1CC8A

Crystal structure of the atx1 metallochaperone protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
AEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Atx1 metallochaperone protein at 1.02 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
molecule keywords PROTEIN (METALLOCHAPERONE ATX1)
total genus 18
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1999-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cc8A00
2QLWA 1GXUA 3GZ7A 4A48A 2AW0A 1CPZA 4A46A 1TZ0A 4OJGA 4Y2KA 4EFAC 1ULRA 1OQ6A 1YJTA 1Q53A 1YRXA 2ROEA 1Y3JA 1YG0A 1FVSA 3HX9A 3QGPA 4F67A 2L3MA 1S6UA 2W4DA 3DCAA 2AJ0A 3QMQA 2ACYA 2KT3A 1FEEA 2PGCA 5A6WA 1N5VA 1XBWA 2K7KA 2Q3PA 1Y0HA 2BYCA 2QIFA 2FTRA 3HHLB 1VQYA 3DXSX 3LO3A 2AP6A 2XMTA 4NPOA 2PD1A 5F0UA 1N5QA 2QLXA 1TL4A 1OPZA 1WD6A 3HHLD 2GGPA 2IYIA 3BGUA 1KVJA 2HLUA 2RSQA 1X7VA 1FESA 2OMOA 3WDOA 2VH7A 4YDXA 3IWLA 4YEAA 2OD4A 3BN7A 2G9OA 4OJ3A 2GGPB 4Q2MA 4HH1A 4ZA1A 4A4JA 1U7LA 3IWXA 1P6TA 2W4PA 3BB5A 1APSA 2HQIA 1VQSA 3FRYA 1AW0A 1Y9OA 3BDEA 3FGVA 2OD6A 2N4DA 2XMWA 2LQ9A 2ASYA 3VTIA 5B0BA 1CC8A 4NL5A 2ROPA 4HI1A 4HI2A 2OKQA 2KKHA 1TR0A 2LQBA 1FE0A 1FD8A 1LQ9A 1IUJA 5A6PA 1SB6A 2OAUA 4HL9A 2FIUA 3K7RA 2EW9A 2BJEA 2XMVA 1Q8LA 4HH0A 5B0AA 2N4CA 1FVQA 3KG0A 1CC7A 3MCSA 1V3ZA 2W4CA 2OFHX 5B0DA 2JDJA 2OFGX 3BM7A 1AFJA 3CJKB 4QOTA 2GFFA 3KNGA 2KT2A 3BF4A 5K9FA 3TRGA 2XMJA 2XMUA 1K0VA 3CJKA 5B09A 2RILA 1TL5A 3BR8A 3FMBA 2N7YA 5B0EA 2HFNA 1N5TA 2GCFA 3F44A 4Y2MA 2K7JA 1YJRA 4ZOSA 2BJDA 1N5SA 1S6OA 1OQ3A 1Y3KA 1YJUA 5F0WA 2LXFA 1MWYA 4FNHA 2RMLA 1RJJA 2GO8A 2CRLA 1R6YA 3HFKA 1FE4A 5B0FA 3HDSA 1SQEA 1Q8BA 2FHMA 2KYZA 1GXTA 1QUPA 1TUVA 2IFXA 5T7LA 2AJ1A 3KKFA 4A47A 2ROGA 3HHLC 5B0GA 3MZIA 4DN9A 1JWWA 2GA7A 1OSDA 4OJ1A 2VV5A 2BBEA 2RU9A 1SI9A 4OIXA 4U9RA 5IXUA 2HLTA 2BUNA 2FB0A 1X0PA 2IYGA 1W2IA 2K1RA 2K2PA 3LGMA 1X8DA 4Q2LA 3TOQA 4DL0C 5B08A 1KVIA 1P8GA 4OJHA 2HFOA 4DPOA 2ZDOA 5B0CA 3UDCA 3KG1A 2XMKA 1AFIA 2LDIA 1URRA 1JK9B 2GV1A 1YJVA 2K1RB 4Y2IA 3T9NA 2OP5A 2QYCA 2ZDPA 1Q4RA 3LGNA 2XMMA 5T7LB 3E8OA 2HIQA 3HHLA 3I9ZA 1MWZA 5KAKA 1KQKA 3HF5A 3TNVA 4FNIA
chains in the Genus database with same CATH superfamily
2DR9A 3MM8B 1KOOA 4R5PA 2KHDA 3V6DA 3N0VA 2AX1A 4NLQA 4USVA 1YIJS 1S12A 1SH2A 3ICLA 3RW7A 1YRXA 3QT5A 3M2RB 1Q5YA 4M5DB 4L6V3 2AV5A 1WJ9A 2RVJA 2VDIA 1VHFA 2W01A 4OV1A 4ZPVR 5B7WA 4RWXA 2RD5C 3HO1A 1S1TB 4PG8A 1RWWB 2DCLA 3TUZC 4G65A 5A6WA 2XLJA 1Y4ZB 2G0CA 1YHQS 1ZAXA 3V81B 1VHIA 4DL7A 1QE1B 2JEJA 2WVEA 1B3TA 2G2ZA 4ZP8A 1VQ8S 4LRCA 2RF2B 4M5HA 4ECRA 5CYMB 5C2CA 1VQ4S 1TL3B 3D9BA 3M30A 2HAFA 3KHRA 3ETOA 3VAIA 2BJ3A 3EVWA 4UTGA 1WTFA 1RT4A 3KLIB 3Q8UA 5IT0A 4FP9A 5BXIA 3N6LA 2I0XA 3JB9k 2Z2ZA 2F3JA 2AYGA 2PA8D 3OR1A 4C3LA 4LF5J 1HNVB 3V6KA 3BYRA 1XMQF 2I2YA 4MK7A 4ZVPB 1QAIA 2J9EA 1RZMA 3UN2A 3K59A 3NNHA 2EFVA 2N4DA 1MLAA 5LSLA 4QWCA 4FYYB 5JVHQ 4HI1A 4ECSA 3RW6A 3MPWA 2QC3A 3FDSA 2UUBF 1PBUA 1RCXB 1L3SA 1G6BA 5FDLB 1S6QB 3ZZPA 2VHGA 3UNGC 3I82A 3B78A 4BLGA 1ELOA 3NEKA 2ZH2A 2ZEJA 2QLJB 2J6UA 3G8TA 3U1NA 4LRDA 1NB7A 3A13A 1U0SA 1RA7A 1HNVA 2A3JA 4USIA 5B0DA 4DR3J 2VA3A 3OBIA 1HQEB 4PABA 1U2RA 2C22A 2MKHA 3OVSA 3EWGA 2XY6A 5KG7A 4QOTA 2WOMA 1T0TV 3GV7B 1D9DA 3ILIA 1DLOA 1S76D 4IG3A 2L08A 4MTPA 2HBZB 3K8WA 4NLDA 1K0VA 2IHR1 3LOUA 1JXVA 2H51B 2HURA 3K8VA 5BYQA 2KG0A 3LUYA 4NX9A 2H5JB 3H2LA 2FY1A 3Q83A 2XBPA 3P5BP 4OZ5A 2QA4S 2ZE2B 3K0JA 2DXEA 2UVRA 2KI2A 3M8SA 3OV7A 5HL7Q 2PO4A 1IR1A 3PX4A 4USUA 1FKOB 4ZPCA 1JLQB 4W4MA 1WSRA 1QVFR 2FHJA 4H4OA 1SQEA 1Q8BA 2OEJA 4WJBA 5CAAA 4J9VA 4OI6A 4F26A 2OPPB 2CNLB 1I1GA 1GXTA 2HFUA 1P1LA 3E3XA 1N54B 3P5TL 3N9UC 4KKOA 3D0GE 3VV2B 3HD1A 4Z2XA 4C0HA 2YKNB 3QAUA 1B7YB 4OX8A 1R27B 4R0JA 1SQFA 3GJRB 1GEHA 1IBMJ 2JVRA 1JLAB 4J9NA 1E6YA 1YJNS 4ZLJA 2JX2A 2J0QD 1BWVA 3H59A 1WTBA 3LGMA 4DF8A 3PYGA 2XNQA 1U45A 1B64A 2D9PA 1VQ5S 3BV8A 1WF0A 1YGYA 2VBZA 3I9V9 4HHUA 5H9EJ 4H4MA 1Z2ZA 4Y3CA 4QYZJ 1URRA 7AT1B 1VQPS 1TFYA 4N5SA 1UAWA 2OP5A 3BPDA 3ELHA 3M1VA 2AKWB 2FJXA 5GAEU 3W5YA 1BQXA 1S1WA 2B3TB 2R8KA 5H9FK 4CO1A 2X3DA 2BM0A 4LBIA 1Q82T 4OYIA 3DOLB 1FNOA 3T1AA 5SUHA 2QX0A 3KJVA 1NK8A 1NJIT 3ENAA 3NBPB 1M5VC 2E1RA 3C15B 2DH8A 3E01B 1IKYB 3CF5Q 1UPMB 3DHWC 2H1YA 3L7OA 4ED0A 4JI7F 2J0SD 1RT7B 3J80Y 4M63A 4X66F 1FRIA 2EXUA 2WONA 5D0GA 3UPFA 4DBQA 2GVZA 4K0KJ 3N5FA 1JLGB 4B02A 1DARA 1ZA1B 2RS8A 3HHEA 4NYZA 1TV6B 1VQNS 1WC3A 1VRTA 2QIFA 3CJQA 3G82A 3JTOA 3RBEA 3NL0A 2MHEA 2J0XA 2Y1LB 2RH3A 2NREA 3M6VA 4Q43A 2FVQA 2DXFA 1D9FA 1EARA 1V3SA 5A76A 2ZKUA 5EN1A 1OPZA 1WD6A 3CDAA 3L95X 3EZ5A 1N6QB 1JKHA 2CPXA 5CA5A 1SUQA 2JEIA 1FESA 1R8PA 3CXCR 3GJQB 1JJHA 2ZH9A 4DV7F 3MPUB 2UUAJ 4ZPWR 4AL7A 3CSKA 2DISA 1IKYA 1JMTA 1VIXA 3IWLA 5F3TA 3TQ1A 1RTIA 1VI7A 2CZ9A 4WWSA 3SSQA 4RW4A 2CZ4A 2D7SA 5H1SV 4AL6A 1BD6A 5H9EK 2ASDA 2CJKA 4C0BA 4DUYF 1NK6A 1WG1A 4C8YA 4ELVA 4FZVA 2I1RA 5G4DA 3BDEA 5E3AA 4GC6A 4AE5A 2YKOA 3BSCA 1QSLA 5LOQA 2O3DA 4F3QA 3HM9A 2LQ9A 1SV5A 2M70A 4DV1F 1GK8A 5KFQA 1GMWD 2DXDA 3CCES 5GAHU 3B82A 4ED3A 1JKHB 2MZSA 1HFEL 4ZJQA 4NXMF 4YY3F 1HPZB 1LEOA 2OPRA 3HCXA 1KONA 2XYHB 3T6BA 2XGQA 4LF6J 4DG1B 3GIJA 3I0RA 1U6BA 2FHJD 2W7PA 1PCAA 3C6UB 1K0TA 4J9SA 1Q8LA 3CC7S 1NNDA 1JXEA 2CJQA 3BH7B 3FBFA 3FJ2A 4WFZA 3KG0A 4ANCA 4CLZA 2R8JA 2W4CA 3ZZOA 4DR5F 2M0GB 1R31A 4ANEA 1N0VC 3MEKA 4LQ9A 2V2KA 2QG9B 3PACA 3N28A 4OHVA 4ZJOA 2VBYA 3CJKB 4LSLA 3DYAA 1SV5B 4WP8A 1N36F 3DLHA 2IRXA 1H73A 2MQNA 3MMBB 3GILA 3S1TA 2AEFA 1VIOA 4ECUA 1XMOJ 3C3LA 2J0WA 2C42A 4O4GA 3O6QA 3DU6A 2FY8A 3IN5A 3D3CJ 1OQ3A 2XI3A 3BGFA 3BJYA 2NXNA 2Y0BB 4PYDA 2MMYA 3Q8VA 3R2CJ 4U7CA 3HFKA 2V2ZA 3H20A 3HDSA 3TZWA 4D3HA 6FDRA 4QIFA 3VGUA 5G0RA 2EEYA 4NLRA 5DRKA 4B3RJ 1Y11A 1NSAA 3QRPA 1HA1A 4B3OB 1G7CB 1FERA 2A18A 2EKNA 2RIJA 3CO0P 2ZNZA 4RW6A 1LWEA 3MM9B 3P4UB 3UDLA 4MT1A 2XM3A 2BV3A 4G1QA 4MYUA 1A7GE 2EFNA 4IG0B 4AT1B 3IG1A 5KFDA 2K1RA 4NZ0A 5A8RB 5B08A 3TOQA 2YBVA 2D3OR 3NS5A 3LP1B 3FZBA 4WYLA 4QQBA 3O2IA 5F8JA 1UW9A 4K7QA 1S0OA 2CG8A 2R7VA 2HVEA 4EO8A 2RKIA 4F4YA 4DFKA 4H4KC 1B0PA 4O0NA 4LFAJ 1FJCA 2P5VA 3KG4A 5D4OA 5I42B 3UVJA 3IBCB 2XMMA 5C24A 3ZTQA 1FFWB 2LQJA 3TNVA 1J5OB 2VQFF 3LP2A 5ETQA 1QTNB 5C5JA 2MSTA 2ZM6F 3CCRS 1K1SA 3MCNA 4P72A 1PC4A 1HARA 3CEDA 4WP9A 3CD7A 3UFCX 3A8IA 1S77D 1ULRA 2ZVSA 4UQGA 4DCJB 2BJ1A 2H54B 3QGPA 3TJ9A 3UE2A 1RTZA 2P9EA 3VQSA 4LFCF 3SQGA 1REVA 2BABA 1EB0A 2MY8A 3Q8RB 5EWEA 2ERRA 3QPIA 1MN9A 2IPOB 1YZ7A 3HXMA 5CHCB 4J90A 3M8WA 5LXYA 1S97A 2HQFA 1FTRA 3H5XA 2QLBB 3ADAC 4LF4J 2QGFB 3H5YA 1ZPVA 1RWPB 3MR3A 2IVMA 4WU3A 4DQSA 1HWKA 3LAKA 4HLBA 4DSFA 2DNHA 3PIOQ 2KM8C 2FVRA 5CCMA 1C4CA 2AYEA 2DY1A 4HACA 4KAIA 5D15A 4A4JA 2PI5A 3KJNB 5KT3A 3EMTA 4N41A 1APSA 4NA1A 4YHHF 1WACA 1FHTA 1H7WA 4B08A 4C98A 1FFSB 1EIYB 1VBYA 5DJBA 5KT2A 1VC0A 4LF8J 2DRAA 3P6YC 4KR0B 3LP0B 2DGSA 4ZPBA 4ILRA 1MU2A 5LM7E 4ZIVA 2ZHBA 3LTOA 4DUZF 3THTA 2DK2A 3MPDA 3FEZA 2HK3A 3P3DA 1DQAA 1IKXA 1GAOA 4UQTA 4JI3F 4ZCLA 3K7RA 3NGUA 1JXLA 5J2QA 1PIEA 3N4WA 3FQKA 3TA2A 2N4CA 4CLKA 4F04B 3I4HX 4P6QA 5AXNA 2KXNB 1TK0A 1X60A 1U1RA 2LA4A 4OFZA 5DZ6A 1RWVB 2V50A 1IJEB 4LF1A 3HFZB 2OJ3A 1VR6A 2RQKA 5HJYA 2R2TA 3GG1A 3BF4A 2ASJA 3C66A 3BBCA 4PQUA 2PFDA 1YRTA 1RU1A 2GO9A 3TVYA 2LEBA 4OZNA 1R7IA 2HHSA 2N7YA 1M5SA 5CD4H 1IKXB 4X62F 3M6WA 4EBDA 3IO1A 4NEZA 4R8UA 4NI2B 3OFFA 2BKOA 1HWJA 4KE5A 1IKWA 5DLGA 2CFXA 2O67A 1EX8A 2B56A 3D2WA 3VAGA 1LWFA 2FZKB 2DR5A 4JI0J 1M5OC 1X9WA 1TUGB 1Y7PA 3CCWA 3VVUA 2YKNA 1EP4B 3B6BA 4B3MJ 3JYTA 4I56A 3NOCA 3OTOJ 1RA6A 2DNLA 2OLWA 2XZWA 2IDLA 5D0RA 2GMHA 2MZTA 3DRSB 4YB7A 3B54A 3DLEB 4G1IA 2OTJS 3FKBA 5EWGA 3ENQA 4DV4F 2UU9J 2J9CA 1WC0A 3RRHA 1O8BA 1IBLF 4KH1B 5K8MA 2UUWA 3KLEB 5D4PA 3W9HA 3EPIA 3OW2R 2DR7A 4V19J 1IKVB 4PCQA 3U27A 5A2QU 5F9NA 2LVWA 3EE3A 3A8JA 4USJC 3HJFA 1P9QC 3MD1A 3MEGA 2MKIA 1ZM9A 3TEHB 1YJVA 2LU1A 3KLHB 4N7TA 3JYTB 2V4QA 1HMVB 1RE1B 2AEMA 2FLNA 2V2VA 3KJVB 4ATNA 2FVSA 1S72S 5JVGQ 1EETB 2CDQA 4X2BA 3WC2A 3PW2A 1H2UX 3BBFA 4M5NA 3DMJA 3T1HF 4PWDB 4A46A 5JJBA 2QA4G 1Y5LB 3TJAA 1JLGA 3MR6A 4RW8B 3QGGA 1NKBA 2HGLA 2J8SA 3MTJA 3K5PA 1ZH5A 2WW4A 2YNFB 5EUHA 2HHWA 2HBYB 2GQQA 2KZZA 3HP6A 4DV0J 2CQ0A 3UR3C 5H9FJ 4K59A 4ZVGA 3MM9A 1S0NA 2HQCA 1FEEA 1K73T 4E0DA 4DG1A 2UXDF 4OHWA 4QYRA 3JSMA 3TUJC 5CCLA 1RAAB 2QFJA 3NCRA 3GQCA 1JX4A 3GSIA 3M8QB 2XZDB 4GVBA 3E2EA 1DAXA 4PUOB 3QRRA 1FKPA 4NMLA 1CJTB 4FDFA 4XK8C 1X7VA 4K2JA 4CNZA 4LSLB 4KFBA 3BH6B 1U1LA 4DV5F 5CXTA 3GB0A 2A1BA 4ZITA 3I96A 3Q8PB 2OD4A 4EO6A 1S59A 1C1CB 2XTJP 4Z7YA 1LWCB 1DQ9A 2AJ4A 2NSCA 5I42A 2AJQA 1HBNB 2IBOA 1WC5A 1C0TA 4P52A 1OY8A 1TL7B 2HQIA 4X4PA 2DHSA 1KBRA 1WC6A 2B51A 4LIWA 5HVFA 4FN5A 4DR2F 4TU7A 2H9ZA 1S1XB 4KQZA 1FXDA 4MKBA 2VBWA 4I2QA 4WIIA 3KYLA 1FRMA 2O01C 2C2MB 2WB1D 1O5JA 2Z56B 3PRBA 5A6PA 3KK3B 1VRUA 1QSYA 1XNQF 2C3UA 1T9XA 1Y00A 4ES2A 5F9LA 2NR0A 1YVFA 1TVRB 3QJPA 3LF0A 3NAHA 2BDPA 4B3OA 2MQOA 2CPHA 2KVIA 2ZD1B 3DHXA 4KB7A 3SBMA 4NE9C 3VALA 2HWTA 3CJTA 1RSCA 1CC7A 3ONQA 2VBXA 3ZTRA 4CI0B 1JJCB 2CG4A 4HHHA 4GKKF 3NGKA 2DNZA 3OJSA 4MK8A 1RT5A 5IM0B 4DSJA 4QWEA 1FF2A 1CQMA 2D3UA 1RYRA 3FSXA 4KO0A 3R5CA 2HBQB 5HBMA 4DV2F 2J6SA 2D69A 1BMQB 2FUG9 2WVFA 1IXKA 4HACB 5MAOA 4OYWA 1CJKA 2CDRB 1HW8A 2RILA 1CJUB 2XEXA 4PG5A 4NCAA 1XMBA 3OJUA 2MKJA 1NXIA 2W2QP 2FLPA 1SCJB 3MECB 4DQIA 1TVRA 2B4VA 2B7CB 4QJVA 5FLXY 2LXIA 3IP0A 1BQNB 5DG8A 1ZTTA 4NLVA 3V4MA 5DG9A 2BZ2A 1XR5A 2EK1A 3MGJA 4C9DA 3SMZA 2MY7A 3C14B 2NYHA 3GCWP 3WQPA 1M90T 2VG5A 4H4MB 2UXCF 4WCEQ 3GCXP 1KD1T 5IT9Y 5AJ3J 3G8SA 5KFMA 1TUVA 1QUPA 1YBTA 1SJQA 3AB2B 3IR5B 3OXFA 4DQPA 4M94A 3TAQA 2IM2A 2YQ0A 4R25A 3T5HA 1WF2A 2BW2A 1NBEB 4MIAA 3V6JA 4KPYA 2UXDJ 4RNHA 2HVDA 2YNGB 1HNWF 3GFZA 3LP1A 4LF2A 4LRBA 2QYGA 4C6AA 4XPEA 1NAQA 4OJ1A 2HWHA 2BE9B 4DV0F 3HLUA 4IDKA 5B0CA 3FBEA 1MMNA 4KHRA 3C15A 3SDEB 4JI6J 1HR0J 1UWBA 1S9GA 1DBDA 1IWAA 5C24B 1GFWB 4O44A 4DPOA 4TNOA 2GAGC 2B5JA 1MSWD 4A8FA 2CPIA 2HIYA 3MFIA 4NWBA 4WZQA 2G2YA 4I6AA 2KFNA 4O3RA 1NZAA 2CXEA 2X1FA 1LKZA 1P27B 4OHZA 3PW0A 2Y8WA 2D3O1 4FBTA 3IBWA 3KUHA 2E5IA 2P8IA 4NLPA 2G2OA 1VRQC 1CEZA 1UWAA 4RNOA 4LR8A 1REVB 2YWKA 1U2CA 3O8WA 3Q8YA 1QLNA 1NSPA 2EKYA 4X4SA 4K4UA 2I5JA 2DIUA 3LP0A 1FWPA 3PEJA 3PFEA 4EEYA 1S1UA 1HW9A 1XERA 5E3QA 3TARA 4ID8A 2UU9F 2ZE2A 2VICA 6AT1B 2B8PA 4NLWA 3EM1A 1OMSA 3FVYA 5DETA 2PGCA 4TVAB 1E6VB 2DNNA 3WZ0A 5CYJA 2WSFC 1H7XA 4GC7A 4IG0A 3PO4A 4HDHA 3CDWA 4EU0A 2LQ5A 3EDRB 4OZ1A 2B6AB 2V68A 5ETVA 4KHMA 4A8MP 1RXOB 5DG7A 3RBDA 3SCLE 2ZJQQ 4V19X 4P2FA 3M4XA 3O3LA 4ZCIA 1FDAA 1Q78A 1QJHA 1W2BR 5HATA 3VGTA 4F4ZA 3GWCA 5K14A 2O1PA 1T9WA 4YDXA 5E2QA 4URGA 1NJYA 2F40A 3BN7A 2G9OA 1JLCA 4M5MA 1NHKL 1U26A 1NSQA 4M95A 1DFDA 4H54A 2RQCA 1KQGB 3IFEA 2OPSA 3L7PA 5T41A 4C4WA 2JLFA 1T3NA 3TUIC 4DJBA 5DDRC 4JV5J 1VQSA 3GV8B 2JHEA 3PRDA 3PYFA 5A8WA 4OX9J 1H2VZ 2YKAA 2FD2A 3MPVA 1U1OA 3MOZA 3OL8A 2Z30B 2BJ7A 4CLPA 3LQVA 1FJ7A 3JQMA 2RHSB 1HBUA 1NM2A 1IR0A 2DHGA 1LW0A 1UCNA 2KKHA 4DL5A 1XTZA 3U1LA 2RRNA 2M7SA 2LLZA 4K4VA 2U2FA 3CJ5A 4N8NA 3R9LA 4S0MA 1F3VA 1UEKA 2UUTA 3PVXA 1TKDA 1DTQB 4LF7F 2BJEA 1X5TA 1KLMA 1TKZB 3M9OB 3L4BC 1CJVA 2VASA 2HVIA 4YR3A 4ED2A 3OTCA 2PA3A 5F8HA 1V3ZA 3MR5A 5KFKA 3MM6A 2JLGA 1FK9B 1FKOA 4KRWA 4MMOA 4MFBB 3OUYB 1M5PC 4J9RA 4D3GA 4L73A 4Y0FA 1HHQA 3T41A 3UW1A 2QMUB 2KXHA 5GMKa 4NYPA 1BQMB 2HHUA 4RJVA 1UFWA 3K17A 3FQLA 2XMUA 2PMZD 3PZPA 3RAQA 1PGZA 4ZVQB 3DM2B 3AXKA 4RU2A 3PYEA 3OPKA 4OLPA 4OYXA 1NDLA 2HGMA 2HFNA 2C3PA 3AXMA 2I38A 3DNCA 4ZS6A 3IAM9 3KDNA 1VDHA 1YJRA 1REGX 2EBEA 4YFUA 2VC1A 3BO2A 2E5LF 2V4JA 1IM6A 3MM6B 1RAIB 2DNPA 2ZBCA 3DDKA 1LFWA 1MU2B 2RMLA 3U1MA 3HHNB 1RT2A 2P2CB 5HN0A 3ZFVA 2WCXA 3I5BA 4YS2A 3R8YA 4QWAA 3R7SB 2M88A 2YNFA 5IOLA 2IBKA 3NLCA 3DM2A 2ROGA 1WOSA 5KFNA 1H2TZ 2AX0A 4OYMA 2QL7B 2YKPA 1YDLA 2ZKTA 2Z2MA 4UOGA 4RLEA 3N79A 1SJ1A 4ECXA 4LFCJ 4L3KA 1KKHA 2GQCA 5IXUA 2CVIA 2IYGA 5ETMA 1Q81T 1V6HA 4QYZK 4ID5A 3OLBA 4DV2J 3EXYA 1HHTP 2DGOA 1YSJA 4OJHA 2CQDA 2HFOA 3O1LA 3R7BB 3D67A 2BRLA 2LDIA 2F1FA 3ULHA 3OLAA 1ROFA 3FC9A 1VLYA 2WAQD 1ZM4A 3DMJB 4V1Ak 5F8NA 2C2NA 2HIQA 3PG9A 4HEA9 1YQHA 3RZAA 3Q8QB 1HBOB 4ZP6A 3PO5A 1U24A 3M2RA 2IA6A 4Q45A 5LSRA 4ZK7M 1XNQJ 1UA1A 4KPCA 4PYAA 2AGOA 2VPWB 1Q86T 3EZOA 3TZXA 1Y3JA 2CQ4A 2NPIA 3BQ1A 2VFSA 4DR6F 5HQMA 2XWYA 2XB2D 3CCLS 5JMNA 2H4WB 2CQ3A 2J9DE 2VA2A 1Q5VA 1WKKA 4DFJA 1J5EF 1HWIA 2KT3A 3PJWA 4CLTA 2QEXS 1TL3A 1ZOTA 4PKDB 5GAGU 3IR7B 5CQGA 3ISNC 3KLEA 4FXDA 2R2RA 4DEZA 1RAHB 5G0RB 1RUSA 2NQPA 3HHLD 3ZTSA 1MN7A 4NLXA 2W2PP 4ECTA 5J2MA 2PDAA 2ZHAA 3MEGB 2ILYA 4IOBA 2KTQA 4YEAA 4J9PA 2JEGA 4HDGA 2M9KA 5IT4A 3OXLA 1JB0C 1ZM2A 1RT1B 3C16A 5D77A 1ZTWA 4UY8T 1N33J 5LJ3Y 1KLNA 4LSNA 3RRGA 1NK0A 4TYBA 1KS2A 3FGVA 4CTAA 1NSKL 2E9TA 3T5LA 3UD3P 1B4SA 1X4GA 2MZJA 2R7WA 4ZHRA 1JJ4A 3T3FA 3KK2A 1FXLA 3POTB 2ROPA 1ZS6A 3THPA 3QZ8A 4PQUB 2EC2A 1NMEB 4FXVA 8AT1B 3RJMB 1FD8A 1SBRA 3W2VA 5L46A 2V67A 3MI7X 3ETMA 3T1HJ 1Q0NA 4B3SJ 1HQUA 1TU0B 2BE7D 4HL9A 4DR5J 5HQLA 2AT1B 5ADZA 2EW9A 1RKJA 3MCMA 1N8RT 1KFSA 2JFKA 3MWBA 2HHQA 4CP5A 1WF1A 3DDNA 4OZ3A 3NY0A 1SC1B 4ZP7A 2RF2A 1Q8KA 2W9CA 3MM5B 5KFHA 4RUBA 4NXMJ 2F4VF 2PE8A 5T14A 1U48A 2JWNA 4U6PA 2VOPA 2Z57B 3EVMA 3DLGA 4ZKAA 2CQBA 1KWMA 4RW6B 3TP2A 3W2WA 3BR8A 3D5MA 4CNYA 1NDPA 2B5JB 2CUYA 3DLKA 5B0EA 1RISA 4WFYA 1OYDA 4OI3A 1RTDA 4DCOB 3IWNC 2FGOA 4DUYJ 3HZEA 4RX6A 4ZOSA 5AXLA 2MHNA 3J7YI 2VG5B 5DO2A 4ZLNA 1HI1A 4LREA 1RAOA 2D9OA 3DRPA 2W1BA 4OV6A 4FNHA 4I4BA 4DV7J 2UUAF 2HFSA 5CD4A 1JNZB 2VONA 4DZ6A 1PAUB 1O0PA 1VJQA 3D1HA 3MM5A 1RHRB 3BREA 4DPXA 1VLOA 1HIYA 5GMDA 3V2UC 1SPBP 4EUVA 4RU9A 5L1LA 2RQMA 2C3YA 1N52B 2IRUA 2IFXA 3TANA 1OIAA 1WC1A 3H42A 4L74A 4JYAF 3CB4A 4P2MA 1DTTB 2RHQB 3IMQJ 1EETA 1T95A 1OSCA 1NKEA 4DWIA 4K4ZA 4HTIA 3QBCA 2IC3A 2BM1A 1RK8A 1HNZJ 2MZ1A 2RU9A 2YWEA 1SI9A 2HLTA 4N77A 1UVMA 1F60B 4URSA 1C4AA 5KFRA 1VBZA 2FJVA 4YR0A 3RBZA 3SQGB 2AU0A 3ZZRA 1MWQA 2W9BA 2L41A 2ZH1A 1GH8A 1WEYA 4K4TA 2G1HA 3Q2SC 3D1OA 3E8OA 5T7LB 3V6DB 1S0MA 3MD3A 3BKUA 3HF5A 4UF4A 4ZDNA 3OT9A 3RB6A 3KNAA 1XQIA 3WC0A 4HHJA 2HHVA 1CLFA 3KK1B 1UETA 4ICLB 4CM2A 4P7TA 4MAKA 4Y2KA 1S1TA 1OQ6A 2R7OA 4KIAA 3VHQA 4BC7A 3RGIA 3AD7C 3ENWA 1S6PB 1A0OB 3BSOA 2NXCA 3HX9A 1LW0B 1WKJA 2I9SA 4ZVFA 4DSIA 1RP5A 3CE8A 5KFVA 1HBNA 4DX5A 2BEFA 2AJ0A 3GYNA 4WFBQ 4E8UA 2DRBA 3AJDA 8ATCB 2DHHA 4RBUA 4PG7A 2HZVA 3TVZA 4IKAA 1UVIA 4J9MA 4Y6IA 2R7RA 2P9CA 4DOZA 4OQJA 5A8KB 4OI2A 5LMNJ 3Q2TC 3KLIA 3W8GA 3H8YA 2FJAB 3ISND 4UY85 2IYIA 4QBUA 5KOWA 1KVJA 5D0EA 4Q5VA 4NLYA 2UV8A 4W92B 2ZJRQ 1B7FA 2HG4A 5HMWA 4KT0C 4RKUC 4LF4F 2R8IA 1HNXJ 3ZZTA 1YTYA 2HNDA 2HNZB 3GFYA 4QCLA 1AW0A 5ETOA 2MB0B 4WYWA 5EGYA 4TXSA 2XULA 4RW7B 4FF3A 1S0VA 4K50A 1UEUA 5SZTA 4JI8F 1Q79A 3VTIA 3VAHA 1VC5A 1D8YA 1U1PA 1FT8A 2MZRA 3S6EA 1U6FA 2J7KA 1S1UB 2O5DA 3O44A 2AYMA 2K06A 2LQBA 3C6UA 3CCSS 1CJKB 3CIZA 1RT6B 4JP8A 4N8OA 3TX8A 3W62A 5KG2A 5KT4A 1H6KX 1RWMB 1F5AA 3IXQA 4LVOP 2VQFJ 1H38A 2V8VA 1FD2A 4A8KA 2EFOA 4OHYA 3DYAB 4IOCQ 1R89A 2G0IA 2GVDB 5EX0A 5KT5A 1LWXA 3RB0A 2JJ4D 4KH0B 1UJ5A 3MEEA 2VFVA 5F41A 3NG8A 5L9XA 3SCKE 4ZN1A 4ECVA 2FVCA 3QIPA 1HD1A 4AUKA 2B9YA 1UTAA 1HD0A 3LGHA 1R8HA 4MK9A 4ZLPA 1UZHA 3SIPB 3WBZA 3UCUP 4X4TA 4C8ZA 3OVAA 2CJXB 3K2YA 3BKFA 2ZBRA 3NWRA 2OMLA 4F4KA 3E01A 2IRYA 1N5TA 4IH7A 4LBPA 3HPOA 5LXRA 1W25A 4J5OA 1Y5NB 3PHTA 2CKWA 2IJNA 4IR1A 3VGVA 2VFUA 1AUDA 1SIWB 1N5SA 3AA8A 3B4MA 1S6OA 5J1PA 2C2EA 5HP1B 1HNXF 4YOEA 4B3RF 1VBKA 4WFXA 5FLXU 1C1CA 1RTJA 2HS4A 5KT7A 1B0TA 1XIQA 2COLA 4XPCA 1C0TB 3G71S 4X84A 3M2VA 2HVZA 1KOHA 2FHMA 4WKYA 1HQUB 1BC6A 2KYZA 3CJ2A 4Q7AA 2AJ2A 1V5VA 1T02A 5LMNF 2R3VA 3OTEA 2AHOB 5CYQA 1TKZA 2J76E 4ZCKA 1N5YB 4YP3A 2ZVIA 5FIIA 7FD1A 4DF4A 3W9IA 2I6WA 3HVRA 4A8SA 2DO0A 2DGWA 4I64A 3PR5B 1KC8T 1GXLA 2BBEA 5HQ8A 4C8OA 2VUGA 4YR2A 4WXWA 2FYXA 4UOFA 2KXFA 2GMLA 3ET6A 4M5DA 2W8LA 4IRKA 2V4RA 1QAJA 1WSVA 4CWBA 1P8GA 3DLGB 1C2PA 5D3GA 2HS3A 4A8XA 1N36J 1AZSA 2A0FB 4ZPTR 1T94A 5CABA 2MKSA 2CPYA 1FRHA 2XC9A 4B9SA 1B70B 3ITHB 4F2RA 2U1AA 3C46A 2V94A 2V6AA 3HT3A 5FJ4A 2PI4A 1HHSA 1PO6A 3HD2A 3G6YA 2KL8A 2F7VA 1TZ0A 2DO4A 1FDNA 4YY3J 2LA6A 3AOAA 4TLRA 4WTYA 3UDEA 1YG0A 2GIFA 5I3UB 2VG7A 4PEOA 2GJIA 2PEBA 1HNZF 3QJJA 1T05B 5M2UA 4ENOA 1F3FA 3VCDA 4ED1A 2KB2A 1JLQA 3BO3A 4JYAJ 1VQYA 2A2DA 2DHXA 2XMTA 1HNIA 2A10A 3HVAA 4WU2A 3PKYA 3HT0A 3I55S 1X0FA 2XS2A 5HI7A 2HLUA 3PDNA 3QO9A 4DPUA 1FFGB 1FRJA 2Y9HA 2CPJA 4NYOA 1DTQA 2HPUA 1U7LA 1P6TA 2DBBA 3R5BA 3CDUA 2IM1A 2HZAA 5IFMA 2P6SA 1RTDB 1FRLA 1MW7A 5KFEA 2DYAA 4DCPB 4K0KF 3MEDB 4ICLA 2IAJA 1UVNA 2FQQB 1SJFA 1VS3A 3VAFA 4PZVA 2ASYA 2C2OB 2E5GA 1IJFB 2CAJA 2IY5B 3FFIB 1SKUB 3DRPB 3Q86A 4ITSA 2F4VJ 2DD8S 3QO9B 1IUJA 3AQOA 2BE2A 1RGVA 3MPYA 4X65F 5HROB 3EDQB 4RZRA 3KLGB 1GNKA 1NLKL 4KGXB 5DGBA 3CD6S 3AJ2A 2XMVA 4NLSA 3QATA 4B9LA 1CQNA 4PPDA 4O0IA 4RUAA 1U4BA 4DPWA 1KQSR 3VZHA 4B3SF 4W98A 1CVJA 1NJZA 2DTJA 2GZOA 1U02A 3PM9A 3OVBA 5ETRA 3TEGA 2OH2A 1RABB 3RU0A 4OZ2A 3FFIA 2W7OA 4BWMA 2OPPA 4J9QA 5C2GA 3IRXB 2HHPA 4XDCA 2XMJA 4C11B 3RYLA 3H40A 2IDEA 1QAYA 2WOMB 5KFFA 4B9UA 1Q8IA 4N47A 1ZA2B 2QL9B 3QT8A 4DXLA 3FCHA 1TK8A 5J2PA 3A3OB 2K8GA 2EFPA 1BLUA 2F5GA 2MQ8A 2Z2LA 2B4OA 2CWXA 1EAYC 3HHKA 3K5OA 3DOKB 1LK7A 4OZJA 3US5A 1Y3KA 4FS1A 2YKQA 2EG2A 2MQMA 4QIVA 1L3KA 1RWOB 1WHWA 5F8LA 4ED6A 1KHWA 2APOA 4I68A 5IC4B 3TJ8A 2JEFA 3D4JA 4WFNQ 1FE4A 3OR1B 1O6XA 2LEAA 4OL8A 1DHMA 3V4IB 1IN0A 1N0UA 4I0WA 2F8HA 3H5SA 1U0HA 3QGIA 2GVDA 1HI8A 1FEHA 2R4FA 3NCQA 1NK7A 3CJ4A 2QMXA 4P9SA 2FZCB 4KGVB 5ETLA 4X64F 1YJ9S 1VQ9S 4CYUA 4B17A 4DQQA 4OIXA 2PIIA 4WK1A 5KFWA 4EFAC 1OWXA 5C42A 5HVGA 2K2PA 2XCAA 1F0XA 2ATLA 3MMAA 1JLAA 1KHVA 1LNQA 3NRBA 2W2OP 5DM6Q 1DZ5A 3TVKA 3FSIA 1PYTA 1NKCA 5ETSA 1L3TA 3MAQA 2PMWA 4I69A 4G3IA 1MWZA 5KAKA 3KXDA 3L9ZA 2DEIA 4RW9A 2Z8QA 5LJ5Y 4LBHA 4EBEA 3R5DA 4CYUB 4USHA 1XK8A 4QW9A 5C25B 2DNOA 3CDEA 5K14B 2UUBJ 1XNRF 1Q53A 1T9TA 3GONA 4DZDA 4I67A 1R8BA 2GNKA 1UA0A 3PX6A 4DX7A 2W2MP 3BGOP 1QUVA 1WEZA 4JI8J 1XJWB 2YNHB 4CCHA 1YX2A 2W4DA 4ZVTB 2WHOA 2WZ1A 5A8KA 4EYHB 3EZUA 3TAMB 4TQSA 3EPGA 4M1KA 4KHPF 3RR7A 5A8WB 3G9CA 4P74A 2XS5A 2AP6A 4BS2A 3IGNA 3V5RA 1KNZA 5KT6A 3M05A 1IKVA 4L75A 2ATCB 2F65A 4J9UE 1HBUB 3TYTA 2YY3A 4EBCA 2QT7A 4F7VA 2X1GA 3WIUA 2G0JA 5J1EA 4XO0A 2F9JA 2DHAA 2AZ3A 3P8BB 2FGCA 1SL0A 4LFBF 1IKWB 3FEYB 3EGZA 4Q44A 1UMJA 5DDPC 3KLHA 4PXBA 4OJ3A 2GGPB 4QIGA 4WBFA 4HH1A 2E7VA 5KG3A 2ZH3A 5GAGI 4UUXA 1CJVB 2W4PA 3UWTA 4ALZA 4OZ0A 1HYSA 1O51A 3FRYA 3NGDA 4DFMA 4WF9Q 4I2QB 3CJRA 3I0SA 2LKZA 2X3GA 1F9FA 1AT1B 2F63A 3MF5A 2P9GA 1FXRA 3RAMA 3CIMA 2NS1B 3MAHA 1RT3B 4O4RA 4CO5A 3I4PA 3DLEA 4ETXA 2CNKB 1R3NA 1UJ4A 2ZOFA 1PYSB 2OKQA 4WK3A 3OHBA 1TR0A 3M8YA 2E1MC 1VMBA 2JC1A 1HBOA 1NDKA 2Y1RI 1RTHA 2VDHA 4OYAA 4RBVA 1RCOB 1RHMB 1ZPWX 2YNIA 2BRKA 3QFHA 4MYTA 4TY8A 2LMIA 1TMJA 4LSZB 4UUWA 1NZ8A 2N82B 3CC2S 4HH0A 4ECZA 5KFOA 1D9AA 1FX2A 3GU0A 2DITA 5BJRA 3J7ZT 4M5LA 4N76A 5E0OA 1HNIB 5MLCV 4FF2A 3J7AN 2LCWA 3GG0A 4MIBA 1RI7A 5JUMA 1X9SA 3UDVA 1QD1A 2AMCB 3VZIA 1I3OB 1CSJA 1TUWA 5I4MA 3W3SA 1U6ZA 3SFUA 1PJ5A 4GMKA 5GAHI 4H4KA 2G13A 4CH7A 2C2RA 4ER8A 4J91A 2E9RX 1FCAA 4I2PA 4UW2A 3ZZUA 1DY3A 3M2UA 3W9JA 1T11A 1V3RA 1SVDA 2D74B 3OXGA 3FMBA 2D3ZA 4IYQA 3CJKA 4F3MA 5BYSA 3GYXB 4NCGB 4PXCA 4WFAQ 2ZH4A 3OL7A 3SZ2A 3QSYB 2IM3A 3GFHA 3H0PA 4TY8B 1NK4A 4G1QB 5EHHA 4JV2A 3EXCX 2M5YA 4C3MA 4FYXB 4DR7F 2KJVA 2LXFA 3K5NA 1SKSA 1URNA 3G6VA 5D6GA 1AUSL 3PW7A 2B9EA 4C8KA 2BE2B 5J2NA 3KMQA 1U49A 1X4DA 3FCWA 2V0NA 3GR1A 2A6MA 2ZC3A 3JSYA 3L09A 1CJTA 2AJ1A 5T7LA 3J7YU 2KG1A 5I3UA 2OIHA 3HHLC 2MQQA 3TA1A 2CADA 2VU5A 4K8RA 4YB5A 4P73A 3NP5A 3KDOA 2EC0A 1S9EA 3GIIA 5IWAJ 1AXQA 1RBLA 4JI2J 1SJ3P 2J5AA 2NYIA 1LOUA 2FC9A 3Q8SB 1W2IA 2YWGA 4DL0C 5HVHA 1S79A 1GTHA 4LIRA 4X4VA 3L3CA 2IMOA 3MHYA 1UVLA 1S1XA 3D6HB 4FKXA 4CLFA 2DJWA 2GHWA 3AY0A 3MECA 4K4WA 2ZZMA 3G86A 5IV3A 4TYAA 5AE3A 3SV4A 3ZC4A 2ZUGA 2HYIB 2YXLA 1GXUA 1Q7LB 4NA3A 2JLEA 4USTA 3CNQP 4CO0A 2NZ4A 3GSDA 3A1YG 1HR0F 1J5OA 1KSPA 2VPZB 2QA1A 3IRWP 5KFZA 3PXGa 3IS9A 2E7XA 2BANB 3H90A 5CYQB 3UN3A 1QE1A 2G4BA 3MOJB 2HW3A 1WI6A 1U0HB 4CH0S 2ZHOA 1ZBTA 2MSSA 4USMA 1HNWJ 3TR5A 4IFYB 3KLFA 2OEMA 2JFDA 1N33F 2B0GA 2GJ2A 3DXSX 3LO3A 4IRCA 2VQEF 1LW2A 1R0AB 2ZOMA 3QQCD 4NPOA 5AJ3F 2QLXA 3N6NA 4IR9A 1PILA 3ZO7A 2KVQE 3GIKA 1F5CA 2B43A 3RBXA 2UXCJ 1V5IB 1LK5A 2RRBA 4K4YA 1JLBA 2VH7A 4NLOA 1R0CB 4L72B 2HRTA 2M8HA 1M1GA 1TKTA 2IAJB 4A8OA 4CQ1A 3A8KA 2HAIA 4RUHA 2NXJA 2ADBA 4HKQA 2UP1A 1Z1ZA 4H4OB 3ZZZA 2DY9A 4DR1J 2QTWA 3BS9A 3JAMY 2AWZA 3NXZA 5KFBA 2ALYB 2FJBB 4PG4A 2VJVA 2B4PA 3DN9A 3J81Y 1J5EJ 2C2ZB 3CCVS 3DLLQ 2QZ8A 3T5JA 1JJ2R 3QNWB 4DR6J 1SIZA 1OS5A 1VBXA 1CG2A 2NUUG 2RE1A 2RDDA 2DNMA 3DGPB 5CH7B 2B9XA 3H4BA 1F2HA 1C0UA 4IOAQ 3DOMB 1NEEA 2OEKA 1OPIA 3K5LA 2ZBIA 2FIUA 4J9KA 2VF3A 5AXMA 1HQEA 3QT6A 4YMEA 3PW4A 3R1LA 4Z37A 4MFBA 1YJ7A 4Y65A 2NPFA 4JI1J 2YX7A 4KGMA 2GS8A 4B3TJ 4JUZA 1LWFB 5HBMB 1YITS 4X4OA 5CZVA 3ZNJ1 5ETTA 4P2SA 3CD5A 4DU7A 3GP9A 1S4EA 2L9WA 2EFGA 2GFFA 2GHVC 2PMHA 3JTNA 1VQ6S 3I32A 1RAEB 1TKXB 4DL4A 3H4DA 1WWHA 2EVZA 3KWMA 4QR0A 1ICEB 1YK9A 4TY9A 3VR1A 1X5PA 4NCBA 2XO7A 3THVA 5KG5A 3RRKA 1SC3B 1WEXA 2JH3A 2W2NP 1U09A 3AOCA 3M7VA 2CQHA 2BJDA 1SQGA 3M8ZA 3C8YA 4Y00A 1BE4A 5IZHA 4FS2A 2E29A 3KFWX 3FK4A 2YWHA 3DXBA 2BQ3A 2DGVA 1RBAA 4R8UB 1M1KT 2CRLA 1UEVA 2Q79A 4DV6F 3I5AA 2OTLS 3DLJA 4RUCA 2NZCA 3QYYA 4HT5A 3R97A 4DFPA 2E5LJ 1NRKA 2FJEB 4MKYA 1ZYQA 1QAXA 3W8PA 2NXEA 4C97A 4YN3B 3KKFA 3CCMS 1YBAA 2ZWPA 2DH9A 3QZ7A 5L1IA 1Z4UA 4EZ9A 4G6VB 4JOUA 4F36A 4DN9A 3J7A1 3HJVA 3LAMA 1YI2S 1WOOA 1K47A 2BQUA 2B8QA 5A2QY 1ZAWA 3TRGA 3DI6B 1X8DA 3CDBA 4ETZA 4USWA 3J80U 4CIOA 4KY3A 2KH9A 2ZBQA 1RAFB 3Q22A 2JZ5A 2KHCA 4CLLA 2UUCF 3QGHA 2F4FA 5E41A 2RAQA 1JK9B 1RWUA 3MMCB 2V5HG 2V8DA 3T9NA 2QYCA 1KDNA 2ZDPA 4U8VA 2Y1IA 1RHJB 2QO3A 3BSAA 1G4CA 3FBCA 1MROB 3HHLA 3I5CA 1DRZA 2Q6BA 5GAEI 7FDRA 4QPTA 3DFEA 1FX4A 3MFHA 4OI1A 4OJGA 3BSNA 2DR8A 2X1BA 1YJTA 1I51B 3O5TB 4UZCA 1S10A 1AB8A 3PFOA 2VG6A 1FK9A 3CUNA 1LWCA 5AE2A 1IBLJ 4NMXA 1QVGR 3OUYA 1LFPA 1RLDA 2OSQA 2ZOGA 4OX9F 1TL7A 3IBFB 3K5MA 2ACYA 4DV4J 5HP1A 3AJ1A 3PRVA 3MMBA 3NKYA 3X3UA 4UT4A 2BJ8A 2HZCA 4GO5X 2Q3PA 5HMZA 3I56S 4FYVB 2QE5A 4K2XA 2YVSA 3HHLB 5J2MB 1SL1A 3OTOF 3P49B 4N56A 5KFCA 3SYZA 3M8PA 1GQEA 2PD1A 1N5QA 2OELA 4PR6A 2MKCA 1TL1A 4IFVB 4B3MF 4F4AA 2GGPA 4ED7A 3SI8A 1PYOB 2Z58B 3BGUA 1WORA 3M9NB 3DRRA 3NCPA 4WKRA 3H2UB 5HROA 2V4JB 2HK2A 3DRSA 1NJXA 1WHXA 4GKKJ 1N48A 2Y0SD 4LF9J 1RHKB 1IWGA 4YB1P 1RQ0A 3D54A 1UFKA 4P10A 4DL3A 3AD9C 1S7HA 3EYZA 1VQMS 2I8EA 6FD1A 4KBIA 3KK2B 2AQ4A 1AA1B 3HHDA 4NZ7A 5HSPA 3RB4A 2GMJA 1LXJA 3M32A 4IRDA 1OY6A 1TFWA 4ILMA 2OD6A 4QIEA 2EI5A 4I7FA 2V8GA 4MKAA 3DC2A 3W5ZA 1FDBA 4ZP9A 2POKA 1TL1B 4WTOB 2HRYA 2YX4A 4KYZA 2C1EB 2DR6A 1LQ9A 1NUEA 3DRRB 1K9MT 3GR0A 3KOAA 1IQTA 2GAHC 2KO1A 1N56A 4GKJF 3KUEA 4DN0A 2MTLA 2ZZTA 3D7SB 2MZQA 1AROP 1R8AA 5B0AA 5A0YA 1S6QA 4B9VA 1Q7YT 2CWKA 2OFHX 1VGYA 3UVJB 1S9EB 3K58A 2MDAA 3MAAB 4WIQA 5KG4A 2W25A 4PWWA 1M0SA 3HMJG 3AH6A 4DUZJ 5HMXA 3I6PA 3QFWA 3SCIE 2BACA 3CD0A 1S7IA 4JI6F 3UQSA 2VKRA 3IC1A 2IVFB 3C19A 3JSBA 3M6UA 5KFSA 4LF8F 3ILOA 3KHGA 2AJFE 4CLUA 4P7VA 2J8AA 2LXUA 2YWWA 4YHHJ 5KFTA 2DVIA 3PJ9A 4Y28C 4IG3B 4ZVEA 5F8GA 5LMUJ 1UZDA 3ILJA 2GJFA 1FKPB 2CYYA 3QLHB 1B99A 2MXYA 5J2NB 1CJUA 4PAAA 3EICA 4DS5A 2LFVA 1RJJA 3GJSB 4Q8FA 3VWSA 1FJEB 2AGPA 2OO4A 4KSEB 2HHHJ 4PQAA 3RUBL 4FPRA 3R5AA 2C2KB 3TWZA 3S01A 1BXNA 1SUQB 2QSFA 1KP6A 1RACB 4DLGA 4JV1A 1S48A 4ECYA 3FNNA 4AYBD 4M5IA 3W1YC 1U8SA 1PJ7A 3QIDA 2BOPA 3IM9A 5RUBA 1F5BA 2HNYA 2NXUA 4U9RA 3JAMU 1X4CA 2X1AA 5DLFA 2PN6A 2D1CA 4FYDA 1V9OA 3KLGA 1JIHA 4NOHA 2BX6A 3J81U 3CCUS 5L9NA 2ZNYA 4F8RA 4AFFA 2ZDOA 5DGAA 3UDCA 4ECQA 2ZM6J 2K3IA 2QRRA 5KFXA 3POTA 1RT4B 4DSLA 1Q4RA 1E6VA 1XEZA 3PV8A 2OHDA 2KDOA 3UI3A 1NPPA 3UCZP 3AQPA 4TU8A 3G2XA 4OYPA 4LFAF 4LRAA 5GADU 3HI9A 1WOPA 3W66A 2AW0A 3BZQA 4C11A 1VQKS 2FJDB 3BYPA 4F4XA 4YUDA 3P45B 3MXHP 1A9NB 5A8RA 4KV8A 4O3SA 2LECA 2XLKA 2R42A 3HK2A 2LYVA 1EKRA 3DGPA 3BEGB 1MMDA 1T8EA 2UXBF 2OPSB 1F2GA 3DOKA 3VAJA 5KG6A 4DR2J 3SV3A 1LW2B 1HYSB 3H98A 2RU3A 1XR7A 4KC5A 3SQOP 3DKDA 3Q23A 4A8YA 5KOXA 1F6TA 3MEDA 1Q16B 1W26A 1Y0HA 2R7QA 2FTRA 4DHVA 5L38A 3BQ2A 3SXLA 2CPDA 1H74A 4P71A 1IBKJ 1M5KC 2GVZB 1RT3A 3DLKB 3NGSA 3TUPA 4O23A 3DI6A 1JNRB 3MUTP 4CRJA 1TL4A 2A2CA 1SC4B 4DV5J 3GTYX 2E7WA 3V81A 4ZVRB 1YWXA 2OMOA 3ZNUA 1F9EB 3R6GB 1D0EA 4DV3F 2YH1A 2J9DA 2YNIB 1U2FA 3E51A 1ZZNA 4WPAA 3GPAA 3MR7A 3BO4A 2HQ3A 2DGTA 1E6YB 4GVLA 1U1NA 4W90B 1VYAA 3AOBA 1ITPA 4NZ6A 3G6XA 4JI4F 1JLFB 1S5ZA 4LRFA 3NWGA 5E3PA 1S9GB 3F0NA 3PHEA 1QY7A 2GQ2A 2AD9A 4NLGA 1NK5A 1XMOF 1C0UB 3SSRA 4DDFA 5DQGA 1KRPA 1FJGF 3CMAS 3J7Z5 2H3EB 2FHOB 2C3OA 3IS9B 5AXKA 1RB0A 3N01A 2HGNA 1U1KA 2BXJA 2V34A 3LA0A 4ZPDA 2XSJB 1JLEB 4C0OC 3UD4P 3AFGA 5L1JA 2SXLA 2HQGA 3DOLA 3H5UA 3JQJA 4GRSA 3BR9A 2J7UA 1EQMA 4ZPAA 1Y10A 2KJWA 4LR9A 4AQYF 3OL9A 2RKIB 4F0MA 3BBBA 4IFVA 2JDJA 1PSDA 1RWNB 1WC4A 4OX7A 1HL6A 3IA0A 4RWWA 3TO8A 3HSJA 2WONB 3IM8A 2PT0A 5JXSA 2LQ8A 2NLWA 2VIHA 4LT6A 1UVKA 1FJGJ 5IT9U 2CA9A 2E44A 2OPQA 3ZZYA 2BVZA 3DDIA 4RPFA 1S57A 4DV1J 2A6OA 2J6TA 4LMZA 4NRUA 1OY9A 2QJ3A 4OMFG 3CTRA 4U7UK 1KTQA 4DLEA 3RG6A 3IGVA 1DLOB 1TAQA 4ANDA 4Y2MA 4DUTA 4JI4J 2BW7A 3M1VB 4FF4A 4F0KA 4E2FB 2QV6A 2YPZA 3HSZA 4J37A 4DPYA 1U47A 1R43A 2Q43A 4ZVOB 2CIMA 1Z2LA 3W60A 5C42B 2YQ3A 4HVZA 4WE1B 1U1MA 4DV3J 1MWYA 2GC8A 1HLWA 4BDPA 2BMBA 1HWLA 2DNYA 3MM7B 4XAKA 3PYDA 1PAEX 4JI0F 4EZ6A 4F2SA 1HBMA 1U8WA 1X5OA 3ILLA 4CTAB 3RB3A 4ERDA 2YWFA 1IBKF 3R3TA 4X62J 3NAIA 5F8MA 4KKOB 2IJFA 1OSDA 1VK8A 2QL5B 2VV5A 2HNDB 3W2VB 1AZSB 4FVMA 4DL6A 1SKRA 4JI7J 4O3QA 1IVZA 1T9YA 2QN6B 2WK4A 4UZBA 1C1BA 2VOOA 4U95A 3R7NB 2KT5A 3BKTA 2DGUA 3PTWA 1FWLA 3EVOA 4KGZB 4LVNP 1RWKB 3JS9A 1AFIA 8RUCA 3MMJA 4NLUA 1HBMB 5KFGA 1S9FA 1FKAF 1Q95G 3NNAA 3NGTA 1K44A 4HTJA 4OYZA 1RHUB 3OR2A 4IH5A 5HANA 3PIPQ 2MKYA 3HKZD 3QLHA 4C48A 3I9ZA 3S8SA 2R2UA 1S1VA 3GLJA 1D09B 2WVDA 1N4LA 4JI3J 3ISZA 2CPFA 2HWIA 2QLWA 2MPUA 1DQ8A 5C7PA 3LWLA 4M5KA 3W64A 3TW0A 2W9AA 2NUHA 4NRTA 2R8HA 5K5MA 4IQMA 3OFGA 1X5SA 5U47A 3TAPA 1TKTB 4RBTA 1T03A 3LALA 1RT1A 2L3MA 4EMDA 1IBMF 2YPYA 2D41A 3M8PB 2WRMA 4KO0B 4L76A 4DPTA 4F0HA 1YKWA 2ILZA 3JTPA 1N5VA 1HMVA 3FRZA 3HVTA 2K7KA 2VODA 2ZH7A 2BYCA 2KRRA 2UVUA 2MQLA 4OYOA 3FMWA 4MH8A 5A0YB 4QW8A 5E7OB 5D8HB 5F0UA 5HK4A 1D1UA 1I94F 4PWDA 3D68A 5EX3A 5KG1A 5HO4A 1NH7A 2XG8A 2XI2A 1KVKA 2M8DB 3WDOA 1DTTA 1PBAA 2UV8G 4AD6A 4TQRA 3T9ZA 1I94J 2WB4A 3CJ8A 5EWFA 2P6TA 4TN2A 2MEWA 1L3VA 3BDPA 2XQCA 1GT8A 1HWUA 1R6VA 4X4UA 1ZAVA 1X4EA 1NDCA 5K20B 3BB5A 5F8IA 3N5BA 4RO0A 3PW5A 2H48B 3F73A 4FVCA 2XS7A 2MJUA 3CCTA 3L7UA 5KFJA 2VFTA 3D1QA 2RS2A 5M2PA 2XMWA 2FZGB 4TKTA 4BC9A 2PFFB 4LSNB 5THWA 4IO1A 2W9BB 2VG6B 1B0VA 2LEPA 4HI2A 3R5JB 5LSOA 2RRAA 3M9MB 1NPRA 4QR2A 4Y34A 2R7SA 2ALZA 5F3ZA 1L3UA 2KYXA 3W2WB 2E1PA 4MIWA 1PC5A 5ETNA 2BR0A 4O3OA 4AL5A 3CJSA 1NH8A 3LPEA 3SDEA 4DR3F 2MYFA 1SKWA 3LW5C 2CVEA 4JV0A 2BQRA 4AXIA 1WHYA 2RJZA 2WVCA 1FVQA 1VK3A 3TX0A 4GKJJ 3UD5A 4CZCA 3OSNA 1G2EA 3FSYA 2HHTA 1FDDA 2DT9A 2MLYA 2NCKL 2CPZA 2HNYB 4DU8A 4ZLLA 3A3NB 3LPYA 1VQOS 5DDQC 3R2DJ 3KJFB 4QR1A 3MUVP 2Y1JA 3AAWB 5K9FA 1WUUA 2X7IA 1D8ZA 3DU5A 4M5GA 4F4WA 3R1HA 3G4SS 2HKEA 2DEJA 3CJ0A 2JC0A 2OI2A 3D0IE 3KK3A 1WG5A 2YKMB 2AGQA 4K5SA 2HMIA 2XNRA 1SC6A 3W63A 2XZTB 3A4TA 1VOMA 2ZH5A 2QFIA 4ZJLA 5GVQA 4ED8A 1F9HA 3J81j 2VJUA 4O4GB 2KFZA 1YJUA 4K5RA 3HFVA 2KRBA 2XSFA 2GO8A 3EJMA 2R9LA 2UVWA 2RNEA 2VB6A 3CT9A 2H5EA 4NI2A 1RKIA 1S49A 3GMGA 3M8RA 2F9DA 4C8MA 4FPIA 2NSBA 3T19A 3AA9A 4NASA 3NMRA 4PWUA 3OL6A 1PKUA 2HVHA 1R0BG 1UJ6A 1YLXA 4A47A 3EX7B 2R7UA 4KFBB 2N3LA 3QWPA 3U02A 3RAXA 1FNMA 4ED4A 2CJBA 1T9UA 3I31A 3MZIA 1TTHB 2KM8B 2XY7A 1JWWA 1JLCB 1XC9A 3NOGA 4ELTA 3BGRB 4O44B 3OHAA 1X4HA 3VF0B 2RT3A 4QPXA 1CULA 1VQLS 4B9MA 1PJ6A 3FUYA 3EGVA 2ZJPQ 3AB4B 1NK9A 4IUFA 2R7TA 1KVIA 3SCJE 2GHPA 2Z4PA 2WW8A 5J2QB 1NPKA 2E1CA 2K1RB 5L1KA 1RU2A 4RNNA 1RWXB 2DPJA 1QTMA 3JXOA 4M5JA 1N32J 4AQYJ 4ZMMA 2C3MA 3GYGA 2CQGA 5DDOC 2EFQA 3VAKA 4ED5A 3D6TB 4LF6F 1JLFA 1H3DA 2MGZB 1TKXA 2XLIA 4ES1A 1LV5A 1CPZA 2QSWA 3MM7A 3KHLA 3DLBA 2HHXA 4XIUA 2K3KA 4DR4F 2YH0A 4E98A 1H72C 2HBRB 3EGNA 5KFYA 1FVSA 2HEKA 2CZVC 4F67A 4J9OA 5D4NA 3NNCA 3ENVA 3DCAA 4OYBA 3CCZA 1T9VA 2FDNA 3C6TA 2DH7A 5D0HA 4ZVSB 2JRSA 5K8PA 3Q0AA 3EGWB 5D78A 5KG0A 1WDDA 1SXLA 4I7FB 3W5XA 4OX6A 1SJRA 3GIMA 4EI2A 2ZH6A 4HYKA 3DRXA 4JV5F 5DQHA 1SL2A 4IH6A 3MM8A 1XWLA 3ZTOA 3FCVA 2RSQA 3R27A 1VQ7S 4K4XA 4PXEA 2B4UA 3M8QA 4JI5F 2IM0A 2XWXA 4Q2MA 4HT7A 4ZA1A 3RR8A 4C8LA 5HAOA 5I3QA 1X31C 2R2SA 1UVJA 2LDYA 3MCOA 4CM0A 3W65A 3ET6B 1Y9OA 4F3OA 2W8KA 3NGRA 3MEEB 1GTEA 1VISA 3MAAA 2FVPA 1W7WA 4X66J 2FC8A 1A6LA 4NEYA 2FLOA 1EJ7L 2CJAA 2DNRA 2B6AA 2XSJA 4U8YA 5IS2A 2FHKA 4PUOA 2ADCA 2CQPA 4RNMA 2CQIA 1FE0A 1BWEA 1MROA 3NS7B 2YNHA 2YQ1A 2V9KA 4O3NA 2OAUA 2ZBPA 3R5GA 4ID5B 4B3TF 2B7BB 3HSDA 1XN9A 3MMAB 4JI1F 2V8PA 2DKOB 5DS7A 4WXOA 1VRUB 2L48A 3SSSA 2EK6A 3V6HA 4KGKA 2Y3YA 1UFLA 4CO4A 5KFAA 2FLLA 2IMWP 2HRUA 3U7JA 3VQTA 2BKNA 2AYBA 3BM7A 3VVTA 4A8WA 4NLTA 3EUNA 2XYPB 3M2VB 2W7AA 3KNGA 4U96A 1TQLA 3B8HA 1IM4A 2KFYA 3ZTPA 2HFVA 5DM7Q 1M1HA 3JSMB 5FDLA 3TZYA 3QIPB 2XY5A 2VKZG 1YRUA 3PY8A 2AEJA 4LF7J 4CLSA 3GIRA 3HVWA 3MR2A 3CCQS 5KTQA 2V9WA 2Z0GA 3F41A 3I0RB 2E5HA 2K7JA 2QA2A 4OHXA 4AXJA 1RT7A 5IC6B 4YQWA 2JNJA 4CDIA 3GV5B 4B9NA 4ES3A 3CPWR 4UOHA 3NS6A 4CO3A 2HHHF 3TQEA 5KFUA 3C2PA 5BYRA 4C8NA 4QZVB 5EDWA 1BQNA 2ZFHA 4C7QA 4Z7CA 2FPHX 4I6YA 1UW4A 3BGLA 3GJTB 3MMCA 1GMWA 5DQIA 1G3OA 1RTJB 2X51A 2VQEJ 3CCJS 2MLZA 1OO0B 4MJKA 3OSPA 1K8AT 5AT1B 2R8GA 2MKKA 5IV4A 2QLFB 5B0GA 4Y2AA 9ATCB 5LMUF 4BHQA 3CJ3A 1RTIB 3HVTB 3OTDA 4OZLA 2PEHA 4ILLA 3LWMA 3OQ2A 3UR0A 1KFDA 1WG4A 2FB0A 5E5NA 4Q2LA 1U25A 4DX8H 2BA9A 2G1DA 2VL1A 3G87A 2UZAA 1F1BB 4GVBB 1T03B 1UL3A 4Q0BA 1N88A 1FA0A 1RT2B 4DI6A 1FO1A 4PG6A 4MKVA 2ZD1A 3KG1A 2XMKA 3QSIA 4DL2A 1X9MA 3HZGA 4X4NA 1WHVA 4Y2IA 1WELA 3KJQB 1UWBB 3LH2S 4OLOA 3T1YJ 5L39A 3DRYA 3D3BJ 1RHQB 2DNKA 4ZVUB 2OUGA 2M3DA 1KQKA 1WI8A 4WE1A 5HLFB 2LP4A 9RUBA 1NHUA 3GZ7A 4A48A 2CNNB 1TK5A 1J27A 4C2MA 1RDRA 1NO8A 1WDTA 5I3PA 5J2PB 2ZC4A 4YB6A 3MUMP 3VAMA 1H0HB 2WSEC 3Q89A 2F8MA 1BHNA 3S7RA 4C3KA 5AE1A 5IWAF 4U67Q 3QMQA 4ZN3A 1S4FA 5E33A 3CVKA 1XMQJ 1GX5A 1RADB 2O66A 3MURP 1SH3A 3CMES 1HI0P 3HSGA 4LF5F 3A12A 3M2UB 5J1NA 3QRQA 4F02A 2XHCA 4QWDA 3K89A 3CWJA 4LF9F 4NCGA 2AF6A 5HLFA 1WKLA 4FBUA 4YDDB 1CS4A 1MG7A 2IA0A 3BQ0A 2HSEB 2FJWA 4X4RA 1Y5IB 1UP1A 3DGVA 3NMAA 2UVVA 1FRKA 4NA2A 1JLEA 4QWBA 1RBOB 2WBMA 2OGUA 4JB8B 2F8EX 1TELA 2GX8A 3I0SB 3KHHA 1VFJA 2HFZA 4RL1A 4J7CA 1BUXA 2ZWOA 3IWXA 2YKMA 1KQFB 4J9LA 2GIQA 1OJ4A 4CLWA 3SFGA 4OI4A 1X4BA 4X4QA 3A3PB 4DQRA 1WNEA 5D3GB 1ZETA 3PNIA 3TI0A 2M2BA 1HQ2A 2KZMA 4DS4A 2GW8A 2DNQA 2CQCA 4LUBA 1RTHB 2V2QA 4NL5A 1EHWA 2M4MA 2V63A 1CS4B 2QMWA 3CW2C 2OPQB 5ETPA 4ZIWA 3ITHA 5L8RC 2CPEA 5FD1A 4CO2A 1SB6A 2YTCA 2EPIA 3BN4A 4EK2A 3JSRA 1SH0A 1RLCL 4RW9B 2L9NA 3AODA 4EYIB 1TP7A 3D66A 2W9CB 2ZH8A 2CJYB 4I1TA 1FNXH 1SJ4P 3MCSA 3KMSA 1I5OB 2EBGA 2YNGA 3UCGA 1EQ0A 4L3NA 3PEHA 3BGRA 3G6ES 3CC4S 3M30B 5IQ6A 4FKYA 3WX8A 2UUCJ 3R6LB 1CULB 3CO9A 1BY9A 1TMMA 2KT2A 2RDIA 2VZ9A 2V69A 4F25A 1YZ6A 1RT5B 2IVYA 3T5KA 2VD3A 1HPZA 1TL5A 2OPRB 4JBCA 3K57A 5DZ7A 1J2VA 1H98A 1VC6A 1BQMA 2GCFA 1RAJA 2HS0A 3RTVA 4LQ3A 2IIHA 1FTCA 3D6FB 1S1WB 2E66A 5F0WA 4ECWA 1VJWA 2MGZA 4PPZA 2BOAA 4ZVHA 1R6YA 4DV6J 1BGXT 4CH1A 5B0FA 4Q8EA 4LFBJ 3DOMA 1VCTA 2VPXB 3P96A 2BKPA 3PX0A 4XTTA 3Q24A 3C14A 2ASLA 3PJXA 1N34F 4Y2CA 1HKAA 1QM9A 2ABYA 4KHPJ 5BR8J 4B9TA 5IQQA 1S99A 2Y8YA 3V4IA 2GIRA 1MNEA 1TV6A 2GA7A 1R8CA 4ZCMA 4FXWA 3CMQA 2N7CA 1GX6A 1KN6A 2XGPA 1NU4A 2VC0A 3W61A 2BUNA 3D28A 1X0PA 3IAS9 5M2RA 1MMLA 5GMEA 1XNRJ 5CYMA 1IR2A 3GE9A 3PCOB 2RDJA 4IDKB 3X1LB 4U7UD 4ZHRB 2HMIB 2GV1A 1EP4A 5GADI 2MQPA 3AD8C 2RUSA 4M8LA 4QU7A 1FI4A 2M52A 3WX4A 4CLYA 4PXDA 3T1YF 2MJNA 3ZZ0A 2EWHA 1RT6A 3AHPA 2DB1A 3KLVA 3QT7A 4FNIA 3IRXA 4DSEA 3UN5A 4FF1A 2C28A 2CNOB 1Q1KA 4TU9A 3F56A 1KTVA 4DX6A 2VFRA 2XHWA 2ROEA 4ELUA 3MDFA 5CZXA 3WIVA 2ACMA 2XYGB 1S6UA 3H2VE 3NBPA 4P75A 2W24A 4X64J 2Q6CA 2I5JB 2DGQA 4DR1F 1XBWA 2EG1A 2VPYB 1TAUA 3H7HB 2XO6A 4UOCA 2PSZA 1X4FA 2DGXA 5LT5A 5K8OA 2DPIA 2AIRB 3LP2B 3KK1A 2LU2A 3HKWA 4BCAA 1CBKA 2RQ4A 3ZXWA 5E3CA 4URQU 4OI0A 4RW8A 3MTKA 4USKA 5KFLA 2JSXA 4I6WA 1OYEA 2E1AA 3W7BA 2Q1LA 4NXNJ 1NB2A 2BJ9A 1M5HA 4IQXA 3QWUA 1C1BB 4QU6A 1PG5B 1ACMB 3VGSA 2CQ2A 4RW4B 4BWJA 1KR4A 3C16B 4K4SA 3OTBA 3OD2A 5B0BA 1FWKA 1T3OA 4A8QA 2UXBJ 3D6MB 1CC8A 3JQKA 5LL6d 2JL9A 2IC3B 4I2PB 2AZ1A 2H5IB 3OR2B 4G1PA 4XDDA 3UNYA 2Q66A 2ZZNA 1QSSA 1S1VB 2WVBA 2CQ1A 1NJWA 5HJXA 3UO0A 1IQZA 1YBUA 4CT9A 3A8EA 2XMAA 4NXNF 4KTQA 2RB7A 4TLQA 2R7XA 1VRTB 1IBCB 3D0HE 3G82B 3OFHA 4LJMA 4DMZA 5C25A 1D3WA 2DRDA 2Z2YB 1YJWS 3OFEA 2H65B 3KTQA 2OSRA 1P9YA 2OFGX 4X65J 1EZZB 1UPPA 4LR7A 2BANA 1QDUB 1ZM3A 1KLMB 4RR5A 4RW7A 3IG1B 5ITHA 4BBYA 3QJLA 4KJIA 1AFJA 3CGIA 3G8QA 3LANA 3I87A 3TAMA 1U1QA 1K1QA 4P2XA 4EWTA 2DCUB 2JOQA 4RNFA 1EKSA 1DURA 4JI2F 4DSKA 1LXNA 5D4LA 5B09A 4F50A 4IO9Q 1R0AA 3FBBA 1ZZFA 3F44A 1S6PA 5BR8F 1GMVA 3M32B 1X4AA 5K8NA 1XR6A 4GO7X 2VG7B 5J1EB 5KFIA 1N34J 1JLBB 1T05A 2HQDA 4JI5J 4PRFA 3M6XA 1GMUA 1JQGA 2PC6A 4WP3A 4R0EA 5IM0A 2E5JA 3KUGA 3QAEA 2N3OA 2E9ZA 2DIVA 3FZ2A 3N6MA 5ETKA 3IR6B 4WZMA 2WBRA 4DR7J 3B4DA 4O3PA 2H4YB 1RYSA 2DNGA 2V8HA 5KFPA 1KEKA 3CULA 3PR4A 1NCLA 1UKUA 3HULA 3TA0A 2RUGA 1G1XA 1NHVA 4QIWD 2YX1A 2B9WA 3BPSP 3TZZA 2IJRA 2C2DA 2KU7A 4FYWB 4R5PB 2L9DA 1DJ0A 1T7PA 1FRXA 2HNZA 1LWEB 3WHIA 4EGLA 3FEXB 2WTFA 5HMYA 1RAGB 1N6QA 3GFXA 4DR4J 1I6JA 3T6JA 2CJ9A 2JVOA 2WSCC 2MLXA 1P1TA 4Q0BB 3SEOA 3H25A 2KN4A 2ZUAA 3C6TB 2J7WA 2XCPA 3LGNA 4HR2A 4IFYA 3KLFB 2ZITA 3G96A 1L5UA 5E3RA 1AYEA 1N5YA 3PKMA 4CT8A 1N32F 3AT1B 4KV8B
chains in the Genus database with same CATH topology
2DR9A 3MM8B 1KOOA 4R5PA 2KHDA 3V6DA 3N0VA 2AX1A 4NLQA 1YIJS 1QVFR 1SH2A 3ICLA 3RW7A 1YRXA 4M5DB 3M2RB 4L6V3 2AV5A 2RVJA 4OV1A 4ZPVR 1VHFA 5B7WA 4RWXA 2RD5C 3HO1A 1S1TB 4PG8A 2DCLA 3TUZC 5A6WA 2XLJA 1Y4ZB 2G0CA 1YHQS 1ZAXA 3V81B 4DL7A 1QE1B 2JEJA 4ZP8A 1VQ8S 2RF2B 4ECRA 5CYMB 1VQ4S 1TL3B 3M30A 3KHRA 3ETOA 3VAIA 1WTFA 1RT4A 3KLIB 5IT0A 4FP9A 3N6LA 2I0XA 3JB9k 2F3JA 2PA8D 3OR1A 4C3LA 1HNVB 3V6KA 2I2YA 1XMQF 4MK7A 1QAIA 2J9EA 3K59A 3NNHA 2EFVA 2N4DA 5LSLA 4QWCA 5JVHQ 4HI1A 4ECSA 3RW6A 3MPWA 2UUBF 3FDSA 1L3SA 1G6BA 5FDLB 1S6QB 3ZZPA 3UNGC 3I82A 3B78A 2ZH2A 1ELOA 2J6UA 3G8TA 3U1NA 1NB7A 1RA7A 1HNVA 2A3JA 4USIA 5B0DA 2VA3A 3OBIA 1HQEB 1U2RA 2C22A 2MKHA 3OVSA 2XY6A 5KG7A 4QOTA 2WOMA 3GV7B 1D9DA 1S76D 1DLOA 4IG3A 2L08A 4MTPA 3K8WA 4NLDA 1K0VA 2IHR1 3LOUA 2KG0A 5BYQA 3K8VA 3LUYA 4NX9A 3H2LA 2FY1A 2XBPA 4OZ5A 2QA4S 2ZE2B 3K0JA 2UVRA 2KI2A 3M8SA 3OV7A 5HL7Q 2PO4A 3PX4A 1FKOB 4ZPCA 1JLQB 2FHJA 4H4OA 1SQEA 1Q8BA 4WJBA 4F26A 4OI6A 2OPPB 1I1GA 1GXTA 3E3XA 1P1LA 3P5TL 1N54B 4KKOA 3N9UC 3D0GE 4Z2XA 4C0HA 2YKNB 3QAUA 4OX8A 1R27B 4R0JA 2JVRA 1JLAB 4J9NA 1E6YA 1YJNS 2JX2A 2J0QD 3H59A 1WTBA 3LGMA 4DF8A 2XNQA 1U45A 1B64A 2D9PA 1VQ5S 1WF0A 1YGYA 2VBZA 3I9V9 5H9EJ 4H4MA 1Z2ZA 4Y3CA 4QYZJ 1URRA 1VQPS 1TFYA 4N5SA 1UAWA 2OP5A 2FJXA 3M1VA 5GAEU 1BQXA 1S1WA 2B3TB 2R8KA 4CO1A 2BM0A 1Q82T 3DOLB 1FNOA 3T1AA 5SUHA 1NK8A 3KJVA 1NJIT 3NBPB 1M5VC 2E1RA 3E01B 2DH8A 3CF5Q 1IKYB 3DHWC 3L7OA 4ED0A 4JI7F 2J0SD 1RT7B 3J80Y 4M63A 4X66F 1FRIA 2WONA 3UPFA 4DBQA 3N5FA 1JLGB 4B02A 1DARA 3HHEA 2RS8A 4NYZA 1TV6B 1VRTA 2QIFA 3JTOA 3RBEA 3NL0A 2MHEA 2J0XA 2RH3A 2NREA 3M6VA 4Q43A 2FVQA 1D9FA 5EN1A 1V3SA 2ZKUA 1OPZA 1WD6A 3CDAA 3L95X 3EZ5A 1N6QB 1JKHA 2CPXA 5CA5A 1SUQA 1FESA 1R8PA 3CXCR 1JJHA 2ZH9A 4DV7F 4ZPWR 4AL7A 3CSKA 2DISA 1IKYA 1JMTA 1VIXA 3IWLA 5F3TA 3TQ1A 1RTIA 1VI7A 3SSQA 5H1SV 4PUOA 4RW4A 2CZ4A 2D7SA 4AL6A 2ASDA 1BD6A 2CJKA 4C0BA 4DUYF 1NK6A 1WG1A 4C8YA 4ELVA 4FZVA 2I1RA 5G4DA 3BDEA 5E3AA 4GC6A 4AE5A 2YKOA 3BSCA 1QSLA 2O3DA 4F3QA 3HM9A 2LQ9A 2M70A 1SV5A 4DV1F 5KFQA 3CCES 5GAHU 3B82A 4ED3A 1JKHB 2MZSA 1HFEL 4NXMF 4YY3F 1HPZB 2OPRA 1KONA 3T6BA 2XGQA 4DG1B 3GIJA 3I0RA 1U6BA 2FHJD 2W7PA 3C6UB 1K0TA 4J9SA 1Q8LA 3CC7S 1NNDA 1JXEA 2CJQA 3FJ2A 4WFZA 3KG0A 2R8JA 2W4CA 3ZZOA 4DR5F 2M0GB 1R31A 1N0VC 3MEKA 4LQ9A 2V2KA 3PACA 4OHVA 3N28A 3CJKB 1N36F 2VBYA 3DLHA 4LSLA 3DYAA 1SV5B 2IRXA 2MQNA 3MMBB 3GILA 3S1TA 4ECUA 1VIOA 3C3LA 2J0WA 2C42A 4O4GA 3O6QA 3DU6A 3IN5A 1OQ3A 2XI3A 3BGFA 3BJYA 2MMYA 4U7CA 3HFKA 3H20A 3HDSA 4D3HA 6FDRA 4QIFA 5G0RA 4NLRA 5DRKA 1HA1A 4B3OB 1G7CB 1FERA 2A18A 4RW6A 2RIJA 2ZNZA 1LWEA 3MM9B 3UDLA 2BV3A 4G1QA 4MYUA 1A7GE 2EFNA 4IG0B 3IG1A 5KFDA 2K1RA 4NZ0A 5A8RB 5B08A 3TOQA 2D3OR 3NS5A 3LP1B 3FZBA 4WYLA 4QQBA 3O2IA 5F8JA 1S0OA 2R7VA 4EO8A 2RKIA 4F4YA 4DFKA 4H4KC 1B0PA 1FJCA 2P5VA 3KG4A 5D4OA 5I42B 2XMMA 5C24A 2LQJA 3TNVA 1J5OB 2VQFF 3LP2A 5C5JA 3CCRS 2MSTA 2ZM6F 1K1SA 1PC4A 1HARA 3CEDA 3CD7A 3UFCX 1S77D 1ULRA 2ZVSA 4UQGA 3QGPA 3UE2A 2P9EA 3VQSA 4LFCF 3SQGA 1REVA 2BABA 2MY8A 3Q8RB 5EWEA 2ERRA 3QPIA 3HXMA 5CHCB 5LXYA 1S97A 1FTRA 3H5XA 3H5YA 1ZPVA 3MR3A 2IVMA 4WU3A 4DQSA 1HWKA 3LAKA 4HLBA 4DSFA 2DNHA 3PIOQ 2KM8C 2FVRA 5CCMA 1C4CA 2AYEA 4A4JA 4N41A 4KAIA 2PI5A 5KT3A 1APSA 4NA1A 4YHHF 1WACA 1FHTA 1H7WA 4B08A 4C98A 2DRAA 1VBYA 5DJBA 5KT2A 1VC0A 3P6YC 4KR0B 3LP0B 2DGSA 4ZPBA 4ILRA 1MU2A 2ZHBA 4DUZF 3THTA 2DK2A 3FEZA 3P3DA 1DQAA 1IKXA 1GAOA 4UQTA 4JI3F 4ZCLA 3K7RA 1JXLA 5J2QA 3N4WA 3FQKA 3TA2A 2N4CA 3I4HX 4P6QA 5AXNA 2KXNB 1TK0A 1U1RA 2LA4A 4OFZA 1IJEB 2OJ3A 2RQKA 2R2TA 3GG1A 3BF4A 2ASJA 3C66A 4PQUA 1YRTA 2GO9A 3TVYA 2LEBA 4OZNA 1R7IA 2HHSA 2N7YA 1M5SA 5CD4H 1IKXB 4X62F 3M6WA 4EBDA 3IO1A 4R8UA 5DLGA 3CCVS 3OFFA 3DLLQ 1HWJA 4KE5A 1IKWA 3VAGA 2CFXA 2O67A 2B56A 2RRAA 3D2WA 1LWFA 2DR5A 1M5OC 1X9WA 1Y7PA 3CCWA 2YKNA 1EP4B 3JYTA 4I56A 1RA6A 2DNLA 2OLWA 2XZWA 2GMHA 2MZTA 3DRSB 4YB7A 3DLEB 4G1IA 2OTJS 5EWGA 3ENQA 4DV4F 2J9CA 3RRHA 1O8BA 1IBLF 5K8MA 3KLEB 2UUWA 5D4PA 2DR7A 3EPIA 3OW2R 4V19J 1IKVB 4PCQA 3U27A 5F9NA 2LVWA 4USJC 3HJFA 1P9QC 3MD1A 3MEGA 2MKIA 1ZM9A 1YJVA 2LU1A 3KLHB 2V4QA 3JYTB 1HMVB 2FLNA 3KJVB 4ATNA 2FVSA 1S72S 5JVGQ 1EETB 2CDQA 4X2BA 3WC2A 3PW2A 1H2UX 3DMJA 3T1HF 4PWDB 4A46A 5JJBA 2QA4G 1Y5LB 1JLGA 3MR6A 4RW8B 3QGGA 1NKBA 2HGLA 1ZH5A 3MTJA 3K5PA 2HHWA 2YNFB 5EUHA 2GQQA 2KZZA 3HP6A 2CQ0A 3UR3C 5H9FJ 4K59A 4ZVGA 3MM9A 1S0NA 1FEEA 1K73T 4E0DA 4DG1A 2UXDF 4OHWA 4QYRA 3JSMA 3TUJC 5CCLA 2QFJA 3NCRA 3GQCA 1JX4A 3M8QB 4C8ZA 3E2EA 1DAXA 4PUOB 1FKPA 4NMLA 4XK8C 4CNZA 3PO4A 1X7VA 5CXTA 4LSLB 4KFBA 4DV5F 3GB0A 2A1BA 3I96A 3Q8PB 2OD4A 4EO6A 1C1CB 5I42A 1LWCB 1DQ9A 2AJ4A 2NSCA 2AJQA 1HBNB 2IBOA 1C0TA 2HQIA 4X4PA 2DHSA 2B51A 4LIWA 4DR2F 4FN5A 4TU7A 2H9ZA 1S1XB 4KQZA 1FXDA 4MKBA 2VBWA 4I2QA 4WIIA 3KYLA 1FRMA 2O01C 2WB1D 1O5JA 3PRBA 5A6PA 3KK3B 1VRUA 1QSYA 1XNQF 2C3UA 1Y00A 4ES2A 5F9LA 2NR0A 1YVFA 1TVRB 3QJPA 3LF0A 3NAHA 2BDPA 4B3OA 2MQOA 2CPHA 2KVIA 2ZD1B 3DHXA 4KB7A 3VALA 2HWTA 3ONQA 1CC7A 2VBXA 4CI0B 2CG4A 3NGKA 2DNZA 3OJSA 4MK8A 1RT5A 5IM0B 4DSJA 4QWEA 1FF2A 1CQMA 2D3UA 1RYRA 3FSXA 4KO0A 3R5CA 5HBMA 4DV2F 2J6SA 2FUG9 1IXKA 5MAOA 2RILA 4PG5A 1HW8A 2XEXA 4NCAA 1XMBA 3OJUA 2MKJA 4DQIA 2FLPA 3MECB 1TVRA 2B4VA 2B7CB 4QJVA 5FLXY 2LXIA 5DG8A 1BQNB 1ZTTA 4NLVA 3V4MA 5DG9A 2BZ2A 1XR5A 2EK1A 3MGJA 4C9DA 3SMZA 2MY7A 1M90T 2VG5A 4H4MB 2UXCF 4WCEQ 1KD1T 5IT9Y 3G8SA 5KFMA 1TUVA 1QUPA 3AB2B 1SJQA 3IR5B 4DQPA 3OXFA 3TAQA 2IM2A 4R25A 3T5HA 1WF2A 2BW2A 4MIAA 4KPYA 3V6JA 4RNHA 2YNGB 1HNWF 3GFZA 3LP1A 4XPEA 4DV0F 1NAQA 4OJ1A 2HWHA 3HLUA 4IDKA 5B0CA 4KHRA 1MMNA 3SDEB 1UWBA 1S9GA 1DBDA 5C24B 4O44A 4DPOA 4TNOA 2B5JA 1MSWD 4A8FA 2CPIA 3MFIA 4NWBA 4WZQA 4I6AA 2KFNA 4O3RA 1NZAA 2X1FA 1LKZA 1P27B 4OHZA 3PW0A 4FBTA 3IBWA 2E5IA 1CEZA 4NLPA 4RNOA 1REVB 2YWKA 3O8WA 4K4UA 1QLNA 2EKYA 4X4SA 2I5JA 2DIUA 3LP0A 3PEJA 3PFEA 4EEYA 1S1UA 1HW9A 1XERA 5E3QA 3TARA 4ID8A 2UU9F 2ZE2A 4NLWA 3FVYA 5DETA 2PGCA 1E6VB 2DNNA 3WZ0A 5CYJA 2WSFC 1H7XA 4GC7A 4IG0A 4HDHA 3CDWA 4EU0A 2LQ5A 4A8MP 4OZ1A 2B6AB 3RBDA 1QTMA 4KHMA 5DG7A 4GKKF 4V19X 3SCLE 2ZJQQ 3M4XA 3O3LA 4ZCIA 1FDAA 1QJHA 1Q78A 1W2BR 4F4ZA 3GWCA 5K14A 2O1PA 4YDXA 5E2QA 4URGA 1NJYA 2F40A 3BN7A 2G9OA 1JLCA 1DFDA 1HD1A 1U26A 4M95A 4H54A 2RQCA 1KQGB 3IFEA 2OPSA 3L7PA 5T41A 4C4WA 2JLFA 1T3NA 3TUIC 4DJBA 5DDRC 1VQSA 3GV8B 2JHEA 3PRDA 5A8WA 1H2VZ 2YKAA 2FD2A 3MPVA 1U1OA 3MOZA 3OL8A 3LQVA 1FJ7A 1HBUA 1IR0A 2DHGA 1LW0A 2KKHA 4DL5A 1XTZA 3U1LA 2RRNA 2M7SA 2LLZA 4K4VA 2U2FA 3CJ5A 4N8NA 1TKDA 3PVXA 2UUTA 1DTQB 2BJEA 1X5TA 1KLMA 1TKZB 3M9OB 2VASA 2HVIA 4YR3A 4ED2A 3OTCA 2PA3A 5F8HA 1V3ZA 3MR5A 5KFKA 3MM6A 2JLGA 1FK9B 1FKOA 4KRWA 4MMOA 4MFBB 3OUYB 1M5PC 4J9RA 4D3GA 4Y0FA 3UW1A 2KXHA 5GMKa 4NYPA 1BQMB 2HHUA 1UFWA 2PMZD 3FQLA 2XMUA 3PZPA 3RAQA 1PGZA 4RU2A 3DM2B 3OPKA 4OLPA 2HGMA 2HFNA 2C3PA 2I38A 3DNCA 4ZS6A 3IAM9 1YJRA 2EBEA 4YFUA 2VC1A 3BO2A 2E5LF 2V4JA 3MM6B 3DDKA 2DNPA 2ZBCA 1LFWA 1MU2B 2RMLA 3U1MA 3HHNB 1RT2A 5HN0A 3ZFVA 2WCXA 3I5BA 4QWAA 2M88A 2YNFA 2IBKA 3NLCA 3DM2A 2ROGA 5KFNA 1H2TZ 2AX0A 2YKPA 2ZKTA 2Z2MA 4RLEA 3N79A