2KN4A 3OJSA 3CB4A 2MPUA 2MTLA 2WTFA 1PJ5A 3MCSA 2DGUA 4FF3A 1I51B 4ITSA 4AD6A 1VIXA 2LXUA 1U1NA 4J9OA 2F4VJ 3TW0A 1FVSA 3BREA 4CIOA 2WONA 4MIAA 1HKAA 2Z0GA 2WONB 5DJBA 2DNRA 1VHIA 3D9BA 2R2UA 2FGOA 4EU0A 1DAXA 4P2XA 2OIHA 3D1HA 1F5CA 4DFJA 4RW8A 2KO1A 1IWAA 4LQ9A 3R1LA 1SH0A 4RW8B 1ROFA 5ITHA 4ZHRA 2LXFA 3FC9A 4ZHRB 2I8EA 1D3WA 3OTBA 1ZAXA 2G4BA 4FPRA 5LJ5Y 2P6SA 3RB6A 4ATNA 1WELA 2JEIA 2ZZNA 4PG5A 3FUYA 4MK8A 2W9CA 4Y0FA 3WIUA 2W9CB 5DO2A 1KQGB 2MXYA 1QE1A 4DMZA 5FJ4A 4IO9Q 8AT1B 1QE1B 4TXSA 1VRTA 2Z4PA 1ZA1B 1VRTB 3CJRA 2PMZD 4C7QA 3CD6S 4M1KA 1AZSA 2ADBA 1AZSB 1XBWA 4X2BA 1OSDA 4LBHA 4TY9A 3LP0A 4URQU 3LP0B 3KLEA 2G1HA 5L38A 3KLEB 3K8VA 5CYMA 1NSKL 3GFXA 5CYMB 4QBUA 3OL6A 5E5NA 4DEZA 3PX0A 5GAGI 4W4MA 1WDDA 4WBFA 2H65B 2D3O1 4J37A 1XWLA 1QAXA 1RTDA 3K0JA 4HT5A 1KKHA 1RTDB 3FEYB 1VOMA 3K8WA 1N6QA 2AJFE 1N6QB 3I5BA 1M1KT 3MR2A 1SIWB 5SZTA 3H5YA 2V8HA 2IJRA 3OV7A 3ETMA 3UR0A 5KG1A 3UDEA 2OTJS 4M5MA 4CH1A 4Q8FA 4ZVUB 2DRAA 1TMMA 3KNGA 4ID8A 5KG7A 4KHPJ 4K4SA 2HKEA 3S1TA 2DXDA 3FMBA 2LECA 2CQ3A 4B9NA 3TZZA 2FLLA 1DLOA 3F44A 4ZPWR 1IUJA 1DLOB 3CMES 1LK7A 4AXJA 2HQCA 1R8CA 2CZVC 3DU6A 2CDQA 5FLXU 2R2RA 1N4LA 1UFKA 3G71S 5F8MA 4FVMA 4KRWA 1S12A 3R1HA 4B9LA 3TVKA 4PR6A 4I68A 4CCHA 3QZ7A 4GC7A 4KC5A 2DNKA 3G8TA 3I9V9 1SJ1A 1EQMA 2OFGX 1N32J 2P8IA 1SQFA 2M8DB 2WVBA 3PYFA 3W63A 4LF9F 2DNOA 1VQ4S 3FSIA 3PY8A 4HL9A 1YITS 2VODA 4FKXA 2CJKA 1GAOA 4JI2J 3A4TA 5DDPC 4EI2A 2DNZA 1FRHA 2MZSA 2QA4G 2LEAA 4E2FB 5GAEI 2GIFA 1UVLA 4ILMA 3H40A 2DGTA 1HW9A 2F9JA 3Q8YA 1W26A 1TL3A 1HR0F 1R0AA 1C2PA 2CQ1A 1TL3B 1R0AB 3OTOJ 1PO6A 5SUHA 1SJRA 1UP1A 4IOAQ 1X0FA 1SC1B 1WF2A 2XMUA 2J9EA 1WEZA 1YLXA 2LP4A 4E98A 4ZLLA 1NPKA 1S1TA 4ZIVA 2Y3YA 4IRCA 1S1TB 1I94F 2HWHA 1IBKJ 3IM9A 3NXZA 4FS1A 5D4NA 4OYAA 1O5JA 2MYFA 1VQ7S 3NAHA 4LF8J 4OYIA 2L41A 4PG6A 2DY9A 2J5AA 4KKOA 3JQKA 2HGNA 4KKOB 2BR0A 2AHOB 2Y9HA 4ILLA 1NDKA 5A76A 1YTYA 3QGPA 2BJ7A 3HD1A 1Q5VA 4ID5A 5IC4B 2XS7A 4QU6A 3W5YA 1OY6A 4DV3F 4ID5B 5KFXA 3BH6B 2NXCA 3UCUP 3SV3A 2AV5A 3BSCA 3RGIA 5AE3A 3NGRA 3ILLA 3EGVA 4FDFA 2OMOA 3FBBA 3GG0A 3J81j 1BHNA 2QLFB 3BQ0A 4F3QA 2OUGA 3HJFA 3ZTPA 1YIJS 3VGVA 1VC5A 2RE1A 1SL1A 1XK8A 4KGVB 3GIRA 4XO0A 3M6WA 3JTPA 3AT1B 4F8RA 4IFVA 1IBMF 2ZNZA 1FTCA 2A10A 1ZH5A 4IFVB 4XPEA 5J1PA 3HT3A 1Q0NA 1SUQA 4JYAF 3T1HF 5D78A 5IQQA 3OUYA 1SUQB 3SQGA 3OUYB 3SQGB 2KT5A 3RUBL 1XNQJ 5KFEA 1J2VA 2MKHA 1MNEA 3GYXB 4QU7A 2QG9B 2KXHA 1RT1A 1U0SA 2GQCA 2W4PA 1RAHB 2UVWA 5C2CA 1RT1B 4MH8A 3KJQB 4O3PA 3W5XA 1U8WA 5JUMA 2MQQA 3G96A 3MEKA 1VMBA 4U67Q 5GMDA 3AXKA 5DGBA 1RWVB 1T11A 4USUA 2DGOA 4DR2F 3ENWA 1GXUA 5D0HA 2WB1D 4ES3A 4FF2A 3TVZA 3QT6A 2BQUA 1TAUA 1CC7A 5J2MA 3CXCR 3I0RA 2BKOA 5J2MB 3PCOB 2MY7A 1LK5A 4DFMA 3I0RB 3B6BA 2FVSA 4UY8T 3M8RA 3LGHA 4DR5F 5J2PA 1LXNA 3QRQA 2V4JA 4ZCMA 5KAKA 5J2PB 2PA8D 2V4JB 4DV4J 2E29A 2KRBA 5IOLA 3Q8QB 1YZ7A 4NLOA 3TQEA 1MLAA 1H2TZ 2HHQA 3G9CA 2GIQA 4LF4F 4Q2MA 1D8ZA 2BKPA 2DPIA 3MR7A 1RT6A 2EKNA 1RT6B 3AJDA 4DQRA 3WIVA 2B0GA 1WOSA 1RKIA 4FN5A 2DPJA 2DKOB 1NH8A 1U48A 1V9OA 2AYEA 1YX2A 4CLYA 4X65F 2F9DA 2KFNA 3CUNA 3HSDA 4CM2A 2MY8A 2WVDA 4DL2A 4J9QA 2QFJA 4Y2IA 4I2PA 2RRNA 4I2PB 2BMBA 2NYIA 1FWKA 3KYLA 4DL3A 4ZLJA 4F3MA 1VHFA 5KFZA 4JI7F 3M7VA 2IMWP 2HMIA 3AAWB 3C8YA 2CPHA 2HMIB 4EO8A 2EEYA 2RILA 4NXNF 1HARA 4F7VA 4IG0A 4IG0B 2JEFA 3BM7A 3PTWA 1UPMB 4IO1A 2RDIA 2GIRA 5CCLA 4OYBA 1FXLA 3RW7A 3B82A 2JZ5A 1FTRA 2XB2D 2HBQB 1A0OB 5DG9A 2CQIA 3EPGA 1OSCA 2QT7A 2ERRA 4OI1A 4PRFA 3WX4A 2MEWA 4IUFA 4P73A 3IM8A 1D09B 1RLCL 4DR1J 1TKXA 1TKXB 2X1AA 1JQGA 2KHDA 1NXIA 2RMLA 3ENVA 5D0GA 3PR4A 4PWWA 2EBEA 2QLWA 5BYQA 5KFKA 3AA9A 3HHLA 1GX5A 3HHLB 1RTJA 5LMUF 5IZHA 1HNZF 1RTJB 4N77A 2EG2A 1WC0A 2A2CA 1GMWA 3BYRA 4JI1F 2HRTA 3TOQA 1CULA 2EC2A 1KFSA 4EBCA 4DV2J 4C3MA 2XMTA 3HKZD 1CULB 4CI0B 2YXLA 3T9NA 3DLHA 1WD6A 3QBCA 2HHSA 4AL5A 3NS6A 3OL9A 4W92B 5K8OA 1VC0A 2YWWA 3MR3A 2JFDA 1VQ5S 3W2WA 1FJGF 3W2WB 1X5TA 3CJ2A 4DSLA 4RU2A 4JI5F 2VKRA 2VV5A 3PKMA 4DN0A 3W66A 4J9MA 2R7OA 1KR4A 4OV1A 5KFSA 1BD6A 2GVZA 1H6KX 1OYDA 2GVZB 2R7SA 2B3TB 2IYGA 2FJVA 2XHWA 1NAQA 2CPJA 1U2RA 4Q45A 3J7YI 2BA9A 4ZIWA 4YFUA 2XQCA 3L9ZA 2IIHA 5EN1A 4J9PA 1YJRA 1MMNA 4NPOA 3BSAA 3G6YA 2CQ4A 2FJWA 3Q2SC 2JLEA 4YDXA 2CJXB 2HW3A 1IBLF 3W1YC 1RT5A 4FKYA 3ZZRA 2G0IA 1RT5B 3TNVA 5E3AA 1M0SA 3O3LA 1B64A 2UV8G 2OSQA 2XY5A 2ILYA 5LXRA 2BW7A 3BR8A 3N5FA 4X62J 1FHTA 1V5VA 4YN3B 2XY7A 3K17A 2B43A 4C97A 2RQKA 3GB0A 1FRMA 4DG1A 2K1RA 3ITHA 4DG1B 1SJ4P 1S1XA 2K1RB 3ITHB 2JLFA 1S1XB 4DCJB 4UT4A 3MR6A 4ES1A 3VV2B 2KTQA 2K7JA 3K58A 1TUWA 2W2PP 1VCTA 4ECYA 5G0RA 2EFOA 4ELVA 1IWGA 1UEKA 5G0RB 4JB8B 1PJ7A 4OZLA 1K0VA 4WJBA 2FHJA 3QT5A 2ZH9A 2HURA 3DRRA 3US5A 3DRRB 4X64J 1RTZA 5HBMA 2PMWA 1Q7YT 1Y3KA 4HDHA 5HBMB 2DGVA 4KFBA 4QWAA 2LQ5A 4KFBB 4FXWA 4DI6A 2BJ1A 4URGA 4ECTA 2PN6A 2M70A 3NMAA 2VB6A 1WG4A 1NK5A 3DKDA 3V6JA 3NY0A 4KB7A 2HPUA 2DHAA 2F5GA 1UMJA 2J6UA 1F6TA 2CPFA 2FVPA 5D4OA 3S8SA 2ZH1A 2MJUA 2DCLA 4LF1A 4C8NA 1NKEA 4A8OA 4CLUA 1EJ7L 2BRKA 4M5GA 4TLQA 3M6VA 4C8OA 3OXLA 5EX3A 5DZ7A 5H1SV 2IM1A 2BQRA 1YDLA 3U1NA 1RKJA 2PSZA 4ZJLA 1RCXB 1RQ0A 3VAFA 2W4DA 3S7RA 3KUEA 2W2MP 1RACB 3SI8A 2E5JA 1X5OA 3JSMA 4EYHB 3TA2A 3JSMB 2EFPA 2D1CA 4TYBA 4HH0A 2M4MA 1T05A 3G6XA 1QUVA 5KG2A 1T05B 1FDBA 3HKWA 5AE1A 3M8PA 4ZVTB 2AZ1A 3M8PB 3H5SA 2HHHJ 4F67A 2FY1A 3LGMA 2AW0A 5GMKa 3B78A 4LVOP 3R5AA 3NGSA 1KOOA 4NCBA 3P49B 3M30A 5M2UA 5K14A 3M30B 4HHUA 5K14B 3K2YA 2VA3A 4LRAA 4GMKA 1F9EB 3AOCA 5KT2A 3IWNC 4ECZA 4CZCA 1BMQB 3GJSB 3C19A 1VQNS 1FRXA 2R7XA 3OVBA 2KT2A 4ZVSB 3PIOQ 4CP5A 1DURA 4QIGA 2NS1B 4YR3A 3QJPA 1YQHA 3L7UA 2B6AA 4P2SA 2B6AB 1N34J 4Z7CA 2XTJP 2KJVA 2F63A 4D3GA 1RAOA 2YNGA 2VFUA 4F50A 4FYXB 2YNGB 1DBDA 2XMMA 2AWZA 1HQEA 1TL5A 1HQEB 1N5QA 3GIMA 1WTFA 2IYIA 2YX4A 4ZP9A 2EFQA 2HVIA 1FA0A 1X8DA 4Y65A 3I31A 2GHWA 4RW6A 1LEOA 3JB9k 5AJ3F 2ZITA 1XMOJ 4RW6B 4DL6A 1FJCA 3VALA 5KT7A 2U1AA 4XDDA 3ISND 4DQPA 2KKHA 4ED3A 5B0AA 3EPIA 1ACMB 3FQLA 2BYCA 1S4EA 4J9UE 3KK3A 1I6JA 5KG0A 4J9LA 3KK3B 1FCAA 3ADAC 4ETZA 4ZCLA 4DV7F 1IR2A 4U6PA 4J9SA 1HNWJ 1RSCA 2UU9F 3ELHA 2XO7A 2BKNA 3M2RA 1T94A 2VHGA 2BE9B 1F0XA 3M2RB 2IRYA 4ZVEA 5CYJA 5DRKA 4WFZA 2RU9A 2ZBPA 2NZCA 1FE0A 3J7A1 2JFKA 1FERA 3VWSA 1UZHA 1JK9B 2YQ0A 1RT2A 2GNKA 2M8HA 2V94A 1RT2B 3RB4A 1FKPA 1FJ7A 1YJ7A 4IRDA 2E9RX 1FKPB 1L3UA 1G4CA 5HL7Q 1SJFA 1WEYA 4UOCA 1XEZA 2CQPA 4U9RA 2H5JB 5KFFA 5F0WA 5ETMA 2CPEA 4YY3J 1FNOA 4PXBA 2FLOA 1U0HA 4FBTA 3BS9A 5LMNF 3G8QA 1U26A 1U0HB 2VL1A 2CPIA 5AXKA 2NPIA 2D74B 4F04B 1BWVA 3AH6A 4UQGA 2XHCA 2AQ4A 4C11A 4C11B 4M63A 2DR9A 1FX4A 3WBZA 2C2OB 5L1IA 3QFWA 4NA1A 4KPYA 1QM9A 2C42A 3I87A 5BJRA 3EMTA 1NH7A 1M5HA 4B3SF 2V34A 2JNJA 2Q3PA 4P2FA 2EVZA 2H1YA 1JLGA 5IM0A 1JLGB 4B9MA 2M7SA 5IM0B 1WORA 1QVFR 3OLBA 5G4DA 1GXLA 3EGNA 4MFBA 3F0NA 4PG7A 4K7QA 4MFBB 3V4MA 5HP1A 5KFRA 4L75A 5HP1B 4KJIA 2E5LJ 3BDEA 3VHQA 2F3JA 3VTIA 1VQPS 2V6AA 3C6UA 2HRUA 3C6UB 2UVUA 2GS8A 2DNHA 1HA1A 4AQYJ 2XG8A 4WU3A 3H98A 3GTYX 1PG5B 4I64A 4NCGA 2VD3A 3KK2A 4NCGB 4IG3A 3KK2B 5I4MA 2CVEA 4JV5F 5J1NA 4IG3B 5HAOA 1SC4B 4RO0A 4U7CA 3VGSA 4ZP6A 2KB2A 3THVA 3NNHA 3SCKE 3H2VE 2O01C 4ZPBA 3Q8SB 2B56A 3EZUA 3R5JB 2BX6A 3J81Y 2K8GA 4LIWA 4NZ6A 3P8BB 1TK0A 2B9WA 3BGRA 2ZH2A 3BGRB 1VS3A 4NLDA 5KFAA 1Z1ZA 4CQ1A 3CJTA 2SXLA 3TA1A 2Z8QA 3PVXA 3CC2S 5IV3A 4YHHF 5L46A 4WFYA 1S6OA 1RAIB 1N36F 1S59A 3D3BJ 1GTEA 3DGPA 3L7OA 3SCJE 3BR9A 1B4SA 4PG4A 5KT3A 1FK9A 3DGPB 2Y0SD 1FK9B 4P71A 1PBUA 2PEHA 4X4QA 2QJ3A 2MQLA 1R6YA 2RHSB 1ZBTA 2FHMA 4Q8EA 2IM2A 4DPOA 4DWIA 2DHHA 4O3OA 2LU2A 4NE9C 3FEXB 8ATCB 4O4GA 3P5TL 2I38A 1NJZA 4O4GB 3VQTA 2IDEA 1EX8A 2G1DA 3QAEA 1FKOA 1FKOB 1L3SA 4PYDA 1FX2A 1K73T 3LWLA 3G87A 4DUYF 3HXMA 4C0OC 1R8PA 3T1AA 3GE9A 2NUUG 1KTQA 1REGX 4LMZA 2RUGA 4ICLA 3WC2A 2QA1A 2W2QP 4ICLB 4OL8A 2NCKL 1QVGR 1TKZA 1RA7A 2HLUA 1TKZB 4DUTA 5D77A 3SZ2A 2EWHA 3M8ZA 3PYEA 1SV5A 3HZEA 1SKSA 1PYTA 1SV5B 2BQ3A 4ZDNA 2HNZA 2HNZB 1T3OA 5KT5A 1HBOA 1TR0A 3A13A 1HBOB 2DJWA 3JQJA 1EARA 1CS4A 2RIJA 1CS4B 3DXSX 5LOQA 4OZ5A 1JLBA 1JLBB 3PEHA 5M2RA 4JOUA 3P3DA 2O66A 1U8SA 1UAWA 3G6VA 2E7VA 1X9MA 4A8WA 2GQ2A 4WWSA 3BN4A 2C2KB 1CVJA 4DR6J 2DNMA 1MSWD 4LT6A 4G1PA 2J9CA 4CLPA 1M5SA 1PIEA 2JSXA 4TLRA 1Y9OA 1KD1T 2VDHA 1SL2A 3FBFA 5KFJA 5EHHA 2CDRB 5KFDA 4QIFA 2F8HA 1N33J 4K4ZA 3QWUA 3UQSA 2MKIA 2OPSA 2FZCB 2OPSB 3K7RA 2JDJA 4OHZA 4OX9F 2ASJA 2HZVA 4EUVA 1NHUA 3QJLA 4WU2A 2VBYA 1RZMA 1B99A 4CO1A 4MIBA 4U95A 5A6WA 4MKYA 4L6V3 1RWMB 2HNYA 3D6HB 3W62A 1S7HA 3BN7A 2HNYB 5CH7B 1HIYA 2R7TA 1U1QA 1JLQA 3PRBA 4CNYA 5KTQA 3H7HB 5E0OA 4QWCA 1JLQB 3CCQS 4OZJA 4IH6A 2W1BA 3I82A 1SCJB 3AOAA 3KHGA 2OH2A 5DM6Q 3CDWA 4PWUA 4G6VB 3SFUA 3KHRA 3MMAA 1XERA 2UXDJ 1CBKA 3MMAB 2DGWA 5AT1B 1RAAB 4RUCA 4K0KF 2YWFA 3QGHA 3UPFA 1NJIT 2AJ4A 3FKBA 2VC1A 1VLOA 4JUZA 3AXMA 4DV5J 5IT4A 3Q23A 3R7NB 3BJYA 2WZ1A 3J81U 1MG7A 3OJUA 1ZZNA 4LFAF 1RB0A 4TKTA 5CAAA 1H98A 1M5OC 2ZHOA 2FJEB 2B7CB 2DISA 4HI1A 1CSJA 3D1QA 5A6PA 2M88A 4ZJOA 3BSNA 4I6WA 3QQCD 3FBCA 4UUXA 3MPUB 4V1Ak 5KOWA 1NM2A 4DR3J 3FZ2A 4LF5F 1UVMA 4B3RF 3QZ8A 3OQ2A 4LRCA 2B4UA 1CJVA 3EVOA 2Q43A 2OSRA 1CJVB 3D28A 3EYZA 2DIVA 5KFCA 3UCGA 3QRRA 5KFPA 5EX0A 3UDCA 4HT7A 2RSQA 2LCWA 3MTJA 4OYXA 2MZ1A 3DRXA 2X3DA 2QV6A 2IDLA 1EKRA 3OVSA 3NBPA 3BBCA 4YS2A 1K47A 1UFLA 4QR0A 2OEMA 3NBPB 1ZOTA 4WFXA 4K50A 1HLWA 4ECSA 2V63A 3VZHA 3QATA 4PQAA 1T8EA 1OYEA 4LVNP 3CMQA 1XN9A 4WXOA 4M8LA 4AL7A 5F8NA 4B3TF 1WC5A 1MMDA 3WQPA 3M2UA 7FD1A 3M2UB 4PPZA 3H2UB 2HQGA 3W64A 4F3OA 1PSDA 1URNA 3HD2A 3AJ1A 4CO4A 4YR2A 2DNPA 3J80Y 3JYTA 4ZCKA 4UTGA 3JYTB 1YI2S 1LV5A 2R42A 1P6TA 3RR7A 3DHXA 1BQXA 2UUAF 2E1RA 2RHQB 3LPYA 5HQ8A 1HNVA 2PC6A 4ZP7A 1KDNA 1HNVB 3UD5A 3B4DA 5LSOA 1F2HA 2CQ0A 3K59A 2HZCA 4FYYB 4A48A 5IS2A 4C4WA 1QDUB 4WTYA 1EZZB 4CLKA 3MOZA 2ZWPA 4ZN3A 2KHCA 5AXNA 3CC4S 1MN7A 3HK2A 4I6AA 1Y10A 2C2NA 4M5IA 4YR0A 3W8GA 2MLXA 2B5JA 1WG5A 2MQNA 1JXVA 1APSA 2B5JB 3KTQA 4P52A 5BYSA 4OLPA 3DLJA 4C48A 4C3LA 1R8AA 2KFZA 1PAEX 2V5HG 4BWJA 4AFFA 2DTJA 2F4FA 3MFIA 4PUOA 3M4XA 7FDRA 5KG5A 3T5KA 3VAKA 4PUOB 1H72C 4B9TA 3RRKA 2CPDA 1J5EJ 4UOFA 2EFNA 2FHKA 1HPZA 1S99A 1HPZB 2WBMA 5K9FA 1JXLA 2AJ2A 5CZVA 2GX8A 1MW7A 2V4RA 4P72A 1B7YB 1T95A 3VAGA 2RNEA 1LW2A 3GU0A 2LA4A 1LW2B 4M94A 2QGFB 2EXUA 3KLIA 3KLIB 1SQGA 1SJQA 3N9UC 2Y1JA 1U7LA 3DLLQ 3GZ7A 5F8IA 1RCOB 1FRJA 3UI3A 4F2SA 2BV3A 1N48A 2BM1A 1WKLA 2YKMA 4CLZA 1FO1A 4ANCA 4QW8A 3R97A 4DLEA 2YKMB 2IBOA 1B7FA 4K4VA 1FE4A 2P2CB 4O3RA 2W4CA 1WOPA 2IBKA 3CPWR 5F41A 2J0QD 4NI2A 4NI2B 2G0CA 2I0XA 2XC9A 5KFWA 4CWBA 2GHVC 1KVJA 4IOCQ 5I3QA 1S79A 2GAHC 2Z2ZA 2HFSA 2AEMA 2ZUGA 3CCMS 1SKWA 4C6AA 3T6JA 1YBAA 4ZVFA 4Y34A 4DF8A 2YPZA 1KRPA 5B0DA 1JNZB 2W7AA 2GCFA 1DZ5A 4RBTA 1UW4A 3IG1A 1MWZA 2ZZMA 3IG1B 4KHPF 3UD3P 3GP9A 3FEZA 1WKKA 3OFHA 1Q8LA 4DCPB 3OFEA 1WF1A 3IA0A 3PFEA 5EGYA 3VCDA 2ZJPQ 2YBVA 2HQDA 3T5HA 3MPWA 3I5AA 2ZH5A 3H42A 1OQ6A 2CQDA 3BDPA 4E8UA 3T1YJ 2R7QA 4DL7A 4LQ3A 1Q79A 3SSSA 4QPXA 2F7VA 3D6MB 3P96A 2M9KA 3IAS9 3V2UC 1DQ9A 3OD2A 4HTJA 2AJQA 1QLNA 5CZXA 3NNCA 2HHPA 3MMJA 5GADI 1P8GA 2UP1A 4TY8A 4TY8B 3MI7X 3OL8A 2V69A 1ZTTA 3J80U 1IJFB 3PYDA 3B8HA 1N32F 4LSNA 2JEJA 1EQ0A 4UOHA 4LSNB 1AFJA 4ZPDA 3TZYA 2ROGA 4JI2F 2DEJA 1RYRA 1TV6A 4BWMA 2CQHA 1TV6B 3GILA 2UV8A 4IQXA 1DJ0A 4K4XA 3Q24A 1Q82T 4CLWA 1CC8A 1KLNA 3OTOF 3KWMA 3KXDA 1HI1A 1A9NB 3TYTA 2BJ8A 2YQ3A 1O0PA 3LTOA 3OR2A 5LSRA 3IBCB 3OR2B 1RWUA 3VVTA 3T1HJ 4ZA1A 3R5BA 4Z37A 3ET6A 4PXDA 2DXFA 3KK1A 5HQMA 3ET6B 2YPYA 5ETVA 4KR0B 4DOZA 3KK1B 3LANA 1GTHA 3AODA 2PMHA 1Q4RA 2RJZA 3K5LA 2UUTA 1BE4A 1RAEB 4ECUA 2QRRA 4YP3A 3GWCA 4YMEA 1D0EA 1V6HA 3BO3A 2V50A 4DV0J 3C66A 2VUGA 1U1OA 1Z4UA 4OLOA 5ADZA 3KHLA 1KN6A 2OFHX 3ZZ0A 3DLKA 4USWA 3SDEA 3DLKB 4WP8A 4ZVHA 4C0BA 5T14A 4J7CA 4KHMA 3SDEB 2X51A 4MK9A 2V2ZA 4Q0BA 4NRTA 2BW2A 2VFSA 4Q0BB 1LWCA 3OSPA 1LWCB 4HDGA 5A8RA 5HMZA 2GHPA 5A8RB 4DR5J 4WP9A 4ZITA 1N88A 5B0FA 3HJVA 2JEGA 4A46A 2DHXA 3L09A 1KS2A 3S6EA 3MHYA 4LRFA 1ZPWX 1R0CB 4CYUA 3V6DA 4CYUB 5CXTA 3V6DB 1JLAA 4X84A 2UZAA 1HBNA 1JLAB 2CJYB 4NMXA 1HMVA 1HBNB 1HMVB 2F65A 3MM9A 1XNQF 2ZHAA 2JRSA 1C1BA 3MM9B 1C1BB 2MQPA 2VOOA 3QLHA 2IJNA 1DHMA 3IGNA 5C25A 4Y3CA 3QLHB 2Z57B 2FY8A 3NWRA 5C25B 2LA6A 4NA3A 5D0RA 2FD2A 2MDAA 3TAPA 4M5KA 2AYMA 4N5SA 2A3JA 5CD4A 2OPQA 3KJNB 2Y0BB 2HRYA 2OELA 1NZ8A 2OPQB 1S9EA 1UEUA 3HVRA 3I5CA 1S9EB 4OI2A 5EWFA 1V3ZA 5T41A 4RW9A 1RWNB 3A8IA 4R5PA 1AXQA 4RW9B 4R5PB 3HHNB 2IJFA 3WZ0A 4NXNJ 1JMTA 4N7TA 2VC0A 3SCLE 4O3NA 1YHQS 4TU7A 2DD8S 1Y11A 4NZ7A 4Q44A 3RRGA 1S7IA 2HVEA 2AYGA 4DV4F 2QLXA 2NXUA 5DQIA 4C8YA 2QMXA 3JQMA 1VBXA 3F56A 1U47A 4TN2A 5KFBA 3EWGA 4ZS6A 4MK7A 3EJMA 3U02A 2OI2A 4HLBA 3PG9A 4N8OA 1Q1KA 1UPPA 2CNKB 3J7ZT 4LF2A 3SV4A 4NCAA 3W3SA 3PW5A 1RGVA 3CJ5A 3NGUA 4QYZJ 3GV7B 5B0GA 4DHVA 1MU2A 3TQ1A 1MU2B 3DLBA 1XJWB 1VGYA 4UOGA 3CDAA 4NX9A 1TKTA 2IFXA 3OTDA 2V4QA 1AYEA 1TKTB 5GAHI 4DR4J 4NXMJ 4A8KA 5B08A 2BZ2A 1SKRA 4YQWA 4RWWA 3SFGA 1WHWA 1N0VC 2RQ4A 2OMLA 1FFSB 3NL0A 1LXJA 1SQEA 1EHWA 1NDLA 2H4WB 4YB6A 3TR5A 3R9LA 1IBCB 3UW1A 3CJKA 3TO8A 3KMSA 4ZVRB 4KTQA 3CJKB 4JI4J 2E7WA 1K1SA 3N6LA 2NSCA 3NMRA 4WZQA 1FD8A 4DR1F 1VYAA 1FD2A 1B0TA 2BBEA 3PJ9A 2E44A 3NS5A 2AU0A 1IBLJ 4O0IA 2VOPA 2V0NA 4WZMA 4S0MA 3FSYA 2FUG9 2A0FB 3QIDA 5H9EJ 5IFMA 2N7CA 4OYOA 3TJ8A 5K8MA 1ZAVA 5HROA 3ENAA 3JTNA 3HMJG 5HROB 3LPEA 2I2YA 2R7VA 2NSBA 1VQKS 1YSJA 2L3MA 2XM3A 1JJ2R 4DV2F 2FJAB 3CE8A 1Z2LA 1U45A 1L5UA 3GR0A 1X4FA 4KY3A 4ELUA 2ADCA 3GFZA 2DNNA 1KFDA 4KO0A 2UUBF 4DSJA 4KO0B 5HSPA 4EGLA 3FGVA 3R5CA 4FZVA 2XZWA 2ZFHA 5C42A 3TA0A 4EBEA 5C42B 2QE5A 3DRPA 2Z56B 3DRPB 2LEPA 2MB0B 4ZK7M 4NLRA 4ED1A 2PI5A 4OYWA 5HK4A 4TU9A 2C3MA 4NLGA 1RYSA 3HSZA 4O4RA 1FJEB 2HBRB 2HVZA 4X66J 2M3DA 2CNOB 1ULRA 4RU9A 5ETRA 1T9WA 4LRDA 2ZNYA 3D2WA 3EVWA 4NEZA 1RBLA 1YJWS 2L9WA 2YKNA 2PGCA 2YKNB 2HS0A 2JH3A 3GONA 2NXJA 1S6PA 4X62F 2AJ1A 1S6PB 2IY5B 5H9FK 1OWXA 1B0PA 4R25A 1WSRA 4NZ0A 4F0KA 2V9KA 3W9JA 1M1HA 3P6YC 2MSSA 2VA2A 4FF1A 2J8AA 2GC8A 1UA0A 4ERDA 3OHBA 2Q79A 4F4WA 1UTAA 4DS4A 2KL8A 1UW9A 2EG1A 2V8GA 2UUWA 2WB4A 3EZ5A 5K20B 3HFZB 4DV6J 5HATA 2IA6A 1GK8A 1RBAA 2MQOA 4OZNA 4RW4A 3RBXA 3BBBA 3E3XA 4RW4B 1RHJB 2PO4A 2VPXB 5J2QA 2HHWA 2CPYA 4N56A 4K5RA 4OI6A 5J2QB 4X64F 4ECQA 1S6UA 4LR7A 2XMAA 1LWXA 3IRWP 2ZJRQ 3N4WA
chains in the Genus database with same CATH topology
1EX8A 1EQ0A 1RAOA 4M5LA 5ETMA 3HD1A 4M5IA 3MCOA 3UDVA 3HSJA 1RB0A 1KBRA 5ETOA 3HSDA 3MCNA 5ETSA 3ILOA 5ETKA 1HKAA 2F65A 5ETQA 1RU1A 1RTZA 4M5KA 4M5GA 4M5JA 3HCXA 4AD6A 3QBCA 2CG8A 1HQ2A 3KUEA 3HD2A 1DY3A 2QX0A 4M5HA 3KUHA 5ETPA 1CBKA 1G4CA 5ETTA 1IM6A 3ILIA 4CYUA 1RU2A 4F7VA 3UDEA 2BMBA 5ETRA 1EQMA 3UD5A 4CYUB 4M5MA 3IP0A 5ETLA 2F63A 1F9HA 3HSZA 4PZVA 5ETNA 5ETVA 3MCMA 1TMJA 3KUGA 3ILLA 3HSGA 4CRJA 4CWBA 3HT0A 1TMMA 4M5NA 3ILJA 1Q0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EX8 A;  1EQ0 A;  1RAO A;  4M5L A;  5ETM A;  3HD1 A;  4M5I A;  3MCO A;  3UDV A;  3HSJ A;  1RB0 A;  1KBR A;  5ETO A;  3HSD A;  3MCN A;  5ETS A;  3ILO A;  5ETK A;  1HKA A;  2F65 A;  5ETQ A;  1RU1 A;  1RTZ A;  4M5K A;  4M5G A;  4M5J A;  3HCX A;  4AD6 A;  3QBC A;  2CG8 A;  1HQ2 A;  3KUE A;  3HD2 A;  1DY3 A;  2QX0 A;  4M5H A;  3KUH A;  5ETP A;  1CBK A;  1G4C A;  5ETT A;  1IM6 A;  3ILI A;  4CYU A;  1RU2 A;  4F7V A;  3UDE A;  2BMB A;  5ETR A;  1EQM A;  3UD5 A;  4CYU B;  4M5M A;  3IP0 A;  5ETL A;  2F63 A;  1F9H A;  3HSZ A;  4PZV A;  5ETN A;  5ETV A;  3MCM A;  1TMJ A;  3KUG A;  3ILL A;  3HSG A;  4CRJ A;  4CWB A;  3HT0 A;  1TMM A;  4M5N A;  3ILJ A;  1Q0N A; 
#chains in the Genus database with same CATH topology
 1R43 A;  3O6Q A;  2OD6 A;  2DXE A;  2E9T A;  4OI3 A;  1S77 D;  1KVI A;  4ECW A;  6FD1 A;  1ICE B;  1RTH A;  1WC1 A;  1RTH B;  4EMD A;  2QC3 A;  3RTV A;  2BXJ A;  1FRL A;  2QFI A;  3NS7 B;  2RB7 A;  1OY9 A;  1N52 B;  1KQF B;  4O44 A;  2DNL A;  2QTW A;  2Q6C A;  3G8S A;  2XUL A;  2PFD A;  4O44 B;  3QWP A;  3H20 A;  3KMQ A;  5ETO A;  4I69 A;  2QL5 B;  1UJ4 A;  3GPA A;  1NDP A;  2NR0 A;  1TUV A;  3BGO P;  2AIR B;  2KYX A;  1G2E A;  2XYH B;  4DX7 A;  2MJN A;  1XMQ J;  1GFW B;  1X7V A;  2AYB A;  2YX7 A;  1K9M T;  2MQ8 A;  1QAJ A;  5DG7 A;  4OJG A;  1S0O A;  1OO0 B;  5KG3 A;  4N8N A;  3N01 A;  4LR9 A;  4CNZ A;  3GV5 B;  3HSJ A;  3THP A;  4LF6 J;  4GKK J;  2C2D A;  2P9G A;  3H59 A;  4BC7 A;  5B7W A;  2W2O P;  1YZ6 A;  4L76 A;  3TZX A;  4HKQ A;  4NL5 A;  1JNR B;  1ZM4 A;  1NSP A;  2RF2 A;  4LFC J;  1KLM A;  2R7R A;  3RW6 A;  2HHH F;  2RF2 B;  3CMA S;  1KLM B;  4NAS A;  2HIQ A;  2D9P A;  4NLX A;  4MAK A;  3IXQ A;  4DV7 J;  2KT3 A;  3MEE A;  2XWY A;  3ZZT A;  3MEE B;  2FPH X;  4QWB A;  2JHE A;  5HI7 A;  4RBU A;  4RNO A;  5CCM A;  2J0X A;  2ZD1 A;  4RUB A;  2YX1 A;  3IS9 A;  2V67 A;  2ZD1 B;  1RBO B;  2YY3 A;  1ZET A;  3IS9 B;  1YRX A;  4CH7 A;  2A18 A;  4PG8 A;  4CLT A;  3QYY A;  4YOE A;  3NLC A;  7AT1 B;  1HHS A;  2DHS A;  2PDA A;  3MUR P;  4IFY A;  3W2V A;  2W7P A;  4IFY B;  3W2V B;  3T9Z A;  4DSI A;  5KFY A;  2AMC B;  4O23 A;  2IHR 1;  4X4T A;  4WP3 A;  1ZAW A;  3MF5 A;  3RB3 A;  3QAU A;  4K8R A;  2A2D A;  3LAM A;  2AEF A;  2HWT A;  4X4R A;  5EWG A;  1FRK A;  3I9Z A;  1ZTW A;  2LXI A;  1NHV A;  1VDH A;  2MGZ A;  3GJT B;  1VQY A;  2MGZ B;  3CCJ S;  4V19 X;  2NUH A;  3CCU S;  1XMO F;  2W24 A;  3R27 A;  1GQE A;  2NXE A;  3JXO A;  1YRT A;  4DXL A;  2K3I A;  2XNR A;  4DSE A;  2BRL A;  1NUE A;  4IR1 A;  3HHL D;  4G65 A;  2BOP A;  3BZQ A;  1HNW F;  2EPI A;  1GMW D;  3LF0 A;  4WYL A;  2VH7 A;  3FRZ A;  3I0S A;  1CJK A;  5L8R C;  2P6T A;  3I0S B;  1CJK B;  5E3Q A;  4QW9 A;  2N4C A;  4FXV A;  2KXF A;  1TL4 A;  2C2R A;  3P5B P;  5F3Z A;  4ETX A;  5C24 A;  3CJS A;  4MYU A;  3CO0 P;  3HUL A;  3UE2 A;  5C24 B;  5KFT A;  4WF9 Q;  1FEE A;  2DYA A;  5E7O B;  3QSY B;  4C8Z A;  4OHW A;  3IR5 B;  1AUS L;  1JX4 A;  5IXU A;  2CQB A;  2HBY B;  4ZMM A;  2DR5 A;  2OLW A;  3D6F B;  1VJW A;  5LT5 A;  4L73 A;  2CWK A;  1T0T V;  3OVA A;  1TFY A;  3PR5 B;  1K1Q A;  3MTK A;  3NGT A;  4DQI A;  2J6T A;  6AT1 B;  3CVK A;  1H3D A;  1T9X A;  3MEG A;  5HN0 A;  3MEG B;  4P7V A;  3JSY A;  4CH0 S;  1PCA A;  1JIH A;  1T9U A;  1CQM A;  2IAJ A;  3HF5 A;  2FZG B;  1CPZ A;  4DZD A;  4TQS A;  2IAJ B;  1RXO B;  1FNM A;  4EBD A;  1W25 A;  3MAQ A;  3Q8V A;  3MPV A;  3KDN A;  1AB8 A;  1UJ6 A;  2R2T A;  2VQE F;  2ZOF A;  2E5L F;  2AF6 A;  4KQZ A;  3TAM A;  3C2P A;  3BO2 A;  3EXC X;  5CAB A;  3TAM B;  2NXN A;  3MMB A;  5KFM A;  2CPX A;  2YH0 A;  1BXN A;  1TUG B;  3MMB B;  1BQN A;  3ZTS A;  4AQY F;  4MYT A;  4HEA 9;  1BQN B;  2ZH3 A;  2EI5 A;  2CFX A;  4F02 A;  4XK8 C;  3QGI A;  2HS4 A;  2CAD A;  2UXC J;  2Y1L B;  2RT3 A;  2LVW A;  2LQB A;  4Y2C A;  3DYA A;  1Y0H A;  1U1P A;  1YJN S;  3WDO A;  3DYA B;  4B9V A;  1OS5 A;  1MRO A;  1X9S A;  2FHJ D;  1MRO B;  3CDB A;  1RHU B;  2W8K A;  3OLA A;  1ARO P;  2B51 A;  2D9O A;  4R0J A;  3RJM B;  2IM3 A;  3L3C A;  2FLN A;  3HDS A;  3IRX A;  3TX0 A;  1KQS R;  3IRX B;  3DDK A;  3D68 A;  2YNH A;  1T9V A;  2YNH B;  3BF4 A;  2DH7 A;  2FB0 A;  1HD0 A;  2N4D A;  1RJJ A;  3PYG A;  4NLT A;  1Z2Z A;  2RH3 A;  1PYS B;  4NLY A;  1O8B A;  5D15 A;  1X4C A;  1FDD A;  2KG1 A;  1VLY A;  3PXG a;  4QR2 A;  4XAK A;  1N5Y A;  3M6X A;  2WSE C;  4GO7 X;  1N5Y B;  4NYP A;  4OJ3 A;  2O67 A;  3T5J A;  3PHE A;  3AD9 C;  3KLV A;  4MKV A;  5CA5 A;  2ZHB A;  3EGZ A;  1V3S A;  2R9L A;  2R8H A;  2B9Y A;  4A8Y A;  3N6M A;  4BBY A;  1X4A A;  5DQG A;  4USH A;  3C3L A;  4K4T A;  2ASL A;  1NPR A;  2IC3 A;  2IC3 B;  5CHC B;  4Y2M A;  4G1I A;  3NG8 A;  1SXL A;  4ZPT R;  1SIZ A;  1XTZ A;  2RRB A;  2D3O R;  2E1A A;  3QMQ A;  5GVQ A;  1KWM A;  4QYR A;  2LQ9 A;  1GXT A;  1RT7 A;  2VF3 A;  1RT7 B;  3MUV P;  2DEI A;  3ILO A;  5GAG U;  2HEK A;  3FBE A;  3ZZZ A;  3QT8 A;  1U1R A;  2F8E X;  4PZV A;  3M32 A;  2HG4 A;  2Z58 B;  3HVA A;  3M32 B;  4DPT A;  3AQP A;  3NGK A;  3KJV A;  1TZ0 A;  2RDD A;  4LIR A;  1JWW A;  3KJV B;  4RR5 A;  1DY3 A;  1XR6 A;  3IFE A;  3THT A;  3LUY A;  5DLG A;  1PBA A;  4ZVQ B;  4AND A;  4J91 A;  3TI0 A;  4Z7Y A;  5ETQ A;  2ZBQ A;  3A3P B;  4OYP A;  4HHJ A;  5HJY A;  3MM7 A;  1S49 A;  2M5Y A;  1RHQ B;  2EKY A;  3MM7 B;  4DR6 F;  1QAY A;  4IKA A;  1WC4 A;  4B9S A;  3O2I A;  3IBW A;  2W8L A;  3O44 A;  4BDP A;  3EIC A;  4ZPC A;  2LU1 A;  4JI0 J;  5IWA J;  3TUZ C;  1XC9 A;  5KFG A;  2ASY A;  2E7X A;  5L39 A;  3E2E A;  1V5I B;  4X4P A;  5U47 A;  2V8V A;  2C2Z B;  2NZ4 A;  1N33 F;  1IVZ A;  3LQV A;  4KPC A;  1R8H A;  1RIS A;  3RYL A;  4QZV B;  3OSN A;  4ZVP B;  1HL6 A;  3BQ2 A;  2LDI A;  3T6B A;  1D9F A;  2JVO A;  4E0D A;  3T19 A;  3CSK A;  2ZKT A;  4ED5 A;  4DF4 A;  5KFI A;  3Q8P B;  5GAE U;  2FQQ B;  4DPX A;  3J7A N;  2YVS A;  1RWP B;  3CCS S;  5D8H B;  2H5E A;  1F5B A;  5KFV A;  2ZH4 A;  1GX6 A;  3C16 A;  1U24 A;  3TUI C;  1SB6 A;  2Z2L A;  3C16 B;  3MR5 A;  4B08 A;  2RDJ A;  1P1L A;  3PNI A;  3GJR B;  1TKD A;  4X4U A;  1FT8 A;  3PRD A;  4KHR A;  3M2V A;  1FWP A;  2B8P A;  2VFR A;  3M2V B;  9ATC B;  4GO5 X;  1LFW A;  4DPW A;  1C4A A;  4YB5 A;  2MLZ A;  2OEK A;  4IR9 A;  5E3C A;  3ZZO A;  2BE2 A;  3MUM P;  2BE2 B;  4UUW A;  2IVM A;  1OJ4 A;  2V8P A;  4B3T J;  3MED A;  4F2R A;  3MED B;  5LL6 d;  3A1Y G;  1UVK A;  3QNW B;  1KON A;  3M8S A;  4P2M A;  3G6E S;  2ILZ A;  2ALY B;  4RNF A;  2BVZ A;  2MMY A;  4PPD A;  2JWN A;  2MKK A;  2FGC A;  4Y6I A;  3FCW A;  1R27 B;  4F4Z A;  3NRB A;  3FZB A;  2GZO A;  5RUB A;  2BEF A;  2LFV A;  2J9D A;  1Q5Y A;  4DN9 A;  1HW8 A;  4JI8 J;  3SIP B;  2ZC4 A;  3SQO P;  5FD1 A;  4JBC A;  2ASD A;  5KFO A;  2V2K A;  4M95 A;  4DR3 F;  5DDQ C;  1RLD A;  2HQF A;  4DU7 A;  5KFH A;  2WSF C;  2BJ9 A;  1GH8 A;  3HLU A;  2AZ3 A;  4JI6 J;  2Y1I A;  4IQM A;  2ZZT A;  3ZZY A;  4LFB J;  1Q16 B;  1FDA A;  2YWE A;  1I3O B;  4ANE A;  1HWU A;  3LW5 C;  4P6Q A;  3UR3 C;  1M5P C;  1S1U A;  3DU5 A;  5CQG A;  1S1U B;  4GC6 A;  5F9L A;  2C22 A;  1RP5 A;  1Q86 T;  1LWF A;  1LWF B;  3ETO A;  3NP5 A;  2M2B A;  3G82 A;  2RS8 A;  1EAY C;  3G82 B;  1C0T A;  2B4V A;  4NWB A;  1QTM A;  1C0T B;  2G0J A;  1VQ9 S;  3LWM A;  3MMC A;  3GIK A;  4ZPV R;  3MMC B;  2QSF A;  4U96 A;  4KGM A;  4WIQ A;  1Q8K A;  4CRJ A;  1SJ3 P;  4LRE A;  2J0S D;  3VQS A;  3TP2 A;  3RR8 A;  4DBQ A;  3H5U A;  5E41 A;  1RAB B;  5H9F J;  3H4B A;  4FXD A;  2AGP A;  3X3U A;  4EZ6 A;  4AXI A;  2XMV A;  2ZH6 A;  5C7P A;  3PW4 A;  4GRS A;  4EO6 A;  1RK8 A;  2GA7 A;  3BB5 A;  3ZFV A;  2ZM6 J;  4B3M J;  2CZ4 A;  2P9C A;  2EK1 A;  4MKA A;  3HSG A;  4N76 A;  2GJF A;  4K4U A;  2C2M B;  4WFN Q;  3RZA A;  2YQ1 A;  2XS5 A;  3NWG A;  3ZZP A;  8RUC A;  3M9N B;  1WOO A;  4MMO A;  2HAI A;  4NLP A;  4ZVO B;  2QMW A;  3PRV A;  4P10 A;  4LBI A;  2A6M A;  3NOC A;  3O5T B;  4DL4 A;  2PA3 A;  1Q81 T;  1HQU A;  2KVQ E;  1HQU B;  1BQM A;  4J9V A;  3ONQ A;  1BQM B;  2RD5 C;  5ETP A;  2MZQ A;  3ICL A;  1FFG B;  1AW0 A;  2HS3 A;  1S1W A;  5IQ6 A;  4C8M A;  5HVF A;  1S1W B;  1EB0 A;  5D4P A;  2QIF A;  3PKY A;  1J5E F;  3QSI A;  3MOJ B;  1VIO A;  3M9M B;  4OZ1 A;  4WCE Q;  1S4F A;  3W9I A;  2X1B A;  3PW7 A;  5HJX A;  4ZOS A;  3CIZ A;  2GW8 A;  3CJ0 A;  3IGV A;  3EDR B;  2VQF F;  4I1T A;  4UST A;  1B3T A;  3ISN C;  1J5O A;  2KM8 C;  2OAU A;  1DTQ A;  1J5O B;  1WJ9 A;  1DTQ B;  2E66 A;  5K5M A;  3CCL S;  4IDK A;  3JSB A;  4IDK B;  5F3T A;  2CNN B;  2KFY A;  1NCL A;  2NQP A;  4YB1 P;  4O3S A;  3ZC4 A;  3QRP A;  2R2S A;  3GCW P;  3TAN A;  1KNZ A;  2HIY A;  1KHW A;  4M5L A;  2AGO A;  3ZZU A;  1X4G A;  3UWT A;  4WK3 A;  2FTR A;  4FNI A;  4RPF A;  1UWB A;  4F4K A;  1WHY A;  1UWB B;  1K44 A;  4DCO B;  3KG1 A;  3BH7 B;  2GJI A;  3IWL A;  4IH7 A;  2P9E A;  1LKZ A;  2ZKU A;  2M0G B;  2ZDP A;  2CJA A;  2UUC J;  2W9A A;  4DZ6 A;  2LMI A;  3C6T A;  1N5S A;  4UQT A;  1V3R A;  2ZUA A;  4HH1 A;  3TX8 A;  2CIM A;  3C6T B;  4HAC A;  2VG6 A;  2BAN A;  4HAC B;  4URS A;  2VG6 B;  2BAN B;  4DQQ A;  1D1U A;  3H90 A;  1NK9 A;  2UVV A;  1FXD A;  1RAD B;  3B4M A;  5HMW A;  2U2F A;  2KDO A;  5CYQ A;  2JVR A;  3VVU A;  5CYQ B;  1F5A A;  5KOX A;  1S0M A;  4DX8 H;  5BXI A;  3J7Y U;  4M5H A;  4KT0 C;  2XO6 A;  2O3D A;  3SSR A;  3Q83 A;  2XZD B;  1EP4 A;  2YKP A;  4NYZ A;  1EP4 B;  2GQQ A;  2Y1R I;  1NND A;  4NOH A;  2UXB J;  4ENO A;  4QWD A;  4WK1 A;  4NEY A;  2WW8 A;  2FLP A;  2CVI A;  2E5I A;  3CTR A;  4OHV A;  2QMU B;  4Y2K A;  1SI9 A;  3T1Y F;  3DRY A;  4C8L A;  3IBF B;  2ALZ A;  3QFH A;  3NCP A;  2FJD B;  3QT7 A;  3RRH A;  5B0C A;  1BUX A;  4DL5 A;  3GSI A;  2BJD A;  1UEV A;  3N5B A;  5ETL A;  2DO0 A;  2MST A;  2MZJ A;  4ECX A;  1KTV A;  4LBP A;  3D1O A;  1TL7 A;  4LJM A;  1TL7 B;  2HFO A;  4AL6 A;  1QTN B;  2ABY A;  3FJ2 A;  2ZBC A;  5B0B A;  2H54 B;  4CM0 A;  2CQC A;  3W65 A;  2W9B A;  1JJH A;  2W9B B;  3POT A;  5GME A;  1HWL A;  3POT B;  2PEB A;  2BE7 D;  4WFA Q;  1S97 A;  1F3V A;  2F8M A;  3DCA A;  4NLW A;  2NYH A;  1IKV A;  2QSW A;  1IKV B;  2R7U A;  4DPY A;  2C3O A;  2H51 B;  4JV1 A;  2PD1 A;  5DLF A;  3D67 A;  2YTC A;  4DPU A;  1RT3 A;  1I1G A;  4ELT A;  1URR A;  3FRY A;  1RT3 B;  2WBR A;  4USI A;  3DXB A;  2WHO A;  2KVI A;  4BC9 A;  2FVR A;  1Y4Z B;  1C0U A;  3K57 A;  1HBM A;  1VBY A;  2CQ2 A;  4FVC A;  1C0U B;  1HBM B;  4OMF G;  4DV0 F;  1ZM2 A;  1M90 T;  1OPI A;  1P9Q C;  2QYG A;  2W2N P;  4ZN1 A;  2DIU A;  3M9O B;  4L3N A;  1ZPV A;  2DGX A;  4FF4 A;  2H48 B;  4RL1 A;  1UVN A;  3CGI A;  1LQ9 A;  1LOU A;  1S76 D;  2XSJ A;  4YUD A;  2XSJ B;  1UCN A;  2LDY A;  3WHI A;  5A8K A;  5M2P A;  1S48 A;  5A8K B;  2E5H A;  5KFQ A;  1Q53 A;  3CC7 S;  4U8V A;  3CD7 A;  4HTI A;  1UVJ A;  1VQ6 S;  3OL7 A;  3F41 A;  3GR1 A;  4C98 A;  2C28 A;  1DTT A;  2IVY A;  3VAH A;  1IKW A;  1DTT B;  1NK6 A;  1R3N A;  1IKW B;  2CAJ A;  4FYW B;  2KI2 A;  4GKJ F;  2YWK A;  1XNR J;  1GMU A;  5T7L A;  5T7L B;  1NLK L;  4ZCI A;  2YNI A;  1SVD A;  4D3H A;  2YNI B;  1S72 S;  3C15 A;  3ZTR A;  2ROE A;  3C15 B;  2CJQ A;  2X1F A;  4DR7 F;  4MT1 A;  2B9X A;  3O8W A;  1EET A;  2WVE A;  2A6O A;  1EET B;  3RBE A;  1VC6 A;  4TQR A;  1UZD A;  3KOA A;  3HZG A;  1IR0 A;  4NLS A;  4K5S A;  1UL3 A;  4OZ2 A;  2XMJ A;  1IKX A;  4U8Y A;  4DV1 F;  1IKX B;  1OY8 A;  2XWX A;  3N79 A;  1L3V A;  5DZ6 A;  3GG1 A;  2HHT A;  3GLJ A;  3HVW A;  1HI8 A;  4O0N A;  1NSA A;  2OGU A;  2LEB A;  5D6G A;  2KZM A;  2VG5 A;  2VG5 B;  4W98 A;  4CLL A;  4KH0 B;  2J9D E;  2D7S A;  2E5G A;  3DMJ A;  1ZZF A;  3BQ1 A;  3DMJ B;  1H7W A;  1KP6 A;  2EW9 A;  4K59 A;  3IAM 9;  3I4H X;  2IVF B;  1SBR A;  2POK A;  4DUZ J;  4P7T A;  4DDF A;  3MM6 A;  4I2Q A;  3MM6 B;  4I2Q B;  5DET A;  3GSD A;  5HMY A;  4UY8 5;  1YWX A;  4DSF A;  5KFN A;  1U02 A;  3N0V A;  1NHK L;  4KIA A;  1W7W A;  1N0U A;  4KBI A;  4USJ C;  2QO3 A;  1U6Z A;  2BAC A;  4JI3 F;  2OKQ A;  3VAM A;  2MZR A;  4H4O A;  2XSF A;  3V4I A;  4DR4 F;  4NXM F;  4H4O B;  4RW7 A;  3V4I B;  3DDI A;  2HK3 A;  4RW7 B;  4P9S A;  2VPZ B;  1HNX J;  4K4Y A;  3FNN A;  1GEH A;  2UUB J;  4AUK A;  1NKC A;  3HO1 A;  3OR1 A;  4QCL A;  3EUN A;  3OR1 B;  2R8G A;  2CA9 A;  4RKU C;  4LSL A;  2DGS A;  3HVT A;  4LSL B;  3T3F A;  3HVT B;  4WYW A;  1X4D A;  4RNM A;  4Y2A A;  2JL9 A;  1JLC A;  2ZOM A;  4UZB A;  1U2F A;  5BR8 F;  1JLC B;  2GAG C;  1P1T A;  4LRB A;  2W25 A;  2DHG A;  3FMW A;  3IP0 A;  3CCE S;  2ZJQ Q;  4JI4 F;  3KLF A;  1R0B G;  2GVD A;  2RUS A;  3KLF B;  3L4B C;  2GVD B;  4OFZ A;  2Y8Y A;  3TEG A;  3CCZ A;  3CDE A;  3FCH A;  1Q7L B;  2DRD A;  4A4J A;  3KNA A;  1S10 A;  4L74 A;  4B3O A;  2KYZ A;  4B3O B;  2XGQ A;  1GNK A;  3KG0 A;  4TU8 A;  2J7K A;  4YDD B;  1WC6 A;  1PAU B;  4LF7 F;  4A8S A;  2G2Y A;  4RZR A;  5HQL A;  3HM9 A;  3U27 A;  4ZLN A;  4RNN A;  2NPF A;  1G7C B;  5DM7 Q;  2G2O A;  2YNF A;  2LKZ A;  4DJB A;  9RUB A;  2L48 A;  1NB7 A;  2YNF B;  3HX9 A;  4EK2 A;  1HI0 P;  4M5N A;  3P4U B;  2AJ0 A;  2HVD A;  3G86 A;  2FC8 A;  1WTB A;  1QSS A;  3RB0 A;  1ITP A;  1KVK A;  2DH8 A;  4RUH A;  5CD4 H;  1YBU A;  3SEO A;  3M05 A;  2XLJ A;  2DVI A;  2CYY A;  3BBF A;  2JX2 A;  2F4V F;  2BUN A;  1LFP A;  4EYI B;  2LYV A;  4XIU A;  3D4J A;  4OIX A;  3HHD A;  3H0P A;  3CJ3 A;  3HI9 A;  1WC3 A;  3BGL A;  4TYA A;  4KGK A;  1LW0 A;  2AX0 A;  5D4L A;  1LW0 B;  2UVR A;  5ETN A;  3KLH A;  1UJ5 A;  2VJV A;  4OZ3 A;  3KLH B;  4X66 F;  4Q43 A;  2ATC B;  2FVQ A;  3JTO A;  4KGX B;  2C3P A;  5HVG A;  3GII A;  2XEX A;  2WK4 A;  2KJW A;  3ZXW A;  1F2G A;  2HFN A;  2MLY A;  4LR8 A;  4QIW D;  3BGF A;  4DX6 A;  3O1L A;  3UDV A;  1TAQ A;  3HFV A;  2R4F A;  3UNY A;  1RWK B;  1E6V A;  1XR5 A;  3CD0 A;  3F73 A;  1E6V B;  2QZ8 A;  2LQ8 A;  4C3K A;  1VBZ A;  4BS2 A;  5JJB A;  3RAM A;  3G2X A;  4W90 B;  3CF5 Q;  1RU1 A;  3H8Y A;  3CCV S;  1JB0 C;  2XLI A;  2DBB A;  2MQM A;  3CIM A;  3OTC A;  2HQ3 A;  1QJH A;  4OQJ A;  4BHQ A;  4NRU A;  2HBZ B;  3TUJ C;  2QLB B;  1SPB P;  4DV6 F;  3DOM A;  2RU3 A;  4Y00 A;  2K3K A;  3DOM B;  4ES2 A;  4U7U K;  2N82 B;  2OEJ A;  4PQU A;  3MUT P;  1IM6 A;  1QD1 A;  4PQU B;  1VK3 A;  4ECR A;  1WI6 A;  4LF9 J;  3W61 A;  2AEJ A;  1NJW A;  1YJV A;  4I6Y A;  4G1Q A;  3RBZ A;  3R6L B;  4G1Q B;  4ED0 A;  1KHV A;  3K89 A;  1SH2 A;  4QQB A;  2VG7 A;  2OD4 A;  1FXR A;  3UN5 A;  2RS2 A;  2FVC A;  2VG7 B;  3PJX A;  1HR0 J;  4BLG A;  4F36 A;  1VRU A;  2I6W A;  5IT9 Y;  3NKY A;  1VRU B;  2FDN A;  3ILJ A;  4BCA A;  4J9N A;  1CLF A;  4MKB A;  2AP6 A;  1HFE L;  4JV0 A;  5KG4 A;  4FP9 A;  3DC2 A;  1U4B A;  1I94 J;  2HGM A;  2I1R A;  4ER8 A;  2CNL B;  3CT9 A;  1T9Y A;  2O5D A;  1XMQ F;  3C46 A;  3EDQ B;  1RHR B;  3TAQ A;  5AE2 A;  4OHY A;  4ZKA A;  2G2Z A;  4J90 A;  3BKU A;  1U6F A;  4DX5 A;  5HLF A;  3DM2 A;  2IMO A;  5HLF B;  3DM2 B;  4LF6 F;  4GKK F;  3GCX P;  3D6T B;  4DV3 J;  1M1G A;  3MM8 A;  3A3N B;  4NLQ A;  3MM8 B;  2HGL A;  4RUA A;  3ZNJ 1;  4LFC F;  1WI8 A;  1S1V A;  1RAJ A;  3PAC A;  3CWJ A;  1S1V B;  3AY0 A;  4H4M A;  3AQO A;  3D66 A;  4H4M B;  2D41 A;  2IRX A;  3R6G B;  1Y7P A;  3CCT A;  4J9R A;  2VIH A;  4ED7 A;  5F8J A;  2Y8W A;  3TJA A;  5J2N A;  5B09 A;  2EBG A;  5J2N B;  2DT9 A;  3FDS A;  1HWK A;  1PGZ A;  2GGP A;  2DCU B;  1IBM J;  2GGP B;  4UF4 A;  1FWL A;  2QEX S;  1DAR A;  1TK5 A;  2XCA A;  5L9X A;  4JYA J;  3CO9 A;  1UA1 A;  3ZNU A;  2C1E B;  4ED2 A;  3A12 A;  3NCQ A;  3L7P A;  1U09 A;  4H54 A;  1IBK F;  2GO9 A;  1FKA F;  2WW4 A;  3IC1 A;  3NCR A;  3BGU A;  1RE1 B;  5LXY A;  4LF8 F;  5K8N A;  3ULH A;  2R8K A;  4OYZ A;  2OJ3 A;  2ZDO A;  5FII A;  4FPI A;  4EFA C;  4KAI A;  4L72 B;  3H2L A;  2X1G A;  3LH2 S;  2BDP A;  2RQC A;  1WWH A;  1NSQ A;  2Z2M A;  3R5D A;  2CUY A;  3DLG A;  4DSK A;  3VAJ A;  1RWW B;  3DLG B;  4HI2 A;  4OJ1 A;  5ETK A;  1I5O B;  3V81 A;  1BGX T;  3TVY A;  2J8S A;  3V81 B;  4DR2 J;  1VR6 A;  1T9T A;  4B02 A;  1SL0 A;  1LWE A;  3BPD A;  3SSQ A;  1JLF A;  1LWE B;  2VFT A;  1JLF B;  5KFL A;  2E1C A;  4CDI A;  2PT0 A;  2JOQ A;  4EZ9 A;  1NEE A;  2I5J A;  4WPA A;  3GQC A;  1H2U X;  3L95 X;  2I5J B;  3VR1 A;  4V19 J;  2G9O A;  1NDC A;  4H4K C;  3BEG B;  4N41 A;  3AFG A;  2VQE J;  2JJ4 D;  3AHP A;  3ZO7 A;  5D0E A;  1VIS A;  1YJT A;  4LF4 J;  1HHQ A;  1VRQ C;  1NK8 A;  3NGD A;  1IQT A;  4CTA A;  5HO4 A;  4CTA B;  1DQ8 A;  2MKY A;  3GFY A;  3FFI A;  3Q22 A;  3U1M A;  1C4C A;  3FFI B;  3HFK A;  3QIP A;  5FDL A;  4ECV A;  3QIP B;  5FDL B;  3A8K A;  2QYC A;  4K2X A;  1MWQ A;  1AT1 B;  1P9Y A;  1R8B A;  3AA8 A;  1TQL A;  4X65 J;  2XNQ A;  3QJJ A;  1U25 A;  4CO5 A;  3PJW A;  4ZVG A;  3MWB A;  1MML A;  3EZO A;  2DR6 A;  1NK4 A;  2ACM A;  3VGU A;  4RBV A;  2FHO B;  3EE3 A;  4X4N A;  4X4O A;  4XTT A;  1OMS A;  3OPK A;  4PXE A;  4P75 A;  4DL0 C;  4JI7 J;  1NJX A;  3BSO A;  1U1L A;  1QSY A;  1G3O A;  4NLU A;  3UN3 A;  1WAC A;  2RKI A;  1L3T A;  5IT9 U;  2RKI B;  1YRU A;  1VQO S;  2QL7 B;  4WKY A;  4JP8 A;  4IOB A;  1WKJ A;  4QIE A;  5D3G A;  2HFZ A;  5EDW A;  5D3G B;  3W8P A;  1WHV A;  2OHD A;  3OFF A;  2JC0 A;  3X1L B;  4YB7 A;  4QPT A;  4FBU A;  4KE5 A;  1RA6 A;  1RHK B;  1YVF A;  1ZM3 A;  1YBT A;  5DDO C;  2KM8 B;  1N56 A;  4Y28 C;  2GFF A;  4A8X A;  2OP5 A;  2N3O A;  2J76 E;  2XMW A;  1J27 A;  1TL1 A;  2UXC F;  3V5R A;  1TL1 B;  1WG1 A;  3HHE A;  2H3E B;  5LMU J;  2X7I A;  2VON A;  1HNZ J;  4USM A;  2V9W A;  2DR7 A;  4F4Y A;  2XI2 A;  5JVG Q;  4LSZ B;  1X4B A;  4JI1 J;  4ED8 A;  2ACY A;  4NML A;  4RJV A;  2K7K A;  2Z2Y B;  4F4X A;  2QA4 S;  3DGV A;  3OW2 R;  4DFK A;  1NRK A;  1NKB A;  2EFV A;  4QYZ K;  1TK8 A;  4I67 A;  2GMJ A;  1CJT A;  4MIW A;  1PYO B;  2A1B A;  1X31 C;  2MKC A;  1CJT B;  1AUD A;  1S57 A;  2YH1 A;  3FQK A;  2FJX A;  1T02 A;  3FCV A;  2W01 A;  1FJG J;  2QA2 A;  2ZBI A;  4JI5 J;  1Q95 G;  2VFV A;  3LO3 A;  3V6K A;  1RHM B;  4JV2 A;  3SMZ A;  3MD3 A;  1H7X A;  4L3K A;  3DDN A;  1X4H A;  2HZA A;  4CT8 A;  2R8I A;  2HQI A;  4XDC A;  5KG6 A;  1D9A A;  5KFU A;  3CD5 A;  2CPZ A;  1O6X A;  5A0Y A;  1W2I A;  5A0Y B;  1TP7 A;  2MHE A;  3SXL A;  2ZEJ A;  5EWE A;  3OXG A;  3MM5 A;  2EK6 A;  2F1F A;  2VIC A;  2DO4 A;  3MM5 B;  1YGY A;  4WE1 A;  3IR6 B;  3OT9 A;  4WE1 B;  3CW2 C;  3EXY A;  3AJ2 A;  1CQN A;  5B0E A;  4NA2 A;  1NK7 A;  3AOB A;  3SCI E;  3R2C J;  3LAL A;  4USV A;  2V2Q A;  3Q0A A;  2APO A;  2IM0 A;  5F8G A;  5DDR C;  2AD9 A;  3U7J A;  2COL A;  2HHX A;  1CEZ A;  1AFI A;  2JC1 A;  1GMV A;  4RWX A;  2HYI B;  3PX4 A;  5H9E K;  3CJ4 A;  1RAG B;  1VFJ A;  3AD7 C;  4NLV A;  5E2Q A;  4U7U D;  1X4E A;  2WVF A;  3I32 A;  1FEH A;  1RT4 A;  1RI7 A;  3BYP A;  1PC5 A;  1T03 A;  1RT4 B;  2ZH7 A;  1T03 B;  1MWY A;  2G13 A;  4F25 A;  2RVJ A;  1S5Z A;  3QGG A;  1BLU A;  4HYK A;  2L08 A;  3S01 A;  3CJ8 A;  2VKZ G;  3GYN A;  2DIT A;  4F4A A;  1B70 B;  3ILI A;  2Q6B A;  4OX8 A;  2XCP A;  3BO4 A;  3IN5 A;  2ZVS A;  3Q2T C;  3TWZ A;  3ZTQ A;  4RLE A;  1TEL A;  2GMH A;  5C5J A;  1VQM S;  1RWO B;  2XBP A;  3KUH A;  2C2E A;  1QSL A;  4ALZ A;  2L9D A;  2D69 A;  3D0H E;  4FYD A;  4OV6 A;  1FDN A;  2GV1 A;  1G1X A;  2V8D A;  2HLT A;  2AGQ A;  1HNI A;  4QR1 A;  2MHN A;  2DH9 A;  4PYA A;  1HNI B;  3JSR A;  2DY1 A;  1HQ2 A;  3KFW X;  4JI0 F;  5IWA F;  2WCX A;  5GAD U;  2AX1 A;  3JS9 A;  1WUU A;  2YKA A;  1NK0 A;  4PCQ A;  1F1B B;  2KXN B;  3HPO A;  1IM4 A;  4FYV B;  2V2V A;  4UW2 A;  2OPR A;  3HT0 A;  2HSE B;  2OPR B;  1UWA A;  2AT1 B;  3BKF A;  1H38 A;  1BC6 A;  2DRB A;  3H5X A;  4OI4 A;  1KC8 T;  4A8M P;  2ZH8 A;  1IJE B;  4ZP8 A;  3V6H A;  3KKF A;  1XMB A;  4C9D A;  1FF2 A;  2WOM A;  1R89 A;  1QAI A;  3D54 A;  2WOM B;  4F0H A;  2B7B B;  3DHW C;  2CJB A;  1IN0 A;  2GML A;  2ZOG A;  3MPD A;  4EEY A;  4TVA B;  1N5V A;  3IO1 A;  3PEJ A;  3GFH A;  3AD8 C;  1U6B A;  1JLE A;  3PZP A;  3W9H A;  1JLE B;  5L1L A;  1BWE A;  3LAK A;  2RRA A;  4CO3 A;  5E3R A;  1L3K A;  4IRK A;  3T41 A;  5DQH A;  4PAA A;  3D7S B;  2MKS A;  3WC0 A;  2DB1 A;  3GV8 B;  4ED6 A;  1CJU A;  3KJF B;  2PE8 A;  3T5L A;  1CJU B;  2PI4 A;  3MD1 A;  3B54 A;  1U2C A;  2CG8 A;  2IRU A;  3IMQ J;  1RU2 A;  1WSV A;  1TVR A;  5I3U A;  2BOA A;  4LUB A;  1TVR B;  2MKJ A;  4CO2 A;  2R8J A;  5I3U B;  3QPI A;  2PFF B;  2YKQ A;  1A6L A;  3UD4 P;  1OQ3 A;  2BJE A;  5THW A;  1N54 B;  4FS2 A;  4KGZ B;  2K06 A;  5I3P A;  3PO4 A;  3MGJ A;  3FSX A;  4C0H A;  4WTO B;  1AA1 B;  1Y3J A;  2C3Y A;  2GO8 A;  2VBW A;  1UVI A;  2D3Z A;  4JI8 F;  3W5Z A;  4C2M A;  1JXE A;  3MAH A;  5C2G A;  4OI0 A;  2CRL A;  4OX6 A;  1TMJ A;  4J9K A;  1R31 A;  2H9Z A;  3LA0 A;  1RUS A;  3FVY A;  5AJ3 J;  4C8K A;  2VPW B;  1HWJ A;  4A8F A;  4I7F A;  4X4S A;  3DN9 A;  3AB4 B;  4I7F B;  4MTP A;  4JI6 F;  2IA0 A;  1K0T A;  5L1K A;  2FC9 A;  2AKW B;  4CLS A;  2ZVI A;  1PKU A;  1N8R T;  2Z30 B;  4AE5 A;  2VBX A;  4LFB F;  1EKS A;  5K8P A;  1VJQ A;  1VQ8 S;  4RNH A;  5E3P A;  1D9D A;  3MEC A;  1IXK A;  3MEC B;  4CO0 A;  4PKD B;  2UU9 J;  4J5O A;  2HFU A;  5F9N A;  1YK9 A;  3QO9 A;  1X5P A;  3PV8 A;  2ATL A;  3QO9 B;  2HAF A;  2B4O A;  3NAI A;  4UZC A;  2VAS A;  2N7Y A;  1NBE B;  1M5V C;  2OTL S;  4Q2L A;  3MCM A;  3RG6 A;  2VDI A;  3R5G A;  1WNE A;  4YEA A;  4G3I A;  1H0H B;  3E8O A;  2ZE2 A;  1YKW A;  1FNX H;  2ZE2 B;  5J1E A;  1N34 F;  1RTI A;  5J1E B;  1RTI B;  3C14 A;  4R8U A;  4DU8 A;  3C14 B;  4R8U B;  2XLK A;  4XPC A;  1Y5N B;  3EX7 B;  5HVH A;  2P5V A;  5LSL A;  5LMN J;  3NEK A;  2VZ9 A;  2VQF J;  1X5S A;  3DLE A;  2KZZ A;  3BKT A;  1HHT P;  1JJ4 A;  3DLE B;  3SYZ A;  1Y5I B;  1T3N A;  1FFW B;  2FJB B;  3GMG A;  3R7S B;  5JXS A;  1VQS A;  1ZM9 A;  1ZA2 B;  3I4P A;  2ROP A;  1WDT A;  3DOK A;  5MAO A;  3MDF A;  3DOK B;  2ZM6 F;  4B3M F;  2PII A;  4AT1 B;  3Q89 A;  3EM1 A;  5L9N A;  3DFE A;  1VQL S;  1D8Y A;  3D5M A;  3DOL A;  4P74 A;  2XS2 A;  1YJU A;  3DOL B;  1B0V A;  2KU7 A;  2BAB A;  4B3S J;  2HWI A;  3BPS P;  5BYR A;  4HVZ A;  3GIJ A;  5KT6 A;  1OPZ A;  3OTE A;  3JAM Y;  1FI4 A;  2E1P A;  1JJC B;  2E1M C;  4HHH A;  5IT0 A;  1U1K A;  3I6P A;  1KSP A;  3M8Y A;  4A47 A;  5GAH U;  1QY7 A;  2QX0 A;  4ED4 A;  1NU4 A;  1O51 A;  1X0P A;  1U1M A;  1SC3 B;  4QJV A;  1RAF B;  4Q5V A;  6FDR A;  4USK A;  3UO0 A;  2XZT B;  4I56 A;  3MCN A;  3LOU A;  5EUH A;  3H25 A;  3W7B A;  3CNQ P;  1X9W A;  4JV5 J;  3LP2 A;  2DNQ A;  2IPO B;  3LP2 B;  3Q86 A;  1NZA A;  1WF0 A;  4YY3 F;  2N3L A;  3SBM A;  2YWG A;  3RAX A;  4X4V A;  3ENQ A;  1H73 A;  4ZPA A;  3KLG A;  3PIP Q;  3KLG B;  4I4B A;  1E6Y A;  3PHT A;  3HHL C;  1E6Y B;  2XY6 A;  3W60 A;  2J6S A;  4GVL A;  3DI6 A;  3MPY A;  4YHH J;  3DI6 B;  1N36 J;  3PX6 A;  2ZWO A;  3R7B B;  3I55 S;  4PXC A;  1SC6 A;  3FK4 A;  4KYZ A;  3PW2 A;  1WEX A;  4WII A;  1S9G A;  1S9G B;  1R6V A;  2UUC F;  3ZTO A;  1LNQ A;  3M6U A;  4M5J A;  2C3U A;  3AB2 B;  2J0W A;  1Q8B A;  5ETT A;  4RX6 A;  3EVM A;  3TEH B;  4DFP A;  3MCO A;  3UN2 A;  2D3U A;  1CG2 A;  3LP1 A;  4TNO A;  2QN6 B;  2KG0 A;  3LP1 B;  3P45 B;  4B9U A;  4WXW A;  1TTH B;  4DUY J;  5DGA A;  3D0G E;  2RQM A;  5AXM A;  1IKY A;  1KBR A;  1M5K C;  4KH1 B;  1IKY B;  2L9N A;  3H4D A;  5IC6 B;  3D3C J;  1HWI A;  2H5I B;  1YG0 A;  1NO8 A;  2M52 A;  1H74 A;  3PDN A;  1ZS6 A;  2UXB F;  2CZ9 A;  3HHK A;  2VJU A;  3NNA A;  3PO5 A;  2BJ3 A;  3UFC X;  4WFB Q;  4DS5 A;  2XGP A;  3I56 S;  1DRZ A;  1R7I A;  4CLF A;  1VI7 A;  5DG8 A;  4GVB A;  3IR7 B;  4GVB B;  1G6B A;  1S6Q A;  2W7O A;  1FRI A;  4KSE B;  3DRS A;  3OFG A;  1RDR A;  1S6Q B;  1Y00 A;  3DRS B;  4PWD A;  4QWE A;  2FYX A;  1OIA A;  4OJH A;  4PWD B;  2DNY A;  3KHH A;  3UCZ P;  1EIY B;  3HP6 A;  3EGW B;  2E9Z A;  3OBI A;  4KV8 A;  5A2Q Y;  4MJK A;  4AYB D;  4KV8 B;  4B17 A;  2CG4 A;  5JVH Q;  4EWT A;  1PJ6 A;  1REV A;  1FES A;  3K5M A;  1KOH A;  1REV B;  2RAQ A;  1MN9 A;  5HMX A;  3Q8U A;  3MXH P;  4PEO A;  4K4W A;  3CUL A;  5F0U A;  2X3G A;  1Q8I A;  1VK8 A;  1NME B;  1SKU B;  3WX8 A;  2WAQ D;  4NYO A;  3UDL A;  1IR1 A;  1ELO A;  2Q1L A;  2NRE A;  4ZLP A;  2EFG A;  2VU5 A;  3K5P A;  1F9F A;  4OX9 J;  3R8Y A;  3E01 A;  2EC0 A;  3E01 B;  1DQA A;  4WKR A;  4GKJ J;  3TZW A;  2CKW A;  2HND A;  3TJ9 A;  3JAM U;  1XQI A;  2HND B;  4PAB A;  4FNH A;  4DLG A;  2B9E A;  1XR7 A;  2WSC C;  3N6N A;  3UNG C;  2OO4 A;  3VF0 B;  4OHX A;  3RAQ A;  1C1C A;  2XMK A;  3OHA A;  1C1C B;  4DR7 J;  4IYQ A;  3TRG A;  2LLZ A;  1S0N A;  1VBK A;  3VGT A;  5A8W A;  5JMN A;  1NPP A;  4A8Q A;  5A8W B;  2H4Y B;  1RWX B;  4DQS A;  1S0V A;  1QUP A;  3KUG A;  4OX7 A;  4K0K J;  5LJ3 Y;  1HYS A;  1Y5L B;  2DGQ A;  4ZJQ A;  2XYG B;  1HYS B;  3M8Q A;  4DV1 J;  1TU0 B;  3RU0 A;  3M8Q B;  2FIU A;  3ISZ A;  3G4S S;  4M5D A;  4M5D B;  3GJQ B;  3BV8 A;  2BM0 A;  1N5T A;  3A8E A;  3M1V A;  4O3Q A;  2WVC A;  3M1V B;  3A8J A;  2JLG A;  4LFA J;  1H2V Z;  2B8Q A;  1PC4 A;  4F0M A;  1KEK A;  5AXL A;  2CXE A;  5HAN A;  2HK2 A;  1UFW A;  3LGN A;  1HBU A;  3UVJ A;  1HBU B;  4K2J A;  3UVJ B;  3TAR A;  2HHU A;  5ETS A;  1PIL A;  3MFH A;  1XNR F;  2YKO A;  2O1P A;  1JKH A;  3CCW A;  3K5O A;  1UKU A;  1BY9 A;  2CQG A;  1JKH B;  2CJ9 A;  2XYP B;  4LF5 J;  3U1L A;  4B3R J;  2I9S A;  1U49 A;  3KG4 A;  3CCR S;  2XI3 A;  2WRM A;  2J7W A;  3N28 A;  1UET A;  1GT8 A;  3VAI A;  3DNC A;  3IWX A;  5KT4 A;  1S9F A;  2HVH A;  4JI3 J;  2OPP A;  2UXD F;  1X60 A;  2HHV A;  2OPP B;  3MZI A;  1KQK A;  1F60 B;  3PFO A;  3R2D J;  1XIQ A;  3A3O B;  2R7W A;  4H4K A;  1ZYQ A;  5LM7 E;  1W2B R;  4DV5 F;  4R0E A;  1NJY A;  2MZT A;  3OXF A;  4ILR A;  1A7G E;  2J7U A;  1NB2 A;  3KDO A;  1IQZ A;  3E51 A;  3PM9 A;  2HFV A;  2F40 A;  3Q8R B;  3K5N A;  5FLX Y;  3RBD A;  1YJ9 S;  2QLJ B;  2CWX A;  4OYM A;  4OZ0 A;  3CJQ A;  2LQJ A;  3TUP A;  4I0W A;  1F3F A;  3VZI A;  5BR8 J;  5MLC V;  2B4P A;  1Q78 A;  5I42 A;  1TFW A;  2VBZ A;  2ZBR A;  5L1J A;  5I42 B;  3CED A;  3D0I E;  1FVQ A;  5E33 A;  1T7P A;  2QL9 B;  4F26 A;  2DNG A;  3HCX A;  4QIV A;  2DK2 A;  4DUZ F;  2YWH A;  4IH5 A;  2UUA J;  2R3V A;  3CDU A;  4N47 A;  1P27 B;  2NLW A;  5A2Q U;  3M8W A;  4QOT A;  4CT9 A;  2FZK B;  2Q66 A;  4LF7 J;  3GYG A;  5DS7 A;  2GJ2 A;  2ZC3 A;  3MAA A;  1DFD A;  3MAA B;  2DR8 A;  4Q7A A;  2V68 A;  3PW0 A;  5IV4 A;  4Z2X A;  2KH9 A;  1K8A T;  1HD1 A;  5F8L A;  2VPY B;  4HR2 A;  5F8H A;  2K2P A;  1F9H A;  2KRR A;  1HNX F;  1SH3 A;  1WHX A;  3J7Z 5;  3R3T A;  3NOG A;  3I96 A;  2KN4 A;  3OJS A;  3CB4 A;  2MPU A;  2MTL A;  2WTF A;  1PJ5 A;  3MCS A;  2DGU A;  4FF3 A;  1I51 B;  4ITS A;  4AD6 A;  1VIX A;  2LXU A;  1U1N A;  4J9O A;  2F4V J;  3TW0 A;  1FVS A;  3BRE A;  4CIO A;  2WON A;  4MIA A;  1HKA A;  2Z0G A;  2WON B;  5DJB A;  2DNR A;  1VHI A;  3D9B A;  2R2U A;  2FGO A;  4EU0 A;  1DAX A;  4P2X A;  2OIH A;  3D1H A;  1F5C A;  4DFJ A;  4RW8 A;  2KO1 A;  1IWA A;  4LQ9 A;  3R1L A;  1SH0 A;  4RW8 B;  1ROF A;  5ITH A;  4ZHR A;  2LXF A;  3FC9 A;  4ZHR B;  2I8E A;  1D3W A;  3OTB A;  1ZAX A;  2G4B A;  4FPR A;  5LJ5 Y;  2P6S A;  3RB6 A;  4ATN A;  1WEL A;  2JEI A;  2ZZN A;  4PG5 A;  3FUY A;  4MK8 A;  2W9C A;  4Y0F A;  3WIU A;  2W9C B;  5DO2 A;  1KQG B;  2MXY A;  1QE1 A;  4DMZ A;  5FJ4 A;  4IO9 Q;  8AT1 B;  1QE1 B;  4TXS A;  1VRT A;  2Z4P A;  1ZA1 B;  1VRT B;  3CJR A;  2PMZ D;  4C7Q A;  3CD6 S;  4M1K A;  1AZS A;  2ADB A;  1AZS B;  1XBW A;  4X2B A;  1OSD A;  4LBH A;  4TY9 A;  3LP0 A;  4URQ U;  3LP0 B;  3KLE A;  2G1H A;  5L38 A;  3KLE B;  3K8V A;  5CYM A;  1NSK L;  3GFX A;  5CYM B;  4QBU A;  3OL6 A;  5E5N A;  4DEZ A;  3PX0 A;  5GAG I;  4W4M A;  1WDD A;  4WBF A;  2H65 B;  2D3O 1;  4J37 A;  1XWL A;  1QAX A;  1RTD A;  3K0J A;  4HT5 A;  1KKH A;  1RTD B;  3FEY B;  1VOM A;  3K8W A;  1N6Q A;  2AJF E;  1N6Q B;  3I5B A;  1M1K T;  3MR2 A;  1SIW B;  5SZT A;  3H5Y A;  2V8H A;  2IJR A;  3OV7 A;  3ETM A;  3UR0 A;  5KG1 A;  3UDE A;  2OTJ S;  4M5M A;  4CH1 A;  4Q8F A;  4ZVU B;  2DRA A;  1TMM A;  3KNG A;  4ID8 A;  5KG7 A;  4KHP J;  4K4S A;  2HKE A;  3S1T A;  2DXD A;  3FMB A;  2LEC A;  2CQ3 A;  4B9N A;  3TZZ A;  2FLL A;  1DLO A;  3F44 A;  4ZPW R;  1IUJ A;  1DLO B;  3CME S;  1LK7 A;  4AXJ A;  2HQC A;  1R8C A;  2CZV C;  3DU6 A;  2CDQ A;  5FLX U;  2R2R A;  1N4L A;  1UFK A;  3G71 S;  5F8M A;  4FVM A;  4KRW A;  1S12 A;  3R1H A;  4B9L A;  3TVK A;  4PR6 A;  4I68 A;  4CCH A;  3QZ7 A;  4GC7 A;  4KC5 A;  2DNK A;  3G8T A;  3I9V 9;  1SJ1 A;  1EQM A;  2OFG X;  1N32 J;  2P8I A;  1SQF A;  2M8D B;  2WVB A;  3PYF A;  3W63 A;  4LF9 F;  2DNO A;  1VQ4 S;  3FSI A;  3PY8 A;  4HL9 A;  1YIT S;  2VOD A;  4FKX A;  2CJK A;  1GAO A;  4JI2 J;  3A4T A;  5DDP C;  4EI2 A;  2DNZ A;  1FRH A;  2MZS A;  2QA4 G;  2LEA A;  4E2F B;  5GAE I;  2GIF A;  1UVL A;  4ILM A;  3H40 A;  2DGT A;  1HW9 A;  2F9J A;  3Q8Y A;  1W26 A;  1TL3 A;  1HR0 F;  1R0A A;  1C2P A;  2CQ1 A;  1TL3 B;  1R0A B;  3OTO J;  1PO6 A;  5SUH A;  1SJR A;  1UP1 A;  4IOA Q;  1X0F A;  1SC1 B;  1WF2 A;  2XMU A;  2J9E A;  1WEZ A;  1YLX A;  2LP4 A;  4E98 A;  4ZLL A;  1NPK A;  1S1T A;  4ZIV A;  2Y3Y A;  4IRC A;  1S1T B;  1I94 F;  2HWH A;  1IBK J;  3IM9 A;  3NXZ A;  4FS1 A;  5D4N A;  4OYA A;  1O5J A;  2MYF A;  1VQ7 S;  3NAH A;  4LF8 J;  4OYI A;  2L41 A;  4PG6 A;  2DY9 A;  2J5A A;  4KKO A;  3JQK A;  2HGN A;  4KKO B;  2BR0 A;  2AHO B;  2Y9H A;  4ILL A;  1NDK A;  5A76 A;  1YTY A;  3QGP A;  2BJ7 A;  3HD1 A;  1Q5V A;  4ID5 A;  5IC4 B;  2XS7 A;  4QU6 A;  3W5Y A;  1OY6 A;  4DV3 F;  4ID5 B;  5KFX A;  3BH6 B;  2NXC A;  3UCU P;  3SV3 A;  2AV5 A;  3BSC A;  3RGI A;  5AE3 A;  3NGR A;  3ILL A;  3EGV A;  4FDF A;  2OMO A;  3FBB A;  3GG0 A;  3J81 j;  1BHN A;  2QLF B;  3BQ0 A;  4F3Q A;  2OUG A;  3HJF A;  3ZTP A;  1YIJ S;  3VGV A;  1VC5 A;  2RE1 A;  1SL1 A;  1XK8 A;  4KGV B;  3GIR A;  4XO0 A;  3M6W A;  3JTP A;  3AT1 B;  4F8R A;  4IFV A;  1IBM F;  2ZNZ A;  1FTC A;  2A10 A;  1ZH5 A;  4IFV B;  4XPE A;  5J1P A;  3HT3 A;  1Q0N A;  1SUQ A;  4JYA F;  3T1H F;  5D78 A;  5IQQ A;  3OUY A;  1SUQ B;  3SQG A;  3OUY B;  3SQG B;  2KT5 A;  3RUB L;  1XNQ J;  5KFE A;  1J2V A;  2MKH A;  1MNE A;  3GYX B;  4QU7 A;  2QG9 B;  2KXH A;  1RT1 A;  1U0S A;  2GQC A;  2W4P A;  1RAH B;  2UVW A;  5C2C A;  1RT1 B;  4MH8 A;  3KJQ B;  4O3P A;  3W5X A;  1U8W A;  5JUM A;  2MQQ A;  3G96 A;  3MEK A;  1VMB A;  4U67 Q;  5GMD A;  3AXK A;  5DGB A;  1RWV B;  1T11 A;  4USU A;  2DGO A;  4DR2 F;  3ENW A;  1GXU A;  5D0H A;  2WB1 D;  4ES3 A;  4FF2 A;  3TVZ A;  3QT6 A;  2BQU A;  1TAU A;  1CC7 A;  5J2M A;  3CXC R;  3I0R A;  2BKO A;  5J2M B;  3PCO B;  2MY7 A;  1LK5 A;  4DFM A;  3I0R B;  3B6B A;  2FVS A;  4UY8 T;  3M8R A;  3LGH A;  4DR5 F;  5J2P A;  1LXN A;  3QRQ A;  2V4J A;  4ZCM A;  5KAK A;  5J2P B;  2PA8 D;  2V4J B;  4DV4 J;  2E29 A;  2KRB A;  5IOL A;  3Q8Q B;  1YZ7 A;  4NLO A;  3TQE A;  1MLA A;  1H2T Z;  2HHQ A;  3G9C A;  2GIQ A;  4LF4 F;  4Q2M A;  1D8Z A;  2BKP A;  2DPI A;  3MR7 A;  1RT6 A;  2EKN A;  1RT6 B;  3AJD A;  4DQR A;  3WIV A;  2B0G A;  1WOS A;  1RKI A;  4FN5 A;  2DPJ A;  2DKO B;  1NH8 A;  1U48 A;  1V9O A;  2AYE A;  1YX2 A;  4CLY A;  4X65 F;  2F9D A;  2KFN A;  3CUN A;  3HSD A;  4CM2 A;  2MY8 A;  2WVD A;  4DL2 A;  4J9Q A;  2QFJ A;  4Y2I A;  4I2P A;  2RRN A;  4I2P B;  2BMB A;  2NYI A;  1FWK A;  3KYL A;  4DL3 A;  4ZLJ A;  4F3M A;  1VHF A;  5KFZ A;  4JI7 F;  3M7V A;  2IMW P;  2HMI A;  3AAW B;  3C8Y A;  2CPH A;  2HMI B;  4EO8 A;  2EEY A;  2RIL A;  4NXN F;  1HAR A;  4F7V A;  4IG0 A;  4IG0 B;  2JEF A;  3BM7 A;  3PTW A;  1UPM B;  4IO1 A;  2RDI A;  2GIR A;  5CCL A;  4OYB A;  1FXL A;  3RW7 A;  3B82 A;  2JZ5 A;  1FTR A;  2XB2 D;  2HBQ B;  1A0O B;  5DG9 A;  2CQI A;  3EPG A;  1OSC A;  2QT7 A;  2ERR A;  4OI1 A;  4PRF A;  3WX4 A;  2MEW A;  4IUF A;  4P73 A;  3IM8 A;  1D09 B;  1RLC L;  4DR1 J;  1TKX A;  1TKX B;  2X1A A;  1JQG A;  2KHD A;  1NXI A;  2RML A;  3ENV A;  5D0G A;  3PR4 A;  4PWW A;  2EBE A;  2QLW A;  5BYQ A;  5KFK A;  3AA9 A;  3HHL A;  1GX5 A;  3HHL B;  1RTJ A;  5LMU F;  5IZH A;  1HNZ F;  1RTJ B;  4N77 A;  2EG2 A;  1WC0 A;  2A2C A;  1GMW A;  3BYR A;  4JI1 F;  2HRT A;  3TOQ A;  1CUL A;  2EC2 A;  1KFS A;  4EBC A;  4DV2 J;  4C3M A;  2XMT A;  3HKZ D;  1CUL B;  4CI0 B;  2YXL A;  3T9N A;  3DLH A;  1WD6 A;  3QBC A;  2HHS A;  4AL5 A;  3NS6 A;  3OL9 A;  4W92 B;  5K8O A;  1VC0 A;  2YWW A;  3MR3 A;  2JFD A;  1VQ5 S;  3W2W A;  1FJG F;  3W2W B;  1X5T A;  3CJ2 A;  4DSL A;  4RU2 A;  4JI5 F;  2VKR A;  2VV5 A;  3PKM A;  4DN0 A;  3W66 A;  4J9M A;  2R7O A;  1KR4 A;  4OV1 A;  5KFS A;  1BD6 A;  2GVZ A;  1H6K X;  1OYD A;  2GVZ B;  2R7S A;  2B3T B;  2IYG A;  2FJV A;  2XHW A;  1NAQ A;  2CPJ A;  1U2R A;  4Q45 A;  3J7Y I;  2BA9 A;  4ZIW A;  4YFU A;  2XQC A;  3L9Z A;  2IIH A;  5EN1 A;  4J9P A;  1YJR A;  1MMN A;  4NPO A;  3BSA A;  3G6Y A;  2CQ4 A;  2FJW A;  3Q2S C;  2JLE A;  4YDX A;  2CJX B;  2HW3 A;  1IBL F;  3W1Y C;  1RT5 A;  4FKY A;  3ZZR A;  2G0I A;  1RT5 B;  3TNV A;  5E3A A;  1M0S A;  3O3L A;  1B64 A;  2UV8 G;  2OSQ A;  2XY5 A;  2ILY A;  5LXR A;  2BW7 A;  3BR8 A;  3N5F A;  4X62 J;  1FHT A;  1V5V A;  4YN3 B;  2XY7 A;  3K17 A;  2B43 A;  4C97 A;  2RQK A;  3GB0 A;  1FRM A;  4DG1 A;  2K1R A;  3ITH A;  4DG1 B;  1SJ4 P;  1S1X A;  2K1R B;  3ITH B;  2JLF A;  1S1X B;  4DCJ B;  4UT4 A;  3MR6 A;  4ES1 A;  3VV2 B;  2KTQ A;  2K7J A;  3K58 A;  1TUW A;  2W2P P;  1VCT A;  4ECY A;  5G0R A;  2EFO A;  4ELV A;  1IWG A;  1UEK A;  5G0R B;  4JB8 B;  1PJ7 A;  4OZL A;  1K0V A;  4WJB A;  2FHJ A;  3QT5 A;  2ZH9 A;  2HUR A;  3DRR A;  3US5 A;  3DRR B;  4X64 J;  1RTZ A;  5HBM A;  2PMW A;  1Q7Y T;  1Y3K A;  4HDH A;  5HBM B;  2DGV A;  4KFB A;  4QWA A;  2LQ5 A;  4KFB B;  4FXW A;  4DI6 A;  2BJ1 A;  4URG A;  4ECT A;  2PN6 A;  2M70 A;  3NMA A;  2VB6 A;  1WG4 A;  1NK5 A;  3DKD A;  3V6J A;  3NY0 A;  4KB7 A;  2HPU A;  2DHA A;  2F5G A;  1UMJ A;  2J6U A;  1F6T A;  2CPF A;  2FVP A;  5D4O A;  3S8S A;  2ZH1 A;  2MJU A;  2DCL A;  4LF1 A;  4C8N A;  1NKE A;  4A8O A;  4CLU A;  1EJ7 L;  2BRK A;  4M5G A;  4TLQ A;  3M6V A;  4C8O A;  3OXL A;  5EX3 A;  5DZ7 A;  5H1S V;  2IM1 A;  2BQR A;  1YDL A;  3U1N A;  1RKJ A;  2PSZ A;  4ZJL A;  1RCX B;  1RQ0 A;  3VAF A;  2W4D A;  3S7R A;  3KUE A;  2W2M P;  1RAC B;  3SI8 A;  2E5J A;  1X5O A;  3JSM A;  4EYH B;  3TA2 A;  3JSM B;  2EFP A;  2D1C A;  4TYB A;  4HH0 A;  2M4M A;  1T05 A;  3G6X A;  1QUV A;  5KG2 A;  1T05 B;  1FDB A;  3HKW A;  5AE1 A;  3M8P A;  4ZVT B;  2AZ1 A;  3M8P B;  3H5S A;  2HHH J;  4F67 A;  2FY1 A;  3LGM A;  2AW0 A;  5GMK a;  3B78 A;  4LVO P;  3R5A A;  3NGS A;  1KOO A;  4NCB A;  3P49 B;  3M30 A;  5M2U A;  5K14 A;  3M30 B;  4HHU A;  5K14 B;  3K2Y A;  2VA3 A;  4LRA A;  4GMK A;  1F9E B;  3AOC A;  5KT2 A;  3IWN C;  4ECZ A;  4CZC A;  1BMQ B;  3GJS B;  3C19 A;  1VQN S;  1FRX A;  2R7X A;  3OVB A;  2KT2 A;  4ZVS B;  3PIO Q;  4CP5 A;  1DUR A;  4QIG A;  2NS1 B;  4YR3 A;  3QJP A;  1YQH A;  3L7U A;  2B6A A;  4P2S A;  2B6A B;  1N34 J;  4Z7C A;  2XTJ P;  2KJV A;  2F63 A;  4D3G A;  1RAO A;  2YNG A;  2VFU A;  4F50 A;  4FYX B;  2YNG B;  1DBD A;  2XMM A;  2AWZ A;  1HQE A;  1TL5 A;  1HQE B;  1N5Q A;  3GIM A;  1WTF A;  2IYI A;  2YX4 A;  4ZP9 A;  2EFQ A;  2HVI A;  1FA0 A;  1X8D A;  4Y65 A;  3I31 A;  2GHW A;  4RW6 A;  1LEO A;  3JB9 k;  5AJ3 F;  2ZIT A;  1XMO J;  4RW6 B;  4DL6 A;  1FJC A;  3VAL A;  5KT7 A;  2U1A A;  4XDD A;  3ISN D;  4DQP A;  2KKH A;  4ED3 A;  5B0A A;  3EPI A;  1ACM B;  3FQL A;  2BYC A;  1S4E A;  4J9U E;  3KK3 A;  1I6J A;  5KG0 A;  4J9L A;  3KK3 B;  1FCA A;  3ADA C;  4ETZ A;  4ZCL A;  4DV7 F;  1IR2 A;  4U6P A;  4J9S A;  1HNW J;  1RSC A;  2UU9 F;  3ELH A;  2XO7 A;  2BKN A;  3M2R A;  1T94 A;  2VHG A;  2BE9 B;  1F0X A;  3M2R B;  2IRY A;  4ZVE A;  5CYJ A;  5DRK A;  4WFZ A;  2RU9 A;  2ZBP A;  2NZC A;  1FE0 A;  3J7A 1;  2JFK A;  1FER A;  3VWS A;  1UZH A;  1JK9 B;  2YQ0 A;  1RT2 A;  2GNK A;  2M8H A;  2V94 A;  1RT2 B;  3RB4 A;  1FKP A;  1FJ7 A;  1YJ7 A;  4IRD A;  2E9R X;  1FKP B;  1L3U A;  1G4C A;  5HL7 Q;  1SJF A;  1WEY A;  4UOC A;  1XEZ A;  2CQP A;  4U9R A;  2H5J B;  5KFF A;  5F0W A;  5ETM A;  2CPE A;  4YY3 J;  1FNO A;  4PXB A;  2FLO A;  1U0H A;  4FBT A;  3BS9 A;  5LMN F;  3G8Q A;  1U26 A;  1U0H B;  2VL1 A;  2CPI A;  5AXK A;  2NPI A;  2D74 B;  4F04 B;  1BWV A;  3AH6 A;  4UQG A;  2XHC A;  2AQ4 A;  4C11 A;  4C11 B;  4M63 A;  2DR9 A;  1FX4 A;  3WBZ A;  2C2O B;  5L1I A;  3QFW A;  4NA1 A;  4KPY A;  1QM9 A;  2C42 A;  3I87 A;  5BJR A;  3EMT A;  1NH7 A;  1M5H A;  4B3S F;  2V34 A;  2JNJ A;  2Q3P A;  4P2F A;  2EVZ A;  2H1Y A;  1JLG A;  5IM0 A;  1JLG B;  4B9M A;  2M7S A;  5IM0 B;  1WOR A;  1QVF R;  3OLB A;  5G4D A;  1GXL A;  3EGN A;  4MFB A;  3F0N A;  4PG7 A;  4K7Q A;  4MFB B;  3V4M A;  5HP1 A;  5KFR A;  4L75 A;  5HP1 B;  4KJI A;  2E5L J;  3BDE A;  3VHQ A;  2F3J A;  3VTI A;  1VQP S;  2V6A A;  3C6U A;  2HRU A;  3C6U B;  2UVU A;  2GS8 A;  2DNH A;  1HA1 A;  4AQY J;  2XG8 A;  4WU3 A;  3H98 A;  3GTY X;  1PG5 B;  4I64 A;  4NCG A;  2VD3 A;  3KK2 A;  4NCG B;  4IG3 A;  3KK2 B;  5I4M A;  2CVE A;  4JV5 F;  5J1N A;  4IG3 B;  5HAO A;  1SC4 B;  4RO0 A;  4U7C A;  3VGS A;  4ZP6 A;  2KB2 A;  3THV A;  3NNH A;  3SCK E;  3H2V E;  2O01 C;  4ZPB A;  3Q8S B;  2B56 A;  3EZU A;  3R5J B;  2BX6 A;  3J81 Y;  2K8G A;  4LIW A;  4NZ6 A;  3P8B B;  1TK0 A;  2B9W A;  3BGR A;  2ZH2 A;  3BGR B;  1VS3 A;  4NLD A;  5KFA A;  1Z1Z A;  4CQ1 A;  3CJT A;  2SXL A;  3TA1 A;  2Z8Q A;  3PVX A;  3CC2 S;  5IV3 A;  4YHH F;  5L46 A;  4WFY A;  1S6O A;  1RAI B;  1N36 F;  1S59 A;  3D3B J;  1GTE A;  3DGP A;  3L7O A;  3SCJ E;  3BR9 A;  1B4S A;  4PG4 A;  5KT3 A;  1FK9 A;  3DGP B;  2Y0S D;  1FK9 B;  4P71 A;  1PBU A;  2PEH A;  4X4Q A;  2QJ3 A;  2MQL A;  1R6Y A;  2RHS B;  1ZBT A;  2FHM A;  4Q8E A;  2IM2 A;  4DPO A;  4DWI A;  2DHH A;  4O3O A;  2LU2 A;  4NE9 C;  3FEX B;  8ATC B;  4O4G A;  3P5T L;  2I38 A;  1NJZ A;  4O4G B;  3VQT A;  2IDE A;  1EX8 A;  2G1D A;  3QAE A;  1FKO A;  1FKO B;  1L3S A;  4PYD A;  1FX2 A;  1K73 T;  3LWL A;  3G87 A;  4DUY F;  3HXM A;  4C0O C;  1R8P A;  3T1A A;  3GE9 A;  2NUU G;  1KTQ A;  1REG X;  4LMZ A;  2RUG A;  4ICL A;  3WC2 A;  2QA1 A;  2W2Q P;  4ICL B;  4OL8 A;  2NCK L;  1QVG R;  1TKZ A;  1RA7 A;  2HLU A;  1TKZ B;  4DUT A;  5D77 A;  3SZ2 A;  2EWH A;  3M8Z A;  3PYE A;  1SV5 A;  3HZE A;  1SKS A;  1PYT A;  1SV5 B;  2BQ3 A;  4ZDN A;  2HNZ A;  2HNZ B;  1T3O A;  5KT5 A;  1HBO A;  1TR0 A;  3A13 A;  1HBO B;  2DJW A;  3JQJ A;  1EAR A;  1CS4 A;  2RIJ A;  1CS4 B;  3DXS X;  5LOQ A;  4OZ5 A;  1JLB A;  1JLB B;  3PEH A;  5M2R A;  4JOU A;  3P3D A;  2O66 A;  1U8S A;  1UAW A;  3G6V A;  2E7V A;  1X9M A;  4A8W A;  2GQ2 A;  4WWS A;  3BN4 A;  2C2K B;  1CVJ A;  4DR6 J;  2DNM A;  1MSW D;  4LT6 A;  4G1P A;  2J9C A;  4CLP A;  1M5S A;  1PIE A;  2JSX A;  4TLR A;  1Y9O A;  1KD1 T;  2VDH A;  1SL2 A;  3FBF A;  5KFJ A;  5EHH A;  2CDR B;  5KFD A;  4QIF A;  2F8H A;  1N33 J;  4K4Z A;  3QWU A;  3UQS A;  2MKI A;  2OPS A;  2FZC B;  2OPS B;  3K7R A;  2JDJ A;  4OHZ A;  4OX9 F;  2ASJ A;  2HZV A;  4EUV A;  1NHU A;  3QJL A;  4WU2 A;  2VBY A;  1RZM A;  1B99 A;  4CO1 A;  4MIB A;  4U95 A;  5A6W A;  4MKY A;  4L6V 3;  1RWM B;  2HNY A;  3D6H B;  3W62 A;  1S7H A;  3BN7 A;  2HNY B;  5CH7 B;  1HIY A;  2R7T A;  1U1Q A;  1JLQ A;  3PRB A;  4CNY A;  5KTQ A;  3H7H B;  5E0O A;  4QWC A;  1JLQ B;  3CCQ S;  4OZJ A;  4IH6 A;  2W1B A;  3I82 A;  1SCJ B;  3AOA A;  3KHG A;  2OH2 A;  5DM6 Q;  3CDW A;  4PWU A;  4G6V B;  3SFU A;  3KHR A;  3MMA A;  1XER A;  2UXD J;  1CBK A;  3MMA B;  2DGW A;  5AT1 B;  1RAA B;  4RUC A;  4K0K F;  2YWF A;  3QGH A;  3UPF A;  1NJI T;  2AJ4 A;  3FKB A;  2VC1 A;  1VLO A;  4JUZ A;  3AXM A;  4DV5 J;  5IT4 A;  3Q23 A;  3R7N B;  3BJY A;  2WZ1 A;  3J81 U;  1MG7 A;  3OJU A;  1ZZN A;  4LFA F;  1RB0 A;  4TKT A;  5CAA A;  1H98 A;  1M5O C;  2ZHO A;  2FJE B;  2B7C B;  2DIS A;  4HI1 A;  1CSJ A;  3D1Q A;  5A6P A;  2M88 A;  4ZJO A;  3BSN A;  4I6W A;  3QQC D;  3FBC A;  4UUX A;  3MPU B;  4V1A k;  5KOW A;  1NM2 A;  4DR3 J;  3FZ2 A;  4LF5 F;  1UVM A;  4B3R F;  3QZ8 A;  3OQ2 A;  4LRC A;  2B4U A;  1CJV A;  3EVO A;  2Q43 A;  2OSR A;  1CJV B;  3D28 A;  3EYZ A;  2DIV A;  5KFC A;  3UCG A;  3QRR A;  5KFP A;  5EX0 A;  3UDC A;  4HT7 A;  2RSQ A;  2LCW A;  3MTJ A;  4OYX A;  2MZ1 A;  3DRX A;  2X3D A;  2QV6 A;  2IDL A;  1EKR A;  3OVS A;  3NBP A;  3BBC A;  4YS2 A;  1K47 A;  1UFL A;  4QR0 A;  2OEM A;  3NBP B;  1ZOT A;  4WFX A;  4K50 A;  1HLW A;  4ECS A;  2V63 A;  3VZH A;  3QAT A;  4PQA A;  1T8E A;  1OYE A;  4LVN P;  3CMQ A;  1XN9 A;  4WXO A;  4M8L A;  4AL7 A;  5F8N A;  4B3T F;  1WC5 A;  1MMD A;  3WQP A;  3M2U A;  7FD1 A;  3M2U B;  4PPZ A;  3H2U B;  2HQG A;  3W64 A;  4F3O A;  1PSD A;  1URN A;  3HD2 A;  3AJ1 A;  4CO4 A;  4YR2 A;  2DNP A;  3J80 Y;  3JYT A;  4ZCK A;  4UTG A;  3JYT B;  1YI2 S;  1LV5 A;  2R42 A;  1P6T A;  3RR7 A;  3DHX A;  1BQX A;  2UUA F;  2E1R A;  2RHQ B;  3LPY A;  5HQ8 A;  1HNV A;  2PC6 A;  4ZP7 A;  1KDN A;  1HNV B;  3UD5 A;  3B4D A;  5LSO A;  1F2H A;  2CQ0 A;  3K59 A;  2HZC A;  4FYY B;  4A48 A;  5IS2 A;  4C4W A;  1QDU B;  4WTY A;  1EZZ B;  4CLK A;  3MOZ A;  2ZWP A;  4ZN3 A;  2KHC A;  5AXN A;  3CC4 S;  1MN7 A;  3HK2 A;  4I6A A;  1Y10 A;  2C2N A;  4M5I A;  4YR0 A;  3W8G A;  2MLX A;  2B5J A;  1WG5 A;  2MQN A;  1JXV A;  1APS A;  2B5J B;  3KTQ A;  4P52 A;  5BYS A;  4OLP A;  3DLJ A;  4C48 A;  4C3L A;  1R8A A;  2KFZ A;  1PAE X;  2V5H G;  4BWJ A;  4AFF A;  2DTJ A;  2F4F A;  3MFI A;  4PUO A;  3M4X A;  7FDR A;  5KG5 A;  3T5K A;  3VAK A;  4PUO B;  1H72 C;  4B9T A;  3RRK A;  2CPD A;  1J5E J;  4UOF A;  2EFN A;  2FHK A;  1HPZ A;  1S99 A;  1HPZ B;  2WBM A;  5K9F A;  1JXL A;  2AJ2 A;  5CZV A;  2GX8 A;  1MW7 A;  2V4R A;  4P72 A;  1B7Y B;  1T95 A;  3VAG A;  2RNE A;  1LW2 A;  3GU0 A;  2LA4 A;  1LW2 B;  4M94 A;  2QGF B;  2EXU A;  3KLI A;  3KLI B;  1SQG A;  1SJQ A;  3N9U C;  2Y1J A;  1U7L A;  3DLL Q;  3GZ7 A;  5F8I A;  1RCO B;  1FRJ A;  3UI3 A;  4F2S A;  2BV3 A;  1N48 A;  2BM1 A;  1WKL A;  2YKM A;  4CLZ A;  1FO1 A;  4ANC A;  4QW8 A;  3R97 A;  4DLE A;  2YKM B;  2IBO A;  1B7F A;  4K4V A;  1FE4 A;  2P2C B;  4O3R A;  2W4C A;  1WOP A;  2IBK A;  3CPW R;  5F41 A;  2J0Q D;  4NI2 A;  4NI2 B;  2G0C A;  2I0X A;  2XC9 A;  5KFW A;  4CWB A;  2GHV C;  1KVJ A;  4IOC Q;  5I3Q A;  1S79 A;  2GAH C;  2Z2Z A;  2HFS A;  2AEM A;  2ZUG A;  3CCM S;  1SKW A;  4C6A A;  3T6J A;  1YBA A;  4ZVF A;  4Y34 A;  4DF8 A;  2YPZ A;  1KRP A;  5B0D A;  1JNZ B;  2W7A A;  2GCF A;  1DZ5 A;  4RBT A;  1UW4 A;  3IG1 A;  1MWZ A;  2ZZM A;  3IG1 B;  4KHP F;  3UD3 P;  3GP9 A;  3FEZ A;  1WKK A;  3OFH A;  1Q8L A;  4DCP B;  3OFE A;  1WF1 A;  3IA0 A;  3PFE A;  5EGY A;  3VCD A;  2ZJP Q;  2YBV A;  2HQD A;  3T5H A;  3MPW A;  3I5A A;  2ZH5 A;  3H42 A;  1OQ6 A;  2CQD A;  3BDP A;  4E8U A;  3T1Y J;  2R7Q A;  4DL7 A;  4LQ3 A;  1Q79 A;  3SSS A;  4QPX A;  2F7V A;  3D6M B;  3P96 A;  2M9K A;  3IAS 9;  3V2U C;  1DQ9 A;  3OD2 A;  4HTJ A;  2AJQ A;  1QLN A;  5CZX A;  3NNC A;  2HHP A;  3MMJ A;  5GAD I;  1P8G A;  2UP1 A;  4TY8 A;  4TY8 B;  3MI7 X;  3OL8 A;  2V69 A;  1ZTT A;  3J80 U;  1IJF B;  3PYD A;  3B8H A;  1N32 F;  4LSN A;  2JEJ A;  1EQ0 A;  4UOH A;  4LSN B;  1AFJ A;  4ZPD A;  3TZY A;  2ROG A;  4JI2 F;  2DEJ A;  1RYR A;  1TV6 A;  4BWM A;  2CQH A;  1TV6 B;  3GIL A;  2UV8 A;  4IQX A;  1DJ0 A;  4K4X A;  3Q24 A;  1Q82 T;  4CLW A;  1CC8 A;  1KLN A;  3OTO F;  3KWM A;  3KXD A;  1HI1 A;  1A9N B;  3TYT A;  2BJ8 A;  2YQ3 A;  1O0P A;  3LTO A;  3OR2 A;  5LSR A;  3IBC B;  3OR2 B;  1RWU A;  3VVT A;  3T1H J;  4ZA1 A;  3R5B A;  4Z37 A;  3ET6 A;  4PXD A;  2DXF A;  3KK1 A;  5HQM A;  3ET6 B;  2YPY A;  5ETV A;  4KR0 B;  4DOZ A;  3KK1 B;  3LAN A;  1GTH A;  3AOD A;  2PMH A;  1Q4R A;  2RJZ A;  3K5L A;  2UUT A;  1BE4 A;  1RAE B;  4ECU A;  2QRR A;  4YP3 A;  3GWC A;  4YME A;  1D0E A;  1V6H A;  3BO3 A;  2V50 A;  4DV0 J;  3C66 A;  2VUG A;  1U1O A;  1Z4U A;  4OLO A;  5ADZ A;  3KHL A;  1KN6 A;  2OFH X;  3ZZ0 A;  3DLK A;  4USW A;  3SDE A;  3DLK B;  4WP8 A;  4ZVH A;  4C0B A;  5T14 A;  4J7C A;  4KHM A;  3SDE B;  2X51 A;  4MK9 A;  2V2Z A;  4Q0B A;  4NRT A;  2BW2 A;  2VFS A;  4Q0B B;  1LWC A;  3OSP A;  1LWC B;  4HDG A;  5A8R A;  5HMZ A;  2GHP A;  5A8R B;  4DR5 J;  4WP9 A;  4ZIT A;  1N88 A;  5B0F A;  3HJV A;  2JEG A;  4A46 A;  2DHX A;  3L09 A;  1KS2 A;  3S6E A;  3MHY A;  4LRF A;  1ZPW X;  1R0C B;  4CYU A;  3V6D A;  4CYU B;  5CXT A;  3V6D B;  1JLA A;  4X84 A;  2UZA A;  1HBN A;  1JLA B;  2CJY B;  4NMX A;  1HMV A;  1HBN B;  1HMV B;  2F65 A;  3MM9 A;  1XNQ F;  2ZHA A;  2JRS A;  1C1B A;  3MM9 B;  1C1B B;  2MQP A;  2VOO A;  3QLH A;  2IJN A;  1DHM A;  3IGN A;  5C25 A;  4Y3C A;  3QLH B;  2Z57 B;  2FY8 A;  3NWR A;  5C25 B;  2LA6 A;  4NA3 A;  5D0R A;  2FD2 A;  2MDA A;  3TAP A;  4M5K A;  2AYM A;  4N5S A;  2A3J A;  5CD4 A;  2OPQ A;  3KJN B;  2Y0B B;  2HRY A;  2OEL A;  1NZ8 A;  2OPQ B;  1S9E A;  1UEU A;  3HVR A;  3I5C A;  1S9E B;  4OI2 A;  5EWF A;  1V3Z A;  5T41 A;  4RW9 A;  1RWN B;  3A8I A;  4R5P A;  1AXQ A;  4RW9 B;  4R5P B;  3HHN B;  2IJF A;  3WZ0 A;  4NXN J;  1JMT A;  4N7T A;  2VC0 A;  3SCL E;  4O3N A;  1YHQ S;  4TU7 A;  2DD8 S;  1Y11 A;  4NZ7 A;  4Q44 A;  3RRG A;  1S7I A;  2HVE A;  2AYG A;  4DV4 F;  2QLX A;  2NXU A;  5DQI A;  4C8Y A;  2QMX A;  3JQM A;  1VBX A;  3F56 A;  1U47 A;  4TN2 A;  5KFB A;  3EWG A;  4ZS6 A;  4MK7 A;  3EJM A;  3U02 A;  2OI2 A;  4HLB A;  3PG9 A;  4N8O A;  1Q1K A;  1UPP A;  2CNK B;  3J7Z T;  4LF2 A;  3SV4 A;  4NCA A;  3W3S A;  3PW5 A;  1RGV A;  3CJ5 A;  3NGU A;  4QYZ J;  3GV7 B;  5B0G A;  4DHV A;  1MU2 A;  3TQ1 A;  1MU2 B;  3DLB A;  1XJW B;  1VGY A;  4UOG A;  3CDA A;  4NX9 A;  1TKT A;  2IFX A;  3OTD A;  2V4Q A;  1AYE A;  1TKT B;  5GAH I;  4DR4 J;  4NXM J;  4A8K A;  5B08 A;  2BZ2 A;  1SKR A;  4YQW A;  4RWW A;  3SFG A;  1WHW A;  1N0V C;  2RQ4 A;  2OML A;  1FFS B;  3NL0 A;  1LXJ A;  1SQE A;  1EHW A;  1NDL A;  2H4W B;  4YB6 A;  3TR5 A;  3R9L A;  1IBC B;  3UW1 A;  3CJK A;  3TO8 A;  3KMS A;  4ZVR B;  4KTQ A;  3CJK B;  4JI4 J;  2E7W A;  1K1S A;  3N6L A;  2NSC A;  3NMR A;  4WZQ A;  1FD8 A;  4DR1 F;  1VYA A;  1FD2 A;  1B0T A;  2BBE A;  3PJ9 A;  2E44 A;  3NS5 A;  2AU0 A;  1IBL J;  4O0I A;  2VOP A;  2V0N A;  4WZM A;  4S0M A;  3FSY A;  2FUG 9;  2A0F B;  3QID A;  5H9E J;  5IFM A;  2N7C A;  4OYO A;  3TJ8 A;  5K8M A;  1ZAV A;  5HRO A;  3ENA A;  3JTN A;  3HMJ G;  5HRO B;  3LPE A;  2I2Y A;  2R7V A;  2NSB A;  1VQK S;  1YSJ A;  2L3M A;  2XM3 A;  1JJ2 R;  4DV2 F;  2FJA B;  3CE8 A;  1Z2L A;  1U45 A;  1L5U A;  3GR0 A;  1X4F A;  4KY3 A;  4ELU A;  2ADC A;  3GFZ A;  2DNN A;  1KFD A;  4KO0 A;  2UUB F;  4DSJ A;  4KO0 B;  5HSP A;  4EGL A;  3FGV A;  3R5C A;  4FZV A;  2XZW A;  2ZFH A;  5C42 A;  3TA0 A;  4EBE A;  5C42 B;  2QE5 A;  3DRP A;  2Z56 B;  3DRP B;  2LEP A;  2MB0 B;  4ZK7 M;  4NLR A;  4ED1 A;  2PI5 A;  4OYW A;  5HK4 A;  4TU9 A;  2C3M A;  4NLG A;  1RYS A;  3HSZ A;  4O4R A;  1FJE B;  2HBR B;  2HVZ A;  4X66 J;  2M3D A;  2CNO B;  1ULR A;  4RU9 A;  5ETR A;  1T9W A;  4LRD A;  2ZNY A;  3D2W A;  3EVW A;  4NEZ A;  1RBL A;  1YJW S;  2L9W A;  2YKN A;  2PGC A;  2YKN B;  2HS0 A;  2JH3 A;  3GON A;  2NXJ A;  1S6P A;  4X62 F;  2AJ1 A;  1S6P B;  2IY5 B;  5H9F K;  1OWX A;  1B0P A;  4R25 A;  1WSR A;  4NZ0 A;  4F0K A;  2V9K A;  3W9J A;  1M1H A;  3P6Y C;  2MSS A;  2VA2 A;  4FF1 A;  2J8A A;  2GC8 A;  1UA0 A;  4ERD A;  3OHB A;  2Q79 A;  4F4W A;  1UTA A;  4DS4 A;  2KL8 A;  1UW9 A;  2EG1 A;  2V8G A;  2UUW A;  2WB4 A;  3EZ5 A;  5K20 B;  3HFZ B;  4DV6 J;  5HAT A;  2IA6 A;  1GK8 A;  1RBA A;  2MQO A;  4OZN A;  4RW4 A;  3RBX A;  3BBB A;  3E3X A;  4RW4 B;  1RHJ B;  2PO4 A;  2VPX B;  5J2Q A;  2HHW A;  2CPY A;  4N56 A;  4K5R A;  4OI6 A;  5J2Q B;  4X64 F;  4ECQ A;  1S6U A;  4LR7 A;  2XMA A;  1LWX A;  3IRW P;  2ZJR Q;  3N4W A; 
#chains in the Genus database with same CATH homology
 1EX8 A;  1EQ0 A;  1RAO A;  4M5L A;  5ETM A;  3HD1 A;  4M5I A;  3MCO A;  3UDV A;  3HSJ A;  1RB0 A;  1KBR A;  5ETO A;  3HSD A;  3MCN A;  5ETS A;  3ILO A;  5ETK A;  1HKA A;  2F65 A;  5ETQ A;  1RU1 A;  1RTZ A;  4M5K A;  4M5G A;  4M5J A;  3HCX A;  4AD6 A;  3QBC A;  2CG8 A;  1HQ2 A;  3KUE A;  3HD2 A;  1DY3 A;  2QX0 A;  4M5H A;  3KUH A;  5ETP A;  1CBK A;  1G4C A;  5ETT A;  1IM6 A;  3ILI A;  4CYU A;  1RU2 A;  4F7V A;  3UDE A;  2BMB A;  5ETR A;  1EQM A;  3UD5 A;  4CYU B;  4M5M A;  3IP0 A;  5ETL A;  2F63 A;  1F9H A;  3HSZ A;  4PZV A;  5ETN A;  5ETV A;  3MCM A;  1TMJ A;  3KUG A;  3ILL A;  3HSG A;  4CRJ A;  4CWB A;  3HT0 A;  1TMM A;  4M5N A;  3ILJ A;  1Q0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...