1CBVL

An autoantibody to single-stranded dna: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*T)-3')
molecule tags Immune system/dna
source organism Mus musculus
publication title An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded Fab and a deoxynucleotide-Fab complex.
pubmed doi rcsb
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cbvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cbvL01
2ZUWA 4YXLL 4NO2B 4O2CB 4R4BA 4K55A 4HUNB 4LLWA 4KROC 4RAVB 4LHUD 1AH1A 1NBYB 2PCPB 4HD9A 4M6OL 5C0BA 1QSFD 5AEAA 43CAA 5T3ZH 1Q8MA 2FL5B 3H9ZA 5DTFA 2R1WB 3C6SA 2OLDA 4RAUB 4WU5A 5F1NA 1KOAA 1ZGLA 3U4EB 3QFJA 5I1HH 3TZVD 4I77L 5J12B 1A6ZA 4LPTA 5E5RB 4MJ4A 1FIGH 4IMLA 3QWOB 5ESAB 4FQIH 3A6OA 3BEWA 1R3LA 4OFVA 4GAJH 2FJHB 4OB5L 2AERT 5IMLB 1D9KD 2C3WA 3U1SL 4HGWA 3MLRL 2K3TA 4KVNL 3OWEA 1P7QB 1GZQA 3I6KB 5F7MC 1AD0A 2HTKC 3BXNA 2ORBL 3U9PH 4X4XB 3H42H 3OAZK 3MV8D 4RGOH 5JW3L 3G6AB 4WO4B 4EI5B 2J7LA 4HJGA 2LV4A 5TF1H 2UUDH 2ZUTA 3OG4B 4LEXL 3NZHL 4Y19E 5GPRA 3HAEG 5A2KH 5I1KL 1JPSH 4Y88A 1NBZB 3TYGH 3QQ4A 2G5BA 3HA0A 4M61B 1JWSB 3SGJA 3F5WB 4PJHF 4HAGA 4G80B 3UJIL 1JGLL 4X9FA 2XN9B 4U1IB 5HPMA 1QSZA 1X5HA 1NBQA 4Z7QF 5IIEA 1SEQL 5ID0A 4MNQE 3M1BB 5M7QA 3HLAB 1YNKH 2HJKB 2DQJH 4CKVX 1ORQA 1KYOK 4Q6IA 2IPKA 1BECA 4QYOB 1XCQB 4ZS6C 2RBLA 5IW1B 4O5LL 3IDYC 2W9DH 1KPRB 4FQXB 3RWDB 4I8DA 3L5IA 4WEBL 2CGRH 1JTOA 5J6HB 4D94A 2BX5A 2XTJB 3FKUS 4U1LB 4F2MB 3D0LA 3MYJA 4PJCA 4HKZA 4KKCC 5CZKA 4Z7VB 5FKPB 4P23B 4OF8A 4NKIH 2D2OA 1UM4L 2DAVA 4ZUVB 1FZOA 4MB3A 3KPMA 3EYFB 4QHUA 4XVTL 2Z8VC 3SHSA 3WLWC 2P8MB 1U2CA 3EUUA 3REWB 3T2PA 4OQ1A 1HDMB 1FO0B 3MMEB 1J1XL 1IEBB 4PJGF 5ACMA 1X4YA 5TDNB 3QULA 4I4WB 3TGXA 1OTUC 1NGQH 4Y4KB 3P0VL 4JPVH 4GXVH 2Q8BH 1GPOL 4HUWB 3S9DB 4PJXF 5I1JL 2EDEA 4ZPVB 3HNTH 1RZKC 1QSFB 3B9DA 5ADPL 4Z7UE 5EUOA 2YD1A 1INDH 1U8QB 3Q6FB 3VG0H 5K9OA 1FFOB 2FHCA 3EJYD 4XPAL 4Z7VA 7CGTA 2FEDC 4QRRB 5CJ8A 4LRNH 1I7ZB 3JTTA 4WI5A 1JZ3A 3I6LE 3KVQA 5E6IB 3CDCA 5D7KE 1YUHB 4GAFB 1CFBA 1F00I 4G6JL 4TVPE 4CU6A 4L5FL 1DE4A 4MJIB 2G5BB 1N0LA 4HDIB 4P9HC 3MODL 4RNRB 5J12C 4DUWA 1TFHA 5KS9A 1WZMA 3FFDB 3MRKA 4FTVD 3D39D 2R0LH 3TV3L 3MLZL 2VDPL 3QNZB 5DD0H 3TO2A 1N3NB 2P8LA 3QRGH 5JNYA 2BVTA 5DD5L 5DVKA 4QRSA 1I7RB 5MENE 3LQZB 4ZTOL 5C0RL 3MA7B 3MOBH 1QTYT 5EZJA 5L2KD 4RRPA 1P4BL 2R69H 1SYSA 1B6DA 4D9LL 3R0NA 3EOBB 2RFXB 2EE3A 3BEWB 2P5WB 3D3VA 3ZL4L 1YC8A 4PGEA 1M05B 1KLFA 4Z7NF 2V17L 3HPLB 1T3FA 3QXAA 1R5IA 5C0EA 1ITCA 5MEND 5C8JB 3PDOB 1A1OA 1KPVA 1QFPA 2NX5A 4Z7WE 5C3TA 3MOAH 2HMIC 1A7PL 2DL2A 3NIDF 4P3DA 1UH3A 2R4SH 1N5AA 4GKZA 4JFXB 2JJTC 4FQLL 4DN4H 1G7IA 3SKNB 1RZKL 4S2SA 3TBWB 1I7RA 1LEGA 4KFZC 4KDWA 3OKMA 1UQSA 3KXFD 5TQ2L 5D7KD 1HHKB 1B0RB 3ZE2E 2RAMA 1BOGA 3CUPA 5DUMH 5TDPA 3RIAK 1WFTA 4YX2H 3PWNA 4L4JA 4ZUSA 1VFUA 1IGCL 5FHBL 3ZDYF 4GRMB 1AXTH 3PWVB 3ZDXF 2BERA 3GI8L 5F1NB 3OB8A 1K8DB 3FT3B 1JWMA 5D2NB 5DURD 4JR9L 2Y36L 3D18A 4ELMA 1Q1JL 2DQJL 2V2WB 4UV4L 1H3VA 1TQCB 1WT5C 3SDAC 4NQCA 4Q9RH 3WNOA 2A6DB 1YEGH 2QHRL 2Y72A 3SDCB 5FM5M 5FF6B 1CXKA 1OW0C 5GIRA 2VABB 3S5LA 5C9JB 1RJZB 2JJWA 1H8SA 4OFDA 1VFBB 2CIIB 1T5XA 2KZWA 4G8EB 1EEZB 3RUGA 4ZFGL 3K4ZA 4PBXA 5F7YC 2YPVH 3TA3B 3HMWL 3RZCD 2O61B 3GHEL 2DDQL 5CEZH 1OAKL 4OM1H 1F90L 3GMOB 1S7QA 2DQIH 3VH8B 2X4RA 4OQTL 4MXVF 2BVQA 3SKMA 4NZRH 2LTQB 5DHXB 4NRXB 5C0CD 5I1DA 1FYTE 2IAND 5C08A 4HH9A 3TEUA 4DVRH 4EDWH 2DYPD 2Y6SC 3KPSA 4PB0L 1CFTA 3MYJB 4XNQB 5F44A 2BNUB 4RISL 3MA9H 1TVDA 4GUPB 1U8QA 5K9OB 1YN6A 2XFXB 2FD6H 1G7LA 1PW3A 4K8RL 1T5XB 4AEIH 1LK3L 2G75B 3V7AG 1EUTA 1IGIL 1QRNA 5JR1L 2O5YH 3QWQB 1G6RL 4FQQA 4IOSD 4KVCL 3DVIA 3H3PL 4PJ5D 1T2QL 2NNAA 5FXCH 1U41A 3U7WH 2BOCA 3DXAB 3PNWB 2H32B 4KV5E 5B8CA 2YN3A 4PUBH 2F74B 1U3YA 1V7NL 3QDJE 3PHQA 4P23A 2C7UB 1NC4B 4OLUL 2X4QA 1K8IB 1GRWA 4ZTPH 4UTBH 4NM4H 3EO0A 4LSTL 5FCSH 5GGVH 3MRQB 3LQAL 1CU4H 4L1HA 4YPGA 2VLRB 3GO1H 1VKXA 3TJHD 4HPYH 5J1TC 1DQJA 3PABA 4GAYB 4QRRE 3I6GA 3ARWA 4YHPB 2UUDK 2Z31B 1MLCB 1IGIH 4PJ8B 4AM0A 2DQHH 3L95B 4OZFB 5BOPA 4UIKL 3W39A 3BSZH 4YHOL 4KQ4H 3RVXD 1WCBA 1ZHLA 3VXSE 1AKJA 3BO8A 1JGDA 2AK4E 3PGCA 2XZCH 5L6YL 1L6XA 1CF8L 1ZTXH 2R39A 3JWDL 3SGEH 4HCRL 5DQJA 1I8LC 3IFOB 4UV7L 5FB8B 5ITBH 4CVUA 2KPNA 1AHWA 2X9YA 4TRPH 2ATKB 5I75C 4MA7L 4GXUN 2VZ3A 4G80A 3IFPA 4NKDA 4U0RB 4ZUUA 2BSRB 1WLHA 2ICES 4PGDA 2OI9C 1ONQB 4D9QE 2Y06L 1HINL 3U30C 2QR0B 1DLFL 5B39G 4OD3H 1JGVL 1L7TH 4P2OC 2BSRA 3EFDL 1I8IB 5JXED 1WCQA 3DETD 4HT1L 1OGTA 4XBPB 2WWKO 4N5EC 4KZEH 3TO4D 5EUKA 1FPTH 4NN7B 4OIIL 4GG8A 5MP6L 4XVUD 4P3DB 3TVMD 3L3OB 4JDVB 2AK1H 3WIFB 1G7JA 3SKJH 4PFEA 3V5KB 1OB1A 1L0XA 3IXTA 1GOFA 3RWEB 4YAQB 3O8XA 5CCKL 2VXTL 5TPWH 1DTUA 2CK2A 4PRNB 4U7SA 4RNRA 3BGAA 2XNAA 5BXFA 4TTDD 2ARWA 3VFRB 4E9LA 1RK0B 3HC0A 1U8JA 2EYTB 3FN9A 2GTWB 3E6FB 4J1UB 4JM2D 1A1NA 4JPVL 3LMJL 1EEYB 1MNUH 2WWMD 1MFDH 3G6DL 5DJ2A 2OR8A 2NW3B 1OAUL 1L9MA 5D6DA 1EIBA 2FL5A 3F58H 2NZ9C 2R1YA 1ZVSA 4M5ZL 1RU9H 2VLMD 4JLRA 1T21A 2F8VA 3MBEA 5BVJB 4JKKA 2DQUH 3VD3A 3TBYA 3CFDA 5T1MA 2I5YL 3FB8B 4HKXA 2W65B 3IXAB 5JORB 1CFNB 4HXAH 4DKDC 5ICZB 1IZKA 4NFBA 2JELH 4NO5A 5HHVL 1U3HA 3V4VL 4ERSL 4WU7B 3T08A 4XPGH 1X4XA 3MNZA 5IB4A 1LO2H 2HWZH 3WJJC 5KSBF 1YMHA 4GMSL 3VFWA 1KN2L 5F7HA 5FHAH 2H2SC 3AAZB 5E2WH 3E3QC 4S1RH 5ISZD 4C56A 1CFQB 3LKSB 4GQ9H 1T20A 3T77B 1AGDB 3TO4A 5JZ7D 3QH3B 5GGSB 3P0GB 3TCLB 5I8OL 2JF1A 1AGFB 5DS8B 3MBXL 4H1LB 2R0KH 4L4VD 4XVUC 3KS0J 2Q8AH 1FVCA 1TJIL 4NQCE 1MFCH 4QRTB 3DXAA 3PNWA 3S4SG 3RKPA 3IJSB 2JJSA 3FQNB 5H35A 1UEMA 3PQYD 1MLBA 3DWTA 4QHNA 3O2WH 4CUCA 1IAIL 2A38A 3MRPA 3BPCB 2QLVB 2GITA 4DGYL 1QRNE 3PHOA 4QTHA 5KG9B 1NCCH 4HWUA 5CIPH 3VFTA 4RFEA 1QUNA 3LZFL 1TETH 2ZCLL 4AH2A 4GRLB 4LKCB 4K3JL 3SKUD 1NFIB 1GJIA 1YEIH 2VN4A 4OCSH 5HHPA 3AREB 4JE4B 4OFKA 2ZOLB 1KJVB 2GHWB 1RZKH 4H88H 1VEPA 4PV9B 1RVFL 3ZT6A 1IT9H 1H3PH 1LO4H 5F7DB 4YHYC 3ULVD 4GO6B 3RUGB 3S34L 1AD9B 1N26A 2VKXA 4M48H 5A16A 4OZHA 3SPVB 3BKYH 3MREB 4H5SA 5C0CA 5IVXA 3P30L 1KSRA 4PJIE 3RU8L 2B2XH 5CP7B 4JREB 4ZS7H 3HI5L 1UQSB 5CWSB 2DM2A 2YD7A 5DRWB 4QXUL 3QEGH 2F15A 3VRJA 4HIJB 2HKHL 4LCWE 2N1KA 2VLJA 1VGEL 5F9OH 1GGTA 4JZNA 3CMGA 4MSWB 3QDGD 2COQA 4F57H 3CFCH 2EE6A 2VXSL 4L3EA 3FO0H 1T0MA 4MQXD 4MVBD 4R7NB 2HTLD 4HUMB 2Y5TB 4Y5XC 1J8HE 4P9ML 4R0LB 4WVRA 3ULUD 1HK6A 1V5JA 1XGTB 2XRAH 5JW4Q 4X7TB 2W07A 2X1XR 4Q9QL 3QO1A 3W0WB 5KVDL 5FA4A 1CG9B 2I9LA 4HS3A 4N9GB 2AJVH 2C3GA 2UYLA 2OXHA 5F96L 3RWCA 3DOSA 4H0GA 5FOJA 1NBYA 4MLIA 1RV6X 5I71B 1KFAH 2HRPL 1GGCL 3C60C 3LEVH 4JG0H 4I3GA 4F37K 4L4TE 4BQ8A 5IMOB 1T7YA 1XGYL 3MO1B 4JO1H 2ZUYA 1Y0LA 5HVFB 1YY8B 2Z31A 1JGEA 1M05A 2A73A 4XPTH 1DP0A 2XA8L 4EKXA 3QUXC 4P59L 1MCWW 4L4VA 1NFDB 4KI5D 5D1ZC 4X7CC 4Z7OF 4R0LA 1BBJB 1ZWIB 5D1ZA 2ICCA 5IB2B 2BXZA 5B38B 2ESVA 4YDKL 2VL5A 1ZT4A 4GOSA 3ISWA 4U6YB 3BYTA 4N1HB 3SDYL 1I7TB 4ENEC 1RZJC 5DQJB 1N5YH 4D0CA 3HMXA 2NLJA 3WIIH 1HQRB 3I02B 4P2CG 1Q72L 5E8EA 5HHME 1FGVH 1NC2D 1GAFL 1UB6B 5A16B 1FFPB 3MRBB 3UC0H 5D7IE 4HIIA 2VC2H 4NN5C 3ET9F 3OL2A 3NZHH 1IAOA 3ROOB 2IFFH 5K59E 1EK3A 3RL1A 1BF2A 1V3LA 4HPYL 1P1ZA 1S78C 3VXSB 4ZYKB 3U0WH 4HUVB 1YMME 4IJ3C 4N0RA 4XC1H 4IDLA 1UCBL 3KYMA 5E5MA 2V2TB 3UYPA 4OCLC 2GFBA 2NY4C 2NY3D 4NNXA 4WI9A 5HHNA 4NQDB 1HHGA 1G7HA 1MHPL 2J6EL 5FDWB 1QSFA 1NL0L 2AEPL 3O45A 4BFIB 2VDNH 3N50A 1T7WA 2B0SH 4KI5E 4DQOH 5DK0A 1HHGB 3LKOB 3QP3A 4FA8A 3QPQC 1G9ML 3MACL 1TNNA 2M26A 3O8XC 5EU7C 4OCMC 3RDTA 1FQ9C 4O58L 1HIML 1A8JH 1TQBC 1FFPA 4JEGB 5HYEA 3C8KA 1WAAE 2CIIA 1N4XL 2ED9A 3RPIA 4HWZA 5HYQA 3U0PA 3ZLQC 1JNLH 4KMQA 5AYQA 5H37H 2BHUA 5EO9A 5K59F 5D1QA 3LN4A 3QFJD 3NCJH 4LU5H 5D6CA 3MJ9A 4DOHE 1FV1B 2J8UB 3ZE1E 4OZIE 1B0GA 1GC1L 2DOCA 4XCYA 3FJTA 1JHKL 4KK5C 4JLRB 4JKPL 1OSPH 3QDHA 1N8ZB 4FNLL 4G6KH 3AGVA 1YEKH 4O58H 3QZWB 1TENA 3QXVA 2D7TL 4MXWH 3C5ZB 3ECBB 1NMCB 2EDKA 3VXRA 1XCTB 1DBBH 3NPSC 4JB9L 3CSGA 1CZ8H 3ARVA 5IT2L 3IFLH 4JRXA 5GRJL 3LPGA 1ZLSH 4LIQE 2L7JA 2QADD 1GHFH 1WGOA 4M4PA 4OT1L 3O3EB 4N1EA 2YEZB 3UO1L 2YXFA 2VLKB 3IDNB 2FWOB 1RJLA 4KRPC 2MHAB 3SGDI 5SWSB 2VLJE 2AJYH 2NY0B 3OX8A 1IGYB 4HKBB 4KGJA 5D7JD 1MFDL 4MJ2A 3GB7A 2A6JB 5EC1A 3WKML 2C3HA 2ZSWB 3GMNA 3ZKSD 2AP2A 2QADB 5I1EH 2Z9TA 4LFHD 5IEKB 4N9GA 4XZUB 1FBIL 4F7PA 2NXYB 5HDOA 2OS7A 4WU5B 4GBXD 3GHBL 1FNGB 5FYLE 1ZOXA 1X44A 4QY8A 3RX5A 3HFMH 1RMFH 1WWBX 3ULUC 1PEWA 3NACH 3I2CH 1P9MA 3TZVC 3PWVA 4JFHE 3ARRA 1KFAL 5IMKA 2Y5TA 3QAZC 1H5BA 3L7FA 4G8GB 4OBSA 2FEEL 1G7MA 3HPJA 4LFHG 5IMLA 5HYFA 4RFOH 1CD1A 1G6RH 4XPGL 4M6NL 5TDOA 2DKUA 3QA3A 1C16B 4KUCF 2OL3H 1EHAA 3E0GA 4XHJD 3X3FL 4J4PD 2XA8H 2IPTH 2EDLA 4JAMA 1AGEB 2MHAA 2IBZX 5DR5H 2WUBL 4MJ6B 3BWAB 4YE4H 4W4NA 2O93L 3S35H 3L3DA 4FP8H 3DMMD 1EFXD 2YKLH 1IAKB 3IDYB 4HGKC 3SQBA 1TVHA 3RWFA 3LQMA 2PXYC 4DTGL 3VXPB 2FATH 5HGAA 5HGBB 8FABB 3JTTB 3AB0B 5LG1A 2YD9A 5CJXA 5BV7H 5AWNH 4WTZA 4LSSL 3SQOL 3ULVC 4AL8L 1I9IH 3VE0B 3UC0L 2UZXB 1XGPA 4ZS6D 1DR9A 1UWEH 4HG4J 1WF5A 3V0WL 2CQVA 1I9JH 1A6UH 3MRPB 2HLFD 3UTTD 3UJJH 5DHYA 1R5WB 2JIXB 3CFBA 3HI6H 4Y4HB 1EPFA 1NGXB 2EEDA 4WI8A 4ZSOA 4X99A 2B1AH 3CZJA 2PO6C 1T1ZA 4FFWC 1RIVH 2HJLA 1N7ML 3MLSL 3U4BH 3V5DA 3MSPA 1RVFH 2NCMA 1TZIA 4ZOEA 2ARJB 1NKOA 1S5IL 2OSLA 4GKSA 3DRQA 1G7LB 3VXRD 2Z92B 3GBNL 3EYOA 4HS6B 4M00A 3MJ7B 4LP4A 4U1JA 1BREA 2OSLB 3DUHA 5EOCL 4ZO7A 1Z0MA 4KK6C 5C08E 5HYQB 5CMAA 4I5BB 3WXVL 5DA0B 4QHUB 4X80H 4KY1H 2AJSL 4DKAA 4GBXB 4NNXB 4XAWL 2DQDL 4ELKA 1J8HB 4X4YB 1DQLH 4BH8B 4KQ3H 1EMTL 2X70A 2BNQE 5JHDE 1T1WB 2FNBA 3NMEA 3L3HA 4C83A 5ITFA 3GHEH 5K9QI 4AJ0A 4G8FB 2XOTA 5I18H 2JJTA 3RDTB 5IIEB 3I75B 4OFYA 2I9TB 1ADQH 3LKNA 3UP1A 1OQOA 4S1QL 5E99H 4IJ3B 2VDMH 4M1CC 2EDNA 1CFTB 4N8CL 1TTUA 1I8MA 4JGJA 3BH8B 5D7JC 4Q9QH 4ZAKC 5GS1A 3FFCB 2VLME 2R2HA 1CFQA 4PD4J 4KTDH 1CFNA 4M61A 1WIUA 1DDHA 4RGNE 1FIGL 1J0HA 3UTTA 1L7IL 3T2QA 1EZVX 1L9NA 4P5TC 1DN0B 1TXKA 2BHYA 3ZDZF 3N0PB 4WIQA 3RVWC 2FBJH 1MCOH 4OF5A 2PTTA 3BMVA 4CU8A 3BH9B 4HC1H 5D1XA 5JR1H 5ID0B 3NCMA 1KNOB 3L5WB 5D72H 3GNML 2G9HA 5JA8B 1RHHA 5DVLA 1V7MH 1JWUB 1VFBA 2IPKB 4N8CH 1KCSL 2W0FB 1OCWL 4ISVB 1E6OL 2VUYA 4GQ9L 1WQVT 1ULVA 5M95B 3SO5A 4CJ0A 4MD0B 1RUQL 2ITCB 1ZVHA 1MEXL 3DETC 3BXNB 5D7SH 4QHKJ 1OM3L 1RZGA 2X9XA 1QD0A 5ACZB 1UADC 2KKQA 5F97E 4MNGB 4F37F 3OKNA 1NAMB 5IJKA 1CYGA 3U2SB 1U3ZA 1BD2A 2J1KA 1FFRA 1VHPA 1KG0B 2R23A 3ARED 2DYPA 1VGKB 1T6VN 2V9TA 2HVKB 5T5NF 3PXHA 2V5YA 3WN5B 2C1PB 3LZFH 5CWSA 3ZTJG 4X7TA 3Q5YA 3SDXE 1UJ3A 2J88H 4BFGA 4NJAL 5SWSA 5DUBB 2HVKA 4JKLA 5E1HB 4F80A 1A64A 2RIKA 3MREA 4H5SB 3QJHA 3D2UA 3O3DB 3PQYA 4JRYA 3ALXA 3C5SA 2C3VA 2HT2D 4U6XB 1EHNA 3WKNA 1Q9LB 2QSVA 5FAAA 1X5KA 4P9HL 4YHZH 1OAQH 4JY6B 2L0DA 1RZGB 5ICXB 4DKEL 3MBEC 5EB9A 3TBTA 4WFGD 3KYAA 5DJAB 5CGTA 4PJ8C 2WM0A 3O3EA 1PZ5A 1BIIA 5IFJB 2CLVB 3R4DA 4FABL 5DEFA 4HJ0C 1AQDA 3D0VA 5I9QB 4Y8AA 2NY2B 2AV7A 3EYUL 3AS2A 4LLYA 2RGSA 3BKMH 1YEFH 4ONGL 4L3CA 1M7DB 5EU3B 2OI9B 4E41A 2YWZA 4JN2A 1ZLWK 3LN4B 1U8PA 4OZGB 3MV11 3EKCA 1F90H 1QEWB 1MCSA 4JG1L 1MHCA 4YNYB 5HDLA 2IADB 5D71H 3V6ZB 1KN4H 4OZHE 1GYAA 5H35B 4EJ1C 4PGJA 4M6ML 4HUWA 3OKKA 4XBGB 4ZXBD 3BQUD 4NT6A 3L3KA 3JV4B 3LPWA 4I3RL 5I1AB 3I50H 4HLJA 4X7SL 4Z18A 1RUKL 1HXYB 3R1GL 2NY5L 4LHUG 1QG3A 3FO9A 1MRFH 5T5FL 4F9LA 2DIJA 1K3ZA 2Q76A 4EN3B 3KYOA 1MFBL 1DBMH 4XNMA 1TIUA 4E41B 5MERB 1NMAL 3PWPE 4NHCL 3VWKC 3JXAA 4WJ5A 3D0LB 4HG4K 1OT2A 3HCVB 2UWEA 1WVZA 3FFCD 1YJDL 4NJ9L 4OLZH 3MOBL 4FFZL 2AJUH 1V7NH 2XG5A 3DVNA 4YHIB 1SJHB 5HSFA 3VXME 3ZHDA 4D8PB 4CMMB 4QLRA 5GGRY 5DWUL 4JDZB 3LQAH 3TVMB 3QR2A 2YZ1A 3CIQA 1XR8B 4IRSD 3KPNB 2FGZA 3CFIC 4UTBL 5IQ9B 3U36A 2E7BA 3H9HB 1DCLA 5E2WL 3C5SB 5KSUB 5FCUL 1U8HA 4MX7B 3CVIL 1R5WA 1JGLH 1DANT 3GNMH 3H9YA 4OI9A 4LSUL 3WFCH 3OR7B 4NDMA 4WHCA 1AC0A 4JM2A 4PJAA 5EO1A 2A74A 3HI1A 4YHOH 1OOAA 1U3HD 1LNUA 3BI9X 3QUMH 4NO3A 4XXDB 3VGEA 3UX9B 2AV1B 2CLVA 5KTEH 2IJ0C 5ECJE 5IESH 2VQ1B 1FSKC 1YNKL 5L6YH 1FORL 2OZ4L 1QQDB 4LPYA 3IB4A 1URLA 3TT1H 5CGMA 5KSVA 2E9JA 5AG8A 4MA1C 3B9KB 2X10A 3QDJA 5EBWB 3KXFE 2F53A 3CK0H 2RHEA 1KGCE 4JO4H 1KELL 2YK1L 4G9FA 4OD2B 1KG0A 2R23B 4ZD3L 2B4CH 3IS0X 4M93C 1HKFA 2I25N 2FLRT 2M2DA 5KSAC 1LILA 1IM9B 2F53B 2VZVA 1CXHA 2WIIA 1B0RA 1QO3A 1MH5B 3FFCE 2ZUQB 1MI5A 2A1WL 4KJWD 3DVGB 3VG9C 3FQWB 4LKXA 3W11D 2DQGL 2CLRA 4WWKA 3JUYA 4Y7MA 1RD6A 3BP4A 5EBLB 1UM4H 4BYHA 4F7PB 4JRYB 4RBPH 5DEZA 4AG4H 1D5XA 1FNEB 1X6NA 3O6KH 2WNGA 1CL7L 4O2EA 2P44B 4XWGL 8CGTA 5I66A 1S8DA 3D39A 3F7QA 1IEAA 4K9EL 1X5GA 5I76B 4PJIA 4OV6F 3W81A 4PRPA 4FZ8L 3ULVH 2IQAB 5B3NA 3HNTL 3DXAD 3FN3A 4KGLA 4GG6E 1OAKH 3QWRD 5ISZA 3EJZC 3T0EE 3LIZL 4NFDA 4PS4H 1RSFA 2BNQB 1B4JH 2IWGA 5JHDB 1ZHNB 4XCCH 3BW9A 3FL7A 5EZIH 5SWZA 4ZFZA 1SEBB 4B7IA 2AJSH 4HIXH 5I1GL 1GZPA 2VLKA 4HX1A 3H9SE 2UVEA 3ARGC 4DW2L 1KBGL 1C5CH 5D5ME 4HDIA 1U8MB 1MCQA 4GAYA 4XGZA 5HHQA 4MSWA 4ZFFA 3H9SA 1FCCA 1D6EB 4K94C 3MJ9H 3QUXD 5KVDH 3BP6A 4B5EA 5LAXA 1RFDL 5C0CB 3BIAX 3GMQA 4ZOBA 1JV5A 4RGNB 4JCMA 4NSKA 1EDQA 1T2QH 4HEME 2HP4A 3W0WE 2VDPH 3V0VA 4MNHA 4KVNH 5HHVH 5IV2B 1GGCH 3WHXB 4LIQL 4PREB 2B4CC 4NKQB 4PYHA 3GDBA 5D9SA 3CNKA 4RGOL 4JO1L 5GGVL 3FO1B 3HE7B 5KVEH 1D6VL 5SWSD 4EN3A 1CICB 3BAEL 4L4TB 1AQKL 5DGRA 5FHAL 4EN3C 2JJSC 5EUOB 5E56A 5IB5B 1BFOA 3FHAA 2I27N 3MRDB 1XF5A 3I2CL 4TUKH 1CXIA 4K71C 2Y1VA 4O00A 3MJGX 3X14A 1LO5A 1P4IH 2AEQH 5D1QC 3NIFF 3VFSB 5FYLL 1U91A 4TVSa 5I16B 5EU5A 1JPTH 4WGWB 4IIQA 4HAFA 1JYNA 1R3HA 3MRCA 5E5UB 4KUZL 3Q6GL 3VH8A 4JPWL 3ARDC 4HUVA 3IJHA 4I48A 4RWYL 2UZIH 3L5XH 4E41E 1T1ZB 3ZTNL 4HS8L 5I8EB 4Z0BL 5I1DB 1KJ2H 1P4LB 3BPLB 1G0DA 4H20H 4WNQB 2XN9E 2EE2A 2X4UA 1BVZA 1MFAL 2ARJA 5TQ0L 3NFPA 5ALCH 1OSZB 1FSKB 1HQRA 3I02A 1OPGH 1QFUH 3TM6A 2AV7B 4MCZB 2BVOB 1F4XH 1BFOB 5DLMH 5GS0C 3QNXB 3MJ7A 4BQBA 1OTSC 4M48L 3KYNB 4QXTA 1BBDH 3TC9A 3NIDE 4R7DB 3U6RA 5DFVC 4K94L 3VJ6A 2A6DA 1IT9L 1H3PL 2R56H 2Y06H 4HKZB 5CZVL 1TZIB 4FFVC 3U82B 3THMH 3VXOB 3BKYL 3MRIA 4LPXA 5ABDE 1H0DA 3RGVA 2DIBA 1CGYA 3AFLA 1MUJA 2YD2A 3GSUB 1T66C 4GSDH 4MAUL 5GSVA 3EDDA 3SGEI 1HI6B 1YPZE 1BM3L 3NPZB 1MAMH 4FN0A 3HZMB 2AK1L 2Q6WB 5LAXB 1S5HA 4AIZB 5DLML 3Q0HA 1IKNC 5D7IF 5I1LB 5F9OL 2UWEE 4ZDHB 2OTPA 1FL6B 3QUKB 4U31A 1D5XB 4XNXL 1TZGL 1R5IB 4HMCA 2Z4QB 3SE4A 2XI9A 5DC9B 4OCXH 2GJ6E 4HWBL 4NO0B 4HJJH 4PRBA 1YEKL 5BJTB 3K4AA 1HXMA 1S9VB 4I2XA 4MJID 4XPFL 2JE8A 3LHPL 3EYSL 5JPMA 5F7LB 5J06A 4Z7NE 3F62A 2YEZA 1P7HL 3VU2A 1HHIB 2APBA 3C5JA 1DQDL 4W81A 5DD3H 2PXYA 1S5HB 1J1PL 2WK2A 1ZGLB 3C5ZA 1P7KB 4JZJA 1T1YA 2FIRT 1GIGH 2AXHA 1TVBA 2DMCA 2O5YL 2D0GA 5I1EL 1ORSB 5D1XB 3B9KC 3RAJL 5DRZB 4X8XA 1X5FA 4QY8B 4ZPTA 3VXQB 1WTGT 5E2UL 3EJJX 3T1FA 1WZ1L 1ED3B 4GJTB 2EXYD 1FNAA 2Q86A 2H8PB 2XG4A 3MRLB 2Q8AL 4YFLF 1PQZB 3UCRA 3QCTL 1KJVA 5E8NA 4NQED 4PJ7B 4NRZB 4JY4B 3QQ3B 3GIVA 5DC0A 3I84A 5HGHA 3E2HB 3U79A 4QT5A 4Y5VA 4ODUA 2F74A 2HKFH 1DBJL 4TSCL 2JKXA 3QXWA 5HHOA 3BEVA 3VGBA 1SVCP 5DJ6B 1CK0H 3DNKA 2WBJC 2EZ0D 3PWPB 1MCNA 4KPHH 5BZWB 1VADB 3UTZA 5T33L 1K4CB 1MEXH 4G8IA 3NVQA 5GJTL 3SJVB 3QXTA 2AXGB 2MSPA 4YEFA 3QZWA 2BNRA 4L8BB 3BRGC 2VXVH 1NL0H 1FNSL 1BEYL 5DFWH 2EDBA 3DI3B 4BM7A 5MEQB 2E8ZA 3RX8A 4U6VH 4W70A 2DRUA 1J0IA 1UXWB 4Q0XH 4GLRI 3GRWA 5MENB 4HS8H 4GKOA 4GUPA 1KB9J 5GS2D 3GSRA 3MACH 1HINH 4D9QD 3O2VL 3MRRB 1BQLL 1A6UL 2OTWA 1R24B 1ADQA 1N4XH 4MXQD 4OUUA 2YPKB 5CGYC 2X09A 4ZNCD 1XF2A 2V7NB 5E8DL 4N1CA 1H3XA 1P6FA 3EGSA 1RZ7H 1VGEH 3VE0A 5IGXH 4OIIH 3K46A 3BGFB 2IQ9H 5ILTH 4V1DA 3IT8D 5H2BA 1UZ8B 3O4OC 1W2KT 4M93B 2W60B 4N9OB 9CGTA 4J6RL 5I6XB 1FGNL 4G7YL 5J57B 1VESA 4P2RA 2BP3A 3DTXB 1QBLH 3LS4H 3TT3H 4DGVL 2Q7NA 2AK4D 5DFTA 4KMTL 2OBGA 5DFVD 1DUZB 4OF7A 1XEDA 5C6PB 2FO1A 4D0DB 1R0AH 1EHLH 2BVQB 3V6ZA 4BZ2H 4YHLL 1HH6B 3RZCA 4EZMA 3CX5K 2ICEA 3B8SA 4TQEH 4XP4L 5CJQL 5B39A 1C16A 3LIZH 1S8DB 15C8H 2IBGA 3RY5A 5TFSH 3WFEH 4QRRD 2W59A 1WIPA 5ISZB 2AJYL 4LHUB 5E8EB 1I8IA 3MV7A 4IDJL 3MLPA 5AUMB 5DK2A 1NAMA 2E7MA 1PKQE 5D71L 3S3PA 2FX8L 4AEHL 4ERSH 1ZHNA 2W92A 5IM7A 1I4FB 1ADQL 1LO3L 2DQFA 1T04B 2FB4H 3IYLW 4PTUA 4BK5A 4HXAL 4PLKC 5JW4M 1LO2L 3EJYC 1QRKA 4FFYH 1HCVA 1I3VA 1A14H 4ODHH 1J11A 4PB9H 5E94A 3ZDXE 4LSRL 3B9VA 3JBG7 4M02A 2EDHA 2XNAB 1I9RL 4OTXH 5BXFB 4ODWA 5FECA 5I8OH 1CU4L 5DD3L 4KKBC 4RMWA 1MFBH 5T5NG 3QUZA 3MA7A 4KROB 2F5AH 4POZD 5GRZA 4ODWB 2YD4A 4P23D 5F88B 4YGVA 4XWOC 2FH6A 4FQCH 4MDIB 4LCIH 5HXMA 4P2YA 5EDXA 3MV7B 5C0CE 1A6ZB 3K3QA 2ATPB 3QG6A 3RGVD 4DCQA 4Z7QE 4NC1E 1K6QH 3SBWC 3NAAL 3U6RB 3QXDA 4QOKA 2FJHA 3EYVA 4ODBD 3E6HB 2ADIA 2DLFH 4G9FE 1OAXL 4HUKB 3WSQL 3GKWH 3V9FA 5B3JE 5MHSE 4FFVD 5A43C 2D7QA 1LDSA 3O6FC 3HMXH 5JXAL 3FFDA 3DROB 3MRKB 35C8L 3T0VA 3B9EA 5F7DA 4RAUA 3G6JB 2AEPH 2A77L 1RIUL 3PL6B 3B5TA 3DTXA 2IPUG 2GSGB 3L5XL 2OZ4H 4PP1D 2CD0A 4I2XE 3RIAF 4P2QD 1EV2E 4Q9RL 3GSNH 2WP3T 3ZE1F 1XCTA 3GJEA 4OZIF 4YLQT 1EXUB 3CVHL 1L7TL 5ADOL 1DQQA 3I75A 2Q87A 5I8EA 5L7XH 2B2XL 1YEDA 2CO6B 1NEUA 2J5LC 2VTFA 1Q9WA 2Y4SA 3T0EA 2VLRA 1RURL 2AJ3A 5IWLC 3CK0L 3WCYA 4WO4D 4X5WA 1SBSL 2ZG2A 4ACPA 5F9JB 4HCRA 4XNMB 5CZXD 1YNTB 1KLGB 5K9JL 2VXTH 5IROC 4XB7A 2NNAB 5T1LD 3SE9H 1D9KB 4EXKA 4G8IB 3MMEA 1I7ZA 5H8DA 1K5NB 1YMMD 2DLHA 2PF6A 1JF6A 3JTSA 5FIEA 3S37X 4L8BA 2Z8RA 5E4EC 3DSFL 3PE9A 3LKPB 4YPJA 1CZ8L 1CFVL 1IQWL 3UJTH 3RI5F 1RURH 4QT5B 4Y5VB 4M9OA 2VDLL 4JFZL 2CMRH 3JSSA 4JQIL 1CT8B 1MIEH 1S78D 2FBOJ 1U8LB 3FHQA 3CXDL 3PWPA 1RUAL 2IALB 2HJKA 1Q9WB 4G6MH 5I16A 3QPXH 2JK5B 4DKFL 4Y16D 1G9NL 4NRXA 2CIKA 3LKRB 2Q86B 3K80A 1IMHC 1KBGH 5TDNA 4F7TB 2ZZUT 4JFDA 1WBXB 1EVUA 4PJ7A 1I1AB 1MY5A 3QDGE 4PJ5B 5HI3D 1Q9LA 3D2UD 5DDHA 5ICZA 2R2CA 5IB3B 4XP4H 2AABL 2EKSA 1NGXA 1A6WL 3GEWB 5FKPA 4N0UA 5IBUB 4X5XB 3O3AB 5SX5H 3TNMB 5BZWA 2D7NA 1ZVYA 1MJJA 2KUTA 5GGUB 1YDPA 4HJ0D 2WIMA 4X6CE 4WI7A 2UWEF 4LSVH 4I0PC 2B20A 5GGRB 4GT7A 1FN4A 3WS6C 2YS4A 4DZBA 3D2UB 3O3DA 1N0XH 4KUCD 3O2DL 3SBWA 1I1YB 2R29L 4X7FC 1NUNB 3VFPB 3VW3L 3U4AA 1KTDB 2X41A 1FP5A 5I1CH 4O4YL 2IMNA 3V2AR 5L2JB 4KHTL 4PLJC 4Y16B 4OTXL 2CR6A 2N56A 4G8GA 2A6IA 2AEQL 1V3KA 4DVBB 1S7TA 4Q9CA 3VXMB 1ZLVK 4KJWC 3GI8H 1FL6A 3RKDD 4QTIH 1R3LB 1QHPA 1JNNL 1EAPB 5IB1A 3ZKMC 2UY6A 5SX4I 1FAKT 2X1OA 1GC1C 2X1PA 1JRHL 3O2DH 4LLVB 3GMLA 4LCWD 4D2NA 2VQ1A 1MQKH 1CN4A 3KPTA 2YSSB 1YMMB 4X6BA 2J88L 4FXLA 2VDQH 2A6JA 4NKOA 4OD3L 5LCVH 5FB8A 2XWJB 4YHML 2UYLB 5ALCL 3O4LA 5AUMA 2W38A 1G9EA 5C8JA 2YSSA 3RU8H 4NUJB 4HT1H 1QFOA 5IWLA 5IUSA 5JA9A 5LWYL 4PRIE 2Y7QB 5DURB 4OF3A 1HEZB 4D9RE 3QEHB 3P9LA 4LU5L 5L2JA 1N5AB 1CD8A 3QUKA 1Y18A 3C8HA 1OY3B 2PTVA 2BFVL 3CLEH 4JREC 1TTFA 1XR8A 5GGQL 3REVA 5AYUL 5DXWA 3SJVE 5DD1L 3KXFB 5J6GB 1AR1C 3WFDL 4P46B 1QYGL 3LEYH 2VH5L 3WV0A 4NQTA 3WDJA 4WW2C 4PJ5A 3PHOB 4QTHB 5KG9A 1BLNA 5DK2B 3BDYH 5LBSL 3WS6A 1M71B 2W1NA 4RMSA 2D7PA 4OSUH 3PGCB 3C6LC 5I8KL 1YEHH 3OB0H 1F02I 5BV7C 4URTB 2ZNXA 4UINL 4KKAC 5F9WC 1Z3GH 5HHPB 4Y1AD 4L4VE 4JM2C 3VFGH 1F3DJ 4Z76A 3KLDA 3ARFC 3BE1L 2BJMH 3FRPA 2IH1A 5A40E 4KK9C 5BRZB 3GI9L 1MLBB 4QHNB 4OLYL 4RGND 3UO1H 4NZJA 5HI5D 4BH8A 3LKPA 2NY1B 1JN6B 1NCTA 3PF2A 5AZEL 1NGPL 1ZMYA 2F8XC 1U8LA 1Q9OB 4ZTPL 3RKDC 2E7LA 4MQ7A 1EFXA 2X4TB 1E6JL 3H7BB 1UXSB 1LP9E 1JN6A 5D7LA 3UBXI 4MDJB 4E42B 4FQXA 3RWDA 1JI2A 4ZSOB 2MKLC 4PLKD 4HKXB 4HWNA 5FV1L 1BPVA 3FO9B 5HGHB 4ZPVA 1UEYA 5CKAA 3OAUL 1TJIH 5LGHH 5C2UB 3RQ3A 2V6HA 3HTLX 4G6JH 4RMTA 4NWTL 2EDOA 4K7PH 5CSGA 2ZUUA 5F9JA 3LKQA 1CE6B 3BPNB 2KQNA 4RISH 3GIVB 3GK8H 3JWOC 4IS6B 4CL7A 2WBJA 1RJYA 2BMKA 4HW6A 1A9EB 4WGVB 3MUGB 4PJGB 4JPIA 1T4KA 4IRZL 5GGTL 5GRYA 3V5HA 3MZGB 2NW2A 3QI9B 3C9NA 2AJZB 5HVHB 4PGZA 4FQXC 3LSOB 5E24E 5TDPB 1OWWA 1T21B 4ZO6A 1TZHB 4RQQB 5CJOL 3PWJB 1Z9LA 2APWA 2OJEB 3DURA 1NEZG 5F88A 3FB6A 3G5VA 1MCIA 3IFNH 1JWMB 3FB8A 2LAAA 3L3GB 1MHHA 4LSQL 3ALWA 4Y16C 1Q9KB 4KHTH 4XCEA 5HYSG 4L3CB 5ERWB 3V0WH 1H9VA 4H20L 4PBWD 4ZQKA 3HMXL 5MP6H 5GJTH 2GJZA 2B8OT 4KZDL 1CD1B 4R3SB 1OAQL 1MFAH 2D31A 4L29A 4Y2DC 1CTNA 2DTMH 1XH3A 2FSEA 3EFFA 3PWLB 4M7KH 2EIZB 4R3SA 4ZFOA 2DBLL 2R56L 4LVHB 4XHJC 5F3BB 3OGOE 3L3DB 3MCKA 1EHXA 1IM9A 5CBEA 1T1YB 1LK2B 2BOBA 3WIHA 2QSCH 4LK4A 5J0BA 3VRJB 4YX2L 3HUJE 4DOHB 3EYUH 4HFUL 3SCMA 4UT6H 1RZ8A 2J8UE 1PSKL 5SWSE 3NABH 2DWEA 3L3OA 1JPGB 3K1KC 3WNKA 1AJ7H 4IMLB 2WBJD 4O2EB 5IBUG 3QUMA 3WUWA 4ZXBA 3JWOL 4NQSB 5D2NC 3SJVD 4JFHD 4M1DH 3KLAA 4WHYG 4JZJC 5KANG 4YFLI 3OB0K 4G9DB 4PRHB 1S7UB 3RGVB 2VYRE 4PRIB 3ARFD 3MV7D 5F6HI 4GW4A 1OSZA 4G5ZH 3ZZ1A 4NBYB 2ID5A 5D2NE 2BK8A 2NY6D 2BRRL 5ESQA 2XPGA 4O2FA 1MRFL 5DD6B 5CIPB 4GAGH 4Z95H 1A9EA 3R1GH 5I1LA 2HLAB 5EA0L 5SV3A 2O26U 4TULL 4PJ5E 4XPFH 2ZCKL 4DKFH 3L7EB 3L3IB 1INDL 4NQXA 2X2YA 1DQDH 5T3XE 3HFML 5FYJD 1L6ZA 2O5ZH 2DTSA 1U92A 1FNLA 4L3ED 4NQVB 2O5XH 1G6RA 1NAMH 3CDGB 4RDQF 2XV6B 4OGZA 1XGQA 5IW6B 2APTA 1I8MB 5D1XD 2NX5D 5EIIA 1ZV5A 4Q6YA 5FA3A 1NBVL 2NTFA 2IGFH 1V05A 3FO2A 3GSRB 1E6JH 3KYOB 2P46B 3B83A 3KG5A 3SDAA 5JQ6H 5INDB 1KCUH 1R3IL 4IHOA 3GZKA 3U7AA 5KW9H 2BNUA 5K93A 1EGJL 1B90A 5JW3H 1OF2B 1WC7A 1Q0YH 4NN6C 2O61A 2V5MA 3U9PL 5HBBA 1JPTL 4K9EC 1I85C 5HVHC 3CLFH 2W9EL 5EC2B 1NDGB 3H7LA 3QPQD 2B1HL 3K2MC 4OKVA 1SYVA 3IETB 4DQOL 3ZYOA 1T1WA 1ORQB 5E70A 3K8LA 3WO4B 4HPOH 3LKSA 1GOGA 5FUCE 2J12B 3X12B 5A2LH 4YBLB 4JO4L 4H1LA 1J88A 3L1OL 4WO4C 3CSBA 1SEQH 1KACB 4XHQA 5D96C 1C08B 2QJDA 2Z0BA 4FXKB 1OPGL 4HV8B 2CDEB 1H5BC 4HIEB 3U83A 1K2DA 4DKEH 4X98A 3EOAB 4JM2F 5J3HC 5L2KE 1IAII 2E9BA 3DMMA 2GCYA 3QHFL 2NY7L 3O6MH 1GGBH 4JM4L 2KH2B 1I9EA 5DT1H 5D9SB 1OB1B 3RWEA 1XGRB 3T65A 1U3HC 4D0CB 1C5BH 5DUML 5GIRB 1QLFB 2Z35A 1NGZA 4N0FB 2R0WH 5E8NB 3N06B 1KPRA 4WFHD 1RK1A 3VWJC 5L9DH 2EC8A 1UM6H 1CE1H 4PLNC 4TNWK 2IAMA 2PW2B 3VXNB 2QHLA 3U2SA 2NPLX 4YUEL 4JQVC 3JVGC 5MHSD 5FECB 2AJVL 1E4KC 5D1ZD 3V6BR 5CD3A 5F8QC 4UV4H 3M1BA 1W72L 3VGFA 5EZIL 4F33B 1G7MB 3HPJB 1SVZA 3DYOA 2X4SA 3GMPA 3PWPD 5DJDA 1TZGH 1MCPL 4ALAH 5C0EB 3CZFA 3IDMA 3O6LL 3P30H 4LLMB 4YFDB 5DJ0A 1AGEA 1FFNA 2R0WL 3MRJB 3FB7A 4WEMB 4YHLH 4BZ2L 4GBXC 1YN7B 2LVCA 3HG1E 3FONB 5IHZA 3VI4F 5AZ2L 1AJ7L 5F89A 4MHHG 1CFVH 3UJTL 4NQSA 5C3LD 1JK8A 3SKOA 2VITB 3LQAC 4CN1A 1B3JA 1YDPB 4XNYL 3B9KA 3TWCL 3S37H 4PRDA 1IGFH 3WFEL 4AMKH 5F8RC 1GGIL 3KYKL 1LEKB 4LRIC 4XZUA 3F65A 3I9GL 1NLDH 1FO0H 4FTVE 2R8SL 5F3HB 2OR9L 4LDOB 4PG2C 1J05A 2IMMA 5L88L 4R6UA 3MODH 1WT5A 2QR0A 5HHXH 2W0PA 3P73A 4I77H 1YEJH 3MLZH 4Y4FD 2EIZA 4Z77A 1RI8A 4DVBA 1CR9H 1U8IB 4WY7H 2FD6L 1S9XA 2ENSA 1ZANL 4PJHA 3L3GA 2CXGA 3F7VA 4NOFA 4LRIA 2EXWC 3QUXB 3VI4E 3ZKND 3UTPD 4XP6H 4YDIH 3QCTH 4OM0H 2R29H 4WFGE 2ADFH 2GT9B 4WEUD 3Q6GH 2V7HB 3D3VD 3WLBA 4OZGE 2F54E 4ZSOE 4LSUH 3ZTNH 3GKZA 1NGZB 3NOIA 4N0FA 1DEEB 3IRPX 5GS1B 1U58A 3KPRA 2OQJB 3BP7B 2DM7A 5BO1L 3GBLA 3RPIB 5GGTH 2ZJSH 2P49B 1CDCA 2QQNL 2VE6A 2VJXA 3GM8A 5MERA 4P48A 2X70B 3UTTB 3KPMB 2Y5EA 1XF1A 2G2RB 1PAMA 3AAZA 1NSNH 4FQLH 1KXVC 4PRHE 3SJVA 1T80A 1E4JA 4YHKH 1FZJB 2OR7A 4DK3A 3ZYJA 4EI6A 1CTOA 4JDZA 4NN5B 2XZAH 4X6EB 4IM8A 2IAMD 2VN7A 3FMGH 1OGAD 2DS4A 1JGUH 4Y2DD 4ODXA 4BQCA 4MD5B 4NWUL 1IGCH 6FABH 1X5LA 4O5LH 1NAKH 3MGAA 1EFXB 2VR4A 2VABA 4JR9H 1KIPA 2CGRL 3CVHH 4NCC1 1RZFL 4JFQB 4OCSL 4Z7VF 1MAML 5EU6D 4K7PY 4YZFF 2IQ9L 3G6JA 4YWGH 1RZ7L 1IL1A 3K2UH 3MRBA 5EUOF 2B7DT 4RMUA 4ODVL 2E7LC 1M71A 3B6SA 3QQ3A 4UUJB 4ETYA 3VXUA 5F72S 3E6FA 4IHOB 4MNGE 2DBJA 1U8PB 4CAGA 2F5BH 2H1PH 4QOKD 2JTDA 3PGDA 3KYMB 2NMSA 3ARGB 3Q1SH 3OR6A 3FT4A 2UZYB 4PJBF 3MRFA 2IH1B 1MWAL 4XP5H 3T1FB 1K4CA 5I1GH 1OWRM 4R9HA 1CGTA 4NN6B 2FX7H 4YUEH 3P0VH 3JWOH 4MDIA 3RVTC 5TPWL 1MIEL 1AP2A 1PQZA 3HNVH 5HYSB 2VDLH 4JFZH 1MREL 1GZQB 3I6KA 3GJEB 3NPSB 1KPUB 5E1AA 3O0RL 2FEEI 4MJ5A 2H6PB 4C56D 4R4NC 1SEBA 4OQTH 4KHXL 4DVRL 2AI0H 3QA3B 3VFUB 5BVPL 3O11B 3RWHB 2NXZD 1PZ5B 1IKFL 4HBQA 2VITA 2LAGB 3RA7H 3IVKA 5D1QD 1D9KC 5FUOL 3M8OH 5DYOB 2YOCA 4RIRB 4QHLA 1A14L 2E9WA 4BK4A 1S7XA 3MRMA 3TV3H 5C0GB 3TWCH 2ZUVA 3IU3B 2OK0H 4EN3D 4S2SB 4J3VA 3CZFB 1MFNA 4JO3L 2VISA 3UPCA 2NY0C 3QIWA 4LSPL 1N59B 1BFVH 4H8WL 3GBML 4KK9D 4L3AA 5HYSA 3GMNB 2ORBH 4K7PL 5C0ND 1DQTA 4KV5F 5HI4D 4LLUB 2GJ6D 3VFPA 5FGCE 3P4MA 3MV01 1CWVA 4KKAD 1JPFB 3OR7A 3FQRA 5JQHC 1IRAY 2MPAL 2GTZA 2VAAB 4S1DC 3M8OL 2EDJA 1AE6L 3IS1X 2HFGL 3MFFA 2GUOA 4B0MM 4XXDA 3HI6L 43C9A 2PW1A 5KSAA 3FFCA 1AGBB 4OLVH 4L8SC 1XH3B 3EFFB 5T1DH 4AM0B 4XCEB 4JANA 4WFFD 3MLVH 1BFVL 1FN4B 4PP2B 4HQQL 3TIDB 4EUPG 5E9DB 4XH2A 2EKSB 4QXWA 4DN4L 1K9TA 3IDXH 3SDCC 2R4SL 1RY7B 2PTTB 3TJEH 4YGAB 3IJHB 1CF8H 4G6AC 4CVXB 2C4XA 4L9DA 3ARGA 2F58L 2AQ2A 5IMMA 2DQGH 2I07A 4FP8L 3S4SB 3V95A 1NMBL 4IOIB 1AFVL 2ZUXA 4GG6F 1BZQK 4KTEH 1TQCC 3V6FA 5CS7A 3BHBB 3B2VL 4NFCA 4PJDF 1QR1B 1WBXA 3L95A 4OZFA 3C2AH 3DUUB 3WFHA 2Y07L 3B9KD 1R3HB 1DL7L 4UTAH 3DBXB 5C0BE 3OSKA 3RY6C 2B0SL 4R7DA 2EIBA 5I2IA 1NC2B 4E0RB 3VA6A 2P5ED 4YBHA 4YEEA 4HMEA 1PFCA 2EEAA 5CEXB 4P0DA 5SWQA 3HCVA 3MROB 4TNVF 1GVIA 5KVFL 2H26A 2VDML 4JGMA 4MD4B 3TN0B 3NABL 3QQNA 1U3HB 1QFWL 4A6YB 4U2ZA 5CP3A 3ZHLA 1S9WA 4GG6B 3DHMA 3LHPH 1ZT7A 2EH8H 1EJ6A 4AEEA 1D5MA 4MCYA 1QOKA 4WI4A 2I60L 5FO9A 1EA9C 3N1PC 4J2XA 1RFDH 4NYLB 4IRSB 4ODTH 4G6KL 4JHBA 3HE6C 3VD4A 1VFMA 1NLBL 4PJHB 1A6VH 4RSVA 5CLWA 5HI5C 5GRVL 3HE6A 3P4LA 3QG7L 3RVXC 4NBZB 1HH9A 4JY6A 1HQ4A 5E7BA 4ZPTB 2I26N 2DQCH 2OJZL 1NANI 1MRDL 3MNWB 1S7RA 5F21B 1MIML 3STLA 3CDGA 3DGGA 4UIMA 3PIQA 1OAUH 1LO0H 3QBTB 3SDCA 2EH8L 4M8QA 1BIIB 4N90E 1WZ1H 3VFWB 3GSWB 4E41D 4JFEA 2O5ZL 3OKDA 1DQMH 1WBZB 5GS3A 1O7SA 2R0ZH 3O3BA 5K9KA 2V5TA 4XMLL 3LS5H 2NR6C 2QQQA 3ILPA 2OM5A 4LNVA 4UDTB 4XH2B 3PP3K 2ZSVB 3D5OF 3ROLA 3NTCL 3ZTJH 4TSAH 3T8XA 5IG7A 2VWEC 1FH5H 3MPCA 5HGBA 4NWTH 5EUOE 1KUMA 4S1RL 5C0AE 4OV5A 1UCTA 3QUML 5FYKE 1HHKA 1Y18B 3QCUL 5CILL 2VO5A 2ICWJ 4GMSH 4BH7B 4JPWH 1CICC 5C0IB 3DX9B 4F3FB 3CAFA 4AENB 1DVFB 3NACL 2NY1C 4WTZG 5JIHA 4PY8J 2PTUA 4LBEA 3D69B 5FYJH 2GK0B 2R0ZL 4Z0BH 1U8IA 4XMLH 4YC2C 3VFMB 5IQ7L 1ES0B 1S7WB 5HGGS 5C0IA 2VZTA 3BPLC 3CC5A 4YK4B 1VPOH 4M8VA 5JW4R 5CJBA 4ESKA 2BVEA 3P11L 4MNGA 4M6AA 1HYRC 1EERB 1HWGB 2WBWB 3GM0A 3VFMA 3DX6B 2C5DC 3BQUC 4UBDD 2FWOA 4U6VL 1YPZB 1AXSB 4RBPK 2DLGA 1N6QL 1J86A 4C59B 3RNQA 4OZ4A 2ZSVA 1RK1B 1YN7A 1MQ8A 4FABH 1JTTA 1NCCL 1TITA 3O9WB 1UCBH 3C5JB 4UZGA 5CP7A 3TO2B 1A1OB 5KVMC 3QIWB 4ORZC 4UU9B 3UAJD 4WEBH 4Z9KB 3QO1B 2D7OA 2XA3A 4QRUB 4IRJA 2VWEE 2Q7YB 1YJDC 4NP4H 1KJMA 4K2UL 4M3JA 3SE4C 2NTSP 2VLLA 5E4IA 1LQSR 1A22B 2H41A 3CD4A 3MQIA 4LCUA 4HKJB 5DJXB 1SYSB 5DT1L 4M7KL 5DYOA 2GYSA 3RVVD 4H88L 3ZE0E 4Y4HD 3HZMA 1FNHA 4XRCB 1JZ6A 1KLUA 3V8OA 4NN7C 4R2GB 5BW7A 1ACYH 5F7KC 3MLWL 3V4UH 4XBEH 1VERA 3EHBC 2F58H 3TFKD 1JJUA 3WFDH 1FNFA 1WCBB 1ZHLB 5E7FA 4PJAB 2RCSH 2H6PA 12E8H 1RHFA 2KQMA 4N0CD 5EU6A 1UM5H 3HB3C 3I50L 2AK4A 5DJZA 3GSVA 4JJ5B 5L9DL 5E9DE 1KENH 2DD8L 4GRLA 3OJDB 2F9BT 2YPLA 5CJQH 5H94B 4JFEB 4YHYB 4YBQC 3FOLA 2Y07H 1A3LL 4LLDA 3S36H 5ADPH 5DHVA 4EXPX 1A02N 4P49A 1IM3A 5CEZL 4P9HH 4KJYA 3X14B 3PV6B 4MCZA 1OF2A 2DJSA 4P9MH 1PY9A 4IRJC 4J3WA 5KS9F 5EOCH 3KPPA 4W4OA 4MA8H 4GS7B 1JPST 4IIQB 3C08L 3VJ6B 3AREC 5EC2A 2C9AA 2ED7A 1S9YB 2X4NA 3CGTA 3EYOB 4HS6A 2BOCB 4XBGA 5DMKA 5DQ9A 1M7XA 4JZOB 2AXGA 2C26A 1YUHA 4I48B 4JO2H 3BKML 2VE6B 3AS1A 4ONGH 4XAKE 3DUUA 1KCVH 2BSED 2E8YA 3F58L 3KJ4B 1U2HA 5H2BB 5AD0A 4JFOB 3VFNB 1JMXA 3MTRA 2Q76B 1ZHKA 2EO1A 2B5IC 2XQBL 5C0JA 1XF3B 2QKIB 4Y19B 4LSRH 3W82A 3VFOA 1RIHL 4IRJD 1CD9B 4OAWA 1SMOA 3MJ8B 4PGBA 5IVZA 4KRPD 2QKIA 4Y19A 5IF0B 1W8OA 4XPBL 2JCCA 1CICA 4L4TA 2MCPH 2XPGB 2NXZB 4KRLB 4Q58C 2EYRA 1EEZA 4JO2L 1M7IB 5FYJE 4GRWE 4QGYA 5IESL 1QSED 3SDDC 4MZ2A 1J0JA 3MROA 5FF6A 5TE4L 4JO3H 4NCDA 2WQRA 3QIBD 1T2XA 1BVKB 4J3TA 3EZ8A 2GFBB 5ID1B 5IMMB 3DROA 3HKFA 2VC2L 3MRNB 1NFDE 4F9LC 1QP1A 3I6LD 3VD7A 1TDQA 4X6DA 4B50A 1ZA3A 1AY1H 2WUBH 1FGVL 3MCLL 3GSOB 1BBDL 4WV1C 3KPLB 3ROOA 4ZO9A 1CLYL 4M7ZB 4ZFOL 3BRFA 3ZKXB 2XZCL 5I8CB 4NQCB 4YFEA 3HZYA 3PGFH 3FQRB 4DGIH 3GSVB 4JJ5A 2VIRB 4PJ9B 4PGCB 4U6HB 3A67H 2H45A 3VGDA 1Z9SA 3JWDH 1J12A 3C60A 1XMWA 1IEAB 3ARUA 3OG6B 4MNQD 4K3JH 1QRND 2EH7H 3WFBL 2IH3B 3NIGF 1F58H 3OF6D 1F2QA 1MCLA 4OD1L 3BYYA 3LH2H 1CXFA 5T3XD 5IEKA 5DRNB 2E27L 4P57A 3JV6B 2XWBB 3WEXA 1ZXQA 2JIXD 3BD5A 5T1KD 1MH5A 3BW9B 4XCCL 3VRLF 5E94B 3EYVB 3O4OB 4F7CA 3ORJA 1Z0NA 3UPRA 5F3HA 3BKJL 3QHFH 2OCFD 2Y7QA 2GK0A 2PNDA 1IE5A 1DSFL 4GW5B 3EOYG 2VAJA 3F7PC 1UWXH 5ISZE 5KN5B 4OF0A 1BZ7A 2IC2A 3MV7E 3MUJA 1A3QA 2R2BA 4MQTB 5EWIL 1UM6L 1FNGA 4BSVB 1QVOA 4FFWD 2VIRA 2A9NH 5IJVB 1K4DB 1HCFX 1N59A 1AXSA 1RUAH 3MRFB 5CSZA 5EZJB 1A21A 5EZLB 3DMMB 4HGWB 2OL3A 2WQ8A 2J6EA 3G9AB 4R8WH 3DX9A 4F3FA 1E28B 2CLRB 1H3WM 3QSKB 4FTVA 2OJEA 3DURB 4NO0A 1QLFA 1JTPA 4X80L 3BH8A 3W39B 4LHUA 3MUHL 3ULSA 1DQLL 1OW0A 5LQBH 4EDWL 3SDXA 4L5FH 4XWGH 2H32A 4YXKH 1K2DB 5IM7B 4G8GD 2IFGA 2BDNL 1HYSD 2JCCF 2WP3O 3UROR 1A5FH 1UVQB 4OV5B 4IOFD 4YQXL 4O2CA 2V9QA 4DFIA 5CUSH 3IDNA 2AS5M 2ICWA 1MREH 3HG1B 3HE6D 2DF3A 4M43L 2NXYD 5FYLH 4BZYA 3IGAB 1MOEA 3RTQA 5F7FA 5CEYA 4D0BA 3SE3A 1EUUA 4KKLD 4RX4A 5C6TL 1LO0L 3RWIB 1PLGL 2X4QB 2NY0D 5HHNB 5DGQA 1A3RH 4NT6B 3T0WA 4Z78A 4WY7L 2Z92A 2BDNH 3S8WA 4D9LH 5J13B 4HZLB 1RMFL 1OVZA 3W9EA 4PGBB 4RFOL 4AZ8A 4XPHH 2E6QA 1OAZL 3IDIA 3MOAL 1J5OL 4U1LA 3WHE1 3DX7A 1RUMH 3VGGA 4M7LT 3KR3H 4KI5F 4MQXC 4MVBC 4YDLC 4O02H 1BHGA 1ZT1A 4QTIL 3AMLA 4LF3A 4CVXA 5DMYA 2CUHA 4DGYH 4Z7UB 1F5WA 1GAFH 4WV1B 3QEUA 1QKZL 3G5XB 5KSBB 2NLJB 3BP7A 2H32H 3QO0A 2YKLL 3PV6A 5CD5C 5D96B 3SE8L 1ZT1B 5JOPD 4WCYL 1X5YA 3TA3A 3N1GC 3HNSH 4EBQL 3F7VB 1ZTXL 5HJ3B 1PJ9A 1G1YA 4ZNEE 5TE7L 3ILQC 1NH6A 4MB4A 4NSKB 1TETL 3G6JE 4KAQH 2X4RB 3L7EA 1RZIA 5C0AB 1BBJA 1ZWIA 4ZYKA 4PBVC 4BKLB 4NO5B 3TNNA 5BV7L 2YN5A 1JZ4A 3QUZC 3MCLH 4N5UA 4O51A 1G6RB 1Y6NR 1DBAL 4U6YA 3FAXA 2YD5A 3MRLA 4HLZG 3FO1A 3HE7A 3WJLA 1UACH 4M62L 5HHOD 5EIIB 3U30B 3C5ZC 4X6CB 4WUUA 3HRZA 5D7IA 1A7NL 3ARQA 1JWSA 4KK8D 1PX3A 3VWKA 5JW5B 1MAJA 5TE7H 3RNKA 3KWWA 4NWUH 3QXDB 5C09E 1T22A 3MLXH 3GJFB 1CG9A 2I9LB 4HS3B 2D0FA 2P5WD 1CDYA 3RRQA 2FZ3B 5EH1A 2NY3B 3CMOL 2IANA 5D2LE 5C08D 1FYTB 5C0GA 3K2UL 5F3BA 5DA4A 3VFGL 5TFSL 4ORGA 4MYWB 2IPUK 4GRMA 2WAHA 3HMWH 5CZVH 1D7FA 4G5ZL 2HRLA 3O41A 3V52H 1NANH 4F7MA 1KIRA 3S7GA 2DQDH 1A1NB 5FGBA 2P48B 1OLLA 3P4MB 4ELMB 2R1WA 1E4WH 4Z5RB 1KENL 2DD8H 2R9HD 4P99A 5IFAL 5DMJB 2K7PA 1X5JA 3EOBA 1A7QL 1A9BB 4GRWF 1KTLB 2VKWA 4FFYL 2P4AB 1FNEA 5EZLA 4F8TA 1KT2A 1D5ZB 1BD2B 3LD8B 4PLJD 5EBMA 3NA9H 3RNKB 4ODTL 1KTLA 3WUZA 3QDJB 4CRPA 3MA9L 5I76A 1I9RH 4PJAE 1LE5B 3KPSE 3ZT5A 4JHAH 5FYLD 3RIFK 3U1SH 5ACZA 4M1GL 3B3IB 1Z6JT 4M6MH 2Z4QA 5EBMB 2NXYC 4H0IA 2F5AL 1OL0A 4L9LC 5J9PB 1G0YR 1CGXA 1MJ7H 2X9WA 3MR9B 3ZE0F 2EIEA 1IGJA 4P59H 2OR9H 1FLRL 3RVTD 1DBJH 4TSCH 3OJ2C 1NBVH 2WW8A 3G5ZB 3RA7L 1N8ZA 3G08A 4QHLB 2VLJD 3QAZB 4Y5XA 1HYSC 3CX2A 4AIZA 4X4ZA 4WUUD 3B6SB 5DMIL 1FDLH 1T7ZA 1PYWA 3ECBA 2PKDA 4GKNA 5BS0B 1IC4H 4OJFL 4OUOA 2EICA 1QR4A 1W0WB 2WWMC 4XP6L 1HSAB 4LARL 4HV8A 4HC1L 2XKNA 1ZK9A 5EU4A 3UMTA 3RBSA 1F6AB 2P43B 1G1CA 1DLHB 2NY6B 2R1XA 2LU4A 3NBNA 3PG2A 3ZHKA 3IFNL 5CINH 3P40A 4TVPH 2VLRE 2XTJD 4MDJA 3ARFB 3IJYA 5CJOH 4KQ4L 4KJQD 5IOPB 4I3SL 1I1AA 2BMKB 5CILH 2HFFA 4ETQA 3MNVB 2PO6B 3IDIB 4UUJA 1R24A 2EDTA 1I1FB 3T77A 4QRPB 4D3CH 3S35L 3T0EC 3HAEA 1BX2B 2PYEE 3OKKB 5JXEA 4TRPL 2XKSA 2LTQC 5IGXL 4DTGH 3AS0A 4L8CA 5T1DL 2OMNA 4PR5A 4AQOA 5DUPH 5FGRA 1SBBA 2ZP0T 1MVFA 1WV7T 1CGWA 5KJRL 1YQ2A 3X12A 3IDJA 3VGHA 1I3GH 4UT7H 5GISL 1DQQB 3FB5B 1SY6A 1HHHB 5IW1A 1FZKA 1R0AL 5MEOB 4CW1A 3UXFA 1D5BA 1F58L 2GAZA 3K8KA 5IVXF 5INDA 2HFEB 4GRLD 1FNSH 1NC2A 2VXSH 1II4E 2DWDA 3SDXB 4JFDE 4HIIB 4NKMB 1ACYL 3E8UH 2BSSA 2ZG1A 1JHKH 3D25A 4LCCA 3OJDA 3OKYA 3LDBC 3OQ3B 1MCHA 5HGAB 1S5IH 4IBLT 2X42A 3EW3B 1UVQA 1MVUA 1J18A 1P7QD 1G9NH 4QNPE 3IAQA 2EZ0C 3MLWH 4K7PX 5DEFB 3V4UL 1IGJB 1MHEB 3QFJE 1RZJL 3G6DH 4N0UE 5E5MB 2V2TA 1YECL 4Z8FH 4MMZC 5EU3A 2J3SA 4Y4FC 5I1IH 4OLEA 5CEYB 4D0BB 2GTWA 4L4VB 1JHLL 5BZDA 5MEPB 5C70A 3QI9D 3L3JB 2J8UF 2EC9U 4KJPD 1P69B 1W0WA 1H8NA 2QQLH 3QEHA 5FGSA 3RFZC 2NW3A 2X4OA 5F96H 5DJAA 1KF9B 2ZCKH 1SM3L 2EDXA 1U6AL 5E99L 1WEJL 4KI5C 1P2CA 4OF6A 1NC4D 1W0VA 5CHNB 2QSQA 3WUWG 1JGEB 4XT1C 3UEZA 1YMMA 4X6BB 4P46A 2LU7A 3DGCR 1EH9A 2X7LB 5GJSL 4Z7WF 3T2OA 3WUWB 3V4VH 3NAAH 4YQXH 4LPCA 4PRDB 4ORGB 5JMRA 5E6YA 3H0TA 1DBKH 3OTTA 3R8BB 4DFHA 4PJEA 4H26B 3SDYH 1ZLUK 5DRNA 4ZXBC 4X9HA 4DEPC 1JUFB 3SO3B 3VXNA 4DZBB 4EUPA 5GS2H 3Q2CA 1VACA 1ZHBB 3KWWB 5GS0L 2DQFB 1WEJH 4H26A 1EJOL 4UOJA 3W11C 3FQXB 2A77H 3AU1A 1WZLA 1YJDH 1JZ7A 3BKCH 2IANB 4JRXB 4JN1L 1V7ML 1LEIB 1P7QA 3D87B 3OKOB 3LB6D 2EE9A 1WISA 2DB8A 4YBQD 2MPAH 4PJBA 3W5NA 4OGXH 3I6GB 3LV3B 1OM3H 4N0CC 4JGUA 3EO9H 1JF1B 3HRZB 2ADJA 2E3VA 2HG5A 2IBZY 4LHQB 4P57B 5F7EL 1TCRA 5FYJL 5ITBL 1S9KC 4J3OC 4LQFL 1EJOH 3EOAA 1T04A 4PV8B 5TJWK 5JOFA 3PIQB 3D85A 1UWEL 5FDYA 2AGJL 2V7NA 4QXGL 5C07B 3U7YL 1FYTA 5TE6L 2VZOA 3WNMA 4EBQH 3SDCD 4K3HA 3FT4B 4FQHB 5HDQL 4LASL 4XNUL 1BD2E 1KTKE 4IRSA 4X4YA 2EH7L 4UDTA 3WFBH 1JNLL 3GKWL 3QUZD 5EORH 2AKRA 3TZVA 2AW2A 1NMBH 2E27H 4QRQA 2VDRH 2AEWA 1HDMA 4KDVA 4OSUL 5I8KH 3IETA 4J12A 4PJGE 1XF3A 1W72H 2LFGA 4P5MB 1HSBB 1RIUH 1C5DA 3LKOA 4LCWA 3VG0L 4C58B 5F9AC 1OSPL 2VSDA 5D7JA 3C60D 4MNQA 3WNLA 4ODSH 5BMFH 3VDBA 4NOBA 1KB5B 3VMOA 1U42A 3RIFF 5SWQB 4LCWB 3T2NH 5L8LB 4PJFB 3NCBB 2H2PD 5I73C 3P0YL 2K9UA 3T3ME 3S36L 4KQ3L 3O9WC 2Z31D 3DX7B 1EMTH 4EEEA 4RA3A 4RAHA 1IEBA 4WUKL 4CADB 3TCLA 2EIDA 1T7VA 2N7AA 4BQ6A 5JW4N 1LHZA 1D5MB 4MCYB 1F45A 1IGFL 4AMKL 4P4KD 1OTTC 1NCUA 4E5XA 5L0QC 1QBLL 3WKMH 4JN2B 2H2SD 4XNYH 3D6GA 1NLBH 2OTUB 2HN7B 5ICXA 1MHCB 4TOYL 4F7EA 3BT2L 4RA0C 4OBRA 5I1IL 3T0EB 3NFNA 5L2KB 4HH9B 3GSNA 4JFFD 5ICYB 2OYPA 2FIKB 2BVUA 1K8DA 3GUTA 5IP4A 4GKSB 4O4YH 1K3IA 4TNVK 4EI5C 4OLXH 4JJHA 4LLYB 1G0XA 1W72A 4HIHB 1NKRA 1NFDA 4YC2B 4LOUD 5HYIA 5KW9L 1A7RL 5JIKA 3VFRA 2BVYA 4MNHB 1J9CT 5D5MB 1IGML 1C12B 4N8VA 4HC1A 1E27B 1KCSH 4M4RA 2YPLB 5H94A 4L9LB 4HX1B 1MJUH 1AQKH 4L1DA 3SO3C 3S5LB 5C9JA 4JDTH 4LL9A 1ZKAA 5DMIH 2EDRA 3OAZH 2VLLB 3JZ7A 1OCWH 4NKOB 4AQ1B 4NZTL 1T0NA 2HT2C 4UQ2B 5FKAB 3SCMB 2HJFA 1YY8A 2X4PB 3P9MA 3CVHB 4Y0GA 3RTQD 3T4AB 3GMPB 5DJDB 4B7LA 2X6MA 3EJZD 2VOTA 5IVXE 3VA2C 1AXTL 1T0NB 5F1IA 4LHJB 3IU4H 4GRWB 4BUGA 4EQ3A 2F54B 5FCUH 1PBYA 1ES0A 1S7WA 2R4RH 1IFHL 2D4DA 1KIRB 1KTRL 4Y4KD 3PWNB 1X9QA 4R7NA 4FMKA 3B9AA 1Z2KA 2FYYA 4MJ6A 2VSCA 3CSPA 3QEQE 1IC7H 3T4YA 4LLAA 1QYGH 3LEYL 3ZL4H 1F3DH 4JFFE 2VH5H 4F9PA 1ROWA 5BCAA 2I24N 4U6TA 1TCMA 25C8H 4L8DB 1ITBB 4TNWF 4KTEL 1T1XB 2PO6D 4OZ4B 1IGTA 3EOTL 2VZSA 3BVNB 4K3DL 3VXMA 2FZ3A 3LY6A 2JB5H 4EUPB 1YYML 3HI5H 5ESVB 3DYPA 3RTQC 2QTEA 5JDSB 1AKJD 2AQ3A 4UQ2A 2XXCB 5DTFB 1I8KA 1S7XB 3OKLB 3ILPB 5KSVB 3CH1B 4NC0B 5J8OA 1A6TA 5D7LD 4FQXD 4IMKA 4UT9H 4OD1H 3K1DA 3TCXA 3SY0A 2J8OA 4G9FB 1NC4A 4OD2A 3L6FA 2P47B 4PG2A 5F6IB 4MAYD 1KNOA 3V7AE 2VXUH 1GGYA 1MUJB 3GSUA 5I17A 4JKPH 43CAB 2A74B 3HI1B 2PYFB 4CNIA 4R4FL 5FGBC 3FQUB 4J7RA 4C56E 1OHQA 1RPQA 3MJ8A 1DANU 2MOVA 2VLJB 2FX7L 3BPCA 4CW1B 1ZLSL 2XN9D 1SBSH 4GS7C 5IHUL 2CRYA 4U05A 1IC5L 3KJ4C 3IKKA 4JB9H 4PV9A 1J0ZA 2Y9RT 1WSST 3BZFB 5IKCA 3QYCA 1B4JL 5HI4C 5FO8B 4JRXE 1X5XA 1S7VB 1XR9A 4PS4L 1I3UA 5IFAH 4F58L 1NDGA 1UKSA 2VDKH 1J1OL 1KLGA 3NH7H 3JWNC 1CDUA 1P6AB 1F3JA 1NJ9A 1BD2D 3B4NA 1F4YL 1ZS8A 2XACC 3AXLA 1OTTD 2R2HB 3ZKMD 3QO0B 1I1FA 5BVPH 4I3RH 1CLCA 2EYSA 5LQBL 1F4WL 1S3KH 1VADA 1KN2H 3HE7C 1PY4A 3AXLB 4Y8DC 2VLKE 4JHWL 3HS0B 1M6OB 4N5ED 2P7TB 1UXWA 5C71A 3QPXL 4G8FA 3LS5L 2QQKL 1KJ3L 5CUSL 4YHNA 1NMAH 4NHCH 2FB4L 3DV6B 4R96B 4ONHA 3TZVB 5I1AA 3BZFA 2OL3L 5E6ID 1UH2A 3ARFA 1FYTD 3IJYB 1BWMA 3ZT7A 1E0OB 4ZUWB 4WFEE 4YE4L 5SV4A 5IBLC 1A6WH 1CVRA 1ZSDB 1FRGL 3MNZB 4FS0A 1BQUA 2IPTL 3MLYL 2PYEA 4HPOL 1GZPB 2GI7A 2BZDA 4UNVA 1QEWA 4FXGA 4NQEA 3B5HA 3H2WA 4ZUVA 2FATL 5IVOA 2YR3A 3RZCC 4K8RH 2ZCLH 3ZE2F 5BRZA 2QQKH 1P4IL 5FGCB 3V6OA 3CU7A 4NUJA 4LCYB 3BP6B 4TVPL 4J1UA 5TF1L 4WWKC 4BQ9A 2P42B 3WXWL 2AJXH 2HKFL 1LEGB 4JKMA 3WN5A 2QV2A 2WWKT 4G43B 3WN5C 1CLYH 3UDWA 3M17B 3IDXL 2V17H 4PJ7E 1FYHB 3A67L 1P5VA 1KULA 5DUBA 4G7VH 4NNPL 3MBED 5IHZB 3TJHC 3KPQA 2HAZA 3UTPE 5L0QB 4RFNB 2R2EB 3DIFB 3T3MF 1JNNH 1CDBA 4X0KB 3SDDD 2H3NA 3CU1A 3S98A 1DL7H 3STBA 5DSCB 2R4RL 4JFYA 3BSZL 5C2BL 3EDFA 1F4AA 1BJ1H 4Y5VC 2XZZA 4K94H 4X0KA 2C1OA 1P5UA 1TVHB 3RWFB 5C92A 1ZGLM 3O9WA 4LEOA 1JCKA 3S5LG 3EIFA 2C1PA 4APQD 3CVHA 3T4AA 3V0AC 1A7OH 5CZXC 3O6FA 3RVUC 1T22B 4Y89A 2A83B 2YRPA 2AXJA 1KGCD 5I19H 1PG7X 4WW1A 1CL7H 3B2UC 5ILTL 2XWJA 2P24A 1XGUB 1MF2H 2Z8SA 4Y5YB 3DX8B 4B41A 5E8DH 5KN5A 1RU9L 2GW5A 3AUVA 3CXHK 4P3CH 4QGTA 5C1MB 5IMKB 3NZ8A 4IEFB 1F6FB 1AP2B 2O5XL 3HG1D 4POUB 4EOWH 4Z8FL 4PP1C 4CN6A 3V52L 3EAKA 5DZNA 3U48A 5B22A 5F1IB 3KYKH 3WDHA 4CGTA 1XGYH 2PR4L 3TYFA 4EI5D 2OJZH 1ZSDA 5J1SC 5L88H 3AB0C 3MV8B 3OKEB 1E27A 3LKNB 3KGRA 1SJHA 4UAOC 1NFKA 3PP3H 3HUJA 3O4LE 1P2CB 4JQXC 5FUZH 4JCLA 4NQEB 4BSWA 3HZKB 1NDMB 4ZAKB 5FO9B 4P5TA 4MWFA 5J13C 3BZ4A 1FFQA 4KI1A 1RJLB 2AXFB 3BE1H 2XQYK 4XXCA 5DJCB 3RY6A 5LXGL 1QSEA 4PJFE 5D72L 2ILLA 4F58H 4TSBL 4NJ9H 4OLZL 2PYED 3VWKB 4TVPD 3GSOA 1S9WB 4X6EA 1CDIA 3T0AA 4MS8C 2EYSB 2Q3AA 4M1CD 2YRZA 3WNPA 1O5DT 3KPSB 5F71A 3X3FH 3RL2A 1MI5D 1DJSA 4MD5A 3MGTB 4APQA 2P7TA 5FUZL 5GRVK 1WITA 5D7SL 3QUYB 1DQJB 2CDFA 3PABB 4Z7VE 3U36B 1T89A 2L4OA 3H42L 5GSRA 5T3ZD 3V5DB 5HY9B 5B8CC 4DZ8B 3B2UD 3BP5A 2ZNWA 2DWDB 4ZOAA 1F3JB 1NJ9B 3O8XD 4L8SB 4G6FD 3LOWA 1I75A 5I1KH 3UDWC 2HT4D 1UB6A 4PD4K 3UYOD 4I18A 3KNBA 5A2JH 4NRZA 3MNVA 4XVSH 5IKCB 1AO7E 3D39E 3PGFL 2ZCHL 4PJ9D 3F6LA 4U0QB 3TIEB 4RZCB 2D03H 4GBXA 4PJDE 3VDAA 5EOQH 3HNSL 1T5WB 1LO5B 5ALBL 3G9VA 1LD9B 1YQVH 4KAQL 1Z9MA 2YHGA 3CJJA 2AGJH 3J7HA 4PREA 1BEYH 5GRXG 2R1YB 1LE9B 1GGUA 4YHZL 3G5ZA 5J4MA 1XGPB 4IOIA 5DO2C 1QZ1A 1XAUA 5IEHB 3FT2A 2KDGA 1X5AA 4FQJL 3RVVC 3QIBB 1S7QB 2ZUQC 3QUMB 2NX5E 4F2MA 4H0HB 3S97C 3WNNA 5HPOA 4FNLH 2IF7A 5SWZB 4W6XB 1LE5A 3VFVB 1F42A 1UKQA 2Q3ZA 2LVEA 2D3VA 4KZDH 2Y25A 2EXYC 4NKIL 4Q2ZA 3DX6A 3IXTB 3BZ4B 3S6CA 1BQHA 4XCNB 4P2OA 4PJEB 1Q1JH 3LD8C 3X13B 4U1GB 1TQBB 3A6CL 4UILL 5FYJU 4ZNEA 1MELA 2IEPA 2CLZB 4XP9H 1NPUA 5EU7E 2P5WE 3BIBX 5INCA 3O6FB 4Y19D 3EFDH 1LEKA 5AG9A 1DVFA 4JG1H 5JIIA 3BP4B 1XIWC 4GXVL 2Q8BL 1INEL 1FAIL 2XICA 4HWBH 1U0QA 4BA8A 4QEGA 1CLZH 3AM8A 3AY4C 4X6DF 3T2NL 5BQ7B 1H3TA 2YA1A 3SKJL 1CDGA 1MRDH 1JK8B 4PJEF 4UNTA 1X7QB 3TESA 4OFIA 4Y16A 2QQLL 1RUKH 1C12A 4FQ1L 4XPAH 1JPGA 2CKBH 2ICEB 1YY9D 2CJUL 1G84A 4LLQB 5I30H 3MRIB 4NZRL 1MCOL 3P2TA 5E4EB 1ZA6A 2CKNA 4XPBH 1T3FB 1VEMA 1HI6A 1D6VH 3DSNA 4XI5C 4P2RE 4XMKL 1HE7A 2LU3A 3OHXB 2AABH 2Q20A 5IG7B 3N9GH 4XPHL 1XT5A 2J8UA 3LQZA 4NC2B 4BZ1L 5C0FB 4R90H 2NW2B 2VB5A 4F33A 3ME0A 1HWHB 2BRQA 3MLRH 5GGUA 3S37L 4Z7OE 1RUML 1CGVA 1ERNA 5C86A 3CFEA 1AI1L 1ZA3B 5JMOC 2WBKA 3SQOH 5CINL 5GGTA 3KAAA 5GS0H 1MHHB 2EYRB 2UZIL 3KYNA 4QXTB 5SX5K 4YDVA 2LQRA 3EYQD 2YC1B 3VFTB 4F15B 3FRUA 3BKCL 5B4MD 1U8KB 4OGXL 4BFIA 2F53E 5TH2B 1PD6A 2BNQD 5JHDD 1JZ8A 4JFPA 3QH3A 3FZUD 5GGSA 4G3YL 2F19L 2GCYB 2A6KB 3NFSL 4ZOCA 1A4KA 2XFXA 3VI3E 3E3QE 5ANME 4PJIF 3EGSB 3UJIH 2EDDA 3S3SA 4QRTA 3S35X 3SGJC 1GH7A 4U1SA 3WHE0 1W0YT 5KBNC 4KC3B 1UZ6F 1R5VA 4HH8A 1JHTB 1BFSA 2GJ6A 3EYFA 4QHKI 1OP3H 3P77A 1KB5H 3THML 3Q48A 3VXRE 3O2VH 4PRAB 3U0WL 4YHMH 1C7SA 2YD6A 3TBYB 3KS0H 4A2MA 1FC1A 2F53D 1KJ2B 1QR1A 1IM9D 3VWJA 5GZOC 3MXVH 5C07E 1KEGL 5ENWB 4FZ8H 3VXUE 1CBVL 4U1HA 1BGXL 1EX0A 4PG9A 4NUGL 3W2DH 3MV8A 3LVEA 2ESVB 3GIZH 4K9EH 4PJDA 4BFBD 1YEGL 3DLQR 3DRTA 1EEQA 5D70L 1EVTC 3RJDA 3D85D 3QDAA 5IROA 1JGVH 5E03A 1SHMA 2YD3A 2M1KA 3MUY1 1A7OL 1WBYA 1AQDB 2OP4L 4OI7A 1VB9A 1A7QH 2MTPA 1XIWB 4JFEE 4I0PD 1P7KA 3CFJA 1S7VA 2WLYA 3VXPA 3P0YH 5TF0A 4ZFZB 4Y1AE 5CCKH 1A5FL 3TBSA 3UBXB 5IHUH 4QKXB 3CPLA 3NA9L 5I1JH 4YXKL 3R06A 3F7YA 4KRMB 2VISB 3MV9A 1CXEA 5HI3C 3CSYB 1IVLA 5DJXA 3ARDD 4KMLB 3KJ6H 4AEHH 4P4RA 3H9SB 1T2JA 3L5HA 3D0VB 5M94B 1VA9A 3ZSTA 3MRHB 2YUXA 3ZMRA 3PP4L 3RNQB 4LDEB 1QA9A 5E2UH 1OP5K 2YMXL 3IVKB 1BIHA 1CDJA 5GZND 1F11B 3W0WA 1K4DA 3EDJA 5B38G 3KPRD 3N1FC 3TBVB 4FQIL 2R2EA 3DIFA 3I85A 1JFQH 4N68A 2WLZA 4I0PB 5TGBB 4OCWL 2H9GA 1HHIA 4FMFA 1BOYA 2Z31C 3QQ4B 4QRUA 4MJ5B 1J5OH 3P3YA 5I30L 4D9RD 5ETUB 4J8RB 5HDBE 4JRWA 1PG7H 3GGWA 5MI0B 1G7QA 4HMDA 4HSQA 1D5IH 2DKSA 2AI0L 3O4LB 1F6LL 2YA2A 4XC3H 4EVNA 1LP9B 3Q3GA 3GK8L 3MCG1 3PWJA 1P4BH 3F12B 5ELIA 1CVSC 3L5JA 1BQHB 3FRPG 4M5YL 4XMKH 4ZFOB 4I9WD 1JNHA 2A83A 1GXEA 3IDMB 2ZWLT 5KVGL 3O41B 1PDKA 1H5BB 3SE8H 4F7MB 5F1OB 1CFSB 3GHBH 1LK2A 2BOBB 3FT2B 1KCRH 2QADC 2CLZA 2GK2A 4Q97A 3I3BA 4M7ZC 2FO4A 2FX9H 3MUGA 1KC5H 5BZDB 2MQ0A 3TBVA 3PDOA 3HAEH 1HZHH 1AI1H 1I85A 1D3CA 4PJDB 1OP9A 3EYQC 3UTSD 2A6IB 4L29B 5TQ0H 4GMTH 4PTUB 1UGNA 2FGWL 2FIKA 4NO3B 4LQFH 3CDFA 4G42B 1DEDA 3UTSB 2RFXA 1MQKL 3D9AH 4P2OB 1MWAB 4X6CA 2CK0L 4YXHH 3OAYH 5EO0B 2D9QB 4IS6A 5LCVL 3SPVA 3ZKNC 4EQ2A 4UMGA 5ADOH 1E4XL 1AE6H 2A1WH 5EU5B 5J3HD 3LEXB 5J89A 4JPIB 5MEPA 1XF2B 1NEZB 3IAPA 5L7XL 5SWZE 4XMPH 3H3BC 1AGFA 1ZLUH 2CXKA 2JB5L 1F97A 4NDMB 5DJ8B 1ZLVH 3TVMA