1CBVL

An autoantibody to single-stranded dna: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded Fab and a deoxynucleotide-Fab complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/dna
molecule keywords DNA (5'-D(*TP*TP*T)-3')
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cbvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cbvL01
1NDGA 3MODL 4N0FA 2HMIC 3VXTA 2HRPL 4RNRB 5D9SB 1RZKH 2O5YH 3OKDA 4UUJB 3M8OL 2HH0H 1JGVH 3FFCB 2ZSWB 5IB1A 1H9VA 4PY8I 4PJ7E 3RY5A 1KJ2A 4WI5A 1P1ZB 4UV4H 4NO5B 1L0YA 2ADJB 2VZ1A 4PJFB 5AZ2L 2A6IB 3OWEA 5F6IB 4JFYB 4OI9A 5HGGS 3P2TA 2QADB 3PWUB 3EYOA 1MJJB 3QNXA 1U8IB 1TQCC 3FTGA 5DC0A 2J4WL 4BSWB 4N0CD 4BUHA 1FAIH 5T1MB 2ATPB 4FQLH 1MCWM 2AK4A 4P2OA 4GKSA 2H3NB 3IDNA 8CGTA 1EEYB 3TVMC 1CLCA 4HBCH 2BY2A 4JPWL 4LSUL 3NCBB 2BSSA 4YDIL 1AR1C 3B2UC 1IBGH 1LVEA 1ORQB 5DJ2A 3JWDH 3BIAX 5EZJB 4KROB 5HDOA 2VXSL 4HH9B 2JJUA 2QLVB 2HT2D 4U6XB 4Y4KC 2ZOKB 1E27A 3KPRA 2FR4A 2NW3B 3MRJA 2X7LB 5T5FL 4YK4C 1GZQA 3SDXE 5F9WC 2IFFH 2R2CA 3DVGA 4Y89A 1J7VR 2V7HA 4Z8FL 4I77H 2OK0L 3REWB 5FOJA 4MNHB 2I60H 4J1UB 4NC2B 3WD5L 1ZHBB 2W65A 5LGHL 1MVUB 1YPZE 3IAGC 2RHEA 1YEEH 1PYWA 4FTVE 2PXYA 4DOHE 3D87B 4AENB 4RWYL 4JFFA 4TVPL 4F2MB 3EOBA 3EYFA 4F15B 4DFIA 3E3QE 4Q0XL 1D5IH 3HR5A 4FQXB 5I19H 1HZHL 3IETB 3G5XB 1RMFH 4DUWA 3DV6B 1JWMA 4G5ZH 4PRBB 4I2XE 5IQ7H 4NJAL 1Z0NA 1I7UB 2CGRL 3D1MC 4QXTB 4JRYA 4K7FA 2HVKA 1L7IH 4Y5VA 2PW1A 4O51A 3UPCA 1J8KA 4J7RA 2F54A 5F1NB 4UT7L 2DQFA 5ISZD 2C4XA 5C0RH 3J7HA 4XVJL 1PQZA 1F8TL 2FO1A 4YJZL 4OZHB 4CUCA 3MFGB 1DZBA 4MD4B 3WIHH 1BIHA 4ZS7H 3L3KB 5JPMB 2F19L 4IRJB 1SMOA 5F6IC 4OLEA 4PRAB 1IILE 3TBTB 2G60L 1C08A 4RGNB 2VITB 2EXWC 5TJWK 4Y1AB 1SM3H 2NW2B 4NZJA 3O4OB 5MI0B 4GFTB 3DO3A 1V3JA 3RL2B 4J6RH 3T0XA 2A1WH 4YXHH 3T0DA 4KH2A 2SEBA 3QRGH 3D3VE 2R8SH 4L8SC 4YDJA 5DFVD 2A6KB 3AS0A 1J0KA 2QBWA 3K8MA 2YS4A 3CGTA 5DWUH 3SKJL 4RAVA 4L3EB 1YQVH 4PUBH 3UTSA 5IW3A 3G6JB 5GJSH 1TZIB 3GEWB 3JV4A 1NAML 5FGBA 2EDTA 1SY6H 4YXHL 3P0VH 3X13A 4FQQA 2NMSA 1IEHA 2AXFA 2VC2L 3H3BC 5GS0D 2BSSB 4IOFC 1P9MA 4ZUSA 5MEQB 5LGKA 2WUBL 1A0QH 3MRKB 4P2QD 4ZFFB 3H9HA 2EKSA 1DBBL 3P9MB 1KACB 4B41A 4UZGA 4W6YB 3T4AB 3BH8B 1DN2A 1XF1A 3GO1H 3ZKNC 1KFAL 1MIML 2X7LA 3O2VL 5FDWB 4KZDL 3H9SE 1WJ3A 2DMBA 1U3HC 4KRNA 5DJXA 3P4MA 1EGJA 4DKAA 4S1QL 4U1HA 3FAXA 1M7IA 3MV9A 4NO2A 1MQ8A 1TJHH 5GGSA 4P9HL 2BMKA 4RZCB 1J18A 3JSSA 4NNPH 4EIGB 5BXFB 4NQEB 5L88H 3CFKB 1UZ8A 3RPIB 3L3IA 2UVFA 2FEEI 5KSUB 1S7UA 4XVJH 3WD5H 3ARGD 3OKLB 3BRFA 1GGYA 4OD2A 2Q86B 1AO7E 4X7CC 4M1CC 1H3TA 2VDLL 4ZDHA 4JJ5A 2BY0A 2XA8L 2V2WB 5DYOB 4KXZI 2HVKB 1CDHA 2MKWA 4HJGB 1GVIA 5F3HB 2EDXA 3CMOL 4M7ZB 1ZEAH 4IMLA 4JFHD 4LPXA 3BHBB 3RKDC 2JELH 5CINL 1X5ZA 3MCLL 1EO8L 4N9GB 3QIWA 3UEZA 1XR8B 5CSZB 2Q8AL 2VDOL 3QEGL 3Q48A 5CEZE 1HCVA 2FCBA 3MRBB 5FCUL 3GSVB 4R2GD 1L0XA 2MFNA 5JIPA 5DUBA 5GRJH 5EOQH 1JZ6A 2FSEB 3HUJE 5C0RL 2BSED 3CDGA 2ESVB 2QHRL 4Y1AA 3K74B 4DKFL 3KWWB 3JV6A 4P4RA 5D72L 5EBLA 2AABH 2P5EA 3MV8A 3KPOB 5HGDB 1ZLSL 4F57H 1NLDH 4ONHB 3MA7B 3NCMA 5SWQA 4NP4L 5DD1L 4OGXH 4PJHA 1F3DJ 4KV5E 4OZGE 4FFZL 4YDJB 3GB7B 1S5IH 1L4IA 1UQSB 1WBXA 3BEWB 4HPOH 4PJHF 2OSLA 5DHXB 4HUVB 1RZKL 1WLHA 2O5YL 4TSAH 3IVKB 3ZE0F 4WU7A 3MV8D 2P5ED 4ZNCD 5CHNB 4R9HA 3AM8C 3QNYA 3R0MA 5EU7E 1TLKA 2AJVL 4PB9H 3MNVB 5TDOA 1RZJL 5D5MF 2HT2C 3DX8A 15C8L 3O4LB 2I9LA 2GY7B 4ODXA 1LEKB 1EZVX 1HXMB 3TJHD 5ESQB 4B50A 5BW7A 1CBVH 3C08H 4H0IA 3M45A 4M00A 4MXVF 4J4PC 3QO0B 2C26A 4UNVA 3UAJC 3GRWL 1IAIH 1LNUB 3PP3H 3P9MA 4CN6A 5IFJB 1KG0B 2B20A 5HHMD 4EN3B 3BH8A 3ALXA 4OZIE 1RZJH 5DDHB 1IC5H 1JPFB 4ONFH 1ZE3C 4WHYH 3U48A 4JM4L 3WUWA 1YZZA 3RVXD 1CFSA 4TN9A 4NOBA 2HJKA 1JWSA 4G6FD 2Q6WB 1FGNL 1WC7B 3OKKA 3BH9A 5E08H 5HYQB 5EU5A 1DQLH 1ZHNB 2YA1A 4PP1D 3VFOA 1KT2B 1YEDB 4XMKL 2C1OA 4NQEA 4XBEL 2R23B 2A6DA 2NY0D 1F58L 3CFKA 3MRMA 2HMID 2YEZB 3UTSE 3BW9A 1QLFA 1EEZB 4M6ML 3ARQA 2D7TH 5ICZB 2QSTA 2GJJA 4H26A 5CD5C 5D7SL 3DIFA 4H5SA 1NDGB 4Y16D 3IXAA 4X7DC 5LAXB 4P9MH 3MRPA 1J1OL 5F3HA 5I8KL 2CDGA 4JY4A 1FJ1B 1FE8L 3T1WA 1OAXH 1KJVA 3GBMH 2A9NL 4TSBH 4IRSC 4K8RD 4F33A 3Q6FB 5TQ0H 1AKJA 1JE6A 1NJ9B 4EN3C 2Z92A 1FIGH 1OCWL 4Z5RA 4P99A 4UTAH 3L7EB 2RGSA 1NAMH 4RMTA 1X4XA 2Z4QB 3EYOB 5EIVA 4GAJH 3Q5OA 4C4KT 4JAMA 4XVTL 3NVQA 3L3OB 5HDQL 3RGVD 3CXDH 1JHKL 4IMKC 3C09C 5C0BD 3C08L 2HLFC 1MLBB 2DIAA 2AQ1A 3CZJA 1IEAA 4HUKB 1TCRB 4EJ1C 2BVQA 2EC9T 15C8H 3LDBC 5LKNA 3V5DB 4ONHA 4C59B 5EU6A 3LPWA 5A2KH 3QUMB 1VKXB 3O4LD 4PGBB 3VMNA 3QIUD 5C0BA 2IPTL 1CF8H 3C8DA 1WBZA 2NW3A 1VFUA 1LD9A 4U6TA 4RWYH 4J3VA 1YEKH 5FO7B 1H8NA 4TSCH 4ZXBA 1XMWA 3ROLB 4KROD 5L0QC 4NP4H 1F4XH 5TE6L 2OR9L 5LCVH 3O4LA 4DEPC 4J1UA 1A6UL 1HXMA 1ZWIB 1CD0A 3PL6D 3QIUA 4NJAH 5FUZH 2FGZA 2YPKB 5FYKH 4QHUB 1LO3L 4HIXH 2GW5A 3QXWA 4G8IA 1S7VA 2Q8BH 2GT9B 2CUHA 3MV7D 1DP0A 4JFFB 1BEYH 2NY1B 3MJ6A 4J8RA 1DUZB 5J8OA 1NGQH 4PJ8B 4Y16B 1KEGH 3PWJB 1FFRA 1YJDC 3B9KB 5ETUB 5D7SH 1K6QH 5GGRY 1CFSB 3RY6C 5C2UB 5HYJD 3GK8H 3ZDXF 1WGOA 2IH3A 1BGXL 3MV7A 3OKKB 2VLRA 1MRDL 1PAMA 1S7TB 4TTGA 5ESAB 3KYNA 4YBLC 5EU5B 1HIML 4LGRB 1ZHNA 1HH6B 1MELA 4Y4FA 3HNVL 2YXFA 1U3YA 1IT9H 3QEHA 1FRGH 4XC3L 3O3EA 4GRWH 2FHFA 1PQZB 4WRLA 5DA0B 1S9YB 2KUTA 5DD0H 4PV9B 4A6YA 4NN6B 4MQXC 5JOFB 1G7HB 2NYYD 4DFHA 4Y5XA 1C5CL 4GUPB 4ODHL 1IGYB 3PV6B 5FO9A 2QKIA 3DGCR 3BGMA 1I9JL 1HXYB 3AVEA 4OF6A 1HHIB 4YIQB 3HZKA 2GHWB 2MOVA 4K23L 4R96A 3WIFA 2FJFA 5E6IC 5A3IC 1ZVHA 2CDGB 2EE3A 4JY4B 2X4PA 4HXBH 4LSSH 4ZFGL 3GMLB 4OJFL 1LE5A 4FFVC 4RFEA 3VA6A 3S8WA 4Z7WB 2VXQH 3MJ7B 4YK4B 4PJ5E 3QDAA 4MVBC 1IM9A 4HX1B 1RULH 1D6VL 4AEEA 3L3OA 1L7TH 3BP7B 5L9DL 4PP2B 2BNQE 2XWJA 3B6SB 1JNLL 2X44D 5D96B 2VZSA 4H25A 3UYRL 3WJJC 2ATPA 4ZUSB 3N9GL 4EXPX 3ECBB 3SN6N 3H42L 1KNOB 4XMLH 1K2DA 4ZTOH 3QI9D 3NZHH 1KCLA 3S6CA 3OG6B 3T2PA 4DQOH 2GUOA 5EZJA 3F6LA 1FL5B 1ZLWH 2X40A 1KJ2L 4Y5YB 2ZPKH 1P7KB 5IJKA 2YC1A 1BJ1J 5SX5H 2QQKL 2X70B 4UV4L 2MQ3A 2EYSB 1YC8A 5J13B 1UXSA 2YPVL 3UTQA 1UH4A 4KRMB 2WIIA 5B38G 4LLVB 1CF8L 3BRGC 4XCFL 5BXFA 1PG7W 1T2QH 2RFXA 1EIBA 3IFOA 4G8IB 2X6MA 1S7VB 3I85A 4OD3H 1T7YA 3OAUH 3T3PF 5CEYB 4CNIB 1QHPA 4YPGA 1NC4D 2HT4C 4FABH 3GI8H 1MNUL 4M8VA 3VGAC 3INUL 2ZOLA 1LEGA 4K3JH 3UTTB 4P23C 1FZKA 3ARZA 4GMTL 3KPQB 3F7QA 5D93C 2EE9A 4TQEL 3FT2A 4LAJH 3SKNA 3G5XA 3KYNB 5JNYA 1UJ3B 5D1ZD 5J11C 5DTFA 1KPUB 1I3GL 1ADQL 5L8JB 3UTSD 1NC4B 4LVNB 2R1WB 4NKDB 4GKOA 3BPNB 4AYFA 5GXBB 1S9YA 2P5WB 4C83A 1YN6B 2IG2L 4M4RA 3H9SD 4RQQB 2JJSC 1GGBH 5E24E 2WBJA 2AV1B 1IC4L 2BOCB 1G9EA 1UA6L 4IM8A 4F7PA 2A74A 1TVDA 4U1IB 5IBTH 4PLJD 4JQIH 4OGYL 1RUKL 4M7KL 3NIDF 1ONQB 5DUBB 2AEQH 4HQQH 4OLVH 5BZDB 4JPIB 3V5KB 4LQFH 4WDIB 2DLHA 3A67H 5D2LA 3LVEA 3U7WL 4LHUG 4M6MH 4LU5H 4ZUTB 3DV4B 4PJCF 3HA0A 4MAUL 3UO1L 1UA6H 4KJWD 5TE7H 3NIGE 3PHOB 3QJHA 2V7NA 3VFUB 4GLRI 4N68A 4K8RL 3HS0A 5HGBA 4HUVA 1DQQB 2Y07L 5T1KB 4WTZG 2EYTB 3VXOB 4HX1A 1GZPB 3O3AA 1OP3H 4MAUH 4EUPH 4LSTL 4MJ2A 1R6VA 5I71C 3L1OH 2GCYA 3PNWB 2YA2A 1KSRA 2E27H 1XGUA 4XP5L 4D9RE 1D9KC 1R5WA 1Q0XH 5DJZB 4IRJD 5I1EL 4WCYL 2JB5L 3L5XL 4LASL 5D71L 1JF5A 3RGHA 4D0DB 3L3GA 3V0WL 4QXGL 3T77B 1MCSA 1FL5A 1OAQH 6FABH 1RV6X 5JW4R 3MRLB 3DMMB 2GAZB 3ZLQC 5C6WH 43C9B 2F53D 3T4AA 2HJKB 2AI0H 4ACPA 3FN0L 1ZHKB 2B7DT 1DE4B 3UPRB 3ZHKA 5AYQA 3EHBD 4GH7B 5SX5K 3P4OA 4JRXE 4PJCB 2WIIB 1KT2A 2BHYA 4O4YL 1F8TH 1CXIA 2DLTA 4I0PA 3GJFH 5BJTB 5CEZD 1ACYL 1B0WA 1CN4A 1NKOA 5F3BA 3VD7A 1OAQL 3SKMA 4OV5B 4U3CA 3D6GA 3TVMA 3DO7B 4JY5H 2P47B 3S3PA 4LLAA 2P8PB 1JZ8A 4KQ4H 4LSQH 4CMHC 2E7LA 4JFHE 5T5FH 3HAEB 4GQ9L 2GTZB 3L3IB 1QRKA 1HHHA 5GQBA 1RUAH 1YQ2A 3D39E 2EDOA 4PJ7F 3WXVH 3TH4T 3OKLA 4G9DA 4M1DH 1UH3A 3WIIL 2AXGB 4OSUL 2W1NA 4KJQD 1LHZA 1ITBB 2JJSA 3CSBA 3E0GA 2R1XA 4X4XB 1JZ7A 2VXUH 1S7QB 4OF7A 5I8OH 4GRLD 3MLPA 4ZUUA 4WY7H 3H9ZA 2YHGA 1FBIL 1QHOA 3WN5A 2MKLC 4F7PB 4HEME 4MA3A 4YNYB 5DQ9B 2IWGA 4WFGD 3WBDA 5CIPH 2PN5A 2VDLH 4X4MA 4XP5H 2ATKB 1T83C 3DMMC 4P3DB 1TDQA 3MRCA 5T3XH 2CR3A 1MLBA 4XP1H 4M62L 4L1HA 1T5WA 3DV4A 3KYAA 4OFKA 2PKDA 3P4LA 2C3VA 2GEEA 3O3BB 1DBAH 3I50H 4KI5F 3PABA 2V7NB 3ME0A 3VFUA 1WEJL 3TZVA 2NY7H 4O02L 4MMXC 4PRPA 4P5KB 1S7RB 1OB1A 1UKSA 1HH9A 2DQHL 5DRXA 2NLJB 4NN7B 2J4WH 3QG6A 3TN0C 3VXOA 1IGJB 5F1OB 1NGPH 1EUUA 3ULVC 2BVPA 1U58A 1I7TA 1Y18A 5KZCB 4D94A 4O4YH 3MBEB 2DM2A 4Z7NF 2Z93A 5L7XL 5JLZA 4NQDB 4PRPD 5EBMB 5KN5B 1IJ9A 1A6WL 4QHUA 5LBSH 3TJEH 5DJZA 1CFTA 2Y07H 4YHIA 1YECH 5FM8A 3ULUL 1MUJA 4L3CB 1NH6A 4ODHH 1MPAH 5CBAB 3NCYS 5M95B 1B4JL 4Y16A 1H3GA 4LSDA 5GGSY 4XVUC 1I4FB 1B90A 3QQ9D 1FVCB 3LOWA 4WCYH 2YWZA 2XY2A 2N56A 1XT5A 3RRQA 3HE7D 1MHPH 2HJLB 1DJSA 1T66D 2NY0B 4XAKE 1FNSH 4JGUA 4P4KA 5ITBL 4Y4FB 2VERN 1YEHL 3G08A 3BH9B 1XR9A 3HE6B 2R4RL 3KPLB 4AG4H 1BOYA 5IHUL 1WSST 4V1DA 3MNZA 3TVMB 3IDXL 3RVVC 4HH8A 3KXFD 5GPRA 5EZOL 2A6DB 5T1DH 1NBYB 5TPWL 5FO9B 5IESL 4Z7OE 1YJDH 1QOKA 4XNXH 3F58L 4Z95H 3TA3B 4XPBL 2AGJH 2PO6A 3VFWB 5FYKE 4G9DB 1RZ7H 5D7JB 4ZSOA 1F90L 1FFNA 3GMPB 5KW9L 4AT6A 1QKZL 2VZOA 3INUH 4KRPC 1BJ8A 4DGIL 3DYPA 3FCTB 3MLYH 4OLXL 7FABL 2I9TB 3GSWA 1OPGH 3TA3D 3HZYA 4QNPE 5CZXC 3B3IB 3MRGB 1HNGA 4N8CL 2NY7L 2H26B 4U1KA 4K94C 4HAFA 4ODWA 1RQ5A 3C60D 4HK3J 2M26A 4ALAH 5I1HH 2HRLA 4QYOA 1Q9KB 1RUML 4KDVA 1P84J 3RWJA 1EK3A 3D69B 5GGTH 2CJUL 5GRZA 4N8VG 1HI6B 1IC5L 2FLBT 4PB0L 3S35L 3VXMA 4WUUB 3W11C 4MDIB 4UTAL 1BD2E 4RA3A 3Q1SH 2DQDH 5DLML 3CAFA 1SBSH 4Y5YA 5DC9B 4PGBA 2AV7A 4C4KO 4WGWB 5E9DE 4PGJA 1CLYL 1QYGL 2VISB 1NLBH 1RJYA 2P1YA 4HT1L 3PHQB 3V8CA 2NNAA 3U46B 4BUGA 5DK0A 5BRZD 3DROA 3NFPA 3LQAH 3GFUA 1NBVL 3IU3B 4CADA 2BRRL 1CE1H 1NDMB 4QOKB 4LLVA 1KXQE 3B9AA 5KN5A 4UIKH 2D7MA 4JPKL 2BVOA 4AL8H 3W11D 4GT7A 3RJQB 4NN6C 2QADD 3WN5C 2AVGA 1NLBL 4KROC 4M4PA 3LMJL 3MLUL 5HHVH 1U42A 4H20L 3QUKA 1KPRB 1YMME 4PBWD 5DURB 4Y5VC 1RFDL 1VFAA 3PWJA 2ESVE 3ZKXB 1Q9OB 1I7RA 1XIWC 2LAAA 1KB5H 3PIQA 3JTTB 3RWEA 4Z0XA 4M3KB 4QRQA 4ZD3L 4DTGH 1R3KA 4FFYL 3HZVA 1NUDA 5CGTA 5ESAA 4TVPH 2AJ3B 5F7MC 2RB8A 3FB6B 1HH6A 4Y2DC 4AZ8A 1G0YR 4RQQA 1G7LA 4E41B 5DD3H 2CMRL 4NGHH 3NPSC 3HRPA 1I8MA 1BFSA 5BMFH 5CMAB 1FORL 3CFDB 1BVKA 2AABL 4P46B 5AWNH 3K1KC 1MCEA 4ZUVA 3RBSA 4MVBD 1HQRB 3ZT5A 4Y1AE 3U0WL 3V0AC 1MCCA 1BGXH 3UTZB 1MCPH 1G1CA 4KQ4L 4LSQL 1RIUL 2LE9A 4XZUB 5DXWA 1HXYA 5J9PA 5FYKU 4LLDA 3L3DB 3ISWA 4O00A 4BZ1L 1JJUA 4K3EH 3SDCC 4FP8L 1IRAY 3HNTH 2YRPA 4D9QE 5CD5D 4A6YL 4I18C 4UAOB 1LE5B 4NQCB 1CLYH 5DC4B 1M05A 25C8H 5EC1B 2D03L 2NY5C 2ADJA 4Q58C 3QUYD 1GZPA 3O3AB 4GAYB 2AQ3A 3FJTA 4P3CL 3BIKA 2G9HA 4Y4KA 3KGRA 3VWKB 3S96B 3M1BB 1Q9KA 3NA9L 1CXFA 3R1GH 3SBWC 2XICA 2ITCA 1U8LA 4OGZA 3QUYA 2ZZUT 1HCFX 2DQEH 4D0DA 1D5ZA 4ZAKB 2LTQC 2PYED 4ETYA 2PW2B 4N9OB 1JGEA 3CMGA 4P9HC 1LO2H 5KVFL 4BQ8A 1JPST 1T83A 1I1FB 2ARJB 3PDDA 2X4TA 1QO3A 4L3ED 3MV9E 1ZSDB 4ISVA 1U92B 4IHOA 3WKNA 4F37K 5IW6A 1RU9L 5HD8C 5CIPA 3FQWB 3P4OB 1U6AH 3Q1SL 4WWKA 2ARWA 5F93C 3V4UL 4P5MB 4LCYA 4XNZB 2D3VA 2K7QA 5HHXL 3GSRB 4RIRA 3WFHA 5FUCE 4QRTB 5H37G 2XZCH 5F6HI 3UMTA 3UTTD 5FYLD 5D1XB 3BPOC 1WFOA 4EBQH 5C0BE 5EH1A 3V4PH 4HQQL 5HHNA 2IANB 3WLWC 1MI5D 4KMTL 3IT8D 1HHHB 4PLJC 2FX8L 1M7DA 3HR5B 3QG7H 2FBJL 3TO4D 1YA5A 4OUOA 5HI3D 1CFNA 4MXVE 2WNGA 3UTTA 5JXAH 1UZ6F 5FA3A 3C60C 1FZKB 3MRIB 4FXLA 4M48L 5E4EC 1ZHLB 1MI5A 5DJAB 5MP6L 2CLZB 4BH7A 3MR9B 5LWYH 2W0FB 1YC7A 5L0QB 4M5YH 2DQFB 1P4BL 4CVXA 5DR5H 5F89B 3TA3C 1AH1A 4Z76B 1CG9B 3WDHA 3KYKH 1UEYA 5DQ9A 4JM2B 3VW3H 3NCEB 4IRJA 1WWAX 5ESVB 5I66A 1ZS8B 5EOCH 2PF6A 1XGRA 4I8DA 1J1OH 4JY6B 5I8KH 3QEUB 5DD3L 4OT1L 1T5WB 1RZGA 4HUMB 4I4WA 2YUXA 1T2JA 1ADQH 1A9EB 5DK2A 3ZO0A 2A9ML 3O3BA 2C3VB 5E70A 3U7AA 5C7XL 5E1AA 2WANA 1ZT1A 2VLKB 3G6AB 4W6WB 1Q8MA 2B39A 2HFTA 4OQTL 4HS8L 2ZPKL 3ZT6A 1X5LA 2KQNA 4P5TC 2D7TL 3BKCL 1DQML 3BAEH 4PJAA 4YE4H 5C8JA 4NM4H 2NLJA 4CGTA 4LARH 2AKRA 4P23B 5EC1A 4I3GA 4LFHG 4HG4J 1C5BL 3B9EA 4HS6A 4RGOL 3RVWD 5A3ID 3UYPA 2BC4A 3MRDB 1JHLH 1U58B 3VG9C 4NO3A 1HOCA 4Z7UB 2EDQA 2ZCKH 2G9HB 3MGTB 2Z93B 1M6OA 1Z0MA 1ZVYA 4WGVB 4Z78B 2EE2A 2J12B 4HXBL 4L9LB 1JPGB 1YEJL 4RISL 5GGVY 2GCYB 3PNWA 1DBJH 4YHIB 4R0LB 2ITCB 2C4FT 1QLEL 4Z77A 3UC0H 5SV4A 4JFFE 1WBYA 2YD8A 4YX2H 4K71B 1XIWD 3VRLE 2EEBA 5H8DA 1UM6H 3AAZA 2OJZH 3ZKND 4WV1C 4NRZB 2OYPA 2FIKB 4RMVA 3SGKA 1FV1B 4E42A 1J5OH 1T21B 3C5ZA 4U33A 1XIWA 2WIMA 3FQWA 2XA8H 4IEFB 5DJ0A 3GKZA 3OL2A 3SKUD 4NO2B 4P23D 5IT2L 1MCNA 3ALWA 2GI7A 2OCFD 2MCPL 3MZGB 2BMKB 5BJTA 1WT5A 4JFDA 3NABH 3V6FA 4UNTA 3QFDA 3DO7A 5I9QC 2ZP0T 1FL6B 3C60B 4OZ4B 2VDOH 3IDJA 4S1DC 4M5ZH 3KDMB 1CS6A 4X6DA 4MB3A 4G6KL 5CUSL 5CJOH 2CQVA 4BKLB 4LHUA 3HAEA 1I1AA 1T20A 3ILPB 2WQRA 3QQ3A 4JFDD 2HRPH 3ILQC 4NUGH 3OHXB 3EYVB 4K3GA 5TE7L 3FO9B 4NC0B 4HIXL 3TZVD 2E7CA 4HKJB 3MRIA 4TNVK 4R4FL 5CP7A 3T0VA 3TBSB 4IS6A 5FYLL 4PJXF 1X7QA 1ZAGA 2YUZA 3FCTA 5F89A 1V05A 2CJUH 2Y6SD 3V7AG 5FUCC 4W81A 3MJ9A 3PWPB 2YA0A 4TSAL 3SDDC 4I48A 1AO7D 1OP5K 5SWZD 2AQ2A 4IJ3C 1MJJA 3QNXB 3KS0J 4YNYA 2ITDB 5IB3A 1LP9F 1QR1B 1ES0B 3OXRA 1R5VB 3GHBH 4MNGE 4GKSB 4QYOB 5JR1H 1I3GH 3I3EA 1IT9L 3LQZB 2YKLH 3TWCH 3BEVB 1KLFA 5H94B 3JWNC 2BVYA 5TFSH 1AO7A 5A2IH 1PLGL 3EFFB 4LVNC 5SWZA 2J88H 4KK5C 2D7OA 3GMMB 4PJAE 4MDIA 3E3QC 2UZYB 3SE8H 3P77A 2JK5B 2ID5A 3GO1L 4FFVD 2DLIA 2DQCL 2NXYB 2ED8A 4LEOA 1J86A 2A9MH 5C0GA 5C7XH 3SDCB 5IK3A 4CDHA 3MRJB 4ENED 3P4NA 1N4XH 5A1AA 5DK0B 1BFTA 1QFHA 3DROB 1HNFA 1YNLH 2A2QT 3KAAA 4NO3B 4G8GB 1EDQA 1NDMA 3WJLA 1XEDA 2DI9A 5F96L 4IRSA 1KJMA 2X1PA 3IDXH 1I7TB 5K9OA 1I1RA 3V6ZB 5BV7L 5IEHA 5IG7A 3LS4L 5E99L 3M17B 5TDNA 1NC2B 4KKLC 1ZK9A 3QT2A 1EEUA 3DARA 3V4PL 3FOMB 4KK6D 3L5JA 1S9VA 4TQEH 5I16A 3QQ9C 5D7IE 4EN3A 3GJFB 3NA9H 3EYFB 4P2RE 4NO0D 1DBKL 5DDHA 2BSTA 3NIDE 2DBJA 1FV1A 5JXAL 5L6YH 1IAII 1L7IL 2DQHH 5GZND 3ZDYE 1FVCA 1X5FA 4NNXA 1GPOH 1HK6A 1JWSB 1LQSR 5EORH 1AR1D 1WZLA 5HDBF 3PQYD 4EN3D 3JWOL 4JFOA 4Y5VB 4X7TA 4A6YH 3MLTA 1OPGL 4NRYB 4HKBA 5GS0C 3QO1A 3EO1A 5JHDB 4XPFH 5EN2B 3VI4F 2Y36L 2F5AH 4JM4H 4O5LH 4CVWA 3WDJA 3C60A 1A7QH 4KV5F 4OZGF 3GUTB 1HQRA 2B4CH 1N26A 1BF8A 1BQLL 1QFUL 3OKMA 3VFSB 5EO9B 3OAYH 4X7SH 4G7YL 4JGJA 3TBTA 4WU5A 4H26B 1IKNA 3HB3C 1ETZB 2XYCA 2W9DL 1R24B 4XCYA 5IVXF 3U7YL 1NBZA 4X5LA 3EJYC 2VO5A 3HNSH 1VFBA 1Q0YL 5HHME 3BUYA 3C5ZC 1RMFL 4UOW0 3VXTB 2J8UE 5JOPD 1BZQK 1JNHA 2Y7QB 1JNLH 2R2HB 3MUGA 4NZRL 2Q7YA 3PXHA 5DK3A 5GRUH 3OKEB 4R7NA 4JFDE 3GHEL 4GBXC 3UTSB 4R4FH 3T04D 3VXRD 4WI7A 2H32H 3KPPB 4FXGB 2R69L 3JV4B 4PJFA 1ES0A 3O2DA 4GRLC 4HWEL 5C08D 1OF2A 3AXLB 1EJOH 3MYZA 3PWUA 1T7XA 4FFWC 4KKCD 5D6CA 3RGVC 3NCFB 3LQZA 3FN3A 3TH2T 5D7KE 3H6JA 4C56D 1OARL 3FRUA 1RJLA 2HG5A 1FNEA 2GJ6E 5BO1H 3IDNB 1M71A 1EEYA 3QDGD 5SWZB 3CFJA 3O8XB 4GQPH 1CL7H 1PG7X 1FVDA 2APVA 1E4WH 1IC7H 3H9HB 3EUUA 1HI6A 1GIGH 2DI7A 3OQ3B 1BM3H 2VXTL 3O6MH 5DJDB 2E7BA 1XCQA 4R3SB 2NY5H 1IAMA 1GGTA 1I3UA 2WW8A 3SDCA 3SQOL 1ZGLM 2D0HA 4OLUH 4CVUA 1G7QA 2CXKA 1TNMA 3LD8C 3O8XC 1UKTA 1KJMB 4LCYB 4FZ8H 1A3RH 2NY1C 4PG2C 1GC1L 1XF5B 3DVGB 1ZTXL 4FOMA 1FAIL 2R29L 4CW1B 2B1AL 2FGWH 5IKCB 4RMWA 4JN1H 1HINL 5LQBH 1OTSC 4OLZL 4FN0A 1QBAA 4E0RB 1J8HA 4OSUH 5JOEA 4PTUB 5FO8A 1DBJL 1FSKB 1J0ZA 4OF0A 4Z7UE 2Q86A 4OD2B 1A7NH 4OCYH 1OT2A 2OBGA 3MLXH 2D0GA 1HQ4B 4GS7C 4HDIA 3GKWH 4APQB 1FYTD 4JJ5B 2B1AH 1F11B 2FGWL 1OAZL 1Q9OA 3FHQA 3VG0L 2JB5H 4ZG1A 3C2AL 5IGXH 2WBKA 4F7CA 3DV6A 4Z0XB 2JJVA 4R4ND 4HBQA 2W0FA 3V0WH 4KI5E 3ORJA 4CVXB 4JZOB 3EO1B 3QEHB 1ZKAA 2WV3A 3EOTL 2XWBB 4HGKC 5ABDE 5E9DD 4JM2A 3EO9L 1KENH 2APBA 5JOFA 1IGCL 1LP9E 3CH1A 4Y5XB 3EBAA 1T1ZB 4M6NH 1T03H 1OWRM 5E5MA 4C56E 2YPLE 1MFDL 4NM8H 3DX6A 1ETZA 3U0PB 4UT9L 3T0AA 1KXVC 2PNDA 4WW2C 1F3DH 1ZT1B 5F9WB 5J9PB 4F58L 1H15A 5SWSB 2K3TA 4URTB 1TQCB 2NW2A 3PP4H 2I07A 4F3FB 4AIXA 1JNNL 5IVXE 3FQTA 2IAMC 3VFGH 3ZDZE 4WWKD 1NMAL 4WUKL 5EUOB 4Z7WA 5C2BL 3KPNA 3FB8A 4LCCA 3VFTA 5D2NC 3KPPA 1M05B 4UTBH 5DR5L 2I25N 2DJUA 3LCYA 1T04B 3RX5A 5EA0H 1VPOH 5TDOB 3C6LC 4L9LA 5E99H 4JB9L 5CZKA 1CVSC 3PGFL 3WL9A 2ENYA 4YWGH 5AZEL 3BP5B 3OGOE 4FQPA 4U2YA 4K8RH 5MEND 3G5VB 5I0ZA 2Q1EA 1RK0B 3OPZH 3QO0A 4GMSH 3ECBA 1A4JB 4M9PA 2O5ZH 3K1DA 2WZPD 1KELL 1NGZB 1MREH 4PGZA 3TO4A 5TDPA 2XRAH 3U30B 5I1GL 2P7TB 4A2MA 5MENA 1T21A 3ARYA 4NDMB 2ZUQC 2E27L 4ZFOA 1I1FA 3VJ6A 4ZNEE 4FABL 1AI1H 2OI9C 5MP6H 3AREC 4Y8AA 3VFPA 4WFFD 4L29B 1OTTD 1CICD 2ED9A 4QHLB 1MAKA 2E6PA 3ZHDA 3WYRA 3E6HA 4EI5B 1F2XK 3X3GL 3IFOB 2V2XA 1AP2A 4IIQC 2VDPH 3T1FB 4DWHA 5JW4M 1G7PB 3QIUC 3IDJB 1S9XA 2KZWA 5SV3A 1KCSH 2QHLA 4PJEB 1QLFB 1OOAA 3HI6H 5FIEA 4PBVC 4BKLA 1QSEA 2N1KA 3TT1L 1NFIA 3RWDB 4DGIH 3DHJA 1OP3K 3GMOA 4JLRB 1LEGB 4GXVL 4R2GC 4S11A 3E6FB 2HWZH 1MCLA 4KWUA 5IBTL 2Z9TA 2J88L 1Z6JT 1AXIB 4IIQA 5ICYA 4KK9D 4WUUE 1EMTL 2E3VA 3VI3E 5KG9B 2R2BA 4PLKC 5CJQH 3WE6B 2R1WA 3MR9A 4XWOD 1O0VA 3QJFB 5I73C 4C83B 4WJ5A 3WXWH 2WBJB 1RUQL 3HE6D 5K59F 4M1DL 2HYMA 4MJID 3NTCH 3OXRB 1ND0A 5JA8B 4OZIB 3H8NA 1YEHH 3MODH 4YUEL 4JQVC 4WDIA 3AS3A 3QDME 4N5EC 4U31A 5A43C 3G04A 4G8FA 3IYLW 1JTPA 5E8PB 2HFEA 4WY7L 4AM0A 2ADGA 4MLIA 5IF0B 3NPZB 4BK5A 1BZ9A 3FQXA 3PHOA 4GOSA 2GFBA 5CFHA 3C5ZD 3O11B 4RWHA 3MA7A 5SWQB 5BCAA 1OAKL 3BGFB 5LXGL 4MMZC 3T0BA 2VIRA 5DA4A 3CFCH 2NX5D 4JR9H 4AL8L 1UM4L 4P23A 4YHMH 1SY6A 3VXPB 5C0EA 4M62H 1IE5A 1X5AA 4HS6B 4BA8A 4GG8B 3HZMA 4OBRA 3IVKA 5K9OB 2FBOJ 1AGEB 1ZTXH 4OBSA 3UTPD 5HXMA 1FZMA 1IBGL 5CSBA 3DX8B 4FG6D 4OFYA 2ICWA 4LCUB 1X4ZA 2H32B 5TH2B 2VH5L 4X99A 5ESQA 2IC2A 4R0LA 4F37F 3V5HA 2PTUA 3KPSA 1DUZA 3GJFA 3S35X 4U1NA 1LO0H 2P7TA 1NEZG 1SJEA 4NQXB 4XXDB 3DMMA 3W5MA 4YDVB 4X8XA 4NDMA 1YDPA 2AAVA 2JJTC 4HWBL 1IC7L 2Z35A 4HCRL 5C09D 1S7TA 3MXVH 4X7TB 3SGDH 5FHBL 4ONOA 4NQVB 1CGSH 1WC7A 1P2CB 2HWZL 3GDBA 1QFWM 5EN2A 5GJTH 4Y0GA 1B6DA 4KAQH 3T1FA 4JQVA 3ARVA 4FZ8L 3V4VL 5C09A 5DQDH 1IAKA 3VXSD 3I9GL 2GTWA 4RAUB 3CD4A 5D93B 5FCSH 4KZDH 3KG5A 5H35B 4YFLI 1OGAB 1DVFC 1FFQA 4U1GB 2V17H 2ADIB 3QP3A 3E6FA 1G9MH 5IFHL 5MEOB 1F13A 4JO2L 3RGVB 4J12A 1U93B 5F9JA 5INDB 4PGDA 5BV7C 3TBSA 3AUVA 1S7XB 1SYSB 3D18A 3O4OC 4JFQA 1RIHL 1XGPA 3QQ4B 3RWFB 4NFCA 1NJ9A 3KJ6L 3AB0C 1JHKH 5D96C 3L3HB 1KEML 1AGCB 1LP9B 4AEHL 3RNQA 1H5BB 1G6RL 3B6SA 2D4DA 3MRCB 4Y19D 1N3NA 1PW3A 3BO8B 4N0CC 2P49B 4QRPB 4MXWH 5C9JB 4NO0A 1W8OA 3SO5A 4YR6B 2V5YA 2Y4SA 3GSNH 1B4JH 2FWOB 3EFDH 5IB5B 2ZCLH 1S7RA 2JK5A 5JW3L 2D4FA 4XP1L 3LV3A 3ZKSD 3HZMB 1P69B 2ZUSA 4JZNA 3LEYL 5F7DB 1RJCA 4MCZA 3UTQB 4BFGA 1CWVA 5D2NA 3QISA 1IC1A 2A1WL 3N06B 3OB0K 1T5XA 1X3DA 4OUUB 4IRSB 3OAUL 5IROA 1KN4H 1FLTX 2PCPB 3OF6D 4NQSB 4OD1L 4X7EC 5DVKA 5CEYA 4PRPE 3KPSB 3HAEG 1WWWX 5TPWH 5FO8B 3AB0B 1PKQE 1JIBA 1SJEB 1X6NA 4NQXA 5JUEL 1AD0A 3VXSE 1U91A 1OW0A 3CC5B 2AJXL 4PJGE 2FLRT 5JO5A 2BXZA 4Z7WE 4U4BA 1R3IH 2DM4A 2XTLA 4WI9A 5IMMB 4PY7A 2VWEE 1R0AL 2Q20A 1JK8B 2X89A 1UJ3A 5DSCA 4KZEL 3DPBA 2KZ1B 12E8H 1KPUA 1YEEL 3V0VA 1GJIA 1PEZA 1RIHH 4NKDA 4ONGL 4LEXL 3MLTB 1JV5B 2XNAA 1XH3B 2QL1A 5JHDA 3QAZC 5GRJL 3CH1B 2IFFL 2GTWB 3NTCL 1IVLA 2I26N 3DI2B 4C56A 3BDYL 1I9IH 1RZJC 5IROC 5D7LE 4JPIA 3OKMB 4OGXL 2NTSP 3TV3L 4EEEA 2WSKA 4WI2A 4Z9KB 3IRZA 1P7QA 4G8GD 3HZKB 3UJIL 2HT3C 3QXVA 2WQ8A 4K3JL 4R96B 4RNRA 3SDCD 1PD6A 2RQ8A 3GIVB 3SJVD 1NCWL 1SYSA 2IMNA 4ZOAA 3ZL4L 3SHSA 2DQIL 2YD1A 1FLRL 2ZUTA 1UKQA 3GMLA 3RWFA 3CVHA 1JNHB 2Y7QA 5CJOL 5IEKB 5K9JH 2YK1L 3TFKD 4QTIL 4XPGL 4LCWA 4KK5D 2Q7YB 5T1KA 5T3XD 4NJ9H 3OKEA 1JTTA 3L1OL 4R7NB 4X4ZA 1UT9A 4FTVD 4U1KB 2QJDA 4UILH 4FXGA 4UT6H 1TQBC 3C87A 5F7EL 1XGUB 4UIKL 3OSKA 1L9MA 1LK3L 4QRUA 1Z2KA 5FKPB 2VYRE 1OD9A 4YDKH 2V5RA 5T1KD 2XIDA 2HG5B 2VR5A 3LQAC 4WUUA 5KS9A 3CFJB 3O8XA 5IB4A 3WJJA 3ARGC 1FYTA 2DD8H 1F02I 3TP4A 3ZSSA 43C9A 2X9XA 3VG0H 5DMIH 4XPHL 4XCEB 3F6IA 1E27B 2GJ6D 2VISA 3BN9D 2CLVA 3PHQA 1U8NA 4X83A 4L29A 4PY8J 2VTFA 4OCRH 1QSEE 5E2TL 1KBGH 3S97C 3HCVB 1M1SA 4PJ9B 4QHLA 5IM7B 1E6OH 1QLEH 4JDZB 4HS8H 2CRIA 3KR3L 4G6JH 3CFCL 1A14H 1V7NL 3E6HB 1A0QL 2DIJA 4S1SL 1UXSB 2COQA 1RULL 3QCVH 4AJ0A 4CN4A 4F9PC 1VEPA 2V2XB 3A6OA 1PGRB 2Z8WC 2Z8SA 4YWGL 1L6ZA 2KBGA 3EO0B 1S9XB 1T89C 4X7SL 1INDL 5IKCA 4AEFA 4QHNB 3TBWA 3R4DA 5EWIL 1AD0B 3VGGA 1U2HA 1BD2B 2VQ1B 3RWDA 1NCDL 4F2MA 4S1QH 3VXUB 3ARBA 5MERA 4W4OC 2X4UB 5FGRA 3E1F1 1OSPL 1I7RB 4QXWA 4FQXA 1U9KA 1VACA 3F65A 1A7OL 1KJ3L 1B0GB 4WO4A 1EA9C 5FECA 5KG9A 2PYFA 2R2BB 1IARB 1IGIL 4W4OA 1D5BA 2VL5A 3JVGA 3K46A 1YNKH 3AMLA 3FAWA 5DRWA 5DJ8B 2BVUA 1N2RA 4ZMAT 3NACH 4WO4D 1MY7A 1U8JB 4PUBL 5E8DH 5GS3A 3BKYL 1CLOL 3U7WH 2VDML 2WAHA 4ZTPL 5C0IB 2YD7A 3O4LE 5HBBA 3MLRL 4OAWA 1WT5C 3UO1H 4EI5C 4G43A 4MAYC 2V2TA 1C08B 2EIBA 4KQ3L 4AM0B 4HC1A 4TOYL 5DRZA 1BWMA 4N0UA 3V6OC 2IPTH 4AMKL 5KJRH 3MRHA 3ZTJH 2OJEB 2DBLH 1XF3B 2WP3O 3F58H 3WNPA 3TZVB 4XX1G 1KLGB 3IKCB 4PR5A 3SCMC 3U9UB 2E6QA 2DKMA 2SEBB 4ENEC 1CGYA 2MPAL 2UWEE 3DUUA 4ZYKA 3QIBA 2R0WH 3C9NB 4L5FL 3EDKA 3F62A 5AG9A 3FQTB 4LRNH 4GG8A 1NUNB 2BVPB 5HDQH 3KS0H 2EDBA 3PWPD 5J0BA 5C6TH 1MRCL 4RMSA 1NMBL 4R4NC 5JLZB 4X6FB 5GZNC 2XFXB 3QIBD 3TNNA 5KVEH 5KS9F 3L95A 5F44A 5D6DC 3IFNH 2DQTL 1U8LB 1YY9C 1FIGL 2ZJSL 1AIFA 3MBXH 4KHXH 5CBAA 3BWUC 4K94L 4KUCD 4KAQL 3MREA 1G7MB 1K8IA 4NHUA 3SY0B 1OAZH 1VADA 1G7IB 3HMWL 3SGEI 4M8QA 4NQCE 4XC1H 1IKFH 2OTWB 2Y6SC 3QCUL 5J7CC 2I5YL 3QUXA 2BNQA 4MWFA 1X9QA 4X4YB 5IHUH 5M94B 1GSMA 4GBXB 4WWKB 3K8KA 3OG4B 4KKAC 1XR9B 3HE6A 2H9GB 3GSRA 1IGCH 4GQ9H 1NCNA 2DDQL 2OP4H 4MJIA 5FF6B 4FZEH 3SKMB 4Z7NE 2BNQD 4NQEE 4NN5C 4U1MA 3MJ8B 1GXEA 1RU9H 2P5WE 3EYQD 4JG1L 1KOAA 4PJAF 4S1DD 3ULVD 2P8PA 5HVFB 5I30L 3N1MC 5E6IA 1H0DA 2X4QA 5KSUA 4AQ1B 5FB8A 3FQRB 3W9DB 1QSEB 3RUGB 1FNAA 1TETH 2CIIB 3ARXA 4M93B 4C57C 4BYHA 3P0GB 1SMAA 1B0GA 3JVGC 4WO4B 4LVHC 4IRZL 5INDA 1Q9WA 3HR6A 1WCBA 4F7MA 3LS5L 4LSUH 2V2WA 4NWTL 2PYFB 7CGTA 4P0DA 1RHFA 1D5BB 2VL5B 3D18B 1MCJA 1IGML 2ICES 4UBDC 5F71A 1S7QA 2OR8A 1WAAA 5K9KB 1I1AC 4N9GA 5ADOL 3HUJB 3DRTA 4B7IA 4JO1L 4K23H 5I8EB 4KVCL 2BHUA 4JO4H 5ESVA 2VLRE 4M6OL 3QWRD 4J3XA 3TZVC 1XGRB 1DBAL 3QDJE 3KPSD 4I2XB 4M03A 2FSEA 4POZC 1EXUB 1A9EA 5DK2B 1FSKC 5JQ6H 3KYOB 3ZKMC 2XQYG 5JHLL 2IQ9L 3PWVA 2NY3C 4YZFF 4ORZC 3R8QA 1I9RL 4PJAB 3RVWC 2YUVA 3QIBB 3X3FH 1TPXC 1GC1H 1QSFE 2OSLB 3GRWH 3UP1A 2QHRH 2VIRB 1TXKA 5JOPE 2LVEA 3A6BL 3TO2B 1HOCB 4I0CC 2FX7L 5DT1H 4Z78A 3HKFA 4MA7H 2NZIA 4NM4L 5ENWB 1W0WB 1N6UA 5EIIA 1IGTB 1AIFB 4KJYA 2CDFB 4TUJA 4GKNB 3RVVD 4LCUA 1AJ7H 1I85A 3DTXA 3CJJA 3QHZH 1WTGT 2MCPH 4I3SH 5L8KB 3V5HB 5I30H 3N50A 1MFBH 4L8BA 3L9RB 3PWNB 3SY0A 1AR2A 3VXQA 3QUKB 2FIKA 1VPOL 1T66C 2R2EA 1OD7A 5F7FA 2CRMA 2EIDA 3X11A 2NR6C 2D7NA 2IGFH 1T6VN 3ROOA 3C5ZB 1NFDA 1QZ1A 3STLB 1JF6A 2R1YB 3QWOB 1BQLH 3VH8B 1T2XA 4D9LH 5HYQA 1R3LB 1E4XI 4XPTL 4HGWA 4WW2B 1U8HB 2FEEL 1U3JA 3TO4C 3PHSA 3QCUH 4E41A 3WUZA 3O6KL 4HFUL 2AGJL 4U1MB 3GI9L 3HNSL 3OV6A 5F7YC 4IOIA 4KDWA 1BVKB 4C56B 3F8UB 1FGNH 3MRQA 3S34H 1TZHA 1NBYA 2G60H 2HA1A 2XN9D 1MHCB 3HI1B 2P45B 1GGIH 3KLDA 1OGAA 5FUZL 3LKQB 3RUGA 4M61A 3OX8B 3EOAA 4L3AA 4NKIL 4Y8DC 4Q9CA 3S35H 5LAXA 2IF7A 2R4RH 1LK2A 1A8JH 2QTEA 3BOVA 3GMPA 4G8EA 2VZTA 5GS0L 1EFXA 1DEEA 2NY3D 2LU4A 4N1CA 3CVHB 1AGDA 1S7XA 3RKPA 1AKJB 2J8UB 4QCIA 2CRYA 1MWAL 2WWMD 3WO4C 2VNCA 5F97E 3N85L 2XI9A 4YBLB 2E9JA 3VRJB 3UJJH 5SX4I 2AJVH 2YUWA 2Z4QA 3NCCB 4TRPL 1HEZB 1S7WA 3D3VD 1U41A 4AK1A 4JAMB 2L4OA 5IWLA 1FE8H 4LAQL 5FKAA 4WI3A 1S3KL 3LHPH 4Y4KB 3VWKA 5DO2C 1L0QA 2P8MA 1WV7T 1KBGL 1YN7A 1CI5A 1J88A 4MSWB 4YHYC 5H94A 4NQDE 3BO8A 1GGUA 1NEZA 1LDSA 5GS2H 1KENL 2BVQB 1ZLVH 3PDGA 4JO1H 4YHZL 3VH8G 3QBTB 4J3TA 1Y0LB 4OCMC 3GHBL 4M7LL 2H2PC 1NCUA 3T0EC 4XCEA 4OI8A 2VLJA 1WBZB 2DM3A 1ZSDA 1U8NB 2ZWLT 4XNYL 4Y4HA 5HPOA 4JO3H 3CNKA 2VN7A 1OQOA 3G9AB 3ROLA 5F7DA 5ICXA 3EYQC 5C0AE 3DUSA 5MEPB 4NPYA 3T4YA 4D0CB 4TNWK 3IU3A 1ZANL 1GIGL 5EIIB 4JGMA 2VLJD 3RI5F 2F9BT 1TPXB 4OCWH 2BDNH 4KJYB 2CDFA 4TUJB 2XXCB 5C0CE 1BBDL 2ZCKL 1RUPH 3GSOB 1A64A 1C12B 1FNLA 4M1GL 4XGZB 3L9RA 3QXAA 1N59B 3ELAT 2PYEB 3FT3A 2P5EE 3MV8E 3B43A 4NFDA 3ARBB 5MERB 2R2EB 1U91B 4OZFA 5E8DL 3KYMB 4LP4A 3SJVA 4H88L 1P53A 4GW4A 4PJ8D 3RNKA 2BCKB 2Z0BA 1CE6B 3KPRD 2FH8A 3MV7B 2R1YA 3QWOA 2OJZL 1ZHLA 4OQTH 3BZFB 1F6AA 4NGHL 1TJGH 5J89A 5DHYB 2VDNH 4OCRL 5CKAA 2R15A 4PBXA 5E8OB 4EXKA 3HZVB 4FTVA 3K4DA 3BMVA 4PJ5B 3VFRA 3LKSB 1KCRL 3CK0L 1XH3A 4IOIB 5KVMC 1G7LB 1F2QA 1TVHB 1VEOA 2P44B 1F3RB 1D6EA 3IFLH 4KI1A 5I74B 1B4RA 3H0TB 4P46A 2C7UB 3QDJD 3QXUA 4F8TA 4LLQA 4FMKA 1R24A 4XCYB 2NZ9C 3CFBB 4HLJA 4HC1H 3C8KB 4WTXA 3N9GH 3WIFB 3G6AA 4YX2L 1DQMH 3BAEL 4K3DL 3L3DA 3BUYB 1EFXB 5D7KD 1YYML 2FYYA 2YR3A 5D2LF 4S1RL 4P46D 4ESKA 4OCSL 4KJWC 3P9LB 4I0KA 3DUUB 3FZUC 2J8UA 4QCIB 1CXHA 2AJZB 1I8KA 3P0VL 2FX7H 5FYLH 3SE3C 2M1KA 1FO0L 3K2MC 3VDAA 3JWDC 4YAQA 1CIDA 1A2YA 2VABB 3MFFA 5DZNA 3RIAK 5IHZA 3FOLA 1YN7B 3MPCA 4HGMA 4MSWA 4FZEL 1EFQA 3S96A 5FKPA 3SDYL 5I0DA 5FGBC 5TQ2H 2FZ3B 4TNVF 2G5BB 4ZQKA 4XNZC 5I75C 4OLWH 5F1IB 3VFNA 1K8IB 4NHUB 5KSBB 3RVUC 5EZIH 3ULUF 3NOIA 1Q1JL 1EUTA 4R0LC 4N8VA 4L8SA 4XXCC 5DQJA 2VDPL 5EO1A 3I6LE 4MJ6B 3QUXB 1WFTA 2AK1H 1IGIH 4X4YA 3DRQA 2VE6A 2FECI 4MXWL 2YRZA 3E8UH 3ULUD 4LLUA 1RD6A 5DUPH 3H7BB 1F4AA 3VWJC 3ZE1E 2HT4D 1NAKL 1B2WH 3V6FB 2ZUUA 4RIRB 5FDYA 1CFVL 4P5TB 3QUXC 5HSFA 4PJGA 3QXAB 2X4QB 3I75B 3U4EB 1GL4B 4P2QA 1I1AB 1T20B 4PJDF 3VDCA 5HHNB 1Q94A 1AE6L 2X4UA 1KN4L 5AYUH 2ADFH 5FYKD 2A73B 3BZFA 3S5LG 4IS6B 4G6AD 1MH5A 2R0LL 4L4TD 5I71B 4LBEA 5C0CB 1N5AB 3GJEA 3IFPB 3BYYA 3THMH 4KK8D 1YEGL 4XHJC 4U3HA 1K4CB 2APWA 3WNLA 3PWPA 3W2DL 3TBYB 5M7QA 3SBWA 5DRWB 1T0NB 2AV1A 4PPTA 4KTYA 4XPBH 1MHPL 4Z76A 1D6EB 1CG9A 3NBNA 3GZKA 1MFEL 5L8LB 4OCLC 4ZO8A 3D5OF 4LNVA 5C0IA 1JN6A 5FYJE 3DX9B 4I2XA 4HUUA 4J23A 4OAWB 5J6GA 4MQSB 4HXAH 2GJZA 4PJBF 5CGYD 2FD6H 4K8RC 1B88A 5D1QD 1RK1A 3IJSA 4LIQH 2CXGA 1RZGB 4I4WB 3UJTL 5SWSA 2NXZB 3QPQC 4N0UB 1T03L 1RURL 2ICEB 5TE4H 2F8OA 2V9QA 3C6SB 3U9UA 3WIHL 1DTUA 1FFOB 1VESA 3P4NB 4HFWA 4HCRA 4YEEA 5D1QA 4XWGH 1IAIM 3HLAB 4Y2DD 4LLWB 2EYTA 2OXHA 3I2CL 2YD2A 2FEDD 2AEIT 3MOBL 4ODBD 1W0WA 3NZ8A 1MCOH 2KL6A 4QGYA 3F7RA 3NH7L 3FO1A 4PP1C 3TNNB 5H2BB 3P11H 1U8MA 4X6BB 2VDKH 5F88B 2G5BA 4Y1AD 1A1MB 4JR9L 1S9VB 5I16B 1EBAA 2D0FA 5KSBA 3PWNA 3ULUE 3RA7L 3VXQB 1C5CH 3CPLA 2P46B 3VMOA 5EFIB 4L8SB 5DQJB 5J11B 1G7MA 1OARH 1S78C 3X11B 4R90H 4MJ6A 4ZFOB 1UM5H 4MA8L 1NFDB 3DRQB 5IGXL 1RHHA 4UQ3B 4X9HA 5EU3B 1DE4A 1WAAE 4E42B 5KSAA 3VH8A 4ZOCA 1ZLVK 2BNQB 2EDFA 1DDHA 4ZFGH 5I75B 2MNUA 3K0WA 4ODSH 1Z3GL 3S36L 3VWJD 4CJ1A 4MQ7B 2E8YA 2X9YA 3AY4C 3O6FC 3QWQB 4G7VL 5KVFH 2R56H 1JI2A 1LMKA 5KOMC 5HD8D 2RJMA 3FN0H 4PJEA 3T2QA 3VWJA 1CFQB 5EO9A 4HWZA 2IQAA 1JP5A 3LKQA 3O6FA 4QRSB 3KDMA 2ZUWA 3TIEA 1T4KB 2G75B 1Z3GH 4WU5B 3EOAB 5GS1A 1CGTA 3ARDB 4PJXE 1F45A 1QNZL 1QBML 1NBZB 2NX5E 5CLWA 3QQ3B 3N1PC 5CWSA 5ALCL 4Y5YC 2VXVH 4LPCA 3LY6A 3FO9A 5F7NC 1MVFA 3EW3B 2E7LC 2X2YA 3DECA 2OP4L 1RVFH 2EICA 1OLZA 1G6VK 4LPVA 1N5YH 3EYSL 1EZVY 1K4CA 1VGEL 4M7JL 4UT6L 3FONB 4XB7A 4PJ9C 3S5LA 4I0PC 4DZBB 1KPVA 2E6JA 4K07A 3D39A 4UV7L 4M3JA 2B2XL 3IRPX 5IIEB 5K9KA 4LCWE 2QQLL 4HUUB 4XWGL 4IOSD 1SEBB 2J5LB 5DD5H 4OZIF 3RKDD 3CUPA 1NCWH 1ZEAL 2HFEB 3IJSB 5FYJL 5D71H 2ADGB 3ABZA 3BEVA 1FPTL 3H3KA 5D1QC 3SGJA 3ARFD 3EFFA 4OLUL 4OLVL 4Z7VA 5DJDA 4LHQB 3ZTNL 2XG5A 4PTTA 3D85B 1UB6B 1F90H 4QHMB 4ZSOE 2AI0L 1UWXK 1K3IA 1AKJD 2EC8A 4LSVH 3NIGF 8FABA 4K9EH 4P9HH 4LDEB 5IK3B 5HVWA 5ICXB 1OAUL 4KI5C 1JTOA 2BRQA 1R3HB 1TJIL 3MBEA 2OMBA 1W72L 1HHKA 4EOWH 2CDEA 3SO3C 4HWEH 5F88A 1U8PB 3P73A 1IMHC 5AD0B 4LARL 5C0FB 4XGZA 1EO7A 5ITBH 1JL8A 2EECA 4H8WH 3MBED 1H3UA 4X8JB 2C3WA 4L8BB 5EU6D 3UCRA 5KBNC 2DM7A 1XF2A 2C1PB 1YDPB 1CXEA 1U6AL 1J11A 4QRRA 2BSTB 2DKUA 2J5LC 5IESH 1KELH 1PX4A 2CSPA 4QF1B 4YHLH 1CDJA 3ROOB 3TBVB 4F7CB 4OD1H 4NNXB 2J6EA 4LF3A 2BNRB 3DBXB 1J1XH 5CP3H 3KNBA 4PLOB 5D7JC 3S7GA 3G08B 5EBWA 4W70A 4ERSL 3UAJD 2PTTB 1U8HA 5D2NE 2XWBA 3BP4B 4GSDL 4L3EE 2AEQL 3O3UN 2DKSA 1HDMA 5LVEA 3NAAH 3MACL 3PGDA 5F9OH 3K81A 3VXSB 3GUTA 3MRQB 4LLQB 1MCFA 1F00I 2NY3B 3HI1A 4U7KA 2BNRD 5D7JA 4M61B 4WTZA 1YNKL 2DMCA 2QQLH 1YEFL 1U93A 5F9JB 1QBLH 5T1DL 5A40E 3MLXL 5IP4A 4YGVA 4P2RB 4XRCB 4G8EB 2W60B 3DHMA 2C5DC 4Y4HD 4Q0XH 4NBXB 1DEEB 4JFQB 2VXSH 4XPTH 3ZKXC 1AGFA 4Y4FD 2X1WL 4DZBA 2DQGH 4UBDD 4OGAC 3IU4L 1Y6KR 1YEGH 2VRAA 1R3JA 4JFED 5HYSB 2J6EL 3V6OE 4NKIH 3MFFB 3GSQB 3WL9B 1HEZA 1S7WB 1U8IA 3MUHL 2LAGB 5T1MA 2OK0H 3MOAH 4JDTH 5EOTB 4U49A 1IGMH 2A9NH 4TSBL 2DLEA 2W9LA 4P59L 4YFDB 1T22B 1OM3L 2OL3H 3IDMA 4PLKD 1NEZB 1FNEB 1E6OL 1UJTA 1YMMB 1T0PB 2D03H 2EZ0C 2XKUA 3GRWA 3HTLX 3S4SG 4G80A 2FWOA 5E2UL 3T3PE 3VGDA 5DURD 5T3XL 2VR9A 4GXUN 2DIBA 3IAPA 2Q7NA 2BVTA 2VXQL 1HSAB 4CU6A 5EO1B 1E28B 4S1RH 5J57B 3VJ6B 4MJ4A 2OTUA 3ZZ1A 8FABB 4R3SA 3C6LB 3KPRB 2DAVA 2VE6B 5GHWH 4JFFD 2NNAB 5C09E 5I18L 1UYWL 2VQTA 3ZDZF 1BPVA 2OLDA 3QUZD 1CBVL 3QQNA 4F57L 3ARTA 1TITA 4OUUA 5GJTL 2IAMB 1TIUA 3OJMB 3E2HC 1GGCL 5BS0B 5JW5A 3EAKA 1A4KA 1U8PA 1XF5A 3MGAA 3RDTD 2ERJB 3RWIB 3O2WH 1MVUA 5C0FA 1SEQH 1A7NL 2MHAB 2WINA 4U3XA 3V7MA 1J05A 3QI9C 4XP6L 1FO0B 4WV1B 2F54D 5IBLC 4TVSa 3C8HA 4NM8L 5GSVA 3STBA 3IGAB 1C12A 5ISZA 2I5YH 1Q94B 1J8HB 5K9QI 2GJ6B 3HFML 3QIBC 3PGCB 1I1YA 4GW4B 1RZKC 4HUNB 1IFHL 5CJQL 3RWEB 4JPVH 1HQ4A 2BCKA 4HDIB 3V0VB 3T2NL 4Y7MA 1J10A 1BBDH 1EPFA 1F6AB 4NZDA 5DRNA 3CH8A 2R4SL 4J3UA 3V6OA 1KTRL 4D8PB 3QJFA 3I3DA 2DN7A 5BRZE 1I8MB 2O5XH 3DVNB 1UJ3C 2EDDA 4J4PD 2MTPA 2XPGB 3H2WA 3ULSA 4BQCA 1TVHA 3QNZA 2DI8A 1E6JL 4DW2L 1WZ1L 1G9NL 1T1ZA 4NBYB 3RPKA 3QDMD 3T0ED 2AS5M 4L5FH 3JWOH 3UTZA 5E8PA 3ESVF 4LVEA 4M43H 4GG6E 3O3DA 2YBRB 2BOBB 4LASH 2W91A 5I6XB 4HUXA 2NY0C 1CDUA 3IF1B 4LPUA 4JDTL 2W60A 5E6ZA 1H15B 1QBMH 5HGAB 2MJWA 4RDQG 2Z8VC 4LDOB 1IQWL 3QDMA 5DUML 3VGHA 1AGFB 4S2SA 1FFOA 1FZOB 3S3JA 3QSKB 5BOPA 5FCUH 4G3YH 5KSBE 3LEYH 4F9PA 5HHOA 2DF3A 4ZFOL 4YO0A 2YD4A 3EYUH 1R3JB 3LS5H 5DF0A 2WBJD 3LKPA 4ELME 1G7JA 2FL5A 3FB8B 5HI5D 3GSQA 3VFTB 2OZ4L 4EOWL 3BGFC 1CYGA 4K3HA 3BIKB 1OAXL 3GBML 4TULH 3M1BA 4U2ZA 3FO1B 2AXFB 2MQCA 2H1PL 5HHOD 5L2KB 5EG6C 3U4BH 3D2UB 1KTDB 3IXTB 4ZOBA 3CXHK 1NANH 3MV9D 1ACZA 2DLFH 4U1NB 2A38A 1JGEB 1AQKH 3IJYA 4XXDA 3I6GA 3G5YA 2R69H 4U6VH 1MRDH 4L4TA 4IMKA 2XZCL 1WK0A 4TSCL 3X14A 5D1XC 1TZGL 4ELKA 3S4SA 5SWSE 4IHOB 4OI7A 2EDJA 2ERJC 3JV0A 1QKZH 4YHKH 4IDJH 3ARGA 2X5PA 3JV5A 5JW3H 3SGEH 4QY8A 2O5ZL 3CSYB 3LZFL 2ICWJ 3QHZL 5TF1H 43CAB 3TIDA 4QRTA 5EUOE 4RZCA 2Y72A 5EZLB 4XT1C 5J3HD 2WINB 2AERT 4QXGH 4X6CE 1DBKH 5D1XA 3TBWB 3BISA 1YYLL 4EKXA 4P5TA 4X9BA 3SO3B 5H35A 1ULVA 3AMKA 1BQHA 3ARRA 4DZ8B 3I75A 5GGVH 2HKFH 4F15C 4QTHB 2HLFD 3RIAF 1UACH 3BKYH 1P6FA 4PJDE 5IB2A 4XMKH 1S5HA 3RBGA 5A2JH 5D1XD 1MWAB 4PGDB 3W0WA 3RAJH 5DYOA 4DGYL 2E7HA 2DQUH 5GRWA 4N1EA 3C2SA 4UDTA 4TRPH 3GI9H 1MOEA 3HFMH 5DMYA 5HVHB 2BY1A 3B2UD 3S5LB 3BHBA 25C8L 1X6LA 3WE6A 4AEIH 4ODTL 3D39B 4PGEB 3DVNA 1TENA 3TVMD 1KJ3H 4XAWH 4WJ5B 2XPGA 3SDAA 3V7AE 2GSIB 4MA1B 3QA3A 1MRFH 4UINH 3TGXA 1NGXA 2VZ3A 4HUWA 4WVRA 2IBZY 2YPLD 2VL4A 2YBRA 3KJ4B 5I1GH 3IJHB 3B83A 1K8DA 4P48A 3G04B 4E5XB 1RK1B 3IF1A 3KPOA 3IKCA 5IF0A 1DLFH 2GITA 3U82B 4L4VE 4PTTB 2ICEA 4JCLA 2HVJA 4EI6A 1UZ6E 2VWEC 3U83A 4M43L 3LV3B 4GRLA 1SJHB 5JW4Q 5HHOB 3EYSH 1IEBA 3DSFL 1HYRC 3MXVL 3MLWL 4NNYB 3WXWL 2R39A 3TJEL 1JPTH 4RMQA 1G7JB 2FL5B 4HC1L 3TT3L 4MCZB 2BX5A 3AROA 4UB0L 3MGTA 4TPRL 4CL7A 5LJYH 1U95B 2HJFA 4FFZH 5B21A 4LEXH 1H3PL 2ARJQ 5FHAH 3BZDA 4JKMA 3NZ8B 4NQSA 3OAYK 3NZHL 4MS8C 5DD5L 2J6EH 2NTFB 5JTWA 4X6BA 4O02H 2H8PB 3HE6C 1FGVL 3O9WA 1A1MA 2H41A 4JCMA 1PZ5B 1INEH 5DMGD 4NQED 1G7IA 5I19L 2UWEB 4TPRH 1KIUA 5IMMA 3S4SB 3WFCH 1JK8A 2D9CA 2W07A 4FQXC 5DSCB 1CD1B 1JNJA 4LF3B 4YHML 5EU3A 4OZGA 2A77H 3KNBB 1MCIA 4PRIE 1JYXA 2QSVA 3D9AL 1OWWA 4QEGA 1U8OA 1I75A 3CX2A 2DQIH 1DDHB 3MOBH 1KIPA 5I2IB 1JV5A 2XNAB 4X5XB 4JFDB 1UYWH 1FDLL 2J8HA 2R23A 4I18A 4WFEE 3BN9C 1T7WA 1TNNA 5ALBL 1MF2L 2EXWD 1F4XL 3BXNA 5TE6H 4MA8H 4X6DB 5B4MC 5C09B 5E6IB 4HIHB 4JQXA 4QLRA 1E4XH 5FB8B 4RAUA 4KTEL 3SE9H 1CFQA 4N5ED 4RDQF 2W59A 2ESVD 1DLHA 1DL7H 1KCUH 3NABL 1WCBB 2Q8BL 1MCQA 5MEOA 4OLZH 3GIVA 3PQYB 4G6MH 2KPNA 3GBNH 3EDDA 3RGVA 1X7QB 4YGAB 1BHGA 1IQDB 1KJVB 3TCXA 1DN0B 1QPXA 4G8GE 3Q6FA 2P48B 4PGEA 3BP6B 3L7FA 4JRXD 3QHFH 3TC9A 1G6RH 5I76A 2JIXA 4ZNEA 4WFHD 5I1EH 2DJSA 1QR1A 4MS8D 1KYOK 4BJLA 5FGCE 3FB5B 1H5BA 1EXUA 1TTGA 4ZXBD 3TF7C 1I9IL 1SEBA 3IJHA 2PO6D 3C6LD 3HRZA 3F5WA 3SCMD 3ZTJG 2WBJC 4NNPL 3PV7A 3VA2C 3O81A 1MWAH 1OGTB 1GGBL 5C9JA 2F15A 3QPXL 2HLAB 2JKXA 4G80B 5KS9B 2X9WA 4HJ0C 4QRRD 2KQMA 3PL6A 3MLYL 4OLXH 4YR6A 2ZCHH 1VKXA 2EEDA 4R8WL 5IB5A 3VFVB 3KLHC 2H2SD 3C6LA 2H2SC 1JFQH 4X6EB 1A7OH 1KTLA 3DURB 3V4UH 1DR9A 3B4NA 1Q9LB 3BKCH 2J8OA 3N1FC 2P24A 4ERSH 3V95A 5FYJH 3RTQC 1U8KB 4U0RC 1OTUD 2VUOA 1J0HA 4GSDH 5D7IB 2L7UA 5EWIH 1T5XB 3VMPA 3P30L 2BNRE 3SGKC 2MHAA 3RVXC 2ORBL 4QHNA 4YXLL 3DTXB 4M5ZL 3O9WB 1D5MA 4DKEL 4XNYH 5JXEA 5FFLA 5D7JD 1CFBA 1A6ZA 1FL3B 1ZA3B 4ODUB 2KKQA 3O6KH 3H9SB 2ZJSH 4LP5A 1XF2B 2RAMA 2IPKB 2XZAH 1QQDB 5F9AC 4HK3N 2R29H 5FECB 2IH3B 2PTVA 4XTRD 3WHE0 5J56B 1XGTA 1AC6A 5IUSA 4ETQA 4UU9A 5IQ9B 3MBEC 2NXZC 2XRAL 4MHHI 4OIIL 3BPLB 4HGWB 3DBXA 4WW2A 5I2IA 1TJIH 5TQ0L 1A9BB 3BE1H 1RJZB 5DEFB 5AWNL 5EBWB 4WFHE 3GI8L 1N2RB 1U8QB 3LN9A 3BPCB 5ADPL 1QR4A 2QSCH 1U8JA 3GKWL 3QNZB 2OZ4H 5I9QB 1G7HA 2P4AB 1TZHB 1LDPL 1GAFH 4HHAA 1SY6L 3HMXA 4HCRH 1HDMB 4BZ1H 3BGMB 3BT2H 4WEBH 3VCLB 1NCAL 3HC3L 1ERNA 4Z18A 4NZUH 3PJSB 4KVNH 1DLHB 4PD4J 1DQJA 3TN0B 4KUCF 1IM9D 5D7IF 4LGPB 4ZXBC 1H3WM 3KVQA 3TYGH 2OJEA 5EOCJ 2DMKA 1BWWA 1MCHA 1NKRA 3U2SA 4KGLA 3ARFC 4XP9L 2BNUA 3I6KB 2B0SL 4S2SB 3I3BA 1DN0A 4YGVB 2YMXH 2XKNB 3OKOB 4ZYKB 3T09A 4YBHA 2IBGA 2EH7L 2DWEB 1XAUA 3BKML 3BFOA 2R0KH 1CLZL 1PZUB 1JGUH 4G6JL 1WICA 4UIMA 32C2B 1DFBH 1YECL 4R6UA 4F7EA 3ULUH 1EHXA 2PXYC 2R9HD 3FKUS 2YPVH 4X6FA 1IL1B 2CIKA 3BP7A 5D6CB 4JKLA 3L95B 4JO3L 3F5WB 5GRXG 5DFWH 5T3ZL 5L2KA 4TVPE 5ADOH 3W81A 2MSPA 1QFOA 1WIOA 1A3RL 1YNTA 3QDHA 4ORGB 4N1HB 1KNOA 5K9JL 1K2DB 3KPMA 3O9WC 4UI2A 1DVFD 5KVDL 1EJOL 2VOTA 5C07E 4R26L 5IVZA 1FCCA 5D9SA 2B1HH 1HSAA 2NXYC 1E28A 2NY1D 4MA1C 3SOBL 2IQ9H 2N4IA 3SKOB 5KTEL 2YC1B 5F7EH 4MWFB 2R56L 3ILQD 5ITFB 1WTLA 2H9GA 3BKJH 4NO5A 4PJ9A 2IPUK 3CVIH 4JDZA 4JFYA 1PEWA 4Y4KD 1CD8A 2IAMA 4JG1H 4LL9A 1U3HD 1XFPA 3VXRE 1LO0L 3ES6A 5D1ZA 2NY4D 1MF2H 1CDBA 4FS0A 4GAGH 1N64H 5ALCH 2AK4B 2VLJE 4DK3A 1H3PH 3IFLL 5FHAL 3WFEH 1PBYA 2PYEA 1ZA3A 2QSQA 1JMXA 1TFHA 5EOQL 4KKBC 3H9SA 4FNLH 3KYMA 2XACC 2WK2A 4LCCC 4KTDH 4LQFL 4CN1A 1S5HB 4M5YL 2P5WD 2GK0A 2VDKL 4HH9A 4NZTH 3MC0A 1XGTB 3HN3A 5BVPL 1LO4H 4NZUL 3RA7H 1KB9K 4WHTB 2NY4C 1A9BA 3K2UL 1RJZA 4P2OD 2BHZA 1UC6A 1VFMA 4HXAL 3RP1A 1AXTL 3VFRB 1QSVA 4X9GA 5JZ7C 4B0MM 1XGQB 2X1XR 2P5WA 3BN3B 5EORL 5E2WL 1N4XL 2XQYK 5DJ8A 4X9FA 1P4IL 5CJ8A 3LEXB 2WWKO 4JHBA 5KJRL 3S9DB 4HUWB 1PYWB 2FO4A 2Q3AA 1N6VA 3E2HB 1ONQA 2NXYD 2OMNA 1A6UH 3BVNB 2F5AL 1PLGH 3CFBA 3GGWB 4M48H 4DK6A 1G84A 4Y88A 3RWHB 3VXUD 4ZUWB 2EO1A 3RY4A 1FNGB 1GH7A 3MRHB 3IETA 5F72S 1XF3A 3QJHB 4HG4K 1CQYA 2VZUA 1C7TA 5ECJE 2AJZA 2OTPA 2RCSH 4JRYB 1IEBB 4JG0H 5FV1L 1FHGA 4PRDA 3VW3L 4LKCB 1K4DB 2ZUXA 3BDXA 3C9NA 3KPNB 4LCCB 2PXYD 1BP3B 5IFHH 4LU5L 3F12B 3EDJA 2W0LA 3BUTA 2CIKB 5IHZB 4TOYH 3FOLB 4H8WL 5DEGB 2UZXB 1B2WL 1HE7A 1AQDA 1YYLH 3L5IA 4XPFL 2DQJL 4JG0L 3N1GC 3KJ6H 5DUPL 1YNTB 2GIYA 4I0PD 4PRAA 3UTTE 3FT4B 4M1CD 3TO4B 4H0GA 2FBJH 2UWEA 2UZIH 4WTWA 3X3GH 5IVZB 2QR0B 2IMMA 3PGFH 2YZ8A 3MRLA 3G5YB 4DGVL 1OAUH 1RAMA 5DVNA 1VADB 4NBZB 3L3JA 4BH8A 5T1LD 1I8LA 2OTWA 5HI3C 1EVTC 3MROB 4ELKB 3UPRA 3QZWA 4JRWA 4HPYH 4YDIH 3AS2A 1G9MC 4YFLF 3ZYZA 3VGAB 2EH8H 3WIHA 1KIPB 1FVEB 2N7BA 4I0PB 1IZJA 4X5XA 2ZSVA 5F7KC 2PETA 4EI5A 3WDIA 1YMHB 4I18B 4ZTPH 4YDLC 2PYEE 3AU1A 4H20H 5KSAC 4D2NA 5FF6A 3BXNB 5MI0C 3QFJD 3U1SH 1MHCA 1WVZA 3MJ8A 5CILH 1N8ZB 3WO4B 3GMOB 4JLRA 3AM8A 4FP8H 1MFBL 4QTHA 5JHLH 5JDJA 3FFCE 4G7VH 4KKCC 1LK2B 4RBPK 4IOFD 4BFIA 3W0WB 5FDWA 3I9GH 3IFPA 1YUHA 4ZO9A 4OZFG 1J0JA 3DX7B 3QAZB 4TUOB 3MCKA 5B8CA 1NCDH 4KTDL 4OFVA 4YLQT 4RGMB 4MYWB 1HSBB 3C2AH 5IV2A 5I1LA 5JR1L 2C3HA 4GG6A 1ZT7B 4G5ZL 5BQ7A 2ICWI 3HUJA 2F53B 5IBLD 1JRHH 5I8EA 1KCRH 4O2FA 2FEDC 1UZ8B 3DVFA 1NGXB 4G8FB 1C16B 1U2CA 3RL1A 1I8IA 4FQHA 3SDDB 1GAFL 1AXSA 2I27N 1HINH 5KOVC 5CSGA 4FXKB 2FHBA 3PL6B 4GRWB 3RHWF 5CINH 4R26H 1A7PH 2BVEA 2GFBB 3GM0A 3PWVB 2IALB 4LVOC 3O11A 5JQHC 1ITCA 2YSSA 4R4BA 1TQBB 4DN4L 1VENA 1Q38A 4J3OC 4NCC1 4KMQA 4HFWB 1GGCH 2IBBA 1HH9B 5DRXB 3FRPG 3HLAA 1SJHA 1QG3A 5JIKA 1CZ8H 1QD0A 3BYTA 2AJUH 4M02A 4J3SA 3BQUD 1A3QA 4D0CA 1EV2E 2VAAA 5GGTL 5MEPA 3CX5K 4PS4H 2VDNL 4JHAL 1JGVL 1XR8A 5CSZA 1A6AB 4POYA 4OZHE 4F8QA 1AQDB 2XQBL 2WUBH 1JGUL 2HJFB 3ZHLA 1EHLL 5FYJU 1JYWA 2H32A 4P49A 2CUIA 3G9VA 2FX9L 2R0WL 4NJ9L 1S5IL 1K85A 3QG7L 1QEWA 4U0RB 4CVZA 5IOPA 1F3JB 4KTEH 3SE9L 4GKNA 3CPLB 4DVBA 1N59A 3T65B 1MJ7H 2ESVA 1G6RA 4XCCH 1F6FB 1JHLL 3KWWA 2HTLC 4P4RB 1DLFL 3SDDD 3KXFA 3U7YH 3MRRB 3SJVB 1Y6NR 4JJHA 5GSRA 3CMOH 1XZ0A 2Z35B 3ZYOA 5GS0H 5DJYB 2Y9RT 3G6JF 4YDLB 2HJLA 2X1QA 5J3HC 3BEWA 3EZ8A 1A7QL 2P42B 4YBQD 3JXAA 5FM4A 5SX4H 3ARDD 4U1GC 1ZLUH 3BPCA 1FZJB 4MAYA 1A5FL 3VE0B 1CLZH 4ODXB 2AEWA 4LCIL 3BX7C 3ARED 1NGWB 2EH7H 3H0TA 2UY6A 1N8ZA 1JGLH 2C7UA 3ZYIA 3CXHJ 3TA3A 3VFMB 3ARDA 5F9DC 3UTOA 2PO6B 3CSGA 2IAND 4QT5A 3VFWA 4F9LC 3SE8L 1H3XA 3MLSL 5TE4L 4EDXB 2FECL 1JPFA 2FYYB 1MREL 2E8ZA 3WUWB 1VEMA 3PQYA 2BJMH 4JFPA 4MNQA 5B39A 4XNXL 4Z7QF 4Z95L 3K4ZA 3WMSA 3FONA 3QFJE 4HV8B 4S0TD 5JIIA 5CZVH 4OGAD 2ZG1A 4XI5D 5DEZA 3VXMD 5CJ5A 4MB5A 4TTDD 4C58B 3L3HA 3OKYA 3VRJA 5HDBE 4MNQD 4LSVL 4ONGH 4K3EL 2HKHH 3NMEA 5IMKB 5K9QG 5K59E 1N3NB 5FKAB 1I8IB 4FQHB 1MQKH 5DZOA 1FG2A 1CD9B 2GK2A 5C1MB 3VI4E 3HRZB 2AXJA 4PJIF 3STZA 4YHPA 3I84A 3QUYC 5F1IA 1ED3A 4Z7VB 3DYOA 1X44A 2V5SA 4OV6F 4OFIA 3RZCC 1UADC 1UB6A 3UYOD 4P3CH 5EO0B 1Y0LA 1FJ1A 3ARWA 4JRYE 2W92A 4R97C 3VU2A 1J87A 1WQVT 3GSUB 1S9KC 4F33B 3N85H 4QHKI 3U46A 5J4MA 4UOJA 2LU3A 3TM6A 4LGSB 1R3HA 1OT1A 2YWYA 4UMGA 1HHKB 3S98A 3B2VL 1UXWB 2CDEB 1T3FA 1TVBA 5C08A 2UWEF 4X7FC 4NN7C 3DUSB 5E95B 1URLA 2PCPA 1I8LC 2DJ4A 2WUCH 2AJUL 2VMFA 3FO0L 4MJ5A 1RUKH 4M7KH 5A16A 1GOGA 1J5OL 4U1LA 5FM5O 5FUOL 2ADFL 5GSRB 3ARUA 3FT3B 3HMXH 4XHJD 3LKOA 3EGSA 2NR6D 2A73A 2J3SA 3SE4A 3TBVA 3JTTA 1J0YA 2AEPL 5E6YA 3RWCA 4KRPB 4PG9B 1OTSD 4NCDA 3OAZK 1WCQA 3UXFA 1W2KT 3I50L 4BQ6A 4X6DF 4YHOH 3SGJC 1GHFL 1X5JA 4OFPA 4QWWD 2LTQB 3PWLB 3W39B 2B8OT 1A22B 4HWBH 1XGQA 3CU1A 5HPMA 5BS0E 5E8OA 3QDGB 1NQBA 4PRNB 1U8QA 4RGNE 1SQ2N 1GC1C 4HF5L 4BSVB 1FO0H 2BXYA 1RPQA 5DI8A 3QPQD 4JPVL 2Y5TB 4NUGL 5L2KD 1NCTA 4O58L 1J0IA 3D9AH 1CGWA 4OM0L 3VCLA 1DQLL 4X5WA 4J8RB 2EZ0D 3FO2A 1P7QB 2VZVA 3RI5K 3X3FL 2XT1B 4ZUWA 3TEUA 3ULUC 1A7PL 3S3SA 4EDXA 1HYSD 5BMFL 2ED7A 4OM1L 4XRCA 2ZUQB 3G5ZA 5IMOA 4JFPB 5B39B 4NZTL 1XF4A 2IBZX 3CIQA 5HYJE 1TJGL 2VLLA 1CZ8L 4LCWB 5J1TC 1U3ZA 3MNWA 3OXSB 2X1OA 1P84K 5E03A 5EOCL 3W9EA 1M7XA 4PJ9D 4HEPG 4LLWA 1RZ8B 4PJGF 5E9DA 5FK9A 4GAYA 2X05A 5HI5C 5I18H 1EGJL 2A83B 1U3HA 4RBPH 3O3EB 4ZFZB 4HULB 4Z7QE 4PV9A 4N8PA 4A6YB 1ACYH 3H9YA 32C2A 4KJPD 1VB9A 5ANME 4JEGB 4NN5B 2OI9B 2K1MA 4WI6A 4KJPC 1IL1A 4HWBA 1IGYA 3PV6A 5KANI 5HYJA 1JHTA 4B7LA 3SDAC 1FP5A 4YHPB 2AK4D 2VLRD 4F9LA 1D5ZB 4OZFH 4XB8A 5CZXD 3EJYD 2QR0A 1FYTB 1T1XB 5TF1L 3O2WL 4TNWF 2FB4H 5EO0A 4GXUM 3KHOA 2X4PB 3MOAL 5BS0D 2FX8H 2VLMD 3L3JB 4BH8B 1KXTB 1ORSB 1SHMA 3MV01 4P57A 5CILL 3RZCB 1VHPA 3QZWB 1HYSC 5E8NB 3SKOA 5IW6B 4YZFE 4ELMB 3HCVA 4JFXB 4AG4L 5IM7A 3MBXL 5DMKB 1N6QH 1TVBB 4M7LT 3MV7E 1AD9B 3W2DH 1HN1A 3WS6A 3ZE2E 2DLGA 4KDTA 1UACL 5BS0A 5JW5B 4JE4B 2B4CL 9CGTA 4PLNC 4QO1A 3EO0A 4YHOL 2V9RA 2XWJB 1F5WA 1D3CA 5HHPA 3QYCA 3NGBB 4PJGB 3B2VH 3VG9B 4RA0C 3VXUA 3U4EA 3BPNC 4C54A 4ODTH 4DKDC 1M7DB 2JF1A 1VACB 1I1YB 3WKML 4HKXB 1I85C 1DBML 1QACA 5GISL 4PG9A 4PRHA 2BJML 2DBLL 1YUHB 3CLEH 5DRNB 1EBPA 1OY3B 4WUKH 3MCKB 3C5SA 5B8CB 4G6AC 5E2VH 1W0YT 4JRYD 1W72B 1AHWA 4GKZB 2JJWA 3O0RL 2CO6B 1RSFA 4NQCD 2O61A 1S8DA 4BM7A 2AXHA 4KRPD 5HYSG 5JPNB 4PRHD 3U36A 1A1NB 2FDBP 4D0BB 4GLRH 3LEXA 4JKKA 2ILLA 5I66B 4GMSL 2CK0L 3B9KC 4LRNL 4G43B 2V2TB 3U1SL 4PYGA 2CKBL 1AXSB 1EHLH 3DX9A 3IS0X 1QFWH 5C3TA 3IKKA 1EMTH 2C3GA 5ACZB 2MMXA 1VGKA 5DRZB 3LD8B 3MACH 3LKNA 3LSOA 3RWHA 4ZS7L 3GSXA 2IALA 3MUY1 5HGAA 5HHOE 3EO9H 4YQXH 5T33H 5T1LA 3KPQA 1JVKA 5F7WC 5KSBF 1NL0L 1RIUH 4QHMA 5JNYB 3MNWB 3OXSA 5D70L 2AKRB 1HWHB 5JDSB 3EIFA 1NC4A 1QBBA 3LKPB 2BC4B 4PRDB 3MRDA 3MX0A 4EI5D 4MX7B 5IMLA 5HTSA 3AFLA 2EC9U 3F12A 4DKEH 4J3WA 3LH2L 1M6OB 4N0YL 5FXCH 2IANE 1A02N 3ZDYF 2G5RA 3RY6A 2A74B 2J2ZA 3QFJA 4UQ2B 5DEGA 3ZDXE 2Y25A 4Q6IB 1R5IB 5AD0A 2DQCH 2JJTA 3D2UA 5E2JA 1KTDA 5HGHB 5BZDA 2Z8RA 3LPFA 3S88L 4M6OH 3IJYB 3I6GB 4RX4A 2VSDA 2JCCE 4L4TB 1KB9J 2OS7A 3HHRB 4HIEB 5EFIA 1PY4A 5GS2D 1MCPL 2JB6A 3D2UD 2CGRH 2NY2D 5AAMA 3WO3B 3IDGA 4FQJL 5HY9A 2NX5A 1JF1A 1XIWB 1CCZA 4PJXA 1HILA 1WITA 2UV3A 1AD9A 4XMLL 1F6LL 3HNTL 1JMZA 4NQTA 2PTTA