1CDIA

Structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
179
structure length
179
Chain Sequence
b'TKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL SURFACE GLYCOPROTEIN CD4
publication title Structures of an HIV and MHC binding fragment from human CD4 as refined in two crystal lattices.
pubmed doi rcsb
source organism Homo sapiens
molecule tags T-cell surface glycoprotein
total genus 30
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 1994-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05790 C2-set Immunoglobulin C2-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdiA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdiA02
1FZOB 3H9SD 3TC9A 3S37X 1JYNA 1X9QA 1ITBB 5H37G 3KLHC 2VXTH 2XTJB 5B22A 4FQCH 3SCMD 4JFYB 3RTQD 4WHYG 1CICC 4WV1C 4NQEA 1A6UH 3HPLA 3P0YH 1W72B 1DE4B 3GGWA 4KI5F 3VE0A 4UINL 4GSDL 2F8OA 3MBEB 4X4MA 2HT3C 2ICES 1X3DA 3QZWG 2F8XC 1S9XB 4RGNC 1GOHA 5DJXB 2VLRA 4E41E 2X5PA 1T3FB 3TN0B 4IJ3C 4TSBL 4CU6A 4NQCB 2MQ3A 4YHNA 1J8HE 4NDMB 2QSTA 4EDXB 1LE9B 4URTB 1PVHA 4JY5L 4KK8C 4WJ5B 1OP5K 1F6AA 1P7KA 2VITA 5DI8A 5C0RL 1E6OH 1N26A 4PJFF 1RUPL 1I3VA 2OBGA 2F54A 1XCQB 3RVVC 1N4XL 2X4NB 3GK8H 1PX4A 3L9RB 4IHOB 3IKCA 4K23L 1MCOH 4PRDB 1KJMA 5C0NC 1FVEA 2LAAA 5J6HA 5DQJA 3ZKND 4MAUL 1A6PA 5D2LF 3MRCB 4JQVA 5FYJL 2NY0B 1QRKA 3FQRA 3G5YB 3SY0A 2EIEA 3CZFB 3QNYB 1MNUL 1MJ8H 4LCWD 2F5AH 1F3JB 1S9YB 4UQ2A 4KUCF 2MJWA 1MIEH 3NGBB 2C5DC 5HGBB 1R3LA 3D0LB 4ZFOB 1AGFB 1FCGA 2DWEB 4R3SA 2L0DA 2X9XA 4TUJB 3D18A 4UI2A 5D7LD 5KSVB 3H3KA 3WNPA 3W0WD 3EYVA 3NIGF 4M7JH 1DQLL 5T5FH 4MAYC 4LARL 4HUVA 4V1DB 4XBPB 5FDYA 4YXLL 1BQHG 5F3HB 3BKCH 1YUHA 3K4ZA 3LEVH 2ED8A 1KNOA 3FAWA 4JRXE 2B1HH 4ZUSA 4RWHA 5DMGC 2GITA 4N0YH 1AO7D 3M8OH 3L5XH 4PUBL 1NUGA 1EO7A 1GGIL 3H2WA 2BJMH 4LFHD 3IFLH 4K3GA 4HUMB 1IM9B 4P23B 1YJDC 1F13A 5JW3L 2R2HA 4Z7OE 4JY4A 1DLFL 2DJUA 1T0NB 1EK3A 3ES6A 1BJ1J 3UTZB 1JV5B 1NMAH 2CGRH 1WFTA 2FWOA 2FEDC 3QIUA 2UWEA 3EFFB 3TIDA 1R0AH 4HKZA 1AP2B 2JF1A 4M48H 1U2CA 5FUZL 2A73B 2VISA 3DV6B 2ZOKB 3PL6B 2VLRE 1HIMH 4M43H 4N0CC 1MWAB 5IB5B 3VCLB 1GJIA 3CC5B 1A6TA 4L4VD 4ZUWA 3BP6A 1I4FB 1HYRC 1TIUA 3KPRD 3SDDD 3C5SB 4OGAC 1N0XH 2HRPH 2Z4QB 4CVXB 5F88B 3IJHB 4OZGE 2CDFA 5LXGL 4GRWF 2Q87A 3I9GL 4NN5B 3V0VB 2YMXL 2JK5B 2XI9A 1HINL 5TQ2L 1AI1H 4PJHA 2LTQB 3HR5A 5DWUL 1NAMA 5EBMA 5FGBC 1L6XA 4HQQL 4O4YL 5D8JL 1DQQA 5EU6A 4GW4A 4JM4L 5FO9B 2YRPA 4MXVE 3VFOB 4UT7H 4PTTB 3U9PL 5SWSA 1ED3B 2VZOA 5CJXA 1RZGB 1OAZL 4WO4B 4PJBF 5CHNA 5JOEA 4WGWB 4Y1AD 5I18H 4QHUA 5LWYH 5CS7A 4UOJA 4M6OH 3WXWH 2C1PA 4LNVA 1P7QA 5J56B 2X1PA 4Z8FH 2WLYA 2G5BB 3FB8A 5BOZG 5F96L 3QRFM 5DS8A 1ONQA 1IGTB 1ZLVH 1G0DA 4FXKB 3OF6D 4PJ5B 2IALA 3RX5A 4PGEA 1K85A 4MNHB 4ZOBA 4A6YA 4S2SA 3VH8A 1DUZB 1ETZA 1YYMH 5FUOL 1IC5L 2A9NH 2AXHA 1EUTA 3HRPA 2EE6A 2DTMH 1N6UA 1OOAA 3D9AL 3CCHA 3BXNB 2UWEE 4RRPG 5FKAA 3RPIB 3TPKA 1UCTA 4YBQD 4U1JA 4JKPH 5DJZA 1QFWM 4JE4B 2EH8H 3DSNA 5ESAB 3QFJE 3IDJB 3AFLA 5FYKH 3PHQA 4OGYH 5EFIA 3IETB 5DGRA 4JN2B 4NQTA 1YPZE 1I7RA 3VXSD 4KTEL 4XAWH 2G2RA 1D9KC 3SE3C 3CDGB 4HPOL 3S3SA 2EEAA 3OKDA 2EXWC 5CSZA 4Z77B 1DBAH 3RL2B 1JF1B 2AABH 5FKPB 3SGKA 5KVDH 1UM6L 3C8HA 1A7QH 5MEND 1LGVA 2XZAL 4QRQA 3RTQB 5DD6A 5CJ5A 3U9UB 4HDIB 2FEEL 2WQ8A 1INEH 2ZKHL 1QUNA 4JGUA 3LKQB 4F58H 2WWMC 3MC0A 1A21A 3FAXA 5D7JD 1N8ZA 2J5LC 2GIYA 2UYLB 1I9IH 4LHUD 3V7AE 5HYSG 2Y5TB 1OCWH 5F21B 2FB4L 4GRLD 1AHWC 4DAGH 2VJXA 1RUMH 3RI5K 3QNZA 4M8QA 2X4RA 3TFKC 3CMOH 4QLRA 5TE7H 2V5SA 2DQDH 4MS8C 4Y5YC 1J05B 2XOTA 5IW6B 1X5LA 5T3XH 3RHWF 1IC7L 4PRNA 1VFAA 2R4RL 1JGEB 2AJ3A 4M61B 3T2OA 1AGDB 4PJCA 4WEMB 2QQLL 2NY1D 4EI5D 4LRNL 3JZ7A 5E2UL 3RDTA 1HHJA 4PP1C 1WISA 4OZ4B 5DEZA 4YDJB 2Z92B 3QIWA 1H3PL 1CDUA 1II4E 1D5IL 1XF3A 5I1GH 3VU2A 1KJ2A 4LCWB 2VMFA 2BX5A 3EO1B 4KMTL 2OL3L 3QUMB 4K9EH 3FOLA 2NY3C 3FCTA 1H5BB 4PTUB 3PG2A 4NUGH 4XC1H 1HHKB 1G6RL 1FYHB 1UZ6E 1SJVA 3BQUD 3W0WB 3TJHD 4JZJB 3RX8A 3EJJX 3KWWB 1LD9B 3MJ9A 1WAAF 4XBEH 4P3WA 5IW3A 5SWQA 1QFPA 4WNQB 3FQNA 3I3BA 5KJRH 4PBWD 3O9WC 4ZTOH 4CMMB 1ORSA 5C8JA 1IBGH 1FNSL 3HRZA 3OKMB 3P9WB 3WD5H 5IVZB 1MHPL 2A83B 3HI5L 4HK0A 4OCYL 4I2XA 4G9FD 2AJZB 4R90L 3MTRA 3PWPA 4M6MH 3IU4H 2VLJB 3LS4H 4AEFA 4W81A 5C6TL 1I7ZA 1T22B 2XWJB 4JN1L 4X6DE 3KVQA 4HCRL 2V5MA 4P9HH 3V6ZA 3EYFA 3VGDA 2BHUA 2Q7YA 3QQ4B 3T4AB 3WO4C 2ZCLL 1KXTB 4KK6C 2HT3D 1X5XA 2C3GA 4OV5A 4RMQA 1G9NH 1W72L 5KVGL 4PJ7A 4L3EA 1HHGA 2VZ1A 5KS9F 1E6JL 4LPUA 4WTZG 2WUBL 4PJCE 2WBWB 1FZKA 3REVB 5H8DA 4XWGL 3CSGA 1A7RL 1QTYT 3RVVD 1KIRA 4U4BA 1AQDA 4IEFB 3VFSA 1RU9H 3HAEB 1XFPA 1EBAA 1EDQA 3V6BR 1LK2A 1MFDL 3GB7A 4L29A 1UXWA 4ERSL 15C8L 4XZUB 1QSVA 1AFVH 5GSRB 1I3GL 3SO3B 1QFOA 1QKZH 2AXFB 1T1XA 2MCPH 2BK8A 3OXRA 2BDNH 1JHTA 3O2WH 4L8DB 2DQUH 3MXWH 5E56A 4P57B 4I18A 3MLWL 5IQ9A 3TBVB 2D7MA 1M7IB 3MGTB 1A02N 4ZFOL 4HMCA 4OIIH 1T7VA 1EO5A 2HFTA 1G7HA 3SKUD 4WI8A 4RNRB 5KAQG 4F9PC 5ADPL 4NZJA 4G42B 1K2DA 1KB9K 2R4SL 2XKSA 4DN4H 5LBSH 2I9LB 4NBZB 4LSVL 1A2YA 3OQ3B 3FO9A 3GDBA 2BSTA 2DIAA 4U31A 2X4QB 4YH6A 1JIBA 4OF6A 2R8SL 2NX5D 1ZT1B 1JCKA 3Q6FB 3VXSB 4NO2B 2PR4L 3AAZA 2FH8A 3E8UL 4HXAL 4NO0A 3O4LA 2DLGA 4HT1L 5C0EA 4RMUA 3CFEA 4ZUTA 3QUKB 4L3EE 3F6LA 3N9GH 3HE7A 1AGEB 4N0CD 3DVGA 4YWGL 4AH2A 3MRDB 3MV8B 1IT9L 1QA9A 2CO7B 4R7NA 3VFRA 2B1AL 3FRUA 3VRIB 1DZBA 1MWAL 4KHXH 4OGAD 4M4RA 4XPTL 3SGEH 4OKDA 4OLWL 4OZIF 4P2QB 1AR1D 1N59A 4LHUB 1G9EA 3C5JB 4YLQT 4GKZA 4HIHB 5I1AA 1NMCB 5E2TH 1Z9LA 3WO3B 2APTA 4JFFE 3CDYA 2D0FA 1YEIL 3IDGA 3GJFH 1GAFL 3BP7B 4D9LH 1EFQA 3K4DA 5C2UB 5CEZE 3ARFB 3SDYH 4DK6A 2BVYA 4EN3A 2VDRH 4GUPB 4XNMA 4AT6B 2AGJH 4XCCH 5DD0L 4Y2DC 5IFAH 3OJMB 5CGYC 3MBXH 4NBYB 5HXMA 2BVTA 4Z7UE 3MLVH 4KRMB 4Z7NF 3V4PH 2HKFH 3ROOA 2DQIL 4EOWL 4EUPG 4ZAKC 1OT2A 2HVKA 3G6JB 3UTSB 1OAYH 4HW6A 3LQAC 2R23A 1GVIA 3GKWH 5EOQH 4D9QD 2EEBA 2DQJH 2FJHA 3U7AA 4I9WD 1F3DJ 2BSSA 3GJEB 4DQOL 1CLZH 2Y07H 3VD3A 5IJVB 4WW2B 5IK3A 1U36A 4JFDB 3ARED 1FNEB 1A1MB 1YNKH 2AJSL 2X4OA 4BSWA 2HMIC 3LMJL 3T3ME 3UBXG 1BD2A 2ZG3A 4LLAA 4OTXL 3PGFH 1ADQL 4OLUL 2K1MA 3T77A 2V5TA 4J6RL 3QUXC 5ISZB 4R4FL 5C70A 1TPXB 4ENEC 1G7PA 4YK4B 3O4LE 4YPGB 3C5ZD 4UIKH 1PJ9A 2ADGA 4FQXA 3DGCR 1T1WB 3CSYA 1BZ9B 5DRZB 2VXTL 2P5WA 1D9KD 2F19L 3ZYIA 3DMMC 4U0RC 3BZDA 4PV9B 3BFOA 1FO0H 3MOBH 4OQTA 1JNLH 2QR0B 4PR5A 4ZTPL 3U30C 4OCLC 5KANI 1AQKH 2PTUA 4LKCA 4FQQA 3CNKA 5F9AC 1Y0LA 5CJQH 3ZZ1A 5DD1L 4NRYA 5AYQA 1ORQB 5IB2B 2YD4A 4LLWB 3X3FH 2I9TB 2HTKC 3O41B 5ITFA 1S7SA 5F44A 4UMGA 5B3NA 5DMKB 5I17B 2VLKB 2XA3A 4HHAB 4DKEL 5ECJE 1CGXA 1MCOL 4LNRB 4NN5C 1JZ6A 3TFKD 3O45B 4MS8D 2LTQC 2VUOA 4U1MA 3AY4C 5HBBA 1CK0H 3MV9D 4LSUH 3I6KA 3AU1A 3WNNA 3TNNB 3T0EA 1ZXQA 1Z5LB 4YR6A 3MRBB 5C0JB 5ACZA 2C3WA 3BGFC 3QWQB 3D3VA 2W59A 2DLHA 5ESVB 4YFLF 3TO4B 2RCSL 5DJAB 1YEGL 4PP1D 4WO4C 5DMJB 4Z9KB 4PGDB 2I5YH 1N5AA 1CQKA 2YBRB 3W11D 3B9EA 4XBGB 1Z0MA 1OAQH 4X4XB 2ESVA 1DUYB 1JTOA 4HZLA 2WINB 2V6HA 3BKCL 4OZHB 5DZLA 3LEVL 1BD2E 3ZTJG 4W6WB 3ZDZF 3IXTB 2BZDA 4XCFH 3QUML 2F74A 3BN9D 3J8F7 3LAFA 4HG4K 2VDKL 2BJML 3MMEB 4RMVA 3IFLL 1ZWIA 2EDRA 4K94L 4LLYB 5CD3A 3CSPA 1ACYH 1JPTH 1MCSA 4NKMB 3PHSA 4WWID 1IILE 1B6UA 4O51A 2CGRL 4KUZH 1R0AL 1IQDB 5J6GA 3VMPA 5EUKA 3GMQB 5EOTB 4M48L 1OGAB 2AP2A 3BEWB 3BD3A 2FSEA 1QBLH 4G80A 5T3ZD 1GZQA 4EXPX 3TCXA 4I48A 5BS0B 2MQCA 4FFYH 1HIML 2JCCF 1GRWA 1UKTA 2D7OA 5IM7A 4MDIB 1LILA 1UWEL 3GSRA 2P45B 1QVOB 2LE9A 4NQSB 1EZVX 1U3HA 2F58H 3EYOA 1JGLL 1EEZA 2F5BH 3K80A 5EC1B 1H3UA 5DHYB 5C0BA 2PXYB 4E0RA 4IIQA 5L2JB 1IGYA 1N0XL 4JQVC 5ANMB 5ERWA 1CZ8L 4H8WL 4WFGD 4EKXA 4K3EH 2GFBA 2YEZA 4G6JH 1A4JA 3GJFB 4M7KH 4QKXB 4WI5A 4Y5XA 5MI0B 1F00I 1FSKC 5D2LA 5A3IC 1QZ1A 3NMEA 2R0KH 3IYLW 1HSAB 2MKLC 5KN5A 5FV2A 5GGVH 3CU7A 1C16B 3KPPA 4HGKC 3BT2H 3D3VE 3ZE2F 2E9IA 2XKUA 2DLEA 1G7MA 1U8IA 1K5NA 8CGTA 4UT7L 2C3VB 1LO0H 5T1KD 3ZYOA 5I1JH 4ZFFB 5JHDE 2Z31A 4MQTB 5I18L 2H6PA 2AW2A 5LWYL 4M93B 5J11B 5GS3A 5I66A 2G60H 4M4PA 3WXWL 1SBSH 1IQWH 4M6OL 4YHIA 3LKRB 2ITDB 3BIAX 4RDQF 2OJEB 1YEJH 1YQVL 1KSRA 2AK1H 5DJ6B 5E00A 4XMLL 3O2VH 2R0WH 2VERN 4KDVA 1ZHLB 4Y8AA 2GW5A 4ETQA 1OY3B 4F57H 2IMNA 1FFQA 3IDMA 3N1MC 2PCPB 3SJVD 4CADB 1XH3A 3D2UA 1S7WB 4G8IB 1H0DA 3CUPB 4FQIL 1YYML 4YHOH 3KPSB 3QIUC 5A43C 3UTQA 2IH1B 3WNLA 2DTML 2P7TA 4PY7B 4XVUD 5D7IB 5I1HH 5JUEH 1IAIH 4JZJC 5FYLL 5DEFB 1BAFH 3AREB 4HUWB 1DN0A 3MRPA 5FOBA 1G7LB 1KIQB 1RMFL 4B7LA 4KI5E 1LP9B 2ZJSH 2EH8L 5MHSE 4OGYL 4UQ3B 2H1PL 3RNQB 3DI3B 1NFDF 5DJYB 1DFBH 3SEPA 4Z5RB 3VXUB 2HVJA 2IH3B 4YDLB 5FOJA 1VDGA 2M2DA 4PJFE 1RIUH 4NRXB 1IL1B 1RJCA 1M71A 4YHYB 1IGFL 1KCKA 3LSOA 3DIFB 1UVQA 4Y16B 3PQYE 3L1OH 4FFWD 3T1FB 1QLFB 2A6IB 2FHFA 4NJ9H 5C0AA 4R97C 3GI9H 3BP4B 3CX2A 4X7CC 1GXEA 4NWTH 4TNVK 2OK0H 4UU9B 4H20H 2YS4A 4F58L 3TO2A 2PYFA 3P4NA 3QXVA 2CRIA 5IW1A 2DM3A 1QSFA 1J8KA 3WV0A 1I9IL 3INUH 4HKJA 3BIKB 1NBYA 5F7FA 4BFBD 1OCWL 2VLMD 4DAGL 1NGZB 4JFOB 4XCYA 3LCYA 1RUML 2DD8H 2Q76B 1KYOJ 2IEPA 3GSUB 4PJBA 1FDLL 4U6HA 5TE7L 4LCCA 2X4PA 4PG2A 3NIGE 4R0LB 5T3XL 2H41A 5IB3B 2HJFB 4AQ1B 3B2VH 1F90H 4Q9BA 1KCVH 4U6VL 3WNMA 1MVFA 3CH8A 1MHCB 1ZT4B 3H3PH 4K2UH 3NH7H 3PGDA 1KENH 3V5HB 4FP8H 5IIEA 1U8OA 3RGHA 5C08A 4BFIA 4KROC 3BO8A 1J1PH 3HC0B 3V7AG 4LSSH 4DGVL 4GKOA 4Y2DD 3QEQA 5CGYD 3JWOL 4JHWH 1E4XH 3AUVA 2ADJB 5C0GB 1JPGB 1MLBB 4HJ0D 2OZ4H 5DRNA 3OX8A 3QPQC 3OB8A 1UA6L 2AEPL 1I8MA 3KDMA 3QO0A 4JO4H 2PYEA 4MJ6A 2I25N 2YA1A 3L3DB 3GUTB 4JM2D 2VABA 3GMPA 3QI9C 5EO9A 4XBEL 3FT4B 3ALPA 5F9JA 3SGKC 4JO2H 5GHWH 2BNQA 3VH8G 1I8IA 5L2KA 3JTTA 3P9LB 2P24A 3QQ3B 2Z8RA 3MYJB 2OZ4A 2EDTA 1IBGL 3GMRB 1A1NA 1LEGA 4APQA 3PGCA 2HKHH 4FTVB 3WD5L 5MEQA 4X0KA 3QUXD 1UCBL 5CD5C 5JIIA 3OAZK 3W9EA 3TCLA 4ENED 2H2SC 1S5HB 1QBAA 4GRWE 3SQOH 5DLMH 5GJTL 1EZVY 1LNUA 4XB8A 2OQJA 3U0WH 2VYRE 2CSPA 1RJLA 3IU4L 3D39E 5HGHA 2VZVA 3MR9B 2HLAB 1P2CB 3BH9A 3DGGB 1N64H 3MLPA 4UNTA 1C08A 3DMMD 3MODL 4TOYL 1TJHH 4P5TA 3WJJA 1OPGH 3ILPA 5EZOL 4PJBE 1J1XH 3WLWC 4ZYKA 4CW1A 1NGWB 2VDPH 1IAOB 1FLRH 3G9AB 3KJ6H 1QEWA 1G9NL 3VFMA 4Q7DA 3S88L 4LEOA 1JZ7A 2DQCL 4XVJH 4BFEA 1F58H 3GIVB 4N9OB 3QIWC 3QCVL 4ZDHB 5D9SB 1T03L 1W0WA 4XPBL 5EIIA 3PIQA 4NKIL 1PGRB 4GKSB 4L8BB 3P0GB 1ZHNB 3S4SA 3DURB 2V2XB 1GC1H 2Y06H 3BZ4A 3T0AA 5IBTH 3N0PB 3STZB 4MVBC 3QEQE 4XHQA 4C83B 1A64A 3RWCB 3O3DB 4P4KB 2P5EB 4P46A 1X7QB 3GMMA 3EYQC 3RAJH 3EZ8A 4K9EC 4QTIL 1D6EA 2VQ1A 3Q6GH 4ODVH 3O2WL 3MRIB 1IAII 1IFHH 3RVTD 2GK0B 3FOMA 1BF2A 2NW3A 2J3SA 1I3RA 4XNUH 5J57B 3CAFA 1WAAA 4C4KO 3FQXA 4NQDA 1SY6H 2H45A 2GI7A 3OSKA 2YD5A 1I1FB 2XWBB 2ICCA 4O2EB 3IGAA 5L2KE 3RWHA 4GQPH 4Z7WE 5IKCA 4KZDH 4ALAL 3E2HB 5GGRA 4ZNEA 3UPCA 1QFWI 3X3GL 1MPAH 3LV3B 3P0VH 4OUUA 4B53A 3TJEL 5TF0A 4K8RH 2ZP0T 4FXGA 3KPOB 25C8H 1SY6A 3MJ7B 4G6KH 1MHHB 4MWFA 4MXQC 4RBPH 1L7TH 4NQED 4HBQA 2V7NB 4WCYL 1IGJB 5I1KL 1BJMA 5LQBH 5C6WH 4RFEA 2A0LD 2WIMA 4Z18A 1VB9A 1S7QB 2VDNH 1TPXC 5C0FA 3LD8B 3LKSA 1RY7B 2VLRD 2DM4A 3ECBA 5DRWA 2DMBA 5D1QB 4AIZA 5BXFA 3TBWA 2YN5A 1OL0A 4P9HC 1DL7L 3SGJA 1ZA6B 2F54D 2HFEA 3S3PA 4YHMH 5FCSH 3N9GL 5EB9A 5KS9A 5GGUB 1EMTH 2YUXA 1VPOL 2JJWA 3FB7A 4KY1H 5DZNA 3P77A 1G9NC 1T2QH 2JLLA 5F3BB 1NCBH 2Q8AH 4JGMA 3UXFA 2R69H 5CEXA 3OZ9H 1MCFA 1CU4L 4G7VH 1WITA 2Y1VA 5CUSL 5F1SA 3J7HA 3G08A 35C8H 5A3ID 2FR4A 1RSFA 2Q3ZA 5JO5B 3MA7B 1C12A 2EC9T 5EN2A 2GSGB 4GAJH 4L8CB 4XMKH 4PJAF 4D9LL 1E4XI 1WTLA 2FATL 3C8DA 3D0VA 4WWKB 5IMOA 5I6XB 4MJIA 2AGJL 5FA4B 1WAAE 1UFUA 4PJEF 3IU3B 3MLTB 2FO1A 4WFEE 3T8XA 1MY5A 4F7EB 3VXOB 3GSOA 3MLVL 4HWBH 3PJSB 3TO4C 3V4PL 4IMLB 5KANG 1VCAA 2WW8A 1OD7A 5F7DA 2Q8BH 2X05A 1HEZB 5EOQL 4XPGL 1YEKL 1KGCD 4HFWB 4YGVB 4DUVA 2W0KA 4OD2A 2GYSA 1Q0YH 3DTXA 5IVXF 3DWTA 2Y07L 1U8NB 1MCNA 3QIUD 4M5ZH 3KXFA 1SVCP 2YD8A 1UH4A 5F7HA 5K59F 4DZ8B 1YNKL 3QDGB 2HFFA 4TUKH 1U9KA 3NIFF 1PBYA 3QEGL 1OB1A 1S8DA 3OKOB 3V52H 3AM8A 5ACLA 3BIBX 1MRCH 4KZEL 4BFGA 3ZSSA 3P4LA 3E3QC 3LEYL 4UIKL 4YNYA 4Y4KB 5CCKL 3PP3H 2R56H 4DCQA 3U46B 4KK9C 4ODXB 3O6ML 2NPLX 5KS9E 2ZUUA 4W4OC 5ICXB 2BNUB 5D6DC 1R3IH 2W38A 1T7XA 3QO1A 3MOBL 3GBNH 1JNLL 1KPUA 4B0MM 1CBVH 4WDIA 3NCEB 4O2CA 1YEHH 5EU5B 5GRYA 4IS6B 4R7DB 5CSGA 5EU6D 1MUJB 5AZ2L 2DQFB 4GBXB 4E41B 4R4NC 4NHCH 4GRMB 4EIGB 3JWDL 3QULB 3U2SB 4EN3C 1J8HB 2AJVL 5J3HC 5SWSD 4MX7B 3OR6B 1CGSL 3B9KB 1UT9A 4OM0H 2FNBA 3UPRB 4MQXC 1P7QD 4MJIE 1UEMA 3LEXA 2ADFH 1YY8B 2QADB 4FABH 3K74B 5GJSH 1WCBB 3LQZB 1NEZB 2K3TA 3O11A 4RISH 1WGOA 3ZDXF 1WFUA 3WXVH 4X5XA 3QNXA 4HK3N 4ONFH 3S35L 1FFOA 5JQ6H 1IVLA 2FLBT 4BH7A 4ACPA 3X13B 1RQ5A 4S1QL 4NFBA 3MLUH 1XR8A 4KROD 2BVUA 4M93C 2I5YL 3EDFA 2QQKL 3MRHB 2IAMB 3KXFE 5DJ2B 1RFDL 5D1XA 4WUUA 3VDCA 4BSVA 4JRXB 5D96C 1DN2A 2DDQH 3L5WB 3B2UD 3CX5J 4NN7B 5C0DA 1HOCB 2P47B 2EKSB 1HDMA 4BK4A 4YXHH 5FM4A 2CDEA 4CN1A 4CGTA 1J18A 5T5NF 3MLYH 5GIRB 4HC1H 5FYKD 2E27L 4YFDB 1GIGL 2ADIB 4QHKJ 4PGJA 2G9HB 3BW9A 4NO5B 5CD5D 4OZIE 2H2SD 1BECA 1SJXA 3OMZA 3GSNA 4QY8B 2DOCA 4UDTA 3WFHA 1KT2A 5CBAA 4JJ5B 4YHNB 1DTUA 1UKSA 4PJ8A 1KTLB 2QQNH 4HKBA 2GUOA 3C60A 2PW1B 2E8YA 3PHOA 1RK1A 3QIBA 3GM0A 4U2YA 1U8HB 3N50A 3UYPA 4IOSD 3T0EC 1NEUA 5E08H 3IKCB 4DZBA 5FO7A 1VENA 4OZGB 1G0YR 3UTTE 3WLWD 4FRWA 4HIEA 2VXVH 4K3EL 3RDTD 3OKLB 1LO2H 5F71A 1ND0B 2R0KL 3QIWD 2BNRA 4Z7NE 5DEGA 1YECH 1U93A 2W65A 2DS4A 3H0TB 3NAAL 2VIRB 3I6GB 1U0QA 3HMWH 1BBJA 2GAZB 3BE1H 5I1JL 3UJTL 5DJDA 3WN5C 1T5XA 3SKMA 4LVHB 4LLUA 3S35X 3RIFF 2ATPA 3EYVB 5HGDB 1SBSL 1IQWL 3S8WA 4JG0L 3IFOB 3OB0K 4WUUE 3CDFA 1KLGA 4PREB 1YEJL 1IAKA 2AK1L 4ZUSB 1PQZA 3S5LB 5CJOH 4NQVB 2GITB 5AD0A 1S7UA 3VW3L 3KPLA 4KI1A 3V5DA 4F57L 4HUXA 3OKEA 3EGSA 4KGJA 3ZTNH 4F7MB 5IESH 3X17A 5HI3C 2X1QA 1QRNE 4L9DA 5JUEL 5ID1A 2VSCA 1BAFL 3PWPD 4FG6D 2R1WA 4WI7A 3V6FA 1Y18A 3OV6A 4LAQH 3TIDB 5INCA 2FZ3B 4PS4H 1NANI 1ZK9A 5EU4A 4OFVA 2IBZY 3O3EB 2VXSL 5EIVA 3S96B 1U3HC 2NTFA 5D4QA 3QFJB 3RZWA 4ODSH 4JO1L 1Q9LA 1YPZB 1T6WA 2JCCA 3KNBB 1OAXH 4NSKA 4ZUWB 3QRGH 4H1LH 1RIUL 3SDXF 4R2GB 4Y5XC 2VWEE 4Q9RL 3U0TB 1G0XA 3OHXA 4L3ED 4QT5B 5CZXD 2VDQH 3MRKB 4NJ9L 3MNVA 4A2MA 4N1CA 1IZJA 3GI9L 5HHME 4NWTL 3UZQA 1FFPA 1HHHA 3LKOB 1EX0A 4H20L 4UT6L 3RA7H 1HKLL 4PJ9B 3OKNA 3HR5B 1FFNB 4KMQA 4H1LA 2BNRE 2Z31C 4Y19B 2R0ZH 5BOPA 4MD0A 1BM3H 3HMXH 5EU7C 1KN4H 4DVBA 4X6CB 4U6XA 4P5KA 2DD8L 4RAUA 5GZND 2FD6L 3LN5B 2NR6C 32C2A 1YC8A 1ZLWH 5CIPH 1HILA 1HI6B 4WHCA 2DBLL 3B2VL 3QJFB 3NA9H 1P7QB 4EVNA 5FECA 1KCVL 3FB5A 4NZTH 4OV6F 3H3PL 3ZDZE 1CFQA 2Z91A 4K2UL 4J4PD 4X6BA 2HJKA 2BFVH 3G04A 4PGEB 4PV8A 3RY6C 2AQ1A 3ARQA 4OSUL 2DQTH 4QYOB 4KHTH 4LSSL 4P3DA 4MSWB 5IMKB 3O3AB 2ATKA 4D9RE 3MRRA 1MAMH 1CR9L 3K81A 3HLAA 2DI9A 5JLZB 2VDLL 1XCTA 5D71H 4OLYH 2FX7H 4UV7L 1WK0A 2IQAA 5F1IB 4G6ML 4UTBL 4BQ8A 3FJTA 5E6IB 1OAKH 3RVXC 3TZVA 1D5BB 2DQHH 3GRWL 2HH0H 6FABH 3Q3GA 3CFCL 4G8EA 2NYYC 3KYAA 4ZMAT 1P84K 5EFIB 1NFDA 4HUKB 4NQUA 2JCCE 7FABH 3DVNB 3MGOA 3TIEA 4QHNB 5K9KB 1GGBH 2VDOL 3WKML 3E2HC 1IEBA 2DI8A 4NO0D 3WS6C 2OP4H 3O4LD 4KJQC 2HKHL 4JHAH 4ZO7A 4LLMA 3RVWD 4LLVA 3VWKB 2WBJA 3HE7D 4F33B 4AENB 3G5XB 1U42A 1T20A 3SQOL 5DLML 4BZYA 3P9MA 1Q0XL 1KEML 4QRTA 4YIQA 4D0DB 1S9WB 2VR9A 3LD8C 4O5LH 1W2KT 1MF2H 3GSQB 4MB3A 1QR1B 3W9DA 3WDJA 4X6DB 1CD1B 1WIOA 3PP4H 1OPGL 1WVZA 4O9HL 4LOUD 3LPFA 3VMOA 3ARBB 3T0BA 1OSPL 4J3WA 1YMMA 4ZSOA 4F9LC 1FC2D 3KJ6L 1AE6H 1X5FA 4LSQL 4R4ND 2X42A 1QBBA 4JB9L 5HDLA 5I71B 4EN3D 2AJ3B 1NGPH 4NC0B 4PJCB 1CFNB 1Z9OA 1CGWA 3VFUA 1MFEL 1U58B 3O8XB 4MCYB 2AEQL 2HN7A 3QUZB 1WWAX 1GC1L 3WEXA 2OSLA 1OTSD 4XNZB 2Y06L 3PWLA 2EDLA 1KJ2B 2GSIA 4XXCC 3TH2T 4JLRA 1DEEA 5GISH 3QUYB 2BSRB 5JPNA 1JUFB 4ORGB 43CAB 3CK0H 3ZHLA 2ZUQB 4HEPG 5IVOA 5I6XC 3GSXB 3LKNB 3KPNA 1UXSA 3A6BL 2UZIH 2XQBL 5C86A 2XG5A 1QLRA 1MJUH 1GZPB 2J8UF 4XNUL 2AEIT 1BD2D 1JGDA 2JIXA 4H25B 5I74C 4UIMB 4IRJA 1TTUA 5EU3B 2QHLA 1SEQL 2YUWA 1EAPA 2SEBA 1T21A 1ORSB 5C8JB 4KZDL 1ACZA 3Q0HA 4FQXD 3HRZB 4NHUA 2IPTH 4ZO8A 3KHQA 2I07B 3FHAA 3P0VL 5GZOD 4FMKA 5GGSA 3MUZ1 2P5WD 5A2IH 2CXKA 4K8RL 4FQ1H 1QYGH 4HK0B 1KIPB 5BRZE 25C8L 4G6KL 1JN6A 2EYRA 2CLRA 2EH7H 2XYCA 1CN4A 4NT6B 1RULL 4DKFH 5GS2H 3CFJB 4PJXE 3CVHA 5IFHH 3RUGF 1NDMA 3RIAK 1SBBA 1MREH 2HFGL 2ED9A 5LQBL 1S9VA 3AXLB 4MGXA 5DRXB 3IAGC 5DK3A 2WIIA 3E0GA 4GLRH 4Z78A 1TZHB 3VXRA 4X98B 4JR9L 5E1AA 4PG9B 1E27B 1IZKA 4M7ZB 3OAUH 5KOVC 5E6ZA 1MIML 2BVPA 3HTLX 3HI1A 1YMME 1SM3L 2ERJC 3CDCA 2X9YA 1CT8B 3CMGA 1S7VA 1UB6A 1EHAA 4FMFA 1WFNA 3EDEA 3PE9A 4J3OC 5C71A 4J3TA 1UADC 4NNPL 5DFVC 3RNKB 4XB7A 1JGVH 5I19L 3CH1B 3UX9B 4L4TB 2Q8AL 1FG9C 3MO1B 1GGTA 3W82A 4JKMA 4PJGF 5CIPB 2QSQA 3STLB 4N0UA 1KIRB 4P46C 1U3JA 3T0ED 4GBXC 4EI6A 4Y8DC 1NFIA 5EWIL 1SQ2N 2CIKA 3D3VD 4C56B 3D69B 5HHQA 1GC1C 4GJTB 2HAZA 5GS0L 2VAAA 3B9KC 35C8L 2X7LB 1PG7H 5HHXH 5EORH 4KKBD 5H2BA 4JFFB 2XZQH 1CFVH 3HB3C 1TITA 2NY5H 4LKXB 1P1ZA 4F7TA 4ZOAA 3OXRB 2ESVD 4XPFL 4P0DA 4NM8H 3IFPA 5HPMB 3VRJB 5DVNA 1ZA3A 5DYOB 4RMTA 4NWUH 4L9LA 3S4SG 1OP3H 2X4UB 3ULSB 2N7BA 3DUUB 4GAGH 2P8MA 1RHHA 4S1RH 1JI2A 3F5WB 4HLZG 4S1SH 4Z7UB 3PNWB 3UTPD 4PRIA 3NPSC 5ITBL 1KC5L 1G7HB 2W1NA 3D48R 3DUHA 1S5IH 1OARL 3QEUA 1DCLA 5FK9A 4KDTA 2EXYC 5DA0B 2WWKO 1U8JA 4DTGH 3HI6H 1K2DB 4MA7H 2O5XL 4QRSA 2MQ0A 3QDMB 5DUBA 4WI9A 1NCAH 5FA3A 4K8RC 4OIBA 1A2YB 1FL3A 4KI5D 5IR1B 4WI6A 5JW4M 2FJGA 1OTTC 3KJ4B 5MHSD 4OFKA 5CGTA 2D0HA 4NN7C 3N1FC 3VXRE 4UNUA 3SGJC 3SE9H 4NQXB 3UTOA 1EHLL 1MRCL 3KYOB 5DK0B 4ZUVB 1ZLUK 3UO1H 4NZRL 4OCXH 1AGBA 2H8PB 4NO0B 4XC3H 4DJMA 1U3HD 4QRPA 4PP2B 4WEUD 2V2WA 3R06A 1NC2B 5C0BD 3U4BH 2DB8A 1Q9OA 3HE7B 4I3GA 2UY7A 3D85A 4G8FA 5I76B 4HJGA 3TH3T 1G9MH 2J88H 5I15L 2IBBA 1FPTL 1R3IL 2EZ0C 3FHQA 4N0UE 4PRHB 1VGKA 3SKJH 5I9QC 3VD4A 2BCKB 2Q86A 5EBWB 3QHFH 4FXLA 5DVOA 4I0PA 4GW1B 3BPCB 4NHCL 2FLRT 2ARJB 1FZJB 1L0QA 2ILLA 4KUCD 3DO7A 4GG8B 5HHPB 3FT3B 4FS0A 4I1NB 2CKBB 4Z0XA 2Z31D 4OM0L 1CS6A 4NC1E 4G8GA 1VEOA 4JY6B 3NCJL 4I8DA 4X8JA 1T7WA 4Y7MA 2ZUVA 3H9SE 3ESVF 2J2ZA 4MD5B 2JJSA 4PJEA 5DURD 1DVFA 1JI1A 2N56A 1UM4L 2OTUB 4YHKL 5E70A 3CJJA 1XT5A 3GO1H 4PRAB 3WXVL 4PRIE 1X6LA 2R0LH 3I3EA 2NY7H 1EJ6A 3D2UD 2X1WL 1ITCA 5HI4D 3WMSA 3MLUL 4LVHC 4LQ1A 3H9HA 2FJHB 3QPXL 3G6AA 5IVXA 1N3NA 1FVCA 3TVMA 5IK3B 3MLXL 1YEFH 4RFOL 4NO3B 3C9NA 3AM8C 3JV6B 2VXUH 2GJ6A 1W8OA 3U0PB 5B38A 5IHLB 1KN2H 2QBWA 4JO3L 1V7MH 2FHCA 4HFUH 4U1IB 4AEIL 3RVXD 1LVEA 1I1RA 5LJYH 5A2KH 1QQDB 4GLRI 3QG6A 3EO0B 4QRPE 2ADGB 4CVWA 4YXHL 4FQXB 1HN1A 2FL5B 4H0IA 1I1AA 5F93C 3CSYB 2R1XA 3RWJA 3FO2A 2VNCA 1BVKB 3MLYL 4HC1L 4ONGL 5C0AD 3MNWA 1S7RA 5B3JF 3DUSA 5EULV 4KJQD 1YNTA 4OFPA 1MCPL 5FF6B 2FGZA 1QR4A 3QH3A 5IROC 4F80A 4DW2H 3TLRA 4R4BB 5DD3L 1NCDH 4GS7B 5F8RC 4UB0H 2DJSA 4FNLH 1QSFD 5D7LE 3MV11 1HXMA 2B0SH 2WMPA 2VR5A 3NCCB 1UZ8A 4MA8L 1QSEB 3MGAA 5D70H 2X9WA 4Q58C 4R2GC 4CMHB 2QQNL 4JPVL 4NKOA 4PJAE 2AI0H 4GXVH 3DX8B 4G8GE 2D7TL 2Z8VC 3IKKA 4KKAC 2O5YL 2W9EL 1A1OA 3VFVA 3X12B 3MJ8A 4N8CL 1E4KA 2VXVL 5KOMC 1F4HA 5DSCA 2GT9A 4PJ9C 2XN9B 1K4DB 1MSPA 1I8KA 5C2BL 5GS1A 3NZ8A 1MRFH 5C08D 2OCFD 5SWZB 2CD0A 3OGCA 3HZMA 3O6FA 4FQLL 5ID0A 4UAOB 5L7XH 4YDKH 4TN9A 4WFHE 3B9VA 2O5ZH 3QEQD 1BVLA 4ODBD 5F89B 4F37F 4HV8A 4XXDB 5CBEA 1N5AB 5IVXE 1YNLH 5JHDB 3FN0L 5K59E 1X5HA 3FT2B 4Q2ZA 1HXYB 4X5WA 5B39A 4L4VE 2PYED 4IDJL 2JB6A 3F7VB 3NIFE 2IC2A 3M17A 5J0BA 1KJ2L 3ULVH 5CJOL 3VWJA 1GH7A 5IV2A 4XPHH 1WEJL 2BNQD 4QHLA 1FN4A 1U91A 3ZTNL 4F7CA 1NMBH 5L2KD 1D5MA 1M7DB 1T04A 4APQD 4JPKH 5J9PA 1UH2A 3HE6B 1AC6A 5HGAB 2EYTB 5F7UA 4UV4H 5E6IC 5IOPA 1HH9A 4AYFA 4Z95H 1A7NH 4LRIA 3VA6A 1J5OH 1KBGL 3FQWB 4PS4L 5H94B 2AV1A 4NRZB 5HY9A 1P4LA 2A1WL 4XMPH 5GRUH 2H32H 4Y1AE 1PYWB 3BZEA 3BGMA 4ODTH 1V7NH 5E7FA 3CLEL 4JPIB 2WNGA 3QIBC 4P5TD 1UH3A 5IM7B 4HZAA 1OAXL 3GSRB 3QRGL 1CFTB 1XGTB 5C92A 4PJFB 3SGDI 3VWKC 4F2MA 1T1YB 3PWJA 4IIQB 3QXAB 3PQYB 5ERWB 5HYJA 2C9AA 2OI9B 3DJ9A 3TBTA 4GO6B 5C0CB 3E1F1 3FTGB 1R6VA 5ICZA 5E4EB 5JTWA 2AEWA 4I5BB 3ZDYE 3L3GB 1A3RH 1GOFA 4FN0A 3ZDXE 1MHEA 1A6WH 2YD6A 1VADB 4ZXBA 3W5NA 5DFVD 1EFXB 2WZPD 3GMOA 3SDCB 1KN4L 1EXUA 4K07A 4PD4K 1DDHA 4P46D 3S37H 1XGPA 3L7FA 5C09A 5I71C 1E4WH 4QRRB 5E8NA 5DHVH 1DLHB 5I66B 1H3VA 3NA9L 3TT3H 1Y6MR 4LLQB 1DJSA 4JAMA 4PLOB 3O8XC 3HB3D 1K6QH 3M1BB 3QUZC 4NQDD 5DURB 5AYUH 1ZEAL 4M1GH 4X7EC 3F65A 3WYRA 3IDMB 3I50L 2FBJH 2DKSA 2D3VA 5CEZL 4D0CA 1I85C 1MAML 3RWFB 3HG1A 3SDAA 4F3FA 1HNFA 1QP1A 5D71L 1CICA 4WV1A 4YUEL 1OAUL 5I1DA 2FX7L 2XTLA 4CRPA 3QDJA 4OJFH 3DSFH 5DUML 1J1OH 4N8VA 2DL2A 2HH0L 3ARGC 4HWEL 6FABL 3KYMA 4BKLB 1IGCH 5DDHB 3S98A 3L6FA 1ZVSA 2QKIB 4U1NB 1SJEB 1RUQL 2R2BA 1J9CT 3P30H 1OLLA 4QXGH 2YK1H 3HS0B 1OTTD 4P4RA 4RCAA 4JHAL 5DJCA 3SDXA 4P2RA 5HDQH 3W2DH 2XFXA 5H35B 4X7SH 2A74B 4GG6E 3A0OA 1CGTA 4XCEB 3WL9B 3B5GA 5BJTB 4AEHL 3L7EA 2NNAA 3MOQA 4GRWB 5D1ZB 4LCUA 4RAVA 1VKXB 1ZHBB 4OLVH 3D39B 5F7EH 1R5IA 5SX5K 3RX7A 4POZC 1AJ7H 1NBVH 2YD3A 5LAXB 3LHPH 1MF2L 5J4MA 4M7ZC 3ARWA 4LCIH 4CVZB 5IHUH 1WZKA 3BKMH 3TA3B 1HHIB 3TH4T 2X10A 5JNYB 5AWNH 4PRBA 4LCCB 5C09E 3VJ6A 1JYWA 3OWEA 1A7BA 5DFTA 4MAYA 4ZFGL 1A8JH 1A3LH 3A6CH 1Q9WB 4NOBA 4MJID 4OF7A 3WHE0 2YPLA 1NGPL 5C07A 1SYVB 4QO1A 3FFCE 3KPMB 2YXMA 3PGDB 3I02A 4H1LG 1FYTB 1TQBB 3NACL 3K1KC 5E8EA 1WBYB 1XIWB 4LLDA 1L9MA 4G9FE 1KPVB 4JFQB 2CKBL 1TZIA 1KB5A 2XY1A 2Y72A 3ARPA 3TZVC 1KJVA 2VKWA 3BZFB 4UINH 4GSDH 1EVUA 4CNIA 3ZT7A 3VXMA 3K7UA 1OP5H 3S9DB 3QDJE 5BCAA 3MLZL 4RDQG 3KXFD 3KDMB 3QWOB 3NABH 2CIIA 4O2FB 1MJUL 3BKYL 3ULUH 5C0RH 1BREA 3GMPB 4RGNE 2VUYA 3L5IA 5K33A 3SN6N 1MJ7L 2WK2A 1BZ7B 1RD6A 3LQMA 4ZQKA 3VFTA 1DANT 5L2KB 5GQBA 3O3BA 3DROA 4NC2B 4Z7WB 5D6CB 4P49A 1K8DB 4APQB 2OTWA 4MAUH 1CL7I 5EO1A 3ZL4H 5ETUA 1VFOA 1KOAA 4MQSB 5ALCH 4FQ1L 1QYGL 3FQUB 2YPKA 2CLVA 2C1OB 5ICYA 1T80A 2C7UB 2NTSP 2X4SA 2EH7L 4U6YA 1MNUH 1BF8A 4XP4H 5IFHL 4JRYA 4P5MA 1MREL 1IGIH 4OCMC 3DRQA 3ZT5A 1DQLH 1I1YA 1RZKL 4LARH 4NYLB 2XG4A 3OAUL 4HS3B 3AVEA 2F53A 3B8SA 2E6QA 4KKCC 4UDUB 4OQTL 1VSCA 2FECI 5AZEH 3G5VA 2DQEH 1BOGA 4MD4A 1GGIH 3BPOC 1AIFB 2YPLE 3KLAB 2FYYB 1S78C 1Q94B 4E5XA 1PY9A 1MCWW 3L5HA 3OXSB 4KKAD 5JW3H 4X4YB 5JZ7C 1DLFH 5T1LA 4PRPA 1KCRL 2VQTA 2PTTA 2CRYA 2WAHA 1FGNH 4JFXA 4QTHB 2DLFL 4OF3A 1QLEH 2BOBA 5JPMB 4TVPH 1G84A 4ZPVA 3RVUC 1FCCA 5HHXL 5T1DH 5EORL 5FUZH 3ARDB 3DX9A 2XZQL 3VXME 1CFVL 4Y4FB 4J23A 3T09A 3MRGA 4I4WB 1IC1A 3VRLF 3TNMA 3OR7B 4PB0L 1SVZA 2GCYB 4IRJC 3VXQA 1R24A 5D1XD 2J8UA 2ZOLA 4WUUD 1I3RB 1CD0A 1F2QA 1NL0L 4NWUL 2Q20A 3CFDB 3RY4A 4XRCB 3MROA 3U79A 5D5ME 2E3VA 4S1RL 3IS1X 5T1MA 5LVEA 4S1SL 1LEIB 3PV6A 4N9GA 1LDSA 4I77L 5LXGH 2CLZB 3I9GH 4MDJA 4X6EB 3QCUL 1HINH 1XGUB 1JWUB 1Z9MA 5GGRB 5TQ2H 3LB6C 5DWUH 4O4YH 5D8JH 4DTGL 3GMNB 2W60B 4MA7L 1UB5B 3OKKB 1AGCB 1JWSB 1MI5A 3O4OC 4K7FA 1HH6B 4LSDA 2R1YB 3ZT6A 3MV7A 3H7BB 4AMKH 3FO1A 3U9PH 2BVOB 3NN8A 3PWVA 2IANA 1K4CA 1OAZH 2LV4A 4WY7L 4R8WH 4HIXL 5FDWA 4KVNH 1YDPB 2CUHA 5FYJE 3EOBA 1AHWA 3BESR 4CDGC 2YSSA 1WBXA 1CG9B 3UO1L 4ZS7H 3P4MB 1LQSR 1NC4B 4PJ8D 3LIZH 2IGFH 4Y5YA 5F96H 5KVFL 3C60D 1U6AH 2O93L 3QIBD 4HX1A 1S7XB 4QHMA 4WUKH 3WUWB 3PF2A 1OD9A 1CGVA 3BSZH 5FUOH 1IC5H 5HHMD 4PJGA 3MRQA 3DBXA 4D9QE 4RWYL 4I9WE 2C3HA 4PRPE 4QF1A 3EW3B 4YZFF 2BNRD 3CFBA 1T4KA 1A22B 1MFBL 1RJYA 3REWB 5BQ7B 1JZ4A 3UCRA 4ZOEA 3SPVA 3LDBC 1IJ9A 1Y6NR 4HF5L 2R9HC 1WC7A 4KTEH 4NZUL 2EDWA 4WHTA 5KTEH 2COQA 2NY5C 5F1OB 8FABB 2J8UE 1I1CA 5E1HB 3QR2A 4HGMA 4XP9H 4HPOH 1BIIA 3U36B 2Z35A 2P49B 1U8KB 1ZKAA 3OJ2C 5IBLD 3B6SA 3QXUA 3P4OA 1UM6H 1HQRA 4BSJA 2R2EA 4UAOC 1U92A 2HT2C 3MYZA 3O9WA 2EIBA 4KDTC 3G6JF 3VFNB 4X9GA 5HI5C 2R0LL 2NY7L 4J1UB 1MJJB 4FQ2L 3LZFH 4JFEA 3C6LB 2EKJA 2XNAA 4W6XB 3WCYA 1WCQA 4HMDA 4WW2F 5KG9B 3IJYA 3MREB 5FM8A 1F5WA 1CLCA 4OKVA 3MV7E 1MLCA 1D5XB 1UJ3A 1YEFL 1ZAGA 4OCSL 1XZ0B 1Y6KR 3RUGE 3WIIL 3U82B 2NY6B 4F7PB 3LRHA 4BQ6A 2A6DA 5E9DA 2VL5B 2IANE 2KZWA 5BVJB 2J12B 4GXUN 2IPKA 3TBSA 4BH8A 3BEVA 3WFDH 1IC7H 4LDLB 4HFUL 3ZLQC 4QXTA 2R4RH 1VFMA 2YD1A 4I0CC 1WF5A 2QQLH 4P2OB 4LRNH 5E2UH 3MV9E 3N1PC 5HVHC 4ZOCA 4KTDL 1EUUA 4PJIE 1H3PH 3HZYB 3BP5A 2L4OA 4CBPA 2HG5A 1D5IH 4ELME 5CEYA 5F9OL 3QXDB 4B7IA 4KMTH 4PJGE 5CZVH 3RQ3A 4DW2L 1G9MC 3E6HB 4H5SA 5LGJA 5HVGB 4UB0L 4OZIB 4MB4A 4D8PA 2B0SL 2F8VA 1AXTL 4DGYH 1H8NA 1XF5B 4CU8A 5D70L 3N85L 5BZDA 1C8PA 1L4IA 2NY4B 5DO2D 1X5JA 5IHBA 3D25B 4L3CA 2OL3A 5HHVL 2AI0L 1BLNA 5C6PB 5IWLC 2XRAL 4JREB 5DK2B 2H3NB 4YC2C 1DVFC 3KYNB 3AMLA 2E6PA 3KGRA 1RZ8A 1G6RA 2PUQT 5F72S 5FO8A 3STBA 3UTTB 1C5DB 1FNSH 4MNGB 5F97E 3BHBB 3RWIB 1VHPA 2GK2A 1LO5B 4NNYB 1R3KB 3Q48A 2WANA 5IB1A 3GIZL 1NCCH 3R8BB 1B9ZA 1MHPH 1MRFL 3HR6A 3HI5H 4OCYH 2YKLL 3SDCC 2P48B 3Q1SL 4M3JA 4R90H 2O61B 3FN3A 1U8PB 4YDKL 2EECA 4XHJC 4IM8A 3Q5TA 2O5ZL 4F9PA 4JFEE 1U8QB 3RGVB 3ORJA 4WU7B 2DWDA 4G9DA 1YNLL 4RFNC 1FVDA 3CXHJ 4L1HA 5FV1L 1RK0A 2R15A 4JN1H 2J6EA 4OZHF 4N1EA 3TT1H 3TZVD 3B3IA 5D1XB 5GGTH 3T2NL 4NJAL 1BFOB 4HUUA 2Z8SA 2FIKA 1UQSA 4Z76B 3ULVL 4BK5A 1W72H 5KVGH 2IFFL 4HKXB 1FZOA 2CDGB 4KRPD 4XWOC 4D3CL 1L0YA 1E6JH 2WUBH 1SMAA 1NMBL 5I1CL 4BZ2L 4XWGH 3R4DA 4HCRA 3KR3L 4J3VA 4JFYA 1A7RH 4JPKL 4GAFB 2YD7A 5D93B 4NPYB 4ONOA 2QV2A 2WBJD 2LU4A 1QRNB 3VFGH 2PN5A 1FNHA 2HT4D 5CWSB 2ICWB 1MFDH 2BHYA 1DE4A 5J13C 4ERSH 2MMXA 1J5OL 5B38G 1IKFL 2VXQL 1I3GH 1S9XA 4HWZB 3RKPA 4YDVB 5DJXA 1T3FA 4XMPL 3TN0A 5GRUL 2O26U 5J1TC 4NQCA 3MRNB 4ODTL 4NDMA 4EDXA 1LE9A 1LE5B 3CGTA 1V7NL 4WJ5A 5HHOB 3MRJB 2ICEB 5I30L 4OI9A 1XCQA 1WSST 1E4KC 3MLWH 1FV1B 1YMMD 2X4NA 3C60B 3L9RA 3TEUA 4IHOA 4PRDA 2HTLC 5F6IC 3KS0H 4DZBB 3O6FC 4JPWL 4WW1B 4YPJA 3NIDF 4MA3B 3MRCA 4KKCD 3VFWB 4HLJA 3CZFA 4GMSL 5D7SL 4TULL 3DECA 3THML 2V7HB 3QNYA 1XF1A 3QAZB 2R4SH 4HS6B 1F3JA 1S9YA 4RSVA 4ZAKA 2EDFA 4K7PL 5INDB 2W65B 5HGBA 1WIUA 3D0LA 4Y89A 2DWEA 3FL7A 4Q6IB 1BBJB 4TUJA 2FEEI 5KSVA 1A6AA 1V3JA 1FZMB 4V1DA 4XBPA 1E4WL 2CUMA 4DKDC 5F3HA 1KTDB 3WDHA 4WEBL 5K93A 4PBXA 2X70A 3RVUD 2PR4H 4IOIB 3TT3L 3TYFB 5L9DL 1KIUA 3E8UH 4A2LA 4HXAH 1DR9A 3MZTA 3E6FB 1QFUL 1IAKB 2W92A 4HT1H 1PQZB 1ZGLB 2JIXD 3WIHL 3HN3A 4IRJD 4L8SB 2VKXA 3MCKB 1FL6B 2Q6WA 1IT9H 3ULVC 1IM9A 4XI5D 4J12A 1P6FA 4P23A 2B1AH 3LN4B 1T0NA 5D7IF 4LRIC 3P73A 5DJ8B 3UTZA 1JV5A 4XPTH 3AB0B 3EDKA 3EFFA 5B3JE 1JWMA 4OLWH 1AP2A 4LIQE 2D7NA 5B39G 1LP9F 2VLME 3V6FB 2A73A 1J1OL 4IRSC 3LB6D 2FHBA 3DV6A 2ZUYA 2ZOKA 3PL6A 3QA3B 4WIQA 1J86A 1H3GA 1MWAA 3VCLA 3CC5A 4MJ4A 3VXRD 4OCWL 1I4FA 2JCCB 4R26L 5A16B 3C5SA 5C9JA 2Z4QA 5DD0H 5GS2D 2BXYA 4K3JH 5T5NG 5F88A 3W2DL 4M03A 1F4XH 3MRLA 1UWGH 4LPXA 3QDHA 2G75B 4DUWA 3V0VA 2JK5A 4ZXBC 5DQ9B 3MNVB 4EOWH 2DQIH 3UJIL 2NMSA 3L3HB 3BI9X 1FFPB 2OR7A 5FO9A 4CAGA 2KUTA 3VFOA 5FUCC 1AJ7L 2Y6SC 4DQOH 3LHPL 4V2BA 4PTTA 4MB5A 1ED3A 1I9RL 1RZGA 1KTKE 4WO4A 5J12B 2AJSH 2BXZA 3BKML 2AK4B 4U6XB 4UUJB 3LMJH 5AWNL 5KZCB 1SEBB 4MNQB 1U3YA 4FFVC 1ADQH 1MCBA 3S3JA 4OLUH 4ODWA 4J6RH 2BMKB 2G5BA 4K7PX 4QOKB 1A3LL 3A6CL 3RL1A 1IGTA 4FXKA 4PJ5A 4GKNB 5EA0H 4HPYH 2R9HD 4MNHA 4U1KB 3SDAC 1X4XA 1DUZA 3JV4A 4JG1L 2F19H 1JGUL 1ADQA 4DKAA 4M6AA 4G7YL 4PRID 1TZGL 2W0FB 4LBEB 4BM7A 4ZTPH 3ARDC 4OI8A 2HT2D 3T1WA 5CJBA 4OCNC 4RA3A 3JTSB 5HI5D 4S1DD 3RPIA 3VDAA 5DD1H 4TTGA 2ZSVB 5ESAA 3ZKXB 1CFBA 3IDJA 3NABL 5SX4I 1NBQA 3IETA 4JN2A 3ULUL 1RZJL 1PKOA 3DV4B 4Y4HB 2NXZD 1UJTA 3UYOD 4YHZL 5JA8B 3CDGA 1H15B 4KRPB 4DKEH 5TQ0L 2PO6B 2XZCH 2VO5A 4MQ7B 3TM6A 4Z77A 3VMNA 3RL2A 1JF1A 5FKPA 1KLUB 5JW4R 4NNXB 2CUIA 4QRPD 4PLJD 3ZL4L 1AKJB 4HDIA 3RZCB 5ALCL 1TVBB 3D85D 3V79C 3LKQA 3DYPA 5BRZB 5HD8C 4XVTL 4HIJB 4N8VG 2AJYL 1CDIA 2RCSH 1YEGH 4XP4L 3TF7C 2EDOA 4PJXB 2UYLA 2E7MA 3CFIC 2Y5TA 4Z7VE 1IGIL 1XF4B 3F7PC 2LABA 4I0PD 1NCTA 3VG0H 4RZCB 1NAKL 2B5IC 5IW6A 3WFZA 1JPSL 2JJVA 1JGEA 1C7TA 3QUMH 1HYSC 2JJUA 4M61A 2BRRH 4G8GD 2XQYG 5AZEL 3NCMA 4OT1L 2EYSB 2DQEL 1AGDA 2VDKH 3ZKSD 1NGYB 5I8OH 4OZ4A 1NBZA 1XGRB 4BELD 4YDJA 4K94H 2Z92A 5IGXL 5KSUB 2XPGB 2BSED 3RU8H 1DVFD 1AXSB 5JOFB 4G6FD 4HBCL 1B3JA 3T0XA 4OAWB 3EO1A 3QQ9D 5HJ3B 2JKXA 3HNVH 3MXVH 4U7MA 4UILL 1FGNL 4CU7A 4JCLA 4PB9L 1H5BA 1QLEL 4NQEE 4PTUA 4TVPL 4M7LL 4WFHD 1HHKA 5EZJB 5T1DL 4X4ME 2B4CL 4JZJA 1SMOA 4K3DL 3TVMD 5B8CB 3KWWA 3WFEH 1LD9A 2DMCA 1UWEH 2GJ6D 1RVFL 4WNQA 1JGLH 1AD0B 1PLGH 3BD5A 1FJ1A 5T33L 4EDWL 3IT8D 3WJLC 2F54E 3QDAA 5I73B 4OLXL 4CMMA 3PDOB 3ULUC 2KL6A 1IM3B 3UC0L 4NZDA 1CZ8H 3ARYA 4HAGA 4H8WH 2CR6A 5IVZA 4WRLA 3C08H 1I9JH 2A83A 4TUOA 1I1AD 4WFFE 5ESQB 3RBGA 4GT7A 1JRHH 2OM5A 2AJZA 2KQMA 3DETD 1FBIL 4NCDA 4C54A 2NXYB 2VLJA 4HK3J 4AMKL 1T22A 2XWJA 1F97A 4R8WL 4KVNL 1UYWH 3QQ4A 1FGVL 3RKDD 3OL2A 4P2OC 4ZS7L 3HAEH 4KGLA 1YQVH 2EDEA 3LIZL 2IGFL 4XMLH 2NY2C 3K2MC 2Y9RT 1U6AL 2AJUL 2UZXB 2DICA 1TNNA 5KSAB 3REVA 4U1LB 1E28B 4WUKL 4S10A 1IAIM 2JE8A 5GPRA 2F9BT 1WT5A 3RWDB 1A9EB 1IARB 4FQIH 2X2YA 3BSZL 1MFCL 2RFXB 4LMQI 3HAEA 3L3KB 3EHBD 1KGCE 4N0UB 2HTLD 4K7PY 1NCWL 2L7JA 3LS5L 3O6FD 3PXHA 4XZUA 1NFIB 5FYLH 5GSRA 2NY4C 4RIRB 1BBDL 5HHQB 1BGXL 1RMFH 1X4YA 2AXFA 2DMKA 3UJJL 3PWUB 5D72H 3WFBL 1PZ5B 3S36L 4JREC 1FNGB 1CXHA 2OR8A 4L8DA 4YBLB 2H1PH 3KPQB 1INQB 5BW7C 5D2NB 2MHAA 4JHBA 2QHRL 1IEAB 3TBVA 5A2JH 1FNFA 5KTEL 4Q9CA 4HS8H 3VGFA 4ODUB 3H9SB 4XP9L 3QI9A 1M7IA 4PGBB 3C09B 3UPAA 4DVRH 3MGTA 5IVNA 1IGFH 3VWJD 1A6ZB 3I2CL 4OF5A 2P8MB 1XGQB 3SCMB 2OTPA 1GL4B 3QXTA 2DN7A 2EDHA 3MNZB 1K3ZA 4RNRA 1XR9B 1PX3A 3U7YL 2BOCB 4G42A 3DVFA 4PJHE 1WZMA 3LZFL 4LVOC 3EBAA 3IDIB 5EU6E 4GFTB 2I9LA 4Y5VB 3HPJA 5EC2B 1U2HA 5FA3B 5SWSE 1CIDA 2X4QA 1FL3B 5GGRY 3U6RB 4NUJB 1FDLH 5JDSA 1ZT1A 2KQNA 1CWVA 4NO2A 3WFDL 2E7BA 4G5ZH 4KKLC 1EEUA 2D03L 3U1SL 4U6VH 1LEKB 3QUKA 3BPNC 1T1ZB 5D93C 1AGEA 2V2WB 4LK4A 1MH5B 3MV8A 2WUCL 12E8H 1Q9OB 4RQQB 5HYJD 3VRIA 4DGVH 4KDWA 1TENA 5EBLB 5CZVL 4P2QA 3JWOH 4KJWC 4LHUA 4JFZL 3C5JA 3DXAA 5E8PB 4ZXBD 5I8KL 5D7LB 4P99A 4TRPH 4DGYL 4C4KT 4I0PB 1HCVA 1UA6H 2AEPH 2Y25A 4XNQB 3MFFA 3BP7A 2Y5EA 3ARFA 2Y6SD 3VRLE 4PJAB 5C09D 4GUPA 3MLRH 4AT6A 1AO7B 2P8PB 5EUOB 3QCTL 3F8UB 3OAZH 1FG2B 3T4YB 4XH2B 1CTNA 3TYGH 1G7QB 3BISA 3FFCD 3S36X 3ALWA 4U3XA 1AD9B 1UCBH 1NCCL 1RIHH 5FYKE 3QJHB 1CGYA 2NLJB 3G6JA 3UTSA 1LK3L 5AEAA 5GJTH 3GBLA 5BMFH 5KSBF 4Q6IC 5HYFA 3KLHD 1UJ3C 3GJEA 2VR4A 3HG1D 2P44B 5IJVA 4WW2A 4DOHE 4JFDA 3RBSA 1FNEA 3EYSL 1A1MA 3MODH 1CICD 1N3NB 1T0MB 3EKCA 4TOYH 2ZNXA 3QDJD 5DC9B 2AERT 1WBZB 3V6OA 3TT1L 3BWAA 4TPRH 5EZOH 2BVQB 1AH1A 4L4VB 4U1HB 5GGTL 3TV3L 1A4KB 3VXPB 3MRFB 5ISZA 3TBYB 1QPXA 3KPRB 4LCYB 4RGND 3SDDB 3WHXB 4L8SC 1MEXL 3TPUB 4YO0B 3S88H 3W5MA 4YPGA 2DQCH 3QCVH 1T1WA 4KK8D 3I84A 1T03H 4XPBH 1BZ9A 4LF3B 5DRZA 3WNOA 4NKIH 3AB0C 4P2RD 1YMHB 3AMKA 1KTRL 1RJZB 1V3KA 4PV9A 3VFGL 2QR0A 5C0ND 5T3XE 1CDGA 1P4BL 3DUSB 5MERB 2VN4A 3CSBA 4P2QE 3S34L 4CN6A 3DXAE 1B0RB 5ILTH 4YZFE 5AAMA 1ORQA 3L95B 5F1NB 5IB2A 4Y1AB 5TDPB 1UZ8B 4LLWA 1TVHB 4QTIH 2I9TA 3DPBA 1REIA 3BH8B 3O41A 5JXAL 3DX7B 3P3YA 5I17A 3RWGB 4MA1B 2VLKA 5EZIH 3LY6A 2EO9A 1TCMA 1ZT7B 4HHAA 1CQYA 4YDIH 1B6DA 4LNRA 4OZGF 4MAYD 1FHGA 3OKYA 5IFJB 1JF6A 4JANB 3O45A 5EIQA 3MJ8B 2YPLD 2RGSA 5C07D 4HH9B 4ALAH 4QHKI 3HC3H 1RZ7L 5DMGD 2V2TB 5EPMB 2RJMA 4NP4L 1Z5LA 4X4ZA 3X3GH 4ZNCD 3MRBA 5C0JA 1JZ2A 4FFZL 4P3CL 5BV7B 3TJEH 3G6JE 1JE6A 5ESVA 3TO4A 4I2XE 5DJAA 3O2DH 3C2SA 3PWPE 5J12C 2FGWL 4KAQL 4PGDA 2J4WL 4DEPB 5HTSA 1T66C 4WCYH 5I1KH 1VFBB 1DUYA 3VXMD 3JXAA 3TWCL 2FEDD 2WINA 4H0GA 1UC6A 4OZHA 4LPTA 4FQJL 1F11B 4OZFB 1KPRB 3VXNB 3M17B 2XTJC 1DL7H 3ARRA 3VWJB 4PJ7E 3MMEA 5MENB 1P5UA 2ITCB 1VPOH 1FN4B 3IDNB 5E99L 4NKMA 4PJDB 2ED7A 3MBEC 5BO1H 5F8QC 4W4OA 5GSVA 4UBDC 4QXWA 5D6DA 1CU4H 5D7JB 3TN0C 4AJ0A 1IQDA 1MCJA 3ZKXC 1A7PL 5GRVK 3GMQA 5EOTA 1OGAA 5CUSH 4X80H 3BEWA 4R96A 4GRLB 3X11A 1LWRA 4JRYD 4Y4HC 3FKUS 5BS0A 4LPWA 1BIHA 1EH9A 1YPZF 2PO6C 1WIPA 1OP9A 3FONB 4MDIA 2FATH 2PW2A 1JP5A 1QVOA 5FYJD 4NQSA 2XA8L 3N06B 3UEZA 1TDQA 4ZODA 2VLKE 4TNWK 5EC1A 5DHYA 2PXYA 5L2JA 2NY1B 4EI5B 2F53D 1ES0B 3IVKB 4K3JL 2NY0C 1O5DT 3QYCA 5LGHL 4X9IA 1KG0A 1F4XL 1UWGL 2UVFA 3MPCA 5IG7B 4EBQL 1GGUA 4GG6B 3GJFA 2EDXA 5CZKA 3NGBC 2NY2D 1BFVL 1HSAA 4XPGH 4BZ1H 1C16A 1YEKH 5I2IB 5T1LD 5EG6C 4PRPD 2ZSWB 3M45A 1RPQA 2C3VA 3MCLL 4X6CF 2B39A 1M7XA 2Z93A 2LQRA 3BQUB 3IXAB 4L3AA 1CXFA 5BZWB 5FGCE 3ARSA 4ZFFA 1BQSA 1DDHB 3ALXA 4YGAB 4W4NA 3F7QA 3GHEL 3QEGH 2ITDA 4KQ4H 4OZHE 5E8NB 4UNVA 4AM0B 3QZWB 2OJEA 4V2CB 5DJ6A 4KZEH 1BP3B 1T83A 1U8LB 1UG9A 3LEYH 3BYTA 1ZHLA 4P23C 5CCKH 3FFCB 5EA0L 4HPYL 1ZS8A 2PCPA 4POUB 4CADA 3O6MH 1UACL 2NZ9C 1S7WA 3E3QE 4G8IA 3CUPA 1F4YH 3KPSA 1W8NA 4MCZB 4G9FB 2IH1A 2JB5H 3SOBH 4PY7A 1CVRA 2EXWD 5CKGA 3BVNB 5D7IA 3UDWA 5I8CB 1NUFA 4D0CB 3RP1A 4DGIH 2DQGL 2CK0H 2VH5H 1P6AB 3PL6C 1UZ6F 4GW5B 3OAYK 4WV1B 5AZ2H 1G7LA 1LP9A 3OJDB 1MI5D 1KEGL 3WLBB 2QLVB 3JWDH 3MV7D 5I16B 5IEHB 5MEOB 4OLEA 2YD9A 1LDPL 4O58H 1EBPA 2AJVH 2B7DT 4N8VB 4UQ3A 2WWMD 1OM3L 1W0VA 3T65A 5DJYA 5BS0E 2IAND 2FX8H 1CGSH 1JVKA 1FO0A 2VAJA 1N6QL 4Z5RA 3IF1B 3VXUA 2IH3A 2PNDA 3CFKB 5DA4A 2XZCL 2R2BB 1IL1A 4P48A 2UUDK 4FA8A 3DIFA 1BQHB 4Y16A 3T1FA 4ZUUB 1NJ9B 1QLFA 2A6IA 2LVCA 5DJCB 3NOIA 2MPAH 3BP4A 1DSFL 1NKOA 5SV3A 3NFPA 2CMRL 3S35H 5TPWL 4UU9A 2NNAB 3NIDE 1JPFB 2E9WA 2KH2B 2ICWJ 4S1QH 2ZUTA 5EO0B 1O7SA 3BIKA 1CE6B 1K9TA 2APWA 2QQKH 4X6DF 1NGZA 4JFOA 1EEYB 1ZE3C 2Q76A 3H42H 3GSUA 3VG0L 1RFDH 2NY3D 2XKNA 3WN5A 4R0LA 5IB3A 2HJFA 1IKNC 1T2JA 1INDL 5KSAC 2BRRL 5IB4B 3UAJC 2HWZH 4MAYB 1MHCA 1ZT4A 4D0BB 1BEYH 4MHHI 3V5HA 5I8OL 5JR1L 1YY9C 4LVEA 3HC0A 4X6FB 3RU8L 2OX5A 5JDJA 2P5WE 2A6KB 4M62L 3KPSE 4CJ0A 3O9WD 3HNVL 2E27H 3EUUA 2LAGB 3MXVL 1GIGH 4Y2OA 1F02I 2R29H 3NFNB 2ADJA 5C0GA 1HWHB 1JPGA 1MLBA 4XPAL 4J3UA 1KJVB 4JFED 5EBGA 3VXMB 4UTAH 3EJZC 5D2NC 2NX5B 2HLFC 3SGEI 3L3DA 3GUTA 3WFEL 4WI4A 2GTWB 4RMWA 1F6FB 4LEXL 3C8KB 3FMGH 3FT4A 5E9DD 4QCIA 3V5KB 1HCFX 1Z2KA 1PLGL 4J8RB 3SCMC 3B43A 3P9LA 5D5MB 2LFGA 3QQ3A 3RTQC 3MYJA 2AJXH 4KU1A 1WWCA 5DMIH 5T3ZH 4FTVA 4KK6D 2YOCA 3C08L 3GZKA 1I9JL 1N6VA 4JFPB 5HHNA 5EO1B 1S5HA 5E2JA 1JRHL 3T0EE 5GRWA 3CPLA 3MR9A 1KFAL 3GM8A 2HLAA 1OWRM 3NAAH 3DGGA 5J1SC 1NGXB 2D0GA 3UJTH 4NBXB 3OB0H 4ONHB 4NFCA 5JOPD 2XACC 1UYWL 2ESVE 3HHRB 4KV5F 3F7YB 1MAJA 1IMHC 1T7ZA 1MCCA 4JG0H 1NGWA 5CP7B 5DD5H 1PG7W 4NKDB 1IAOA 1R5WA 3ZKNC 2CK2A 4HGWB 4Y0GA 5GRZA 3B9DA 3GIVA 1Q9KB 4ZDHA 4LQFL 5D9SA 3VW3H 4LSRH 3UTPE 2VL4A 4GKSA 4L8BA 1B0GB 1DQJB 1CVSC 5M94B 1ZHNA 3DURA 2V2XA 4X83A 1H5BC 4E5XB 1J0IA 4J7RA 1WUNT 2EE3A 3RY6A 4PRPB 3STZA 4C83A 4K94C 1FFRA 2PTTB 3RWCA 4JFXB 3O3DA 3V4VH 4P4KA 2P5EA 1X7QA 2IF7A 3N1QC 1BVZA 3QEHB 5D72L 1TLKA 3MUGB 6CGTA 2VXSH 3DX9B 2A9ML 3GI8H 3DX6A 3MRIA 1DQDL 2P8LB 4OB5L 2GK0A 4JO1H 3BD4A 4OF8A 1XGYL 2MKWA 4WI2A 3NTCL 5BV7L 3UYRH 5HYSB 4BUGA 4HS8L 2V9QA 2ZOLB 3C5ZB 1I1FA 1UM5L 5DC0A 4O2EA 4DVRL 1JHKL 3DRTB 5C0BE 4Q9RH 4Z7UF 4ISVB 1HZHL 1D9KB 1D6VH 1E4JA 1K8IB 3WS6A 3LV3A 1YN6B 2RB8A 2PTVA 4L1DA 3PWNB 2PF6A 3KPOA 4UT6H 2H9GB 1ZSDB 5D2LE 1HKLH 1EHXA 3MJ7A 2EIZB 1HSBB 4H8WC 1YYLH 3EDJA 3GBML 2V7NA 5FB8B 1IGJA 1NPUA 4Z7QF 1M6OB 3RUGB 1BX2B 4UBDD 2I26N 1AR2A 2FD6H 1R5VB 4CL7A 2J5LB 2C4FU 5GGSY 5ACMA 3MSPA 4NQCD 4XTRC 3QB7C 1X4ZA 4G5ZL 5EU7E 5D1QA 2DBLH 3BDXA 3LRGA 3WBDA 2YRLA 1Q72L 1JTPA 1ZA6A 4NIKB 1A0QL 1WT5C 4F9LA 5GGUA 5TDOB 4JDTL 3MV9B 2XZZA 1J0YA 12E8L 2BC4B 3MJ6A 5F3BA 4MJ2A 4OSUH 4PJIB 3ARZA 3DI2B 1YEEL 3BDYL 1B0WA 1CFSB 4ELMB 3SO3C 2NY0D 4YFEA 1M05B 2R2CA 4JQXC 1CR9H 1A9BB 1M1SA 1SYSB 2VDLH 1CDCA 2Y7QB 3C6SB 2P5EE 4TRPL 4UV7H 4ZAKD 4G6MH 4UTBH 3BX7C 3KS0J 1RZIB 4OUOA 4YE4L 1EJOH 3MA7A 4XXCA 4MA1C 5JO5A 1YN7B 2GSGA 3FQTB 4L8CA 1KB9J 3GRWH 1A6VH 1VGEH 3GSWB 3CFCH 3LRSB 1BWWA 1JK8B 4P2CG 4IMKC 4WWKA 4V1DD 3MZGB 3MLRL 1X5AA 5FA4A 3G5ZB 4N8PA 4ZFZB 2HMID 3FB6A 2VDOH 4X9FA 2FDBP 5DHXB 3WKMH 2V5RA 3IU3A 5KW9L 4I0KA 3TYGL 3MLTA 1SHMA 3LVEA 1BIIB 3HAEG 4RMRA 4YHLH 3ROLB 4F7EA 1LO4L 3OGOE 3VXOA 3GRWA 1FNLA 3PJSA 1RIHL 3P4OB 4IMLA 4CUCA 2OXGA 1IGMH 5C0AE 3WNKA 1F4AA 1HEZA 4KJYB 4X99B 1IM9D 4YBQC 2FO4B 5BMFL 1PSKH 4P23D 4E42B 1B90A 4HFWA 4YGVA 1Q0XH 1KEMH 3MV01 4JFEB 2NZ9D 4TVSa 1Q38A 1QSFE 1OHQA 3EYUL 3MRMB 4DZ8A 3LKPB 3W39A 4OKVB 3SKOA 3QDGA 7CGTA 4LP4A 4O9HH 2JJTC 4TPRL 1KCLA 1CLOL 2IPKB 1OSPH 2H26A 3BEVB 4K3HA 4LSQH 4JB9H 1XMWA 1XF2B 4Y4KA 3IDYB 2HTKD 4JZNB 5F6HJ 3WO4B 4ODXA 1F4WL 1NDGA 5AUMB 5JW5B 2DF3A 1MFEH 3BAEL 2BNUA 1CTOA 2AEQH 5C08E 1C1EL 3BP5B 1NMCC 2HG5B 5FHBL 1I7UB 1G7JB 3WHE1 5EU5A 5CFHA 4IS6A 4R7DA 5T1KB 1MUJA 4GAYB 2DQFA 5ILTL 4GBXA 2HYMA 2RHEA 4E41A 2AQ2A 4GRMA 3ARFC 4N68A 3QULA 1C5CL 3ZTJH 1J8HA 3FO0L 3JWOC 2LU7A 2JELL 3TGXA 4MX7A 1JFQL 3A6BH 3B9KA 4WO4D 2XQBH 5IHZB 2PYEE 2NY1C 3IJSA 5EZIL 3UPRA 4YDIL 5I0DA 4JZOB 1R3HA 2AV7B 2BNQE 5MP6L 1YY8A 5EZLB 1SEQH 4H26A 3SJVB 1WCBA 1TJIL 4HXBL 3LQZA 1NEZA 5FO8B 1GHFH 2WWKT 1FQ9C 4PJ5D 3HC3L 5CMAB 4LHUG 4H88H 5IBUG 1JNHB 3UAJD 1U8MB 2HJLB 3EOAB 4WW2C 3BQUC 3TJHC 3X13A 3O2DL 2EDNA 1YY9D 5KSBA 5HGGS 1L0XA 1RULH 3V6OC 5DC4B 2FX9L 4EXKA 1L7IH 1FRGH 1QPPA 3QBTB 3MRHA 2HFGH 2IAMA 4ZPTB 3U4EB 4CN4A 2BY2A 5DJ2A 3H6JA 4XGZB 1FVDB 2XWTB 3QDGE 4JR9H 4YK4C 1X5GA 2ZNWA 1R3JB 1HQ4B 1SJHB 4JRXA 2X4TA 5F7MC 1MIMH 3I85A 3L5WA 2A38A 2YPVL 4HUUB 5TE6H 1SM3H 4JRWA 4YHPB 5DUPL 5E94B 2IFGA 1EGJL 1HOCA 2ENSA 2Y4SA 4N90E 2EKSA 2HLFD 1YJDL 2W0LA 3RWEB 2E7LA 5TGBB 1KUMA 3HZVB 4FZ8H 4DK3A 4NNPH 4AY0A 3VGEA 3KYKL 5I19H 3I75B 5GIRA 1ZANL 4WFFD 3HZKB 2Y23A 4WGVB 2ADIA 5BO1L 2G9HA 4PGCB 4NO5A 3HCVB 5EWIH 5ENWB 4X80L 1FIEA 4JQIL 1KCSH 4EUPB 4QRUB 1OF2B 5GS0H 43C9B 3K0WA 4QY8A 2MTPA 1WZ1H 4JJ5A 3M07A 1JJUA 5LG1A 4QWWC 4XPFH 1KTLA 2IADB 2VDMH 5K9OB 3UBXI 2PW1A 2OR9L 5CAYB 4NQDE 3VXTB 1U8HA 3HUJF 1P9MC 5TDNB 3UBXB 4OZGA 2AXGB 5IMLB 1EEQA 4PBVC 1B4JL 4LASL 3OKLA 5ITBH 1KC5H 2CKNA 3H9YA 5DTFB 1T89A 4YEEA 4Y2DB 4ZNEE 1ND0A 4HG4J 1TCRB 5I1EL 1OARH 4BZ1L 4M6NL 3GNML 3WE6A 3H0TA 3SKNB 3AGVA 2VIRA 3I6GA 2O5XH 5KSBE 4ZAKB 2GAZA 3IAPA 1WQVT 4FQHB 1QG3A 3VFPB 4JDZB 4HWBA 2G5RA 2ZG1A 4G43B 1A6AB 1ZLUH 4JM2B 5HGDA 5CKAA 3QSKB 3IFOA 4KQ4L 4DWHA 4PREA 1ZHKB 1EHLH 2X70B 5JIKA 1QO3B 4NZRH 3S5LA 3NFSH 5JORB 3ZYJA 4KPHH 4NQVA 1MCLA 5J06A 5I1LB 1DQML 2CRZA 1NGQL 3QUXB 5FAAA 4U1SB 2IBZX 1GPOH 4F7MA 1F4YL 2Q6WB 5I15H 1FPTH 2JB5L 3SOBL 3HNSL 4MJ5B 5J8OA 3BUYB 1ERNA 3CXDL 2KBGA 3P73B 4M1CC 4DGIL 3K46A 2CK0L 2VOTA 2APXA 2VH5L 4XVSL 1JWMB 3DMMB 4U0RB 2GJZB 2FZ3A 2VLJD 4DUXA 5IROA 2ORBH 3L3IB 3U30B 3O3EA 5D7KD 3S96A 4O58L 1WWWX 3QFJA 1DBKL 2FJFA 3FFDB 5F9WB 2FX8L 5IF0B 2PXYC 1YPZA 2K7QA 3KNBA 4XCNA 3ISWA 1MFAL 3L3JB 3QFDB 3BKJL 3KHOA 3PABB 3NCJH 3P2TA 4XNYH 4MHHG 1NAMH 4S11A 3X14B 4X5LA 5MI0C 5C9JB 3U0TA 5E5MA 4U33A 4QT5A 5E8OB 4XTRD 1FL5A 5J1AB 3MRKA 1UM4H 4YHKH 1AR1C 1RUAH 2GTZB 2MPAL 3MRLB 3VGGA 2ZUWA 2NW2B 3LKOA 1NLDH 4PJ9A 1FFNA 4EZMA 2ZZUT 4M1DL 2UZYB 4Y19A 2VB5A 5J11C 2OMBA 3QPXH 4Z7VB 1G7IB 5C3TA 3BGFB 4X6CA 2XXMB 3MLXH 4RFOH 3H42L 4WVRA 5ELIA 4MMZC 3LN5A 5MEPB 4U49A 4LSPL 1T83C 3ETBF 2VRAA 1YEDB 4A6YH 1HI6A 5IQ7H 2WP3O 3WS3B 4YQXL 3QJFA 4JO3H 3SHSA 1F6LL 2A6JB 2AKRB 4ODWB 3QPQD 2HWZL 4AEIH 1MVUB 4KTYA 1BEYL 2EDDA 1QD0A 3RL1B 5FYLD 3VI3F 4XT1C 2V9TA 3QI9D 3WSQH 1DBJH 4QGTA 3UDWC 1RAMA 4QYOA 1JMZA 4MSWA 1QBML 3JV4B 5IMKA 3O3AA 4ONGH 3AREC 3ULVF 1IE5A 5CINH 2GEEA 1MCPH 2R29L 4OLZL 4NQEB 3HPLB 5JLZA 4Q0XL 5DD3H 1ULVA 2HP4A 3GGWB 2EE9A 3VE0B 2X44D 5F1IA 5E6IA 2NZIA 4UTAL 2XY2A 1D5BA 5JHLL 4XNXL 4MA8H 2VLRB 4YDLC 3CZJA 1WICA 4HC1A 1GGCH 4HH8A 3C5ZC 4OIAA 1WFOA 3FMGL 1H8OA 4YHYC 1F6AB 4FHBD 1P7KB 2VITB 5DI8B 4JPVH 3DVNA 4Y16C 3CIQA 3JWDC 3R1GH 4QHNA 5K9KA 2F54B 2D7TH 4JVPA 2O5YH 2AJXL 2W9EH 4Z7WF 4OFDA 5DMIL 4N8CH 5T3ZL 3SE8L 1KJMB 1FVEB 2DI7A 4AEEA 2DJ4A 3VWKA 5C2BH 5J6HB 5DQJB 4F33A 4AENA 3G5XA 3MV8D 2Y36H 3FQRB 1PZUB 1AY1H 3SY0B 4FQLH 5T3XD 4D0DA 1S9WA 4RGOH 4UQ2B 1FSKB 2ENYA 4P2QD 4Y19E 2A77L 1PKQA 3GSQA 1QNZH 5HYQA 1QR1A 3DXAD 1R3LB 4R0LC 4R3SB 4X6DA 1CD1A 4X6CE 5JMOC 3D18B 3FN0H 2DTSA 3V0AC 4MVBD 3ARBA 4HUVB 5DD5L 3H9ZA 2J8HA 4QXUH 1YUHB 4IDJH 3P11H 2MSPA 4KRLB 3V4UL 1KNOB 3EYQD 3ARFD 1KJ2H 2M26A 2IMMA 2PETA 4LSRL 3R8QA 1WEJH 1CFNA 1ZV5A 1ODAA 1U58A 3O8XA 4MCYA 5E0QA 3QUZA 1PFCA 1NBZB 1MCKA 1FIGL 1CE1L 3NCFB 1MRDL 3CU1A 2QQQA 2WV3A 4LPCA 3W11C 1DBBH 2R2HB 4JY4B 3ES6B 3UTSD 3MJ9H 3MOAH 2FWOB 3QUYA 2BSRA 3V4VL 3QIUB 2UWEB 1JUFA 3NCYP 1I85A 4HKZB 1KBGH 4POYA 4ORGA 2XT1B 43CAA 3FZUC 2YA0A 3GSXA 2A1WH 3O3UN 4JFDD 2VISB 3GI8L 3LKNA 3BN9C 3MCG1 4MXQD 2W9DL 3CLEH 3BRDA 1GZPA 3UYRL 4LGRB 3NA4A 3ARGA 1A6TB 5FGSA 3BP6B 4H25A 3GSVA 5ISZD 4UIMA 1FJ1B 5EU3A 4F15B 1QHOA 1D6VL 3GFUA 2CDFB 2I07A 4UOW0 5TFSH 3V0WL 2J6EL 4TUOB 1KIPA 3NBNA 4PJHB 1NAMB 1YYLL 5EBMB 3MLSH 4NT6A 5EU6B 1DQQB 4R97B 3CFJA 4TSCL 4GW4B 4Z0BL 2YC1A 5I1IH 5A40E 5HPOA 3AXLA 1PKQE 5DRXA 5SWSB 1H3WM 1EO8L 1TZHA 4X98A 5CHNB 4PG9A 1E27A 4QHUB 3NVQA 1C5BL 4PYHA 1S7TA 4TQEL 3IDYC 1C7SA 2C1PB 3R0NA 2VLKD 2IG2L 3MA9L 1CT8A 3FB8B 4LIQL 3HMXA 3ZSTA 2DKMA 2ZCKH 5DS8B 3PUCA 1ONQB 1ZEAH 4QWWD 3RNKA 2IALB 3I50H 3CH1A 4L4TA 3MO1A 5CIPA 4A6YB 4S2SB 3STLA 3VH8B 1ETZB 1CD9B 4P4KC 5CEZH 1BFTA 1NCNA 3DVIA 4X7TA 2F15A 4KROB 1KYOK 5DQDH 2OJZH 3CCHB 3D69A 4C56A 3TO4D 4YUEH 1OAUH 1WZLA 4FZEH 2X7LA 3ZYZA 1EJOL 5DUMH 5FKAB 4JFFA 2YA2A 4LKXA 4U1JB 1A6VL 1JNNH 1VGEL 5DJZB 4HWEH 5IMMA 3Q5OA 3PHQB 2KZ1B 2VZSA 5DJ0A 1NCUA 4RAHA 5HPMA 3VRJA 1WTGT 4YX2L 1RUQH 1I7RB 5DYOA 2MHAB 4J4PA 2G2RB 3B8YA 4IDLA 2X4UA 1RIVH 3ULSA 5TE4L 3DUUA 3QI9B 3OKDB 4YHLL 4XVUC 3F5WA 3LQAL 5CSZB 4Z7UA