1CD5A

Glucosamine-6-phosphate deaminase from e.coli, t conformer
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The allosteric transition of glucosamine-6-phosphate deaminase: the structure of the T state at 2.3 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
total genus 84
structure length 266
sequence length 266
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 1999-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cd5A00
3L7OA 3NZEA 1Y89A 2WU1A 3BXFA 3LHIA 2BKXA 3NWPA 1FRZA 4NMLA 4L5JA 1UJ6A 1KS2A 3E7FA 1CD5A 4L4YA 3EFBA 4OQQA 4X84A 1LK7A 1FSFA 3TX2A 4R7TA 1VL1A 1XTZA 2OKGA 2RI1A 2W48A 3KWMA 2RI0A 3LWDA 4IO1A 4L5IA 3KV1A 1LKZA 1NE7A 4OQPA 3ENQA 1UJ5A 3EB9A 1UJ4A 3ICOA 3ENVA 4TM8A 3U7JA 3ENWA 4GO1A 5HJ5A 1FS6A 3BXEA 1FS5A 3HHEA 3BXGA 4M8LA 1JT9A 2J0EA 3IXQA 1PBTA 4L50A 3CSSA 3HN6A 3CH7A 1LK5A 2F8MA 3UW1A 3BXHA 1O8BA 4TM7A 1HORA 2GNPA 4L51A 1DEAA 3OC6A 2O0MA 4GMKA 4L4ZA 2R5FA 3E15A 1FQOA 2BKVA 4R9NA 1M0SA 1HOTA
chains in the Genus database with same CATH superfamily
2OESA 3F3KA 2OORC 1JT2A 4HYTA 1X19A 4S1OA 5JJKA 1H3NA 4HNRA 1K7FB 2JGLA 1BCRB 4L9SA 1IOWA 3UAVA 4TMFA 2VH1A 3ONDA 4ZT5A 3I0MA 4TKVB 1AM4D 3U3KA 3CZAA 5CDTA 1ZOSA 3URMA 1DO0A 3IMFA 3OFSA 5CLQA 2FUKA 3R5FA 2I5PO 2ZROA 2JFYA 3AVPA 1C9EA 1LNQA 2Q8PA 4AQDA 3D3QA 1E4OA 1R0RE 4HX9A 2NO9A 1W36D 1RAFA 2BEJA 4DR7B 3ZY6A 1Q84A 5I3CA 4P98A 3VR4A 4MRAA 3QSGA 2O0LA 4ALLA 1OXMA 1Q6ZA 3AI2A 1WMBA 4P4SA 2B82A 5A03A 1D2NA 1UZNA 2UYHA 4R8RA 1TB4A 2HCJB 1VPVA 5BXYA 2FEAA 2JAXA 2CL0X 2HWUA 3LMKA 4PYMA 1LFAA 3ANYB 4PS1A 4QAQA 4B4DA 3CLSD 4UU0A 3GLHB 1XA0A 4OI4A 2XMZA 3S8MA 1S3GA 2OKGA 1PJQA 4M9ZA 4QOJA 3TLEA 5K6RA 1ECFA 2WTXA 3PNSA 4DE5A 1IHYA 4MW1A 4XXHA 4EKNB 4IIFA 3PPVA 4M87A 1A1SA 1UZAA 6PFKA 1LPMA 4CKBB 1IVSA 1Z34A 5AKKA 3AHHA 1X39A 4W6QA 1ZM2A 4US1R 4RMIA 3T7EA 1Y48E 3ORRA 3RVQA 2Z2KA 4QOHA 2JKZA 4G36A 3K1JA 3CW8X 3X1ZA 1ZM7A 3BMXA 4LHSA 4BNHA 3RAFC 4BJ5A 1GRVA 1H1DA 2QROA 3PLNA 1NQWA 2JGRA 2AF3C 4P33A 1DQSA 1UDCA 4B34A 4S35A 4G86A 3RVOA 1G8SA 2RCNA 4B33A 1RBYA 4DQVA 1M34E 1LPBB 1PEKE 3GT0A 5CM9C 3ZHRA 3BUSA 3QPBA 2A57A 4Y6GB 1Z6XA 1QB8A 3GL9A 1FXWA 4KN9S 3T5BA 3ZGLA 2HA4A 4AUNA 3Q4GA 5BQ3A 4ZA2A 4B6SA 5E4YA 3DLAA 4G0WA 2GFHA 2OBMA 2XB2A 1GL7A 2V5UA 2ZRIA 4QJ4A 1GAJA 4W82A 5COQA 3L7BA 3KVVA 1JKMA 2NUPB 1IATA 4KZKA 2JKVA 4UU7A 2CDCA 4RC9A 5ALPA 1T9DA 2IUUA 3S28A 2XOXA 3AGPA 3WB1A 1A98A 2PRSA 2H5JA 3AKCA 2ZCUA 5CBPB 4HP8A 3V2GA 4KXNA 3R24A 2ARKA 2XJ4A 2ZBEA 4GP6A 5CH3A 1GFIA 2KM1A 1H1TA 4PFQA 2O19A 3VYTB 3HCWA 2GCOB 4DVGA 3NO4A 4GWGA 4UAUA 1WB5A 1WQ3A 4MS3B 3GLIB 1SKYE 4OJQA 1Z4NA 4B7XA 4QM7A 2NADA 2P69A 5A9SA 1E9RA 1NF2A 4G84A 3MFQA 4N82A 1R0ZA 4P2BA 4KLZA 2C83A 4BKPA 4CGZA 1N7JA 2VP6A 2QJOA 2EP7A 1F0YA 2PYDA 3D81A 3Q3HA 4E51A 1OAAA 2HJ9A 2W5UA 2GLTA 2NGRA 4R8MA 3SC2B 2PS1A 2G8LA 3SHQA 4BZZA 4CL8A 1S2OA 4GZ6A 5KYUB 2OBXA 3B38A 5CW2A 2O0MA 3BICA 1Q1ZA 4LQLA 3BWVA 2DWUA 3D3KA 3VHRA 3NBUA 4CVNA 3FHOA 1KDVA 3OT5A 3KE8A 1I3CA 3NPAA 1TF7A 1L1EA 4JLJA 4RUKA 4OP1A 1KHTA 3WLIA 4JFRA 4AN0A 2CVZA 3WIDA 3M8KA 4JR2A 1YH3A 1TU3A 1FFXA 3LC0A 4DIBA 1Z4KA 5CEEA 1Y5RA 1NKSA 5LWHA 1INLA 2BHLA 4X94A 2I4TA 4GM4A 4U2EA 2O14A 4UVGA 4ZAVA 4B4WA 1RWNA 3WYFA 2FG5A 4C2AA 5ESRA 5IN4A 1KVUA 3ND5A 2RBEA 4CF3A 2FRDA 2EJWA 2VUIB 1HEYA 4EB3A 1O6ZA 4HXYA 4MRSA 3KUUA 2I8AA 1KJJA 1DC5A 4RM2A 3RS7A 3PLAE 3LLMA 4B5KA 1YRQA 3JVIA 4MW6A 3VA7A 1X1SA 2ZCJA 3A4TA 4DJFC 1DADA 4D4MA 1E4VA 2OYCA 2PH3A 2PFSA 1J8DA 3H4IA 3PXAA 1YMUA 1O4WA 1JHVA 2BTQB 4WZAB 3DE1X 1NA5A 1Z7GA 5BNWA 2VLBA 1F3LA 1E6UA 3HEAA 5JC1A 3V9AA 3TR6A 4XM2A 4LRUA 4JGGA 3HCBA 3TRHA 3UICA 3R8XA 2B6HA 2ZT7A 3AFNA 1RPTA 1OJ7A 4M37A 5DLEA 3RC3A 1GARA 1T35A 3WGMA 5EMLA 3IHWA 5JDIA 1UZUA 4JY7A 3FETA 1Y7PA 5CG1A 2Z4SA 1Q14A 1R8JA 3G8CA 1DCTA 1L7OA 3GT7A 3DT8A 5D3QA 1UDRA 4QFDA 3R9KA 3PJRA 3TZKA 1N5DA 3Q8WA 3CO5A 4OHFA 1KP3A 1FNDA 1HA3A 2V9CA 5AJWA 5KZMB 2YZ2A 1DFGA 4CM9A 2NNWB 4A8TA 5ED4A 3DDWA 5JHGB 1A5SB 4NENA 3TH5A 1NVKA 5KHLB 1AUOA 1KZ6A 2EX1A 2PX5A 1F3OA 5DM0A 1W19A 3PUWA 3GUCA 4TMTA 4LV6A 5CHEA 2IV3A 3R9XA 2C88A 3GFVA 4LPKA 2UYYA 2PX6A 3SEFA 2QRVB 1J49A 1SXGA 2GWHA 1R37A 3H8WA 3KL2A 3KOYA 3R7FA 3TZBA 4CKXA 1EMDA 1VG8A 5G4LA 3UWKA 1U2DC 4R84A 2XECA 4GYKA 2UYCA 4D3DA 3ZU3A 1C0IA 1MFZA 4AN1A 2QYSA 1BYIA 4OK3A 2FK7A 4ZZ0A 3MQ2A 3L06A 1J2UA 4LHXA 1KEWA 5IH7A 4IKOA 5CCXA 3GR6A 1QH1A 3K0AA 3NHWA 1GADO 4XVRA 3ROTA 4AM8A 5IJZA 5LQMA 1I2CA 5EPUA 2ZRPA 4K6OA 5DTQA 1Q0RA 3BRCA 1XTTA 2FSIA 4HYEA 4IDHA 1KEPA 1SJ9A 2PVSA 3C5VA 3K5HA 3P4YA 2UXDB 2B92A 5ALFA 1VM6A 3AUXA 1PLJA 4EHLA 1N77A 2B30A 4OXXA 1U3DA 3HHEA 3QBDA 2K5UA 4WGFA 1AN9A 1T8WA 5CIYA 3WWDA 5DWQA 2VTKA 2OHFA 5HWSA 4RLSA 1G8PA 1F14A 3BHIA 4UCXA 5EMJA 1AO3A 2BAGA 4HAUA 2ZIAA 3IE1A 1A2KC 1G5HA 1NBMA 2G71A 3GGGA 4J8PA 3G9XA 1F06A 3EG9A 2OCKA 3PKJA 4X85A 4LZPA 3WQQA 5JFTA 1ML3A 5CX1B 1NW7A 1JYEA 1ZH2A 5K1ZA 3WDKA 1VRVA 2DFNA 1EM8B 3A6GA 1CE8B 4MPJA 3ZGNA 4QT4A 3LK7A 2YINC 1L5HB 1RXEA 3DHEA 1G4AE 4WZBA 4YAFA 3JQRA 3OZAA 4FGJA 4QWMA 4WUTA 4CKZA 1K6MA 2X3YA 1M6VB 1LJLA 1OJLA 1TAUA 4DV2B 2JHPA 3GK3A 3M9XA 3L82B 2VVTA 3F9CA 4JP1A 3MTGA 1YHNA 1RACA 3DTTA 5AT1A 2P9ZA 4BCDA 3BSFA 4OYHA 1FFAA 1Y8CA 2AZXA 2XUHA 1UF9A 1J42A 4G4SP 5GOTA 1QYXA 3U56A 5JMOA 2Q2VA 1VGVA 3PEYA 3KU4A 4E2XA 1W87A 5HBRA 3N6XA 1UK8A 1PVDA 2D5BA 4QYWA 3SS8A 3W9UA 5MFPA 3SJCA 1HZZC 3GG9A 2A5GA 5TQJA 1C4XA 2FHSA 5AP9A 4JVOA 2J3QA 3CFYA 1R88A 2YXDA 1AUVA 1Q7BA 4LYDA 2JLCA 3GRZA 3AIMA 2VT2A 4OFWA 3WLTA 5BQFA 1U9IA 2BP7B 3N2EA 3ITDA 2CKDA 2H4WA 3U09A 4LUCA 1G4HA 2MYTA 4YBZA 3K70D 1RI4A 1GNLA 2BE7A 1PL8A 2WR8A 4RSHA 4UEJA 3OCUA 2JI4A 3TSYA 3R7LA 1K7EB 1MO6A 2H3HA 4LBZA 4NV0A 2Z0MA 2CT8A 3DVSX 1N1MA 2MSDB 4PZPA 1GCGA 3A0UA 1I9GA 5IS2A 2C2ZA 4OHWA 1PQPA 1XQYA 5FD8A 1FE8A 3HYCA 5JXGA 3FKSD 2BWJA 3AH8A 4YJ3F 5CURA 1PS9A 2HRBA 2Z09A 1WNTA 2R8RA 4R98A 3ROQA 2ZUDA 3NTOA 3UWPA 4RVFA 2F1OA 3ZWXA 1JU3A 3EWIA 3GFFA 5E0KB 3UV6A 2WZDA 3L2OB 1FQJA 3CINA 1P2VA 3GEBA 2QVXX 2E37A 4AKIA 2DWPA 4IDPA 5IWCA 7REQB 1JJFA 2AR9A 3IV9A 1B23P 2G80A 1MV8A 3KR1A 3L5KA 4HZIA 1KK1A 4A6DA 1Z56C 4AJEA 3ISVA 1VIMA 3WY9A 1P6QA 4IG4A 2X3FA 2QN8A 4P4GA 4B8WA 3QF4A 3DT9A 3BBPA 4Z7OB 5HCUA 5HFAA 3K9GA 1ZD8A 2BBSA 1BOFA 2XT0A 4OFXA 3TRKA 1ND6A 4DAOA 1LTHR 2LD4A 1D4AA 2PXAA 2REBA 3VNQA 2G5GX 4U7WA 3GW8A 3PQCA 1VPLA 1RWWA 3N53A 3NTLA 4HUQA 2PY6A 3J7AC 5KHAA 2AXEA 1H5UA 4FFMA 5ALZA 4BO3A 5BW4A 4TTSA 4MUYA 1CQIB 4TRRA 1LXCA 2PZEA 5AI9A 4BQNA 1XHEA 4Y2GA 1B00A 4MUFA 4EVRA 3C39A 2WVAA 1FJHA 2GETA 1BU5A 2VT6A 2A0FA 5DH9A 3AR6A 3STWA 4FB4A 4RLHA 4JVSB 3EZFA 1C41A 5HUJA 3SIXA 4RY9A 2HMYB 3QUSA 1SQ6A 1VSVA 3WKCA 3MHPA 4PN3A 1Z5WA 3LUFA 5FR1A 2XTJA 1JQDA 1MCZA 1KORA 2EBFX 3ZXXA 4E3WA 1CDZA 3HKEB 3CUTA 4GPIB 4Y2RA 4ZV9A 2VTVA 4HBGA 1KMCA 4JEUA 4TLAA 4E7PA 4P0QB 2IHNA 3RIEA 2QZPA 3LBNA 3L8HA 4B17A 4F60A 1BJRE 4V1CA 4JH0A 2NQ8A 1R5OA 2V0CA 4YJGA 1OVMA 3KTOA 1QP4A 3ENVA 3HXPA 1BEUB 3WOVA 3OIGA 2J9XB 1DAGA 3B89A 1LVHA 5GV7A 4BN4A 5IT9A 1UXHA 2GYYA 3K16A 2J0EA 4MVJI 5EPEA 3RBAA 4JEHA 4MH0R 1Q7RA 2Q5EA 1XA4A 2PKWA 1NRWA 2XEDA 3D2LA 3LU1A 4JJIA 4M49A 1I36A 5DNDA 1WO8A 1Z5PA 1V47A 2AN4A 2FR8A 1H4VB 2PL1A 3VMFA 2VLIA 4YTEA 4CZ2A 4QDZA 2D1TA 2QD4A 2FN8A 3DL4A 3G89A 1BVUA 4YQEA 5I4IA 3L8MA 1TD1A 3LRTA 4I4TB 3TN7A 2UZ0A 5I7UA 1CY0A 1ZISA 2DHQA 1WDWB 3CPHA 1NVTA 3ZIAA 2RDMA 2OO7A 1E1QD 3LX5A 3UC9A 2PXXA 2GJ4A 4DVJA 1I7DA 2ZANA 1J9EA 3SS9X 2HI0A 1DHTA 1K6EA 2IYYA 4YUXA 2JLYA 2JRLA 5LLDA 3WHLA 1LPAB 1C7ZA 4NEGA 1NTOA 3MMXA 3L9WA 1E0SA 5IU6A 2XA1A 1NRJB 1B4DA 3KVRA 1E7SA 4M9SA 4Y2JA 1Y1SA 1QIGA 2W90A 4QT0A 3TS1A 3N0XA 1RYYA 2COUA 3ZCPA 4D2IA 1Z2OX 3ELBA 4TQUS 2IOQA 5KI6A 3ZWPA 1MPXA 1T4DA 2OTCA 3N0WA 5JANA 2G17A 4EDFA 3K70B 1WMEA 3A3PA 4EQ6A 1PWYE 3IP9A 4RJJA 2IF0A 5DGDA 2GGSA 1E3EA 1VSQA 4WY2A 2VJQA 3V3TA 3W3ZB 1SG0A 3GEDA 3K8YA 2O59A 4EKDA 3RABA 3W05A 4D0RA 1VI5A 1VDMA 3MJEA 3MW8A 4E6EA 1SU6A 4MAFA 3BWCA 2XIQA 1MLDA 3LW8A 1RKXA 3TIFA 4PYLA 2B2NA 5HIMA 1MC8A 1U31A 1IVYA 1GCUA 4D9IA 4N48A 3L92A 1Q0TA 2XF2A 3U40A 2WYHA 4ERXA 3PA8A 1PWZA 3TPFA 2C1EA 3LBAA 2YIVX 3SSMA 5M5BA 1YZHA 3CVXA 2K2QB 4D3XA 1YTLA 4O6VA 4DCNA 1ZMOA 3OT1A 4L8WB 3M9WA 1MZPA 4Z6KA 2H1OA 1JEYB 2J32A 1V5IA 4XWTA 4CKBA 3JQAB 1T29A 2ANBA 1PR9A 3RWBA 1JAZA 1VHJA 4D4LA 2ATIA 4KFRA 4Q9HA 3DYVA 4NY1A 1JVNA 4S1VA 5DN9A 2FZVA 1QE0A 1C9JA 2CXNA 3M1YA 4KQHA 3HO6A 1QBKC 2VT3A 3O92A 4Z9BA 4YREA 4DMCA 4TYNA 3ZQUA 4H7DA 1ODCA 2WOJA 1O6FA 3G5AA 1ESEA 2OCXA 3QLTA 3V8NA 1LD3A 2BHTA 5HQTA 3K09A 4BVAA 1P5HA 2XE4A 2XUPA 4J1SA 3CH7A 3WLRA 2WTMA 4NJEB 2FI1A 1PWEA 2O2ZA 3STYA 4DA8A 3OQBA 2F9LA 1HQYE 3JPYA 4PC1A 4WKOA 3P2MA 5E1MA 3VH2A 5IMSA 2G4CA 3LOPA 1GTMA 5KOJB 3FSGA 3IXMA 3B5JA 3DPUA 3K8QA 3IOBA 4UHBA 621PA 1P0FA 4E31A 2V5AA 2R8YA 2IEBA 2RGWA 3WMFA 5C7OO 5TGZA 2XZTA 4DABA 2Z58A 1L1RA 1ZUHA 2WMNB 4DIKA 1SEPA 2XUAA 3MS4A 3HXQA 3C7DB 1CERA 3OZBA 3QU4A 5JZ9A 1G6KA 5B3AA 4BYMA 4PS0A 4EOGA 2NZWA 1KSHA 1O8CA 3NTVA 1J0AA 5B1SA 1ESNA 3EAQA 2WSMA 1TA9A 2V8BA 1S0UA 1IZ7A 4QDUA 3G1WA 5BW5A 2GEVA 1XLVA 4XAQA 4GSKA 5I5GA 1U28C 3VU9A 4A2CA 1MF7A 2OB2A 2X7JA 5K0FA 4DR6B 4J0QA 2LZ0A 2VXCA 3BA6A 4BLTA 3O91A 1P9RA 4LTMA 3DM5A 3N75A 4UAJA 3M0EA 1E59A 3K1AB 4OQDA 2W2KB 1M3SA 4K2HA 3VJRA 2ZBDA 2WUGA 2Z2IA 2JJ1D 4NSNA 2OV3A 1Q1GA 3FA2A 3KJQA 4BVHA 2FQXA 3JWHA 1OC4A 4A4DA 4HDAA 5EWMB 1C2TA 3BGDA 2KQUA 4D25A 1JAIA 1UDBA 5J5VA 3UMVA 4NF2A 1LLCA 4FN5A 1HYEA 2HJHA 1VE5A 1IULA 4L07A 3WKEA 3ZU6A 3IR5A 4BGVA 4BBAA 1LA2A 2ZYSA 5HX7A 3H1GA 4RY2A 1W2HA 2PWZA 4I8IA 1DRUA 3DYBA 4PY2A 3ZDZB 1YUNA 1MENA 1R9GA 2JA1A 2YYAA 1DJQA 1NZDA 2CJYA 1W0CA 3LFUA 4GKBA 3DFFA 1QP0A 3HDJA 2C07A 1N2BA 1WOMA 3EE6A 1VSTA 2GCEA 1C3EA 2OLEA 3KHTA 3N76A 4O33A 1KH1A 3IAAA 3WGTA 4O4HB 5TE9A 4GGOA 1L7PA 5D7BA 2HEIA 4CIBA 2R5WA 3NFRA 2BCJQ 3ENQA 2CV1A 3D0OA 4RD4A 3B53X 5ILGA 4F1JA 5LR6A 4MSUA 1F8XA 2WF6A 1LZLA 2GUWA 4TMYA 3FGPA 4TLLB 1KO4A 1EFKA 1WTAA 2YHIA 2QY6A 4H4EA 4L27A 4MO9A 1FVHA 2FE1A 4R16A 5TT0A 3VM6A 3X3HA 4DIEA 3OEYA 3JV7A 2QRHA 2DY0A 2EJUA 1BEZA 5AFSA 3CISA 4N40A 1UMDB 2H7XA 3FOBA 3R9IA 2QYOA 5AVOA 2X2EA 3AQIA 2XLCA 2A1TR 1EWRA 2Y2VA 4GH5A 4OQLA 1ZSYA 4OQQA 4BJ6A 3NEPX 4MDEA 3IIKA 1QFYA 3OSZA 1SXPA 5IBQA 3PUHA 4MO2A 3GD7A 5CLHA 1DIRA 4D56A 4BMXA 3V1UA 5LQSA 4I6EA 4OEHA 2NYAA 4XTCS 1I4EB 4DCCA 1L4LA 1T1SA 1WVIA 2I7TA 2JLBA 4AMBA 4S04A 3LDFA 2Q1XA 1E1YA 4IJ5A 2IHTA 3RTEA 2XTNA 3L1VA 1MOPA 4EITA 4RD6A 2D6FA 5L6MB 1JR6A 4Q7LA 1BDMA 1OV4A 4GWLA 1WXIA 4QOGA 3SPXA 3W9BA 2G9QA 2FZKA 1PR2A 2ERCA 3L0ZA 4OK6A 4OO3A 3ELWA 4PHGA 4UUAA 3IEVA 3G0OA 3KOXA 1OFGA 1RXUA 2BCEA 2YWXA 2OAEA 2NM0A 3V1MA 1XEWX 3TTTA 2HW8A 4KTVE 3CYFA 5AYVA 1JBKA 2VDKB 2WKWA 3IBCA 2WJPA 4X41A 1ODLA 4EGFA 2P9GA 1KFJB 3KSUA 4TVKA 1ENYA 3ZWNA 3RRBA 2JJ1A 3KQSA 4HYQA 1L8XA 4XM1A 4LNUB 3LTNC 4FR2A 4BZQA 4YCBA 1IM2A 1QKJA 3GA5A 3H7AA 5JZSA 2CZCA 5G4KA 1UADA 1TO6A 1XJ5A 1O0BA 4EL5A 3PENA 3EFHA 5HIAA 2YWJA 1YZGA 3HN6A 1XKLA 1SUDA 1J2RA 3ZCSA 1VJGA 2JLQA 2PGXA 1NE2A 3HV0A 4J03A 1SK9A 4XD7A 1Z5VA 3LPAA 4G0MA 1IY1A 2GHTA 3SF8A 2HSJA 5L3RA 5IC6A 5BT8A 1OGJA 1TYBE 2XA2A 5KQSA 5LMUB 4ID9A 3JQAA 3DTYA 4I5FA 4G1UC 3M3HA 4I8DA 1I2ZA 1US8B 3A6ZA 3U7QB 1QCYA 3BA1A 3U9LA 1WSDA 4B9AA 2NP7A 4WLUA 1QHNA 1ZUWA 2Q8NA 3HI4A 5FI3A 2A4MA 4JA0A 2JAUA 2QJFA 3PNMA 3IP8A 4WN9A 4EBFA 1V9SA 1PDVA 2GK4A 4LSGA 2OXCA 1GCAA 5FWYA 4DLTA 4B74A 3F6BX 5LKRA 2M6SA 1TK3A 1P1BA 2X9LA 4OIFA 3LE8A 2ZUVA 3ICPA 4LXTA 3L0DA 1XJQA 1QK4A 2K4MA 1M1YB 2G04A 3H2SA 3PGLA 1RD4A 4RSRA 3V4LA 1EQAA 1OBFO 3QTBA 2FSVC 4NG4A 1JGTA 2QPLA 3VO9A 1OCEA 4G0ZA 1RLUA 3D8UA 3OHSX 5D8DA 2MHCA 3AMVA 1X1QA 3KB2A 3T0IA 4ETNA 2VDRB 2RKWA 3TK1A 1KK0A 3OLWA 4MQMA 3SP1A 5G1PA 1OGYA 2JVJA 2WUFA 4ILEA 4JC5A 3NHUA 3WL3A 3GRFA 1ZM9A 3KQQA 3HB0A 1L1QA 4EG1A 1TW2A 1DBQA 2WW8A 3MD0A 1Z4QA 3NWBA 1Y6GA 2ERXA 1C8LA 3L8ZA 4TRMA 2VHTA 1LDGA 4B4OA 1ISMA 2EARA 3T9AA 2FPPA 1WPXA 1K8ZB 2FFJA 3AWDA 2YHSA 3GJ3A 3ILVA 1OPXA 3TQRA 5EHGA 5JXHA 4L74A 3W04A 3HXMA 3UWSA 1SZPA 5I8PA 2PT7A 3OH8A 3JZFA 5SZJA 3ILYA 1C0EA 5ALEA 2QLMA 1I7PA 2AMVA 3FOAA 4KQ9A 4IIGA 4FZ5A 3WNZA 3P27A 3ZK8A 1NG1A 1SUAA 2J7PA 1II8A 2OHXA 2HPZA 4GLFA 5KTMA 2NO7A 1BFDA 3C3BA 1LKZA 3K1TA 4DLXA 4BO6A 1GDTA 4W9MC 4CIXA 4PCUA 2QRJA 3ML1A 1XV5A 2XNCA 3U1TA 4OX9B 4C6HA 1LTKA 2MMGA 1YNOA 5D2CA 4E4RA 5ALWA 3H5LA 3NGLA 1JH8A 1N5OX 2R79A 1WM1A 2NUBA 1AK2A 1XR3A 2EW2A 3GN1A 2Z83A 1HNWB 5C34B 1A95A 1E3WB 4M0CA 1EX7A 1IRIA 3K0KA 1W0JA 3UK0A 4XJVA 1GU1A 3LYLA 4R40A 2ZUBA 1O95C 5JCXA 1PZHA 2BGTA 3DLTA 3LT2A 3S2UA 2H4XA 3WNBA 4RTLA 4L72A 4F11A 3A9CA 2LIPA 2BTQA 3FYHA 3H18A 4RH0A 3C6BA 4LC1A 1LK0A 4BJHB 1Y9JA 4LRSB 5I7EA 4S05A 3WZLA 1R5BA 4LK3A 3MWKA 1FJXA 5H70A 2QZ4A 2YKGA 3BXEA 1Y3AA 2AJCA 2SBTA 4I4NA 1XZLA 3WC4A 1A4RA 1PGOA 5LU9A 1EIWA 2GEKA 3WV4A 2UAGA 2EKZA 1XAHA 5FV4A 3AZPA 4QBFA 4WMLA 1DEAA 3WIBA 3G2KA 3KKPA 4FYKA 2BC9A 2H4YA 2ZWIA 3LP6A 3GUHA 4CRWB 2YZNA 2JB9A 5EWJA 4KC0A 1FRZA 1VLVA 4NXNB 2FPIB 2HSWA 3DWIA 2R86A 3EGCA 4HTFA 3T41A 3RBXA 5K0EA 5IRCD 1JHMA 4IOKA 2X19A 4YNBA 1MVLA 1KEEB 1QSGA 4GLOA 4P3YA 4C08A 3LKVA 4ZTBA 1WLSA 2JH9A 4EJ2A 4NI5A 3D6FA 1WHSA 1WBDA 3WYDA 2HK6A 2IC5A 4JMPA 4KWTA 4A73A 4CU2A 1AXGA 1L7QA 2ZQ5A 3P5SA 3QVVA 4HGYA 4KH0A 4TLDA 5DOVA 3UXMA 2NOAA 3MTBA 4DPMA 5FB3A 3UKOA 3BMNB 3MINA 1QHHB 5AXBA 3IO5A 2GA9A 3D5EA 3DOIA 5LP6A 4HJXA 4EEKA 2QAIA 3OQVA 5JI2E 1WZUA 3CVVA 1P45A 2IEGA 2ZITA 4KO2S 3RB8A 4BWYA 2YFHA 4JL6A 4O5OA 5AXAA 1T4CA 3GRAA 1EDOA 3EH2A 1GPAA 2PUTA 1LBTA 1O94C 5IANA 2J6CA 1R0XA 3STVA 1Z5ZA 2WPDD 4TWAA 4Z99A 2I9KA 2JLWA 4G9EA 4ME6A 4XOIA 6Q21A 4REMA 3UAGA 4BXOB 2PL9A 3L1UA 3SQNA 2WI8A 2Q1YA 3N5KA 1OILA 1JNXX 1NV8A 5INTA 2Q49A 3CF6R 4BVJA 3OAAD 4XQEA 2GRUA 3X43A 1TM1E 3QIAA 4RMGA 4W4TA 2QTNA 1JP7A 4XE5A 3SHTA 2D5IA 4HNAB 3F74A 4ZAGA 1NLZA 3TQQA 3WB9A 4E15A 2Y9PB 2H48A 4DW8A 1EDBA 3GMTA 4DA4A 1C30B 1PD0A 1M1NA 4G0OA 3C3JA 2YMQA 4IIJB 3ZWKA 3GLFE 4LMPA 3MZ0A 4LFAB 2ZSIA 1G2QA 5A2QA 3T3EA 4DLAA 4B7AA 2VJNA 3Q0IA 4EMSA 3TRFA 3BXGA 3HXTA 1SQ0A 1T9GR 1VL6A 4XR4A 3UUWA 2D3WA 2PFKA 3NP9A 4GLJA 3LF1A 1XEWY 3SX4A 1TZ2A 1LLDA 2WG0A 4DKJA 3PF9A 1ZESA 3L7NA 5HMMA 1OZ0A 2RGDA 3KJFA 2F90A 5JC8A 5TMPA 2G83A 4J0JA 3R8FA 1QNLA 1CPYA 4CR7A 1SGWA 2ZYIA 1ACLA 4K3UA 3NNNA 1U7PA 2IY7A 4JWTA 1RYNA 1DAMA 3GH3A 3PFNA 3STTA 4QTUB 4MROA 3G8YA 5I7VA 4JLKA 1CBUA 2BDEA 4JKIA 1Y80A 4PG7A 4M1WA 4Y3UA 3GJRA 3RVJA 4AQ7A 5KNBH 1SCDA 2CK3D 2GB4A 2W7TA 5K0SA 3B3JA 4CMIA 1RT9A 1ZVMA 3GQBA 1YZNA 5KYNA 3GWGA 4Q1AA 4C6SA 1PFUA 4JA2A 5EE0A 5LBTA 2FMHA 4FZ3A 1YZKA 4LA4A 3TX6A 5BN1A 4NCJA 1E1KA 4BWFB 1SAYA 2P3OA 3A3NA 1N8KA 2YBDA 4F96A 1L5WA 5BMVB 4BX0A 3H8VA 1P0MA 5ILOA 2IWRA 2HRRA 1KI6A 1UBTS 1BWPA 1KC1A 3FLAA 3WGJA 1KSFX 3HS3A 3M33A 2JJ8A 2QV7A 1QZUA 3DB2A 5TF4A 2ZJFA 3EZ7A 1Y34E 2RK4A 1CJSA 1E96A 1FDRA 1VL5A 3LXRA 4RCZA 3TVYA 1KPIA 4CV2A 3B36A 3PLRA 4UXHA 3DBLA 4ZOEA 4Z9XA 2F43A 2H31A 3QXGA 4EK9A 2Z43A 1LPSA 3D3WB 1ISGA 4Y98A 3QLVA 2LE0A 3TTVA 5KTYA 1L3CA 2FPWA 5JJLA 2Q5QA 1KY4A 4D42A 3MTJA 1X14A 2G63A 5FFMA 3DUFA 3L84A 2AFVA 3EEYA 3Q9LA 4KMMA 4YUVA 4DV4B 3HJTA 4LOLA 1JLSA 3AR9A 1IEVA 2WE7A 4BDSA 4GYJA 3NAGA 5IHPA 1VKRA 1OFVA 2OT3B 4FWTA 4Y9RA 2HT6A 1MVOA 3JD3A 5F33A 2I2XB 4YWJA 5IHXA 2Z2YA 2ZYTX 2X0RA 1BJKA 4DANA 2AKAB 2DPMA 3WWCA 3WE7A 1DARA 4LRQA 1AA9A 1E9BA 3IHKA 2O05A 3OE4A 4Q5IA 3SEZA 1O95D 2Z6VA 4CR6A 5JJ5A 1YUBA 1AQNA 2C3UA 1Y4ZA 1QGYA 4IVNA 3UMJA 1C9YA 4PLWA 4TLMB 3O2NA 4KX3A 5FOVA 5IASA 2V45A 1YE3A 3QV1A 4CIDA 3C3CA 3FWKA 1I6WA 3NHZA 3O6VA 3OOJA 1U2RA 4IGKA 2ZBRA 5JBNA 5ECYA 4ENPA 4EY7A 1SK8A 2EX0A 2PZLA 2V4MA 3NXKA 4KPGA 4P31A 3VHXB 3SQOA 4UTPA 1GXSB 5BSKA 1XQWA 1E2JA 1RJ9B 3NBAA 4RVOA 3HXOA 1M75A 4TL8A 3HUTA 4PX3A 2OOSA 5DGTA 4I1RA 1R9JA 1UBUS 3LV8A 3Q11A 4KXMA 4MKFA 4D9CA 2MU1A 1IYZA 3UXHA 2JBHA 1OWOA 1PGPA 2Q28A 2FZ5A 2NT4A 2WAYA 3JARB 5FUXA 4AS2A 2GN1A 2EU8A 4GXQA 4E2YA 1LVUA 2ZQYA 2CVPA 2BM1A 3GLUA 7AT1A 3TGWA 1S2IA 1PKXA 5DO9A 2JW5A 3QTTA 4F5EA 3R6GA 5CJ2A 4J0KA 4Q03A 4WGGA 4UTXA 4LZNA 4XLLA 4Y9UA 1PYOA 1T5IA 1WEKA 2FK8A 3QWFA 5K7SA 3HY3A 1FFXB 4DA6A 3HC7A 4B6GA 2MSNA 1Y7TA 3I2IA 1DLJA 3C4QA 4KQMA 1HDRA 5TF0A 1DIHA 1VE3A 1M72A 4GM0A 3D2CA 1YB6A 2WU3A 2ZYAA 5PGMA 3UK6A 3WLOA 1AKTA 5H9WA 1H9BA 1MPTA 1AUQA 3PZRA 3HSSA 3LT0A 1VFNA 2I2FA 2RIPA 2ILTA 4JJ8A 1W36B 2PGNA 4XVCA 1QS0B 3VKVA 4U2GA 2AQIA 2ORYA 4IIJF 3K2QA 1JFSA 3NT4A 1T9BA 2GT1A 4RLQA 4C4ZA 2WQ6A 4AY4A 5IARA 2QK4A 3R20A 2V7TA 5CTAA 3IUSA 5ICMA 4JDUA 1IEWA 2DUJA 5CTJA 2QA5A 2OWEA 4ZKDA 2VPQA 3BQMB 1C4WA 4TS9A 1N7GA 3G2LA 1FYFA 4A9AA 3ZYZA 4ZCQA 3JZIA 4Q7EA 4KMRA 3KX2A 5DISB 2YXNA 4J94A 4O2BA 4DC1A 5BN3A 1QQBA 4ETMA 2JBAA 3QWIA 2CCJA 1JG1A 1UK9A 1ODIA 4J7UA 2XQVA 1KBQA 1KE1A 3FMIA 1RWBA 1X7WB 1XIVA 3K9LA 5D7NA 2WSSD 4L15A 1AJEA 1I14A 1RRPA 2GN2A 3VNSA 1BWRA 1MEJA 4ZN6A 1BU8A 1E20A 3BE6A 1JPNA 2FX3A 3NM4A 1DTWA 4EA9A 3KZNA 3GUYA 4XX1A 2X15A 1UT8A 3VDXA 4URWR 1SCUA 3PEEA 4I4TA 4DNFA 1AMNA 3ESQA 2XMSA 1R0SA 3QKRA 5IJAA 4BV9A 2C4KA 1NXTA 3H1BA 4BZPA 3FDJA 4JB0A 4JGIA 4WVLA 3I5XA 2YS7A 2ZATA 1FDWA 5GJBA 4RORA 3NHRA 2PA3A 5BYJA 1MA3A 2C5FA 2ZJBA 3OLCX 4KKVA 1NV9A 3HB4X 3E23A 5JNUA 5T41A 3KAKA 1CYEA 3OOWA 4C22A 4F6LA 2OBNA 3GUZA 4G0XA 5E6UB 4ER6A 3AG5A 3NI2A 3UFXB 5KC9A 5CDGA 3H4VA 2BELA 2OC4A 5B4TA 5DLYA 3OZXA 4M0DA 1CF4A 1XYYA 4DZZA 4DEVA 3SZLA 3Q7EA 4BQOA 3OWOA 4DIMA 2WA1A 2C4MA 4V0MA 4JNCA 1WCWA 2C0CA 4OU4A 1M76A 2BFPA 4RXTA 4ALJA 5GZ3A 2HYIC 4R2HA 1TUIA 1VJ0A 2IW3A 3EN0A 3KYDA 4CLOA 3TMYA 5AM2A 1HG1A 2VZ8A 3EIQA 4OFZA 3CPSA 1SUEA 5SY6A 4D6PA 4LN1A 4IVPA 1OLOA 3BIOA 2L17A 3Q40A 2VDMB 2AD1A 4AMZA 1KJYA 1GPUA 2PYIA 3OD1A 5TX7A 4B3MB 3NDPA 1DKLA 3PE3A 2NNLD 1FRNA 4QA9A 4CUKA 2GCOA 5BOVA 1FP7A 2VZ9A 4TVBA 1PT5A 3E27A 2XB4A 4O8ZA 3ZK9A 3W6NA 3PCTA 3H2BA 4KO1S 5FV7A 5AVQA 2J8ZA 2R44A 1BFKA 2ACEA 2B35A 2VAXA 3NXSA 4GM1A 2DAPA 5JQGF 3LX8A 4GECA 2G9RA 3JALB 4QARA 1MX1A 2X6QA 3I9MA 3AOEC 3G0BA 3N0RA 3QKWA 3CX3A 4R81A 4RPJA 3ZBTA 1G5TA 5CT9A 1U7ZA 1E3TA 1HDCA 3U3RA 3WLQA 2FPGB 5FHRA 1GP2A 4NPHA 3W8FA 3RVBA 1HQDA 4LXGA 3QKUA 2QLLA 2C95A 3DG9A 4E5MA 2A0KA 2FX2A 1G20B 4ZI7A 1ZA1A 2RK6A 1JDSA 2C29D 1MJGA 2UV8A 3DZBA 2QW0X 4GIBA 3O0TA 3A3KA 1O6GA 4JQSA 1EHIA 5KTPA 4KG7A 2VHCA 4CGYA 4XX0B 1TIBA 3LRPA 3OIUA 4JYPA 3ZGXA 4YAKA 2WIGA 3AI7A 2EYQA 2HLNA 4R0VA 4AJHA 3ZVMA 3CLKA 3G88A 3HO1A 1KI4A 3CF4A 2Q45A 3W3AA 4NS4A 1JDNA 2AX4A 2PJUA 3OFVA 2IJGX 3NJ4A 4JFAA 4QE3A 5HEKA 5M29A 2DR2A 1KP2A 5ADHA 3NJ8A 2FN7A 4DHWA 3OBBA 2DE0X 3GJQA 3EC2A 4F92B 1U2ZA 1M7HA 3B2QA 1OR8A 4Z2AA 3OLQA 2D59A 3OIWA 3X2SA 1U4NA 1YBMA 4NOKA 1KKUA 1ZONA 4JQYA 1Z45A 5KPJA 1U99A 3SVTA 1KVRA 1T1JA 2VWHA 3BFVA 3IKMB 4I1SA 1PFQA 1S7GA 1J24A 1T43A 1ORVA 3N7UA 4FFDA 5C1DA 4KL8S 3OESA 4ZIRB 2ALJA 3QE4A 5C35A 3RS9A 3VZSA 4KWIA 3DPIA 3BWDD 1T5TA 4RK6A 4B7ZA 3EZLA 1SA0A 3WOHA 1XZBA 1N78A 5LP6F 4S0ZA 2XI4A 1PP4A 4U2BA 2QN9A 2YOHA 4NOLA 1T1IA 4LJ6A 3ZJ4A 2RJ3A 4F0JA 4ITUA 3ISTA 4J2OA 4QVGA 5CK5A 4Z4CA 1NZFA 2DU8A 4KGZA 3EISA 4Q3DA 3QM1A 3O3MB 1WDMA 2IYVA 2BZ0A 3COSA 2OQVA 4NLLA 3RK0A 2LDXA 3RRJA 1Z4MA 5EIHA 1VKNA 1RWXA 2ODTX 3IVMA 2WTEA 2DUUA 4XUDA 3U4GA 4I19A 4QXRA 3WISA 2O5RA 4IJKA 3INYA 1AXRA 2OILA 1QQTA 1XD2B 5D84A 4JYMA 5TLSA 4Q47A 5THQA 3K9FC 3D6HA 3DCIA 4A26A 5JARA 2PFGA 1JDBB 4TSFD 3PSAA 1FTYA 4H60A 3ZKAA 3GLTA 4QLBA 5JXJA 4F71A 2YCLA 5JQWA 3WK9A 1VECA 2OLJA 2JHAA 2YCBA 2OM6A 2Y2UA 2P6OA 3HACA 3SKVA 5REQB 1SCBA 1M8PA 4BTEA 4WT7A 3OHPA 3HPQA 4G5FA 1RXVA 1I32A 3G59A 4J49A 2GPBA 3CUUA 4LJYA 2B25A 3QE0A 4C14A 5EJ2A 2HTEA 4QOEA 3VR0A 3CX7A 2TMYA 5K6AA 4YMHA 2QN7A 3AR7A 5CB0A 1R6XA 4FXPA 1II0A 1G3RA 3BHJA 3E9ZA 2GEUA 2H2WA 3ETDA 4KNVA 4URZR 3WGKA 2FZLA 4U7GA 1GZ7A 1KJIA 3N39C 1H4TA 3PICA 1GSOA 4KMSA 1U0JA 2XEXA 1KU6A 3RGWS 1IN7A 1P0IA 2W11A 2XY4A 3DPSA 4YH1A 2V3CC 1SBNE 3ESYA 2YVUA 3AB8A 2CE7A 1DKRA 2J3DA 1Z6TA 3U4IA 3IV6A 4F2HA 4FN4A 4ZDIA 5JHHB 3KD3A 1SU7A 3ICCA 4PPGA 3W6OA 4LV8B 2F3SA 3MMNA 4F3CA 2JLUA 4Q39A 1D0IA 3LUCA 1D6MA 5L4SA 3PGVA 2CSXA 4JIGA 1SXIA 4KW7A 3ZDXB 2NTJA 4JJZA 3RRFA 2DETA 3QUTA 1BWSA 2Q1SA 1MRSA 3AU9A 4PICA 4LZZA 3HP1A 4GYYA 3DVAB 4FMBB 2CLDX 1DXYA 3JQEA 1PZGA 2ZRDA 2ZSEA 5HA5A 4F6CA 4JLWA 4IXNA 3PWKA 1O77A 1J9GA 1E1QA 1GVNB 1ZMXA 3EQ8A 4FQ8A 1U2GC 1KVQA 1LRLA 1UJ5A 5LP6B 3A1VA 2WPDA 5F9FA 3CGWA 2BSXA 2OHOA 3CEPB 3JQCA 1DDIA 4C4TA 1E1DA 1Y1QA 3IEKA 3OKAA 4DRXA 4HQRA 5CVUA 3BE8A 3VR4D 2VZEA 1YNSA 4AG6A 1N0UA 1EFHA 4R8KA 1VJDA 5DI9A 1JR3D 1P61B 3IPXA 5JALA 4DIOA 3FKQA 1FYEA 4LFBB 1SPXA 3L0BA 3TIIA 3NIWA 4F2GA 2AX3A 4L75A 4U0KA 4X24A 3GRKA 1XRQA 3L1IA 4FIDA 6REQB 2Q9UA 2DR0A 2JH8A 2WM9B 4FXOA 2YMLA 3EDQA 4Q19A 3JRWA 2YJ3A 1UDWA 4KI7A 4N5MA 3UHPA 1SHTX 4X62B 4E08A 4EPRA 1GPMA 2XD4A 4TM8A 3IP1A 4ZCRA 2JASA 4FGWA 4G4SO 4HWTA 3I1YA 3O8OA 1EEHA 3CZRA 3P94A 3KE9A 4HNAA 4L9WA 4LVCA 3RUCA 3IAS1 3LBHA 3N3AC 1U7TA 4X9XA 5ALQA 1A2OA 5SV2A 5KWEA 3Q7PA 2XMCA 3PXXA 1NI4A 2ZETA 4QNMA 3WLSA 3T3HA 5JY6A 3W2IA 2I4NA 5ER9A 3RQIA 5EZ6B 2GPAA 3S2EA 3KPWA 3KOUA 1GFSA 1YQXA 5KWJA 4MUXA 2AF4C 3LFTA 1G7RA 1BX3A 2A9OA 2HLDD 5A62A 2FPUA 1ORRA 1LC0A 3M6FA 4TWRA 1U2SA 2IYTA 2D2VA 2DH5A 2Q3BA 3PNVA 5I7FA 2DB3A 2R1UA 2J5XA 2WHQA 3FNHA 5HP4A 1WD5A 4HDNB 2H2IA 1RE1A 2AFIA 1PV2A 5SICE 3UJHA 1CRPA 4BC1A 1G7SA 1I1NA 3DMYA 3UUEA 3JX9A 2QX9A 1IU9A 2J45A 3V7NA 3MN1A 2W6JD 1KTVA 4OG2A 5G0SA 4DQUA 3LECA 4K6MA 3CLHA 3VFDA 1Z8FA 4X1KA 4XRRA 4CMGA 1WMSA 2WJ3A 3CX8A 2V3VA 4GEGA 2B7CA 1ORIA 3NHPA 3TBKA 1XN4A 2FFBA 2H1SA 4XI9A 4B7CA 1IBSA 1HT3A 5B55A 4HAXA 2CBZA 1JHYA 5C80A 2GZRA 3H4TA 4ZPJA 3RROA 2PR7A 4HPXB 4J07A 5T8KA 1B3BA 1JBEA 5EP1A 2ZB8A 2INGX 1NOIA 1UJ6A 4KQ6A 2AOTB 2MINB 3BWYA 4HO1X 1T1GA 2BMJA 5A9TA 5ETJA 4E5UA 1PSZA 4AK9A 3FN4A 4B6QA 5K0TA 3JQ8B 1T5SA 2O8DB 4KV7A 1SURA 3VDMA 2VYNA 4K81B 1JDBC 2VK8A 4HGOA 1OA1A 1C3XA 4S3MA 5B3JA 4YMSA 1Z2EA 3F4LA 4G0NA 1QXSA 4BLWA 5IK2D 1GTVA 1MQ8B 1YRAA 3BB4A 4PBSA 4TZTA 1RABA 4J0EA 3BERA 4UM9D 3W34A 5CNJA 1J0EA 4OP2A 4EAQA 1B0UA 1B73A 4BQEA 1U65A 2JJMA 3T52A 4PRZA 3NWJA 1S2LA 1LF5A 2MJLA 2Y9MB 1IN4A 5EZYA 4UU1A 1VJCA 3EMVA 5TPZA 3T7CA 3ZV6A 4DUGA 1XZJA 5IULC 4PANA 1V96A 4M9UA 3WP1B 5BUQA 4DMLA 3LA6A 2B94A 2V7UA 1Z7WA 2YXLA 4J0FA 5EJ6A 3S6JA 3JQGB 2HXSA 4UDXX 3ZJTA 3W8EA 1RS0A 2VATA 3I4LA 1QOQB 3ZLBA 4OBBA 4UTVA 5F9HA 1GPWB 1L8AA 2BKAA 3CT6A 1EK2A 1E2DA 3T15A 4CQMD 3A1FA 2O3UA 5EXTA 2E85A 1M1ZA 1G3IA 2FSSA 4N9WA 5FR2A 5I8WA 3R0JA 3RSOA 3HU5A 5F5LA 3T1QA 3DMTA 5ISMA 3AF6A 3AVTA 4HRVA 3LY8A 2HMSA 1E77A 3ORHA 3UK2A 1MJHA 1G3UA 2Q3JA 4MGEA 1SIUA 2ZUUA 2VUSA 1EP3B 3A9RA 1ZD2P 4HNGA 1QIMA 5DGHA 4MR8A 4BOYA 1YA6A 1Y6ZA 2IEYA 3ASYA 3I9FA 1K97A 3HU1A 5HM8A 3D31A 4F3TA 3E82A 5K09A 3F6EX 3I72A 5A6SA 2IU0A 2ZLBA 4DB4A 4DRZA 3P0RA 2AR0A 4IDGA 4XPIA 4ZZ2A 3SICE 4D3YA 4W5OA 1OX4A 4MMXB 4YI3A 2ROQA 1GZDA 1HO3A 1NBMD 3PIIA 1R6UA 4CQMA 1N6IA 3PX2A 1RJGA 1V41E 4BTVA 2P68A 2VDVE 3PVSA 3JQGA 3WWYA 4QUAA 1O5IA 2H00A 2WRZA 3PWSA 3A4MA 3ZZ0A 1AQYA 1HRDA 2OENG 3QU9A 5IFLA 2OD7A 3BZBA 1YQWA 5SYMA 3ZNNA 5AUOB 4KE6A 3A27A 4GICA 2O3SA 4WCFC 4HEA6 4F7WA 4Q1VA 2PUCA 3BC1A 1E9CA 2JCBA 2NUPA 2AW3A 3W1VA 1OFHA 5DF1A 2HHHB 5TQ0A 3ZNQA 4E12A 4Z4IA 5EI5A 1V9CA 1VPTA 1TT5A 4BNTA 1SKAA 2H52A 2UVDA 3DUWA 3OIYA 5CXUA 3R6LA 4MP8A 3RFFA 4WJLA 1C8VB 2VBFA 2HFJA 4C6TB 2IZ0A 2H08A 3EGXA 4HGPA 3IOYA 4H3KB 1IUNA 2O2XA 6GPBA 1Z0DA 3PDIB 5DRYA 5HZKA 2FZ4A 4WW0A 1SVUA 3CRNA 3AR2A 3NONA 5ALRA 1SXQA 1TM5E 2XNSA 1Y98A 4Y2PA 2FDRA 1PT6A 1L4YA 1YZYA 3K1YA 5A5VA 1IK4A 3DDSA 5BWMA 4C5BA 4I9UA 1V1JA 4JV5B 3FPHA 4GEKA 4H1UA 2IYLD 5D3MA 4MYDA 4TKUB 4E07A 2BDUA 3SM9A 4DC0A 1ZK0A 4ADSG 1PX0A 3U7EB 1LQUA 3JWGA 4JQOA 1DV2A 1SC9A 1G2IA 2SKDA 1D4FA 4RGQA 2B98A 1O1YA 4HMOA 4F3YA 3EJ6A 1PZNA 1EM8A 3QLEA 4M0PA 2H1WA 4IVQA 1KERA 2AEMA 3ICQB 3SJZA 1QFMA 3FCCA 5E95A 4G0QA 1AGNA 1D2HA 4MRNA 1H22A 2XPCA 1KAHA 1KFKB 3HTXA 5TQVA 1A5BB 1PWXA 1TZKA 1U8AA 1ZK2A 2WU1A 2JK1A 1K92A 3F5SA 3S70A 4A91A 3GNTA 1R16A 5C9ZA 1D9XA 5TR9A 2GJKA 2GLXA 2QU7A 4FU0A 5KPDA 4I5DA 1ONOA 2X7HA 4DJTA 4AZ0B 3CR8A 1EVQA 1Y9ZA 1T6BY 1SD5A 4I8XA 5EIXA 4YA6A 4NVRA 1AE1A 2XUOA 1BEEA 3V46A 4DBLC 5AOAA 1NOKA 2PQ0A 2WOOA 3X1JA 3GBSA 2PJDA 1F48A 4BL5A 5B7NA 3H9EO 4ONEA 5E9JA 4RKWA 1GKIA 1HFKA 1KMNA 1CLUA 1QRAA 5AIAA 2OL4A 1SM4A 2FN9A 4QASA 1WU7A 3KFXA 1COWA 3SKYA 1NNUA 3IKJA 1QGZA 2WIAA 4EHDA 3MJHA 4LWOA 5I7AA 1W8DA 4RU1A 2C4UA 2WD8A 3ZQKA 5CIWA 3JQ9A 1XROA 1RZ3A 4GL2A 5CAEA 4B09A 3IAS6 2TRSB 4MMYB 1VB5A 2RAVA 5TGDA 1RWQA 2WFLB 3ZN2A 1OLXB 2BONA 5A5EA 1PTJC 2R6CA 4RF5A 3T4XA 4NCHA 2AYYA 1MOQA 1CETA 4KLCA 1HE4A 1L5RA 3LLSA 4RPIA 4B6JA 4O2AA 2EWWA 3P9QA 3O4GA 1TQ4A 4OQEA 4OJMX 3IEMA 1NONA 4X3OA 2DLCX 3SEAA 1V2GA 3KKMA 2IPOA 1KOLA 1F6WA 3LVFO 1C3OA 2WWVD 1GN8A 2XQFA 1II8B 1X7HA 3CQ9A 1DL5A 4IM7A 2XWSA 3UXEA 1JPUA 4NQRA 2H1HA 4BNDB 4RZQA 4H7KA 3F5DA 1SNYA 4XYGA 1M2KA 1PV1A 3FCXA 3Q5EA 4D9HA 3PCRB 6CHYA 5KJ1A 5GINE 3U4CA 3GLIE 1WXEA 3ANTA 1Y82A 4DOMA 2UUBB 3GPLA 1IG3A 4J90A 3Q8KA 3CCBA 4V0OA 3E3OA 2G09A 4PFJA 1ZEMA 4LQDA 3W90A 3VR6A 4TTVA 1WUYA 4V0LA 2WD7A 3ME5A 4PZ9A 2XDYA 3VOTA 1D3AA 2Y76A 1GSHA 3T5MA 1Q1NA 5IFKA 2WT9A 1OLUB 1PVVA 1RSZA 3JD2A 4IBOA 4RDCA 4CT0A 4IGFA 2ZAMA 4OHKA 5K4GA 5H81A 3A6FA 5E2IA 3OSUA 2DM6A 5EQTA 4ISCA 4G56A 3AY0A 3COYA 4IKEA 2H6EA 4MMZB 3SQLA 2JF0A 5K8UA 4RKYA 1P31A 3I28A 4HWOA 1HDGO 2AWOA 2CJXA 1YS7A 1E58A 5CDYA 1LDMA 1E5XA 1PGNA 1QF7A 4ZT3A 3RHZA 3UC5A 5B7QA 5CLFA 2MSWA 2WIBA 4Z4EA 2F62A 3AUUA 2IYEA 4RHTA 4UOZA 2AQ8A 2ZWOA 5T8KC 1Q20A 4YHBA 2MDTA 2H2AA 2PL5A 2OPBA 3GYGA 1EESA 2JCSA 5CA0F 2AMLA 4JLNA 2QIOA 1CC1S 3X1WA 3MWLA 1U0BB 4V0NA 2EKDA 3N9IA 1BXRA 3QPUA 1KFEB 4MQFA 5HKBA 2EWVA 2G7MC 1OBOA 1BS9A 1IOZA 2V3WA 2X8LA 3A8TA 4U7TB 5EP4A 3CNQS 3MTEA 2RB5A 3MWGA 3ZV5A 4D74A 1QJ4A 4H7EA 4LHZA 3G5UA 4J4TA 3RU3A 5BRAA 1E2KA 3JS5A 2HR1A 5B53A 2LP4Y 5JASA 1ZJ5A 1YBFA 2YWGA 1QKIA 4CMHA 4PBTA 1RHRA 5A02A 1NBWB 2ZJ4A 3QMVA 5AW1A 5JCZA 5FUBA 2IIPA 4REQB 3LHIA 4NJOA 1DWOA 1ZW1A 2F67A 2VJBA 3TB4A 2FJPA 2P6RA 4I4LA 4MCAA 3ZTTA 2ZJAA 4PO3X 4UQOA 5AK3A 3R7WB 3MHTA 3VTKA 4URHA 4ZCIA 1CX9B 1G41A 3AYZB 4ZARA 1B42A 4C03A 4TTAA 3TMAA 4JYBA 4UNNA 3U3ZA 4DM7A 3R9WA 1Z2PX 1BD3A 4UMVA 1CEQA 3DC2A 1Z37A 3BWEA 4LX8A 1A27A 4MV6A 4OFBA 5HZMA 3SYKA 1EUZA 5U1PA 2I4OA 2R1TA 3A31A 3PDWA 4RNCA 5P8WA 4V0KA 3MUOA 1VKHA 3NDRA 3PTLA 1NUAA 4S12A 4LOIA 3AHJA 4C0JA 1RZRA 5EJ7A 1RQXA 4BY9E 3CU5A 4F38A 4RH3A 5JVDB 2IBSA 4B3TB 3Q0TA 2OXIA 5ECGC 4D9JA 5DMXA 1OFUA 4RQBA 1SBIA 3QEBZ 1KAOA 4FGUA 3SC3A 5A2GA 1PLKA 1WXDA 3IBFA 3UVEA 3SC6A 1DXHA 3GEPA 3DW1X 4L5IA 1N3LA 3BD6A 4H3VA 2ZYVX 1P5ZB 3UY4A 3F2VA 4HADA 1OAKA 4PYRA 2XBMA 1CR6A 4JI7B 2HMVA 3EGDB 2CJWB 1W4BA 5LZ2A 4Z54A 1J2JA 1QIEA 3RYFB 3UAYA 3OY7A 1HQKA 4XARA 4BVGA 2BI8A 3O2QB 4P3OA 2P2GA 1CUVA 2P6PA 1XL1A 1TVKA 4LYGA 4D9FA 3NV9A 7ADHA 5AM5A 2B4QA 4KQEA 2RBKA 1KL7A 3W78A 4WY8A 4CEHA 1IQPA 2ZRLA 3QSYA 3MGKA 2P6UA 4D8UA 4Z3OA 4GVLA 2PRJA 4RCVA 3HGMA 3OT4A 1L5LA 2ACKA 2X5KO 3KNZA 3DDOA 1B8VA 2H1FA 5JE8A 2JD2A 1O5TA 4DLSA 2PT5A 4DR5B 1U8EA 2IE0A 4NYMQ 5JJCA 3FMPB 1E9SA 3IJRA 1H65A 1NW5A 3MBKA 5HS6A 3MPUA 5HCNA 1JDJA 5F1KA 4BS9A 3H2IA 1E3IA 3JR3A 3WDSA 3RYCB 1X8KA 5AJUA 3PD7A 4QXOA 1PUJA 3LKZA 3F3MA 1VZ2A 3UGJA 2VNSA 2BSQA 1X8JA 2CVHA 2WLSA 3D8NA 3MCZA 1E9VA 5DNVA 1KMHB 1TLFA 1BMFA 3I8SA 5ADVA 1JYFA 2GDZA 4F9EA 5G4KB 3AX6A 5IDYA 4MYCA 2EFDB 3A11A 2NVUB 2H7YA 1L5VA 2HK9A 1ZIOA 4JI3B 3KSAC 3I2JA 1PS8A 2D5CA 3LI2A 3ZD7A 4X8LA 1TF2A 1E5QA 3LHFA 4DLVA 1EFLA 1L5KA 1ADCA 4AJ4A 2X8JB 2C9CA 2XMBA 1IWOA 3FNBA 4KYTA 3TSWA 1XF9A 2XGJA 4R2LA 4US2R 2ZDQA 4EM6A 2DOKA 1G1MA 1RCTE 4R8VA 1OXXK 4PGGA 3UG6A 2R4QA 1YQUA 3JQBA 4PSUA 1NP7A 4UMEA 2C7BA 3Q3EA 4FBLA 3VJLA 3BAFA 5B1IA 2ET6A 2FSPA 1IMJA 1FLNA 1VMIA 1QVAA 3HKCA 1RBZA 3TQHA 2P27A 1E1RD 2W6QA 3KJEA 3OT1B 3NHBA 5T6MA 5JQGA 3CEHA 4YMIA 1DAHA 4QTZA 3ZU2A 3FSGD 2OXRA 4UVDA 2P3QA 3QVMA 1IXYA 4CM5A 2B36A 4PLFA 3V80A 4LZOA 2ZIGA 3EFOB 2HH9A 3CHYA 3MBOA 2HC9A 2V7GA 3L9XA 4WFIA 4GLBA 5L3QB 4OXNA 1ZI9A 2X9NA 1CEEA 1QRDA 4O4JA 1WDKA 1QF9A 5DKFA 3VNBA 3VR6D 4YJFA 1UJMA 1NW9B 1S4QA 1PJ4A 2QORA 1FX0A 2YZKA 4PU0A 4Z7NB 2QM3A 4IDAA 3NRCA 1U02A 1TMYA 1WOYA 2FW1A 2R85A 3FJYA 4NBLA 2ZK7A 4Q02A 1K5DA 2J4CA 2AQHA 2WJJA 4B84A 5TMBA 2ONYA 1I4TD 2QMHA 3FCOA 4KEAA 4S1WA 1V25A 3OE1A 1OZAA 3CE6A 3N6RA 1L5SA 4YP5A 4KQCA 4XDZA 3A1NA 3Q7TA 5FPYA 1ZICA 3I4CA 2EBWA 4FB5A 4Z49A 3FXAA 1FSSA 1TGVA 4Q01A 3IPYA 1Y9AA 2B7BA 4BFTA 4KRYA 1MIOA 4Z0PA 2HAEA 2JGDA 3ED1A 1OH6A 2LKCA 5K3CA 2P1RA 2R11A 4NP6A 3ZGYA 3BG5A 1JRLA 1XL0A 4GP7A 2XSZA 1ST2A 2XITA 2COKA 1C3VA 3BCSA 3ELDA 4RVDA 2WJIA 4Y6SA 4U2FA 5IK2A 4OQXA 8LDHA 4MAAA 3VAYA 3LNCA 2RH8A 3CRMA 4M8IA 4XCXA 4LJKA 4XZ3A 2PGLA 1VMEA 3HKBB 3FX2A 4F12A 4Y2SA 2XTMA 3TIXB 1NF3A 2QD1A 3TDMA 3HCAA 1U8XX 4FMDF 4GX2A 1KH2A 4BIMA 2EW8A 1PBNA 1U4SA 3ABSB 4FKBA 4N39A 4ZT6A 4XWYA 3ROMA 4UTRA 1M5RA 1IY9A 3I05A 3QLVC 2BFEB 3QMPA 3G5TA 5GWXA 1EWQA 3UFBA 4K3VA 3OFNA 1BVYF 1IOVA 4NCIA 3UMYA 4OMUA 4ZD6A 2QSUA 3RADC 1QGED 4MICA 1TFRA 4XSVA 5LXTF 5E9AA 4V02A 2XVYA 2WJAA 4KQ2A 3P26A 4B4UA 5BRJA 1QVVA 1QZ3A 2P0YA 2ZB2A 3BH0A 2J87A 3FAZA 3IDSA 4M76B 4G5SA 1JVBA 4BUZA 2H2HA 4B2PA 4F4DA 1R9NA 3I52A 1UP4A 4AJ9A 1ZD4A 4U1RA 3PD0A 3VAZA 5AVSA 4G5GA 1XZCA 2BMEA 2OVFA 2P9FA 3AHIA 1PNTA 1QIKA 2CNDA 4N5LA 1UK6A 2WU8A 3ZGZA 1UKZA 5EWLA 3K71B 3K3PA 1V3VA 1VMAA 1AB5A 4WXYB 1NW6A 1U8TA 1Z6QA 3KWJA 2A33A 3C85A 3S29A 3FWHA 4O4LF 4KR6A 3ZHZA 3ZE6A 2FOXA 4JELA 3L0CA 2QEQA 3G2MA 4IS2A 4ECEA 2B1RA 1IZ8A 1G8FA 4JQZA 5AVVA 3DMPA 2QL7A 3AFGA 5DBHX 1YB5A 3LW7A 1QGUB 1W5FA 1YB7A 2P9CA 4WNAB 3EF1A 1XZNA 2J85A 3UM9A 1OWMA 2QRQA 1K75A 3GDFA 4GC9A 1JTFA 1A82A 16PKA 1B26A 4LI0A 4CCYA 1YFZA 1RLJA 3URKA 1TZJA 3D3EA 3ROEA 3RTBA 3AT1A 3QELA 3CZ9A 1W44A 1KU0A 2QLJA 4N7BA 5GOZA 3ENKA 3V4PB 1J6UA 2I4LA 2ST1A 1MU0A 2P5SA 3KR0A 2W8ZA 4K1LA 1FZTA 2E9SA 3EARA 5EY5B 5J1TB 2C1ZA 5ENVA 1N0VC 3W3AH 1D1PA 4J3NA 3ZY5A 3AESA 3GEIA 3V8MA 1KWKA 1ESZA 2Y1XA 1GZSA 4WFQA 3W79A 4HN4B 1ZH6A 4Q66C 3UPTA 1EZ4A 2KLBA 2Y92A 4OL0A 3PHLA 3I64A 5EN4A 1YZVA 1RWMA 1KAGA 3LCVB 2ASEA 3DOFA 7GPBA 2B21A 3QVGA 4PSKA 1BN6A 2G7ZA 2D8MA 4GOKA 4LYEA 5K4AA 4YPVA 4YYZA 2CNKA 4CCSA 1JQBA 2BPOA 1DNPA 1KDPA 3FRHA 3NAZA 1G3QA 2CFRA 3HCDA 4MHSA 3GEMA 2HLHA 3KQHA 1LH0A 3V4VB 3PUZA 1ZG3A 4R5MA 4Y0AA 3NVKI 1U7WA 1T5BA 4QBTA 2G4VA 2XX3A 5DNAA 5DGCA 1J8QA 3EXIB 3AOGA 1WP4A 2J31A 5EKXA 1LNSA 1BA3A 1NLMA 4U2DA 1HBJA 2HNAA 4R7TA 5HM6A 2ORIA 4MV1A 5EJMA 2VWQA 3F4KA 4PAQA 4C89A 3LYHA 4BB0A 3O8DA 1O4VA 1QO9A 1Z8NA 3UOGA 2WKPA 3HHPA 1KDOA 1YE8A 3DWGA 2GJSA 1QLWA 1THTA 4H6XA 1KEVA 5AD1A 4QJBA 4ZI7F 4CQMB 4YJ2F 2YXPX 2F8LA 3AJEA 3GF4A 4DWVA 2V7WA 3L0IB 3VYWA 3KTDA 4CMIB 1IN1A 4FYYA 1J1UA 3LS2A 3QVLA 3HU2A 4H31A 2AKYA 4KV9A 4XPIB 3TQIA 3QVKA 4XWOA 3V4RA 3TLBA 2R8XA 1RRKA 4ZEXA 2JJ2A 4K9LA 2O50A 1ACJA 3T7KA 5FUYA 5KNCD 4QFBA 4QIHA 2X9GA 1RYFA 4OHCA 1JHOA 2D2IA 3DXYA 5E4FA 4M1QA 4GSLA 1OTYA 4LHVA 4EKIA 2P5UA 3KEGA 3RAPR 1TNDA 3IBSA 4KCGA 4EELA 4DCMA 1DEHA 3KKEA 1XP5A 3BWBA 3V8EA 4IH4A 4D26A 2GM3A 3VZRA 1HLDA 1BGWA 2OV6A 4IQ4A 3RVDA 4RH1A 3PFCA 1Y8ZA 2VSFA 1LPNA 4C5CA 3MERA 2NTNA 3MMPA 4WDQA 5IVKA 4I55B 3EG9B 3IOCA 7ABPA 4L3WA 4TS3A 4TMWA 3M2PA 4HK4A 4RE6A 3I30X 1LI5A 3GVIA 2I91A 4GQAA 2WMOB 2YFYA 4TLEA 4URVR 4MA4A 4P0TA 5HGXA 2B99A 2W2QA 4KJZA 4LSMA 1E79A 4YALA 1D5WA 1DKUA 2OA0A 4YRGA 4Z4QA 2Q6KA 2C5AA 3LDHA 1RMTA 4GR5A 1XMOB 3UV7A 5DN6D 2WIDA 4PF1A 4CV1A 4KLAA 2BFFA 3O4FA 2YYYA 5GZ6A 3SC2A 4EJSA 5LQUA 1QU2A 1TT5B 3OQ6A 4FLMA 1P4HA 2QTFA 1UPBA 2WYOA 2IRWA 2VFAA 4H7JA 5DHQA 2IYAA 4G2TA 1N2ZA 3G9TA 4YJ3A 2RC5A 1L4NA 3RVKA 1ZR2A 1G59A 1J2YA 1NXOA 4D4KA 4HN9A 4NZYA 3H5NA 4AMGA 1I2AA 5EXPA 4B76A 5C8DA 3GNQA 5DCUA 4R01A 1MA0A 4OUKX 2PV7A 4JI2B 3O94A 4P54A 1P8JA 1ZD3A 2P9JA 3DKVA 1JPJA 1JHPA 2PMFA 3VSCA 2AC2A 4LY0A 4HL6A 4MTLA 1CP2A 1XNHA 4S0XA 3PQFA 2NLOA 2P9EA 2VXBA 4G09A 1I1HA 3IP5A 3MWDB 1ULAA 4K1XA 4D4GA 1R00A 4Z0NA 5C1PA 1SRRA 2BEWA 4BRUA 4RPCA 5DN6A 1FCJA 2QS9A 3SFTA 5BV8A 2E5LB 4CF7A 1X3SA 1UC5B 1ADBA 1XTKA 4GNRA 1OBVA 1X9IA 4TUYF 2BFOA 4YMGA 5BSFA 4G25A 1XOIA 4EHKA 1NR5A 1GZVA 1XMXA 2A88A 3U3OA 2IH5A 2BEVA 1Z83A 3B2NA 5GADl 1TQDA 1YQEA 2BH2A 1Y6QA 2I8CA 2LPMA 2JGFA 5C8YA 3SF8B 5LQJA 3WQHA 1AMUA 4PZLA 5CX1A 4ZODA 3DFKA 4EYQA 4LCJA 1NM5A 1FTGA 4B71A 1PR5A 3WK5A 1SKQA 1ZRSA 2YJTD 3N2LA 4GOOD 4MW5A 3W7AA 3L41A 4N5DA 1C7QA 3VO2A 4CIVA 4F56A 4Q82A 2BKLA 4AXXA 3HUEA 4X7RA 4BKQA 4FJ2A 3WQRA 1NUHA 4QKQA 1OB5A 1PX2A 2R6ZA 4LRTB 1EE2A 5BOSB 1X1DA 4D97A 1W1WA 3KJHA 1B0PA 2WTNA 3H05A 3MYYA 3O31A 3QOXA 4TMXA 4YGYA 4PYKA 4CTKA 5HS4A 4E5SA 4IIDA 3A6EA 3IQIX 2FF5A 4DMKA 4KUEA 4YMWA 3GDHA 1Z0IA 3M6UA 3OQIB 1YASA 4COOA 3OX1A 2HWYA 3HB7A 4BQRA 4UDOA 2TMKA 1A2BA 4HDRA 1XZFA 2A0WA 4LJ5A 3GLGE 5FI1B 3PFWO 1SBYA 4L6AA 3WYEA 3MGAA 2CJPA 3Q10A 4MV8A 4WOJA 1JWAB 5DPMA 4NBVA 4OCZA 1QHFA 5HFNA 4F46A 4G5YA 1PHPA 2J5BA 2QI9F 4ARUA 2O3JA 4BBZA 4E1AA 1H9CA 5AVZA 4GBED 1E8MA 1TECE 2GYWA 1ZM3A 3PK0A 4O8CA 3RWMB 5IYZB 3B1VA 3LBYA 2EFHB 4J0HA 5DT2A 2GNAA 1G8JA 3EGEA 4FVTA 4F4FA 5IUNC 4AJIA 4DM4A 3RAEC 2Q5LA 1DC8A 1HXHA 2NAFA 3AR5A 4CKEA 1DGQA 2JI7A 2I22A 1GQFA 2ID8A 4K2AA 1Y63A 3MINB 1OYOA 3G6KA 3USES 4C3ZA 2I6TA 3LLCA 3M4YA 4GQBA 4CLXA 2MMCA 3HRIA 4IEEA 3NORA 3EIWA 1UWVA 4KDEA 2X5JO 5HDBB 1IAVA 2ECFA 3NEAA 4W9RA 5J3JA 1K0FA 1FUUA 4II3A 1ECJA 2OFOA 3MT9A 4LJAA 4BNNA 3GCXA 5TPZD 1IUKA 2WYIA 2ZIZA 3FFWA 2QJTA 2IDJA 3CKMA 3ZG6A 1PSWA 3GEEA 4P3KA 5LOVB 3QKSA 2KE5A 1ISIA 2EZ4A 3LVBA 2NYVA 4GOJA 5T64A 5BV2P 2EWMA 1X1TA 2ZTMA 1EFRD 4Q9NA 2E49A 4DUYB 2WP8J 4KAJA 3LUPA 1RHKA 2WF7A 4IHJB 5LOVF 4WOCA 1OQAA 1T9ZA 5JNRA 3T1HB 2OR3A 1H6BA 3H2ZA 4HHEA 4ALKA 4BNVA 2Q6IA 1YK1A 2A9RA 3C1AA 3AETB 4OAPA 2ZE5A 4GOND 4D02A 1ZGBA 2XYRA 1JEOA 3S2IA 4OLFA 4DG8A 2MR6A 1GAQA 2W37A 4YCMA 1ZNYA 4UHDA 4UZSA 2VJKA 3K6KA 4U8HA 4ZCSA 1JJBA 5KHOC 1UJNA 3UMMA 1E61A 2QOEA 2FQQA 2WSSA 2R8EA 3MELA 1NDUA 4GUAA 2OHIA 4Q3KA 1U9YA 4D5EA 4I50B 1FFCA 3QV2A 1UKYA 1UKBA 2ZIWB 2ZKLA 1JL3A 4NL4H 4RTSA 1C7RA 1M1YE 1QX4A 2X1LA 4KQKA 4C5AA 3S2ZA 4L57A 3NBKA 2V7PA 1KDYA 1JQLB 3BH6A 3LZDA 1IHXA 1RADA 2NPFA 3SYTA 4C7JA 1AHIA 2IS4A 1TCUA 3O83A 5FLEX 3JXEA 4ZU1X 4BO4A 4R7GA 3P2JA 4RMHA 1AC5A 4DGSA 3HBJA 5EUBA 4R2JA 4Q1EA 1FVXA 1QQ7A 2D3TA 2BEUB 1L4HA 3PKIA 3NOQA 2D7JA 3RUPA 4EW1A 2PGOA 1FLVA 1YJ5A 1E79D 3LK6A 5KYUA 4LJSA 1EFCA 4AZWA 4JYCA 2BSAA 1PRYA 2AYXA 4C05A 3BT7A 2QLNA 2X8AA 4WL0A 2PO5A 5BNZA 1JEQB 3NH9A 2WM8A 2C2BA 3MIZA 3PB3A 2VCHA 2ZUTA 1GPDG 2WWXA 3CB4A 3NETA 3NIDB 3LUHA 4OIMA 2ERYA 2AUTA 2QDKA 3C43A 4TVSA 2I3BA 3FH0A 1GLGA 1GTZA 1WAMA 1P60A 5L7WA 4X65B 4X66B 1EINA 1CZUA 2Z9CA 4TV9B 3E15A 4KHZA 3TE7A 2GBFA 3SQXA 2YY7A 3C1OA 2AFHB 2B8WA 1OX6A 2C0PA 2VF8A 1E2QA 2QRMA 3E8SA 3ETCA 4RELA 4BVLA 1TT7A 3GMDA 3O8NA 4MINA 2HQSA 5CD1A 3OMWA 3MJSA 4YCAA 4GDMA 2ZRCA 2O7SA 3GZ4A 2ZJ2A 4MCIA 5C52B 3C45A 4BKMA 3V7FA 3HVHA 2HB6A 1RXIA 2J46A 4H7PA 3DZIA 2ZS7A 4EH1A 2XWQA 3AINA 1XXHE 3O75A 3UPUA 1EQUA 1BGVA 5CVVA 4DMHA 1Q91A 1I0IA 3QNWA 5FQNA 4BKOA 4UPEA 1SXJE 3TEMA 1WF6A 5D51S 1IPEA 1EK6A 1JR3A 4YRCA 4U00A 3ILSA 1SXHA 2PMBA 3WGIA 4AB1A 3RFVA 1JH9A 5E3HA 4NBSA 1ZHHA 5BUSA 1ADJA 5H59A 3U7FB 1PS0A 1DXQA 1U2TA 2DTDA 2E4UA 4ZYVA 5BR4A 2I8LA 1RAGA 2A8YA 3NT5A 3Q2KA 4IWNA 3PNOA 3CCFA 4EW2A 5J23A 5DSZA 4I3GA 4J16A 1K7XB 5DP1A 3C4VA 3UQZA 1ZJYA 3QE9Y 5JH7A 4JT2A 2I67A 3K53A 3F7MA 2Z57A 3OJWA 4HGRA 5ICGA 3E3MA 1ESCA 1RBQA 4DDTA 2RGRA 3F5MA 1XVAA 5TT1A 3ODGA 5LU8A 4KPFC 4QEZA 3O03A 2XV1A 4CMEC 2HK7A 5JS2A 1ZRMA 1SUCA 5FFNA 1YDEA 1FW8A 1V26A 1SUBA 1OVGA 3I04A 2R5FA 2X8JA 1YKGA 2CLIB 3E70C 2VCEA 4JL5A 3GLHE 3DOJA 3L8EA 3M6VA 4EQ6B 5GONA 4UOQA 1BD4A 1NXVA 3LUAA 2Y1EA 4HDMB 4Q9AA 5JMTA 3KO8A 4HAOA 1XJ0A 4WOBA 1G2PA 1UQTA 1DVRA 3HY4A 4X7PA 1Q16A 4FFBA 4I55F 4AO6A 4KRXA 3M5WA 2B61A 3RBVA 2W4IA 2XNKA 5A4KA 5B3JC 1ZUNA 2PX3A 3LKBA 4ZWNA 5FLKA 4D6YA 5HTOA 1OKKA 1QAOA 2H06A 1UXOA 4FOLA 2JIDA 2XYQA 2XNJA 3RUFA 1L3IA 3GRRA 1OXVA 3G9QA 4KUGA 1XDZA 1U3FA 4RF3A 4UDYX 3A05A 5K45A 2W6NA 2XNDA 3TOCA 2YMPA 1W2GA 4I5EA 1U3WA 3VO8A 3D0QA 4IW3B 2IK8A 4DIFA 3UMFA 1Y8RB 3LG2A 3F7OA 3ZI4A 3F67A 3EODA 3HQ4O 1IH8A 5EIBD 3EXHC 1SU4A 1W6UA 2PRIA 1KYQA 4IIEA 4E21A 2L69A 2H2FA 2BFNA 2Z1MA 3LCUA 2I54A 4YDHB 3IQXA 1E64A 4O4JB 4H16A 1MB3A 1XNJA 2LR0A 4MVCA 2NYUA 5C3MA 2BEWB 2PT6A 3IC5A 4FONA 4OGFA 1V37A 1MVNA 2IHVA 2G3YA 4A0GA 4YAEA 1QONA 4OQYA 6LDHA 3D7NA 4CWAA 4OHZA 1E3MA 4MQ5A 3HA5A 1I1OA 3AJDA 5DCWA 5D3KA 4BVFA 3VR6H 4ZEOA 4M3NA 4NU6A 4X3PA 1E1RA 1WETA 2PUDA 4NBTA 2G6TA 3C6XA 3PC8A 5I9LA 4DEXA 5IABA 5JY1A 2YW9A 3JQFA 1VHWA 3B70A 4JUDX 3GLFB 4V24A 1SKYB 1D07A 1VP3A 3PEWA 1EXDA 1WQ4A 1CDEA 1GDHA 2Q07A 1FZQA 1NBEA 2DX7A 2ETXA 4MR7A 2BP7A 2WJ6A 1XCPA 2RHRA 1SPBS 1Z74A 1RPAA 4RVNA 4N8DA 2WFAA 1T6ZA 3B6MA 4WBNA 5KWVA 1NVUQ 4P7KA 2RHDA 2ZTUA 3C87A 3A9WA 2C8JA 5E2AA 3H9BA 3ZI7A 2O8EA 5JSQA 4IHJA 5E38A 4YRLA 4L28A 1KSJA 2X14A 3LL4A 3Q5GA 3DYIA 1IC6A 1NUPA 5A3VA 1CJUC 1F0KA 2WUEA 4TWIA 5EFZA 4EVIA 1P5FA 4U6SA 3NYRA 4AAYA 1UFVA 3FNGA 2W70A 1GEGA 2HREA 2CN1A 3MCVA 3U2QA 3EIEA 5NULA 2VAVA 4PPNA 2AVDA 2WUWE 1EP2B 3GVXA 3QGMA 1Z6YA 4HZUB 1TI7A 4MJLA 3FZEA 1TUEA 2FPLA 5HNKA 3CF0A 1E6EA 3HUUA 4HLDA 4X6YA 1YB2A 5HZHA 1X7XA 2XMPA 1M6WA 4IV0A 5DNYB 1YZ3A 4ZO7A 3RIYA 3I2KA 1SO8A 2BH9A 2FQYA 3GEHA 3MGCA 4MKIA 4PQFA 1WZCA 4PGMA 2FZCA 1H94A 3EPHA 3CEMA 1Y3FE 1PGJA 1PN3A 2WWRA 2IELA 2GK7A 2H07A 1YRLA 3ROZA 4AMYA 4QYXA 2WIFA 4WZAE 4ETWA 1U6IA 2BJHA 4NIMA 5DK6A 4KODA 3W77A 4EF6A 2EFCB 3TNFA 2A9VA 4RQTA 1AV6A 1X0VA 2JFZA 3A37A 3LM8A 3ZEIA 4FQ7A 1JI0A 3TL6A 3WFJA 2K2WA 4PV7A 3EVAA 2WG2A 4EY5A 2IUTA 1HX7A 4KFSA 2C8VA 1B1CA 1FSGA 1EUDA 4XIFA 3R4VA 2RFLA 5JZBA 5DI3B 1QC5A 1ONSA 2LIVA 1T8SA 1IUPA 2M9MA 1NHGA 1SWVA 1W581 3L77A 3T1YB 4JUFA 1QPZA 4ARZB 4QGAA 1XX6A 1TCBA 1HTWA 3ZE0B 1N9KA 1YZTA 3IAM6 1T0UA 2JFQA 3K0HA 3WK7A 8GPBA 1BDIA 3QEJA 1LJ8A 4PPYA 3VISA 4OPMA 2VSQA 5SZIA 2AV6A 4N47A 1FRFS 1GIAA 1Q83A 2ABWA 2HCRA 2AFHA 2IYWA 2PXCA 2RGAA 2P77A 4H27A 5CM8B 2X42A 3GC6A 2YNMA 4XD7D 5ARCA 5IC5A 1OZFA 2CKMA 1JAYA 2AD5A 2PX8A 3K2EA 4PTZA 2QR3A 4FMDB 9MHTA 1KFBB 1W49A 1NJ2A 1RLIA 5E7IA 1IMOA 4UXIA 4BRSA 2RG1A 4WKCA 1HG0A 3DV9A 3QNUA 4D9EA 4ENTA 2FAXA 3OTIA 3AFOA 2VDWA 4I55A 4JOBA 3QFCA 4KB5A 4CM8A 5I48A 3QZUA 2R7MA 4EPVA 4RK4A 1EXMA 2ORED 3ANLA 1LY1A 4JJEA 5A0TA 3HDGA 3PC4A 1PZMA 3WRWA 5ALSA 4ZK2A 3FRJA 1LGYA 1K63A 4RK5A 3CF4G 3ZE1B 4DM3A 1APBA 3SNKA 5K0CA 2VRCD 1X7YB 5IVHA 5JBIA 4QRIA 2OHVA 1WZ2A 2NQ2C 4GYWA 2XADA 3SQWA 4GVXA 4MQFB 1AKNA 1XSEA 2R66A 4K9MA 2BJVA 3A1DA 5TMDA 1DXOA 4CKYA 5K9ZA 1EWTA 1PFYA 3MWDA 4RY0A 4CMKA 2IGBA 1Z4OA 2R7LA 2H57A 4FK8A 1VYUA 2CDRA 4KN6A 3T3PB 3O1JC 5J2TA 1EUCA 1P73A 4JZKA 1QOPB 5EESA 4GL4A 4AJJA 1MMFB 1LTQA 4HEHA 4U9IS 1LFDB 1E2HA 1JSZA 1B76A 2QXYA 2ACWA 1NJFA 2OEPA 3BJIC 2YYSA 3CKKA 3Q6IA 4LBYA 1TAHA 4M7RA 4POAA 5DTRA 1GM5A 3OETA 4K03A 4Y2YA 4YEDA 3RV4A 1K68A 5HOEA 1CR1A 2NQTA 2OECA 4GMDA 4QLOA 4WN3A 1MC5A 2R68A 3GA7A 3KR9A 3GB9A 2HU7A 1Z8HA 4OMDA 2NO6A 4PYNA 1S8FA 1BCSA 3NYQA 4Z9AA 4G01B 1L5OA 3BZUA 5CYFA 2ZWMA 1Y9EA 4XM0A 1D6SA 5JATA 4KN5A 3N2NA 1H0RA 3GBPA 1K2VN 1XEFA 1SBHA 3UGTA 2X1VA 2R8PA 3AFIA 1CQWA 2IUYA 2CVOA 3D8BA 5FL7D 4XCQA 1N2GA 3OKFA 4J16C 5AM4A 1LQTA 2MTBA 3AEKA 3N8NA 4XKJA 1GGEA 3W3AD 2WFZA 2GAAA 2MINA 2GBPA 5DHRA 3O1HB 3T3GA 2EFJA 3ERCA 1N2CB 2SCUB 1QCZA 1P9LA 1VL8A 2ZBQA 3L05A 4MYHA 4R9VA 1RI5A 3TR5A 3FZQA 1NQ5A 1TZCA 3LPDA 4X92A 3UBMA 2P67A 2PJZA 4F7DA 3HRKA 3TKAA 2IXAA 3UHOA 7YASA 4UCFA 4IR7A 1XTSA 4R2IA 1Z8DA 2FW7A 3VZCA 4B48A 1KNQA 3ZJYA 4DY4A 3PL5A 4XYLA 4A2PA 3H2KA 1ETHA 1NI5A 1AV7A 3DDZX 1UOPA 1JHUA 3B7WA 3DE5X 4WUVA 1MRNA 1PHRA 4OHBA 4OQMA 2C77A 3LIIA 1XXHB 2B4RO 5HF8A 3BXXA 1IHPA 3ADPA 3O8CA 4AY6A 3ABIA 3EVDA 3QFTA 1ZU4A 4Q18A 2PSSA 1S01A 3QPAA 1PAUA 1YS4A 3FDFA 3PXBA 4KAAA 1GQ2A 4WOKA 1UEJA 1MAUA 1K27A 2I3AA 1ECPA 1W47A 1DUSA 3WK8A 3SZOA 4YFVA 4E2WA 4EB6A 4LV5B 3SBXA 1DJMA 1ZHFA 4PXSA 3NUGA 4EGJA 2QDXA 4TMZA 2R6GA 3BXFA 1IWBB 5CA1F 4WA7A 1LPOA 5ILQA 4HG2A 4WESA 1ZSNA 4H7IA 5HFJA 2QQ0A 3KS9A 4B6PA 3VSDA 4B45A 1F60A 1Y0BA 1T4MA 5SY9A 4ITVA 2W2LD 3AP2A 3DBRA 4KIJA 3KWMA 4MWSA 5F2KA 3Q6NA 2DRIA 4XFJA 4P83A 4YGXB 4YCCA 5BN4A 1IZYA 4RPGA 3HL0A 4PONA 1X94A 2OXTA 5JSYA 4P82A 3LY7A 4G8CA 4MS1A 1SZCA 3LX6A 1WDTA 4NE7A 2JLZA 4QXPA 1NULA 4AKSA 3QUCA 1AX9A 2BRUC 5FYQA 1NX9A 3ORQA 1GPLA 1TM2A 2IODA 2P8JA 5AHOA 5HQJA 3D6MA 2IUEA 4M7OA 4CQLA 2PD6A 3A70A 2ZIEA 3VKFA 3OM9A 3ZCQA 1JLLA 1FMJA 1FBNA 3D6AA 4H3SA 4KQXA 4M86A 2X23A 4XQCA 5A3RA 1LDEA 1DEOA 4O0MA 2IIQA 1KR5A 1I01A 4HZUA 1CF9A 3KDAA 3PGXA 4KMOA 1YVDA 2CL5A 2NU8B 3TOZA 3WRYC 3ZXSA 4FNAA 3D4OA 4Y1RB 1GQRA 1TO2E 3TE6A 2EGGA 2C2GA 1Z9BA 2JIQA 5IUJC 4BE9A 3IILA 5JBQA 2IQ5A 4WXEA 3AKZA 3RLIA 1PZFA 3ZIDA 2GD1O 5LDHA 1DU4A 2BGWA 1TKCA 4ZTZB 3MRSA 3EUFA 4TXLA 4KGDA 5K0BA 3A1TA 1RU3A 4HH4A 1GGHA 3HP7A 3KB1A 2WIJA 4D8XA 4YT8A 3ORYA 4KIUA 4IXTA 2WWGA 1TOAA 1X0XA 3BRWA 4L5AA 1UT5A 3TDNA 4J9VA 1QFZA 2H2DA 4M55A 2R84A 4RHUA 5EZYB 1GD1O 4GXRA 5I7RA 4R8LA 4K40A 2F1HA 2VXOA 3MD9A 4AWAA 2Q3FA 2GTPA 2W43A 3A32A 3C97A