1CDIA

Structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
179
structure length
179
Chain Sequence
TKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL SURFACE GLYCOPROTEIN CD4
publication title Structures of an HIV and MHC binding fragment from human CD4 as refined in two crystal lattices.
pubmed doi rcsb
source organism Homo sapiens
molecule tags T-cell surface glycoprotein
total genus 30
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 1994-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05790 C2-set Immunoglobulin C2-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdiA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdiA02
1KCRL 2DQUL 4LSVL 1PY4A 3OAZH 5DQJA 3T1WA 4L8SB 3QDMB 1M71B 4LDLB 3S34L 2FJGA 1LO4L 2NY2D 4OF3A 5DK2A 1D6EA 3EOYG 3O4OB 2F53D 4Q9QH 2KQMA 3UTZA 2HJKA 2F5BL 3W0WD 4XHJD 1JGDB 4F7PB 5CUSL 2VDRL 4Q58C 3WO4C 2B2XH 2HN7A 4LSTH 1S7WA 1EO8L 4CVXA 3V6OC 3KNBA 4O4YL 4NBXB 1BOYA 4QRRD 4XAKE 4LLWB 3IDYC 5FUCC 4TRPH 4LLMB 5KG9A 1D5BB 1X6NA 1Z5LB 4FQ1H 2KBGA 3B9KC 4R96A 6FABL 2YA2A 3TEUA 3C5SB 2MSPA 2APWA 1JGEA 4JN2A 4D9RE 4YDIL 4JFOA 1OP3H 2JLLA 3MPCA 3ZKMC 1S7UA 3HMXL 1NGWA 1N59A 4RFEA 3UBXI 1MRCH 1XZ0B 3BPNB 2XFXA 2W07A 1BOGB 1OGAE 3ARGD 1P4BL 4ZNEA 3G5VA 4L3ED 4PRID 3V4VH 3FT3A 1KIRA 1IC5H 4OTXH 4YHKL 4MHHG 1FP5A 5DFVD 1FO0B 3MJ9H 4QYOB 4YHPB 4YHOH 4LL9A 5B3NA 1XFPA 3SDCB 2MOVA 1SM3L 3BKCH 4EOWL 4N0FA 4C58B 4MA8H 3ARTA 1NBVH 3P9WB 4HK3N 3WIHH 1TVBB 4GKNB 4LSQH 1BQHB 4DZBB 2Z31D 4XMKH 3EYOA 4LHJB 1BQLH 5DZNA 3KXFE 4GXVL 4NHUA 3LRSB 1N2RA 2DQFB 3MXVL 3LB6C 4Y4FA 4YHML 4NRXA 1JPGB 2NR6C 5IEHB 1IBGL 5H37H 1P4IL 5A3IC 2VAAB 2AXGB 2A9ML 4U1MB 1VESA 4CU6A 4Z8FL 5DJCA 1N7MH 4BQ9A 2B7DT 4QT5A 5D7SL 2C3WA 1GAFH 2B0SL 2WINB 3PDOB 3IFOA 2R2EA 5EO9A 1BX2A 1IQDB 1HE7A 4GKZB 4DCQA 5DXWA 2VE6A 2V9QA 4DZ8A 4WJ5B 5HHOB 5SWQB 1KF9B 3VFWB 5E2VL 3WLWC 2Y1VA 1PEWA 5KS9E 2EDOA 4PRBA 4XNZB 4H1LH 4FQXD 5K9OA 3WHE0 5JOFA 4PRDB 1X4YA 3O3BA 1TNNA 1W0VB 2DQHL 4GUPB 1AJ7H 2IF7A 4N8CH 2H9GB 2P8LB 3NTCH 5AYUL 5E24E 4XBGA 4PP2B 5EBMA 4ZFGH 4YC2B 3VU2A 1OAXL 2VZSA 3QRFM 1X5YA 3O6FC 4P2QA 4ZUVA 3IJHA 1I7UB 4M6AA 2GT9B 5J1TC 4X7SL 4DGYL 5EUKB 3NIFF 4KC3B 4TSAH 1A6TA 3HLAA 1NMCC 4LASH 3IFNL 4LHUG 4R2GB 4GKSB 2Z9TA 1J12A 3FFDA 3ULSB 4XNUL 1MFAL 1ZS8A 2FIRT 4RRPG 2B1HL 1UH4A 4KZEH 1T5WA 1I8KB 4NQVB 3MRQB 1NLBL 3BP6B 4P23B 5KTEL 4P2RD 1OGTA 3VXSD 1B4JL 1A5FH 3V9FA 3OPZH 1CFNA 4BH7A 1ROWA 4LMQI 5F97E 3HPJB 4JY5H 1A6UL 1A1MA 3EAKA 3MRIA 2IH3B 4Q97A 1I4FB 2IJ0C 2O5YL 5EOCH 4M1DH 1GXEA 2JB6B 1JP5A 3IFPA 1WF5A 2DQTL 2RBLA 5DRXB 5TQ0H 3WIIH 4OZGF 1KC5L 1RQ5A 1WC7B 1XF5A 3GIVB 2AI0H 1NBZA 3PP4H 4XVTL 5I1HL 3UXFA 1MI5D 1FL3A 2HJFA 1VACB 4A2LA 5ITBL 3H42L 4BKLA 3JBG7 2A9NH 4PJDF 4LCWD 4YXKH 4ODBD 3VGBA 4CVZB 2GKIA 4DVBA 3X3GL 1A3LL 3AS0A 2GEEA 4FQIL 4PJ7F 1F42A 4DGIH 2Q1EA 1OTSC 4O51A 4PRPE 4XNMA 4XNQB 1QA9B 4NKDA 4L8BA 2FJFB 2DQDL 3HG1A 4YJZL 5I1GL 4JPKH 1C12B 2YUWA 1KEGL 5HDLA 1JF5A 2QHRL 3S6CA 4Z78A 5J1AB 3TWCL 5E8DL 4YLQT 3VDBA 3MR9B 4H20L 1OAUL 4E42B 5ICYB 1FBIL 1QKZL 2HJLA 5CGTA 3ZZ1A 3O9WB 4HAFA 2WIIA 4JFFA 5E94A 5ALCL 3ZHKA 3HCVA 3VA2C 4GFTB 5L2KA 4OGYH 3CXDL 2X4QB 4ALAH 1OGAA 3UCRA 3GJFA 1KYOK 1I7RA 5CINL 1M05A 1X5LA 3SGEH 4PFEA 5C9JA 5HYSB 1FYTB 5F7WC 1IAMA 2Z93B 1INEH 4CNIA 5IP4A 3JWOC 3RJDA 5HXMA 3GHBH 2V7NA 5GGVH 1FNSH 2DLIA 1JPFA 3C2AL 4NBYB 5T1MB 3L3JB 1X5FA 4K94H 4D0CB 1S9XA 4KROB 5GISL 4HFUH 3GRWA 2BJMH 3DMMB 4WGVB 4U3HA 5JHLH 1NC4B 2BC4B 5FKAB 2CUHA 4OFDA 4LCUB 3WDHA 1OD9A 1K4DA 5FM4A 4QY8B 5IG7A 2AEWA 4IRSB 5HI4C 1ND0A 5I0DA 4MQ7A 2AQ1A 1AIFB 5E8PB 2XWBB 3I02B 3MRCA 2V5YA 1UWGH 1LO2L 2UZIH 1DVFB 5JQHC 5KSVB 1T1ZB 4HUUB 4L8DA 4N8PA 1VEMA 3BW9A 5J9PA 2AJUL 1I1AB 2EDTA 2ZKHL 4Y89A 1UVQA 1J05B 3TT3H 5IEKB 2FB4H 1IL1A 2GY7B 1FZKA 2WZPD 3DYOA 5KS9A 4JZOA 1VFBA 4EUPH 4U1NA 5HYJA 5GGTL 3JV6B 3ES6A 3SQOH 2NY0C 3Q6FB 4L9LB 4KK5C 4ELMB 3QEQE 1DSFL 5ALBH 2QSTA 2Y25A 4JKMA 4GH7B 3DV4B 5CP7B 1QBLL 4HXBH 5HSFA 2DL9A 1T3FB 3VXOA 5JIKA 4DKDC 5F71A 3B3IB 3FB6A 2AS5M 3DX8A 4RISH 5JIPA 1L0XA 2CDGB 3QA3B 3MMEA 1AR1D 2P44B 3O8XC 4Z7WF 4GRWB 4OFKA 2M1KA 1T6WA 5I8EA 2ZUUA 5JNYA 5GRVK 3SO3B 3D87B 4QXUH 3VD7A 3D3VE 3BZDA 1KJ2H 1FN4B 3SKJL 4G6ML 3MJ9A 2Y7QB 2R2BB 3PL6D 3ZKNC 2DBLL 1GIGH 3GGWA 4YX2H 5T3ZH 1OARH 1BM3L 3NCCB 3V6FB 3ABZA 3QXWA 5DGQA 3WLBB 4OLZL 2BOBB 2YZ1A 5CSZB 5IB2B 5E4IA 3S96B 5C3TA 4QXGH 1YMMD 4JEGB 1D7FA 4K7PY 3DO3A 1S9VB 4EDXB 5BXFB 4H8WC 3OKOB 5I16A 1I1YA 2BSTA 3HZVB 2ZPKL 4Y5VC 1J86A 4Q2ZA 5HGDA 5KN5B 5JDSA 1G7JB 1HH6A 3VFSB 2UVEA 1JRHI 3IDMA 1AGCB 3LH2H 3ECBB 4CKVX 3PWUB 2NXYB 4JM2B 3FT4A 3CSBA 1SEQH 1ONQB 3A0OA 4WHCA 4Q9RL 3LKPA 3GJEB 4KXZH 1P69B 1HNFA 4F58H 4XPFL 5J6HA 1QRNB 4GS7C 1KJMA 4OD3H 4I3RH 2XRAL 1FL5B 4Z0BL 3NH7H 4DOHE 3UAJD 2OI9B 5FYLH 4PJIB 3TJHC 4LKCA 1A9EA 5IFJB 1IGCL 1MJ8L 1EEYA 5FUZH 3RX5A 3QUZA 3ARPA 3G5ZB 4QTIH 5EU4A 2BFVL 2MHAA 4X6BB 5AD0B 5MEPB 3NACH 4UNVA 4NRZA 1CWVA 4KTDH 4MVBC 3O11B 4FZ8L 4LARH 4YE4L 4EJ1C 5GQBA 3O3DA 4MDJB 3ILPA 5ETUB 2F54D 3AXLB 25C8L 1JZ3A 4R7NA 2IFFL 3ESVF 4P2OC 3AAZA 1PKQA 3FONB 4QRQB 4IMLA 5F7EH 3VWKD 3GKWH 4R8WL 5T3ZE 3HTLX 4LAJH 2WBWB 1F4AA 2EH8L 3LKNB 4BYHA 4V2CB 5E99H 4FN0A 1FNFA 3O4LA 3TO4C 3QG7H 3HE7D 3VCLB 1LK3L 4WUKH 1T1YA 4KTEH 1BBDH 3QNYB 1HH9A 4ZXBD 1HHIA 3L5XL 1Z6JT 1CICD 2Z8VC 3MX0A 1B6DA 3ORJA 1IGFH 5IVZB 4KJQD 3OV6A 3VXNB 1MCRA 1S9WB 2DQCH 4GBXD 1P84J 1Z9LA 4LLUB 5T5FL 1G7IB 5HI3D 3FQTA 3RTQC 4L4JA 1E4XL 2YRLA 3AREB 1AO7E 2MQ0A 4Z7QE 3TZVA 2H8PA 4RGNC 4R90L 4OZFA 4J3VA 3EKCA 4GOSA 3DRTA 1JFQL 3TA3B 4V2BA 4KV5F 1S3KL 1MFDH 1U8HB 4X6CB 1JL8A 3QEQA 4HKBB 5FYLE 4NZTL 4HBCL 2EC9T 4MA7L 4Y8AA 3UTSA 4PJGE 2BVQA 5KZCB 4XP6H 4KI5C 3ZL4H 1KG0B 1OAKH 4PLJC 4RWYH 3B8SA 3G04B 5D7LA 1UB5A 3VXRD 4OD1L 1OAZH 1XF4B 3NPSC 4UT6L 5MEOA 1MCCA 1NUFA 3FRUA 3CH1A 4P46D 2BSSB 1N64H 4DN4H 1NAKL 1ZT4B 4UBDC 1D9KC 2I25N 3D3VA 3CJJA 3CSYB 3VFOB 4Y4HA 4E5XB 4FFYH 4P9ML 2XYCA 1VA9A 4EN3C 3BJLA 2KZWA 1K2DB 3T2OA 2E6JA 1CQYA 3FO2A 4Q6IA 5JHDD 3VI4F 3QO0B 2KKQA 2PF6A 5IB4B 1CIUA 4XBPA 1AE6L 3OB0K 1LK2A 2W59A 4RX4A 2WLZA 5IIEA 2CLRA 1U8MA 2DMBA 5IQ7H 4ZDHB 2DQJH 1WLHA 4NM8L 3K80A 4DEPC 3WFCH 1WT5C 1A22B 5HYQB 3S5LG 4YHLH 1T83C 3GJFK 4NDMA 3MJ7A 2GSIB 3D85A 4ONFH 4KKLC 6CGTA 4P99A 2NQCA 4PJEF 5D2LF 4LGRB 2DDQH 1WJ3A 4W6YB 4FABL 1UKQA 3KPPB 5AEAA 4MJIB 3L6FB 3N06B 1T5XA 3MNVB 3BH9A 3U0TB 1XGRB 5TDPB 3GSVB 4BJLA 1N5AB 4ODUB 5I66A 4ZFFB 3O6MH 4JLRA 3KPRA 5AWNH 2CLVB 3LIZH 4W4OC 3CFEA 3BQUC 3GB7B 4I3SH 4EIGB 5F7KC 3QQ4B 3VFTB 1IAIH 2OL3L 4X8JA 4LBEB 1SYVB 2SEBB 4XI5C 3WHXB 2MTPA 1IT9H 4FQLL 1KELH 3CIQA 4EI5A 3KJ4B 3P9MA 1EUUA 2YKLL 4HH9B 1RZKL 1MAJA 4LP4A 4ZUUB 4A6YH 1OSZB 1SJXA 3TIDA 1E27B 4LPVA 3PWVB 2GK0A 5CEXB 4ZAKD 2IMMA 3I75B 1CXFA 1A6VL 2GJJA 1BEYH 1FVCA 1OM3L 4BFEA 5CBEB 5BOPA 3C08H 1QFWI 1C1EL 3REWB 1NAMH 1AGBA 1KENH 1FNAA 1DEEB 4G8EA 3SCMD 1TZGL 1LNUA 3UP1A 1UZ8A 3RIAF 4CN4A 1KLUA 2UWEB 3BEWA 1KYOJ 3HS0B 3VRJA 1EGJA 1A9BB 1MCBA 4M5ZL 4F3FB 5C0RH 4IHOB 1IEHA 4M7ZB 1AP2B 1QBAA 3QNXB 1J1XH 3ZT5A 5DJDA 3SO5A 3VMNA 3L5IA 4LLQB 1H3GA 4ZUSB 1YQVH 3GM8A 1MJJB 5KJRL 1F4WH 4MAYD 4UILH 1TJIH 4MDIB 4H25B 3HFML 4JO2L 1G7MB 5HY9B 1EAPA 5C2BL 1R5VA 5D1QC 5D7JA 1J0IA 1R5IA 4YH6A 4C54A 4XGZB 1RZFH 4R97C 2WBJD 1YYMH 4AH2B 3IRZA 4ODWA 1QYGL 4JFQA 1BZ7A 3SN6N 1AO7A 1RUQH 2A83A 4P2QD 5E56A 5EZIL 4ONGL 1YNKL 1AHWA 5JXAH 3QCUH 4GLRI 4MD5A 3UJJL 2VXQL 3RNQB 1RK1B 4M93C 4HIEA 5GXBB 4OKVA 2G5BB 4GAYB 4L4TB 3QUXA 4JDZA 4P3DA 3P4OB 4NQCD 5EIIB 1JIBA 1IRAY 5C0JA 1AGDA 4PJGA 4QCIB 1R5WA 2LU4A 4KUCF 5C0CB 4WW1A 3QUYD 1I9JH 2YPLD 4CADB 3WS6C 1D5IL 4HDIB 5ADOH 2ZCLH 3RVUC 3SE3A 4BA8A 3WHE1 3TYFA 1RUKH 5A16A 4XC1L 5C0EA 4M8QB 3LKSB 1HSBA 1S9YA 2VLLA 4I4WB 3QIWA 4R26L 1PAMA 4HD9A 1X7QB 2I9LB 4LHUA 2MPAL 4RAVB 4QLRA 2VLMD 4AJ0A 4KI5F 4AEFA 3D5OF 4J23A 4HWEH 5INDA 4KVNH 4XWOC 3PJSA 3AB0B 4M6NH 4RRPA 1J1OL 4OM1H 4NQEE 2E3VA 4TOYL 5FUOL 3EGSB 5FYKE 2VL5A 4TQEL 3I3BA 1A2YA 1WFOA 2HMIC 2VDLL 2XTJE 1QRKA 4PLNC 3IXAA 2G60H 1T0PB 3D39E 5ANMA 4JGJA 5C08A 1IM3A 3I6GA 4XNYL 1MJUH 3A6CH 4OZHA 1FFNA 4UOW0 3FJTA 1MFCH 4LSSH 2FZ3B 4KJWC 3NIFE 1G9ML 3HC0B 1BIHA 1TJHH 4LLAA 5IT2H 5E2TL 3NIGF 1AKJA 1A7QL 1KCUH 4XAKD 3V5KB 2AK1H 2VXTH 5HGHB 4ZTPL 3EFDL 3J7HA 3ULVC 4B0MM 1T04A 1H3PL 3WN5C 5E5RB 5BRZB 2DLFL 3ISWA 4NQSB 4Y4KD 3ROLB 3VXMB 1G1CA 5IK3B 3LEYH 2HVKA 3U9PH 3X13A 2F8XC 4D9RD 1MLBA 4HH8A 4XCFL 4JFHE 1G6VK 2Z92B 4PJAB 2FECL 3N1MC 4XRCA 4NJAH 3D2UA 1DBJL 1BIIB 1WZ1H 3SDAC 3PV6B 3TLRA 1XIWA 1QFUH 2DLTA 5ICXA 4DUXA 3MRNB 4WTXA 4CBPA 2FX8L 1I8LC 1YN6B 1P2CB 2R23A 3MV11 4QEGA 1PX3A 2H6PA 5IMOA 3GFUA 4M1CC 4DUVA 2NYYC 5DVKA 1ZANH 3GSRB 1J1PL 3OJDA 4MNGB 3RGVC 1HXMA 4DFIA 4OZGE 3D0LA 5E00A 3SGKA 5JPNB 5FGSA 4Y1AE 4MD4B 2BSED 4HIHA 3FN0L 3U9UB 3QJHA 3KPLA 5F7HA 4U1HA 1F6AB 3KXFD 4JFED 2D0HA 4G6JH 2EYSA 3TN0D 1LO3H 5DTFB 3V6ZB 1II4E 3OJ2C 5JORB 4PJ8C 4MCYA 1P6AB 4IM8A 3IJYB 4WW2A 2Q86A 5A2KH 5D5ME 1JTOA 1ZLWH 2OS7A 4P3WA 3WE6B 2OXHA 4K9EL 1ZEAH 4Y2DC 4WI8A 3I9GH 2WUBL 5DRWA 1JGVL 1EA9C 1GGYA 4ODHH 1NUDA 3OJVC 3QCTL 3ZMRA 3FOLA 3V6OE 1NFDF 2EIDA 2CMRL 4ZQKA 1XCQA 3JV4A 4PD4J 5CZKA 1HIML 1TPXC 4TPRL 5CIPB 1ZA6A 5JXEA 3QXAB 1N3NA 4YDJB 3Q1SL 5EBWB 5IV2B 4FA8A 5CEYA 3FOMB 2V2TB 2JJWA 2ZNWA 3RWFB 4RGOH 3GMOB 4OZ4A 3K4ZA 1VEOA 2DKSA 4OFIA 1Q0YL 5D2NC 5D7IB 3EO1B 4NUJA 2HT4D 1ORSA 1R3IH 4AENB 4D0DB 3U2SA 2EXWC 5BV7B 5C0GB 1C5DB 1I3GL 5CJOL 2NZ9C 1FGNH 3CLFL 5ILTH 1T6VN 2XWJA 3MNWA 2IFGA 4HEPG 5IVXB 3BHBB 4M7LH 4JFPB 3EIFA 4A6YA 1T21A 4P5KA 3P11L 4JFDE 5T1KD 3W2DL 1K8IB 4ZUWB 2DWDA 1H0DB 1XR9B 3PDDA 1OQXA 1HZHL 4I2XE 2AEQH 5BVJA 2JJUA 5E2WH 3R06A 3MOBH 1J0JA 1NAMA 2BVYA 4GXUM 5K93A 2HTKD 1NMBH 5DRZA 5FA4A 1RMFH 4JKPH 1JI2A 4GRMA 3B2VL 2LVCA 1JWUA 2PR4H 5HHVH 5D1XC 4WEMB 1NDMA 3QDAA 3EOBB 3RBSA 5TQ2L 2V17L 4FTVA 1HKLL 2V9RA 4HFWB 1GGCL 4XZUA 1IGYB 3PGCA 3BZ4B 3QIBC 3QZWG 1F58L 1T7WA 1C5BH 1ZTXL 2Y6SC 1HHJA 4WDIB 1VFUA 2GUOA 5H35B 1GGIH 2X42A 3NIDF 1HQRA 1UC6A 3QPXL 1A6ZB 4D2NA 4HJ0D 5IF0B 4BFIB 1JK8A 3TCLB 3HE6A 3RWEA 1KPRB 2PW1B 1XH3B 4M02A 1QSZA 3VH8B 1F8TL 2QR0A 5FF6B 3LPWA 2E9JA 5ACZB 2O26U 2WWKT 4TSBH 1WFUA 1RZGA 5CSBA 1B9ZA 4PRPD 3T2NH 4PRHA 5BW7C 1U8KA 4Q6YA 3D69A 5D1ZA 3W9EA 2A73B 4I0PB 3PQYB 2EDDA 1MNUH 5BS0E 1OTUD 4UB0H 5IB3B 1QLEH 2DIBA 1F3JA 3SJVD 1WFNA 3BO8A 5A2JH 1KIUA 5IJKA 1AD0A 4GMSL 1JWMB 1KPVA 3BPCA 3P77B 4K3HA 5EFIA 3VDAA 3C6SA 5ESAA 3GSUB 1T0MB 3ULVF 1PG7L 5HDOA 4ZD3H 4KZDH 5ICZB 4H0IA 4X0KA 2CRMA 5DJ8A 3IJSB 3U1SH 1CBVL 2W0LA 5F7DB 2X4NB 4OM0H 1SYSB 4F7MB 5F89A 3RL1A 1FNLA 4UQ2A 1T2XA 3JWOH 2XWTA 4OZGA 1T7YA 4P5TA 4UV4L 5FK9B 2NY4B 4NRYB 3RIFK 2CJUH 4QNPF 2FWOA 4JZJA 2DTMH 2NY2C 5DA0B 1RPQA 5TDNB 1CD1A 2D03H 4PJDA 4PY8J 3SGDI 5DJAA 5FHAL 4JPIB 4XHJC 3ARFB 1PYWA 2R1YB 3ZYOA 2PXYA 3CC5A 4PJ7A 3O41B 2EC8A 3RUGB 4R7DA 1QLRB 3KYMA 5I1IH 5I30H 5DDHB 4PJXB 3P4NB 1CI5A 5MERB 3QSKB 2NX5E 2J6EA 4XC3L 4KKNA 1UJ3B 4LFHD 3EDEA 2A74A 1EFXB 4OLEA 1U3HB 5CWSB 4EVNA 4FXLA 4AQOA 3WV0A 4HX1A 2GTWB 4OCLC 3T0WA 4X6FA 4X7DC 3V6OA 4F33B 1W0WA 2EYTA 4KJYA 5EA0L 2FEEL 5DT1H 3L95B 5H8DA 1RIHL 2IAND 1M7DA 1UCBH 3B9KA 3ARGC 1FRGL 2E9BA 3IDXL 1OAYL 4KY1H 3L1OL 5C09B 2NY3D 1ZWIB 5DO2D 4QRPE 5DFVC 2P48B 3MRBB 4MLSA 2H2SC 4RQQA 5HPMA 2W0KA 3LKOA 1AH1A 2VLKD 4ZPVB 5BQ7B 1P7QB 4I9WE 4U1KB 2Y36L 3E2HB 1WCBA 4C57C 5DMKB 4X6EA 1JGLH 4PV8B 3CVIH 1U93B 2Z31C 3WFDL 5IMKB 5I18H 1F2XK 2P8PA 2Q76B 3D3VD 5GGSA 4KQ4L 3AS2A 2MNUA 4N0UE 3OG4B 3FQUB 43CAB 1T20B 2A77L 1AD9A 4HKZB 4I2XA 3GMQA 3P4MB 1WUNT 4OJFH 3FQXB 4RAUA 5CGYD 1L7TH 4OT1L 1UXWB 3EDKA 7FABL 1RU9H 4WU7B 1ORQB 3C5ZB 2BVOA 2GJZB 2ADIB 3ZDZF 1INDL 4NFDA 3V5DB 1W72L 3IXTA 3OX8B 5JPMB 2ZSVA 5GHWH 5GS2D 4F7TB 1PSKH 1DUZB 4FQXC 4KK9D 3GMMB 3QXDB 2YMXL 2XA8L 1S7VB 5K9JL 1NUGA 4KV5E 2J8UF 2AABL 1RJZA 4OCWH 3TPUB 3T65B 1CGWA 3SKOB 2VQ1A 4XPHH 1ES0A 4IIQC 4PR5A 4YFLI 1MQ8A 2RR3A 12E8L 3TVMC 3MYJA 3S5LA 4HV8B 4M9PA 2R4SH 4Z7WA 4K2UH 1CT8A 5DJ0B 2R0WH 2FJHA 1XGQA 5IQ9B 3U82B 1TETL 3FQNB 5I1DA 3H3PH 2NLJA 5F7YC 4MXWL 5DQ9A 3TM6A 3L9RB 1MRDH 4P4KD 4LLYA 3TESA 3O6FA 3FB8A 5BS0A 4RA0C 1Q72H 4EI6A 2I5YH 3S4SB 3T77A 2YS4A 1BREA 5I71C 4R0LC 4MNQA 3ARUA 4NGHH 4JRXE 4UT7L 5FDWB 2ZOLB 3DXAE 2BNRD 2MJWA 1QBMH 2VC2L 3GI9H 1A7RL 4OLWH 1FHGA 3H2WA 1QPPA 3BPOB 2G75B 1CZ8H 2NW2A 4RFNB 5IBLD 3H9YA 4BZ1L 1G6RH 3A67L 3P0YH 2F19L 1TZHA 3RPIB 3GMRB 4G8FB 5GGVY 5JQ6L 2LU3A 3GSNL 3D6GA 2G9HA 2JE8A 2PO6B 1VSCA 1MCPH 4OD2A 5F96L 4M43L 3CX2A 4K55A 2IGFL 2QBWA 5IW1B 4MXVF 4G5ZH 5J7CC 1BQUA 3MV7B 3NFSH 5HHME 4PJCF 3W11D 1RULL 1BD2B 2R9HD 5GGQL 1DQQA 1QVOA 4S1RH 3S3JA 4QXWA 5IGXH 2VRAA 5TF1H 3JTTB 1S7XA 2ADGA 5E8OA 2LAGB 4HS3A 5DEFB 4M7KH 5HVHB 5DQJB 1EAJA 3ARZA 5C7XL 1BLNB 4JO1L 3KS0H 2BVPA 2FJGB 5DK2B 1D6EB 5F1KC 4QHKI 2HRLA 1WWWX 3UTZB 4U6YA 3BKYL 2NX5A 3GI8H 2XA3A 1XT5A 4JB9H 4PGZA 3FO9A 2R8SH 1M1SA 1QACA 4KKBD 3MLRL 4CVXB 4EBQH 4N1HB 4OF0A 1UWEL 4WY7H 3MGOA 3KNBB 4PRNA 5JMRA 1UWXH 2YSSB 2DM7A 2ID5A 1VFAA 2AJXH 5KG9B 3LS5L 3ZO0A 1RIVL 3B5GA 4R96B 2QQKH 3VMPA 4Z7NE 3UDWC 2Q87A 3V52L 1JGEB 2NY7L 4JN2B 3QUXD 1T66D 4JFOB 4QWWC 4QRPA 4G8GA 4ACPA 1YNLL 3HMWH 4U1IA 2WSKA 5E9DA 1JV5B 1NGWB 1N59B 2FD6H 4RFEB 4U4BA 3O6LH 1MRFL 3OMZA 3O3EA 1QFOA 2XFXB 1I3VA 1J8HD 2XG4A 4NQDD 3IS0X 4HQQL 3G5VB 5KSBE 4WFGD 3FT3B 1KIRB 3INUL 3QIWD 1KV3A 1BHGA 1QFWM 5HI5D 1FG2A 5JIHA 4CUCA 2HG5B 2E8ZA 4CN1A 1MFBL 3LV3A 2E5EA 3X12A 4N0UA 2Q20A 4HZAA 7CGTA 1Q1JH 1AGEA 2KH2B 4N0FB 4RWHA 4F2MA 4ZOAA 4PREA 3B5TA 5IKCA 1TNMA 2I60H 1YC8A 4JAMB 3WJLC 1NLDL 5TF0A 1AC6A 1HQ4A 4NHUB 1N2RB 4F80A 4HMEA 4Y4FB 4U7SA 4NRXB 1LE5A 4X80L 3O2VL 3N85L 3IDJA 4GW5A 5ITFA 4WHTA 2PYEE 5DJCB 4PB0H 4S2SA 4KRLB 4QT5B 5KW9L 2VUOA 4OCSL 3IFOB 1XR8A 2R2EB 5MP6H 3BXNA 5EO9B 1BX2B 4DCQB 1S5IH 2VE6B 4DZ8B 3V79C 1NCBL 5JZ7D 3EFFA 2VZ3A 3VGEA 1R24A 4YHYC 3LOWA 4EXKA 4PRBB 5I75B 3BGMA 4U1SB 1KJ3H 2GAZA 1D6VL 1INQA 5JOFB 4ODSH 2KL6A 3O3BB 4RGNE 2DJUA 1TQBC 4G3YL 1MH5A 1AR1C 5K59E 2C3GA 4XPTL 2V7HA 4P57A 5HVFB 5EBMB 2GK2A 2MMXA 1XIWD 2FYYA 3UTTE 4ZUVB 2EC9U 3IJHB 5EIQA 3WFHA 2HT3D 4AG4H 2H1PH 4KI5E 3D0VA 3HLAB 1MAMH 1F90L 3O8XA 4I18C 3U0WH 4H88L 4NNPH 4TTGA 1EEUA 1OCWH 1X44A 3WFEH 3DXAA 3FFDB 4NKIL 1CGVA 3U79A 2YD6A 3T0ED 2MKLC 3GBNH 2EECA 5CCKH 1CE1H 1ZS8B 5I73B 1RK0A 4APQB 3KPNA 3OKNB 3U4BH 4OCYL 3NABL 2Q8AL 4KKCD 3VXPA 1IVLA 1T5WB 5EZOL 4M6OH 5D72L 5KVFL 1KCSH 5LAXB 4IOFD 1A7BA 1OGTB 1BZ9A 3H7LA 2Z91A 2HTLC 4PJEA 4DQOL 3NCJL 5D2LA 5AYQA 1I1RA 1CFNB 5EG6C 4BH7B 3NIGE 3OKYA 3V0AC 2XQYG 1U6AL 3CZJA 4J4PC 1IFHL 5F9DC 1A1MB 2CKBH 2Y06L 4HUVB 1ZGLM 2DTSA 3IB4A 3LCYA 5IHLB 2YWYA 1CYGA 1CLYL 1UB6A 5EORH 5IROC 4HJGA 4JR9L 4MD0A 3QFJD 5CLWA 5DJXA 1CCZA 4Y5VA 2YOCA 1XF5B 2XN9D 1NBZB 3EBAA 3RQ3A 4UT9H 1REIA 4G7VH 4ZFOB 5IHUH 1FL3B 3B4NA 1MIML 1EHLL 4PB9L 4NHCL 4UTAL 3UAJC 15C8H 4DVBB 4BK5A 4TVPH 2WW8A 1A7OH 4N8VG 4PUBH 1LE9A 5SWSE 5TDOA 1P1ZA 3LEVH 4O51B 4XNMB 1I9RL 3OQ3B 4L8BB 3HG1B 4K3EH 5F3HA 1ZLWK 3BKML 3BMVA 2CIIA 4X8XA 1FNHA 3RWGA 4Z78B 3BAEH 3HC3H 1RZKC 4RGMC 3VWKC 4QF1A 1H5BC 4UIKL 3BE1L 1N6UA 4UTBH 5EOQH 4D9LH 2HJLB 1CK0H 3DGGA 4DGVL 3QQ3B 4KUZH 4JFFB 5E94B 4NYLA 3T0VA 5L2KB 3IKCA 2V5SA 1QR1A 1OGAB 5T1DH 2RQ8A 3NCMA 3GJFB 1I7RB 4K7PL 3HE7C 1J10A 1M05B 1QNZL 5C9JB 5I1EL 1G6RA 1MCDA 3QBTB 3D18A 4P2OA 5J12C 3S7GA 3QI9B 4XNZC 4ZXBC 3WUZA 2XZAL 1CICC 4CNIB 3QWOA 1LO0L 4AEEA 2ARJA 4KJQC 1AXTL 2WNGA 4PJHF 3RI5K 1JPFB 1NFDE 4JDVA 5E8NA 3MBEB 1J18A 1IEBA 5JTWA 1WVZA 4GBXC 1S9XB 1IM9A 2BRRL 4NQED 3E8UL 4HPOL 5FYKD 4JPVL 3AROA 1S7SA 1QLFA 3BISA 4RBPK 5CILH 4NN5C 3TO4A 2XTJD 2QADD 3D39D 1K4DB 1I7TA 5B4MD 1DQML 1ND0B 2W9DH 1N8ZA 3CUPB 3MRCB 2X1OA 2ZJSL 2B1AH 4R2GC 4L8DB 5KSAB 3C6LD 3BW9B 5J9PB 3F58L 4PP1D 1FAKT 3PABA 5D1ZD 5AG9A 1UVQB 3ULVH 1K8DB 1IL1B 4HMDA 3TIEA 3QZWA 1FZKB 3RTQA 2VH5L 3CCHA 5KS9B 4JZOB 4DAGL 4U0RB 1VFBB 5FO9A 5HYJB 3X3FH 1X6LA 3BP7A 3ES6B 2MCPL 2HRPH 1T03H 1A14L 3DTXB 3L7EB 4PY7A 3S37L 2EDXA 1C7SA 3S9DB 2P4AB 1KTDA 2J4WL 1CL7I 4Z18A 5JR1H 3A6BH 3KPSE 1FFRA 1S7QA 3L3KA 4OIIL 1RUPL 1XF2A 3IVKA 1IAOA 3VXOB 1G9EA 3MGTB 3FB6B 1MF2L 3DX8B 2EDFA 1ZSDB 4KVCL 3MMEB 3MACH 2NY6B 3V4UH 4QHMA 4CL7A 4K3DH 1I1FA 3WIFB 2OJZL 4P48A 5I8EB 2DRUA 5JNYB 3IDNA 4JFXA 3X17A 2CR6A 5DRNA 1D9KA 3OJMB 4V1DE 4Y1AD 2CKNA 3HKFA 1RAMA 2CXGA 3NIDE 4EN3A 4U6TA 2H3NA 1LP9E 4R6UA 1EPFA 2PXYD 4RAHA 2BOCA 4NO2A 3V0VA 4UNTA 4WUUD 1URLA 3OWEA 4NC2B 3PG2A 3QQNA 2DIJA 2RCSH 4ODVL 1KCRH 2DQUH 1CLOL 4LSVH 2JB5H 1WT5A 3S34H 3KPTA 1LO4H 4LPYA 3MCLH 1TVDA 1T83A 5B38A 1Z9OA 2EDNA 5I16B 1I1YB 2BSTB 2IAMB 5DD6A 4Y5XC 5FIEA 3HI1A 5CUSH 4D9QD 2VDRH 1UXSA 1KGCD 5D93B 1ACZA 4ZO7A 1EO8H 4Q2ZB 5HGDB 3RWJA 3BUYA 1G9MC 4GG8A 5JDSB 2ZUYA 4O4YH 4W70A 1HH6B 4UU9A 1JPTH 2HKHL 1SY6L 3IDMB 5JDJA 4XB7A 4YFEA 4JO4L 3FT4B 5SWZA 4H1LB 1TZIA 1YEKL 1KEML 3LKPB 2UZYB 1VGKB 3DSFL 4W4OA 3QDGB 3BQUA 4YDIH 2D7PA 4ZAKC 4JRYD 5L6YL 5J6HB 1KJMB 1VKXB 4UV7L 5DD3L 3MA7A 3JUZA 3DX9A 1TTGA 4QNPE 3VFNA 3MZTA 4JO3L 4LKCB 1A9EB 2N1KA 4HS6A 5FCUL 4ENED 1P4BH 1EEYB 4FZEL 3ARWA 3QUZB 3SCMC 2QQNH 2H2PD 2IADA 4YHKH 1ZHBA 4JFDD 3BESR 5EU4B 2MHAB 1DVFC 1CDYA 1P5VA 1CN4A 2XZCL 4NRZB 3VFVA 4L3AA 1SM3H 3KPOB 4EOWH 5FYKL 2VKWA 3BWAA 1T0NB 4GRLA 3L5JA 3O3DB 3VXQA 3ILPB 1RZ8A 1F45A 3MRJA 1PKQB 4LVHB 5K33A 4IMLB 1QR4A 3H9SE 2EH7L 4HUWA 1ZV5A 3T0AA 4GAJL 3VFUB 4OLYH 5DQDL 3TH4T 4MAYC 3UJTH 3BIBX 2NR6D 4FQQB 4YHMH 1IBGH 3PHOB 1P4IH 2A9MH 1NFDA 2X09A 5CFHA 4Z8FH 4QGYA 1DBBL 3O4LB 5D7SH 3SPVA 3RGHA 2CKBA 4ZO9A 2B0SH 4ZSOE 3OF6A 1U3YA 2WBJC 4K9EC 4BZYA 4I48A 1T1YB 4RA3A 1HHIB 5BO1H 3Q48A 4GG6E 3SE9L 3UYRL 5E2VH 3W9DA 5DMYA 4ORZC 2FNBA 5F9JA 2ZSWA 1AY1L 2FBJL 4E41E 5D1QA 4YHIA 3MV9D 1I8MA 2DQHH 3SO3C 4ONHA 3VG0L 1GJIA 1U9KA 3IF1A 5AYUH 2VISA 1CLZL 5C0FA 2O93L 3T0BA 1UYWL 3FQTB 4X4XB 3W5MA 3TZVB 5D2NE 2H8PB 1R3LB 3QUYC 1JNJA 4DGYH 3DRTB 2A0LD 2GFBA 2FX7L 4NN6B 4PG9A 3GK8L 4WI6A 3MLXL 1T7ZA 1MWAL 4FP8L 3QEQB 1FORH 3IFNH 2Q7NA 3PUCA 4HKXA 4XNUH 3UTSB 3VXTA 5CJ5A 1UCTA 3ZDZE 3IAQA 1MFAH 3SGJC 4FG6C 2C4XA 2X9XA 1ACYL 2B1HH 5D7LB 1JGUL 5F9WC 4WI3A 3WS6A 3UZVB 1NLBH 2ZCKL 3CH1B 5KTEH 3HRPA 4QHNA 1B4JH 3V4PL 3DWTA 2Z0BA 4O9HL 3WNMA 1DDHA 3T4AA 4Y4HB 4V1DA 2NXYC 1BJMA 4HLJA 4MSWA 4OV5A 1PVHA 3FO2B 4ODTL 4Q6IB 3IAGC 2JIXD 3AY4A 4M03A 5GRVL 4TUKL 1YJDL 4XBPB 3PWPE 2DQTH 5IIEB 5SX4H 2CLRB 1U8MB 2AJZA 3CZFA 4G9FA 1KC5H 4JREB 3BKJL 4XVTH 1RVFL 4XPGH 5ITBH 3H42H 2VDKH 4NDMB 3MJ7B 4Y4KC 3V0WL 3D85B 1EFQA 2YRPA 1IC7L 4LGSB 5IFAL 1A3LH 2EDWA 5DJ2A 3OL2A 3V5HB 3E6FA 2IQAA 1T5XB 1IILE 1OTSD 4M7JL 3BH9B 5EH1A 3ZYJA 5I1GH 1R3HA 3WO3B 5FOJA 5I66B 3WN5A 4XBEL 3OR6A 1KEGH 2VMFA 1U2HA 1XF3A 3OZ9L 5ACMA 4JLRB 4EUPB 4NKQB 3KPRB 5TJWK 4UDTA 1YY8A 5DR5L 4HUNB 1G84A 5CD5C 3CFEB 4Z7VF 2VLRE 4H20H 3RAJL 2GIYA 1VPOL 4X8JB 4UINL 3QEHA 1F4YL 3K8LA 1FBIH 1QKZH 3SDAA 5FECA 1P9MC 5CJXC 1SJEA 5FYKU 4EI5B 3P9MB 4PJCE 2CGRH 1I7ZA 1HK6A 3KYKL 1UT9A 2GTZA 1I8LA 5CINH 3TIDB 3FHQA 2GK0B 3F7VA 3TN0C 1FVCB 1WK0A 4OCNC 3HPLA 5HYIA 1WEJL 5F70A 1ADQL 3STZA 5E5MA 3RGVA 3VGFA 3V8OA 1AGBB 3TBVB 3UYOD 2EICA 3VMOA 1KJ2B 3R8QA 2ED9A 4XT1C 1CTOA 5GISH 1LNUB 3H9SA 1UZ8B 1OT1A 1KLUB 3BEWB 4B7IA 1S9KC 3TH2T 3VRJB 1BJ1H 3R1GL 4PJ8A 3O3AA 1K85A 4N5ED 5GGRA 3CFBA 1LO2H 4Y16D 1F2QA 4YZFE 5DJDB 3S88L 4Y2DA 2ICWB 4ZSOA 4N5UA 1UA6L 1QSEE 2AEPL 2AJUH 4POUB 3EYFA 2ZKHH 4YK4B 3GBML 1MY5A 1K6QL 2YBRA 2C7UA 1WV7T 1MCWM 1TCRA 1EAPB 2BNQE 1CDHA 2PCPB 2VIRB 2ATKA 3MCG1 1MVUB 1R5VB 4PTUA 2J8OA 2HT4C 5H2BA 5IHZA 3AU1B 5D7JB 1R5IB 5GGTH 5C0AE 2EKSA 2W65A 1ZMYA 3VWJB 2NY0D 2Z4QA 3S35X 1DP0A 1UH2A 4ODWB 5DF0A 3WMSA 1DSFH 5EU5B 3VGAC 1BZ7B 1FZMA 2B5IC 1AO7B 2A83B 2R2CA 3S36X 1C5CH 3EZ8A 1AHWB 3W81A 5DK3A 1QBLH 5D2NA 4ISVA 1CVSC 4MD5B 4TNWK 3T2QA 2B4CL 2X7LA 4HIEB 3HMXA 3OAYK 3KWWA 4JRXD 4OKVB 3STLA 4IJ3C 3KHQA 3LN4A 3MUJA 3DXAD 3BPLC 4JDZB 4P3DB 5BZDA 2HTKC 1I1CA 3PP3K 5A2IH 4N0CD 1R5WB 3C87A 5GIRA 1JF1A 4WW1B 3P0VL 2ESVB 3SKJH 4G6MH 2EIZA 1RJYA 1NGXA 1MHPL 2DBLH 5A1AA 3L3HA 4ZFOL 4GKOA 1BM3H 5A16B 3TYFB 4LVNB 4OLZH 5C0EB 1TQCB 1ZOXA 2VLLB 1V3LA 3GMPA 3MSPA 1ZE3C 2J8UA 2P5EB 4LHUB 3CPLA 3F8UB 1CR9L 3E0GA 2AXHA 4J8RA 5INDB 1A6WL 4HJ0C 3K7UA 3PJSB 5D1XA 5DMIH 1UJTA 3VG9B 1C7TA 1A2YB 3PWPA 2VJXA 1G0DA 4X9HA 3TV3L 2ZPKH 4JKLA 3SGEI 1F4HA 3QIBA 3GIZL 3IXAB 3UYPA 2VXSL 5ANMB 5FV1L 4YBLB 5C08B 1IM3B 1J5OL 1T1WA 3I6GB 4OZHB 2EDYA 2J3SA 1EJOH 4OB5L 2DM2A 3BT2L 4KH2A 4UMGA 1JYXA 4Z7UE 1AKJB 5ISZE 2OQJB 4LPUA 1FE8L 1YECH 3H7BB 3QISA 3QO1A 4K3JL 5BW7A 3QIUB 1T04B 1WZKA 4L4VA 4PJIF 4XNXL 3UTQA 2XRAH 2JELH 4D0BA 3SOBL 2WM0A 3LQAL 2HVKB 3X13B 2AK4B 2YK1H 3MV8E 2X9YA 5EZLB 1IEAB 1IGCH 1MJ8H 5C0BE 1N6QH 2VLRA 3QRGL 3EDDA 2D0GA 1JF6A 3GSQA 3VXSE 4JQIL 4XRCB 3ZKXB 3D2UB 4I5BA 1MPAL 4N8VA 2BFVH 4OFYA 5AZ2H 3BMWA 3HI6L 1Q8MA 3MRLA 4HBQA 5ICXB 4C55A 4XAWL 4K23L 4JJHA 2O61A 4YE4H 4PJCA 3HR6A 2YXMA 2AXFA 2Q8BL 3WDIA 25C8H 1DZBA 4WO4D 2IFFH 3FFCB 1J0YA 2H6PB 5IMOB 1ETZA 2VSCA 4R8WH 4Q0XH 2X89A 2YD9A 1HXMB 2RB8A 2IALA 3D0LB 5E00B 4KWUA 1HOCA 2X4PA 2W60A 5FGBC 2EH8H 2NY1D 3RZCD 5JW4R 3L3DB 1MI5E 2B2XL 4HWBL 3QJHB 3BX7C 1IKNC 3I3EA 2W1NA 4U1HB 3QNZA 4LCWE 2F53A 1IGTA 2EYSB 5GRJL 3W0WA 5F1IB 2XT1B 4YIQB 4WV1C 1SJVA 4CAGA 1L4IA 4MCYB 4TRPL 5F88B 2PYED 5CD3B 4N0RA 2Q86B 4QRRA 1H3WM 4P5MA 5DVMA 5D70L 4LVOC 4JY4A 1Z9SA 1AXIB 5DRWB 4MXQD 3DYMA 3WS3A 2PUQT 4MHHI 5DGRA 5T5FH 3ROOA 2NY3C 3PF2A 5DO2C 5KVDL 4XP5L 3FOLB 5HYEA 1WAAF 4ZQKB 1XCQB 3THML 2BNQA 2ZZUT 4YR6A 4X98A 3U6RB 4R90H 4OUOA 1A6PA 1JHLL 4NN7C 1ZA6B 3H9HA 1JFQH 1S3KH 5CEYB 4L3EA 4PRIA 1YEHH 2P5WB 1HHKB 3BKCL 4M48L 3UTTD 4TUJB 4NZTH 3BDYH 4HBCH 4MA7H 1I9IL 3MLYL 3RY6C 1AFVL 1NBVL 4FQJL 4KI5D 3WIHL 3U2SB 4LSQL 5CEZD 1YPZF 3P2TA 1LD9B 1BQLL 4PJHE 4OD1H 4U7KA 4DK6A 5E08L 4UT6H 2R0LL 5CGYC 4JDTL 3MNWB 2GSGA 1NSNL 2Z31A 1NAKH 5IVOA 3KPMA 4CDHA 4A6YB 4P5KB 4KXZI 4YPJA 4DUWA 1GAFL 4P9MH 3VA6A 2M2DA 2VABA 1LO5B 2DQIH 2DWDB 3T3PE 1A3RL 4KK9C 4P2YA 5BVJB 1RZ7L 1ZHNA 5JUEL 1NAMB 1AE6H 1JNHA 5E6ZA 5TE6L 4LCCC 4NT6A 2CK0L 4NM8H 4U1GB 4GRMB 3VXUE 4U7MA 1NDMB 2XXCB 4LDEB 5DI8A 2E7MA 4FTVB 2WUCL 4TUOB 4XP4H 1HEZA 4FQXA 4NC0B 4XZUB 3NCEB 4FFVD 3TC9A 4FABH 5I8OL 3LKRA 4LEXL 5FGCE 5A43C 1IE5A 1J87A 3OAUH 1V8HA 1HHJB 3EO9L 1QHOA 1G7QA 1BWWA 1HQRB 1N4XL 2WP3T 3MQIA 4P4KC 3CXHK 1JK8B 3ESUF 3MRGA 4D94A 1L7IL 3HE6B 4GSDL 3RWEB 4IIQA 3BRGC 2X1WL 1CXKA 3TVMA 2QR0B 4KJPD 4GW1A 4U1JA 5C71A 3Q5OA 3CLEL 5SWSD 5GGTA 1RZGB 5JW4N 5ISZA 1CE6A 4LF3A 4PRHB 1U8KB 3D69B 3W9EB 3QDJE 2OL3H 4KZEL 2AERT 4HJJH 4YPGA 3G6DL 5F1OB 3BH8A 4FQLH 5IBLC 4PLOB 5JW5A 3BO8B 3BWUC 1AD0B 1RZKH 3OPZL 3B8YA 2I07B 2HFFA 4R0LA 1KPVB 4Y8DC 1OT2A 4P2RA 5EFIB 3VXSA 3NCBB 3C6SB 1CD8A 4POYA 4JG1L 4HIJA 1A6VH 1OM3H 2LQRA 4H0GA 4NSKA 4WHYG 2Y5TA 4GRLD 4FQHA 1C1EH 4LAQH 1YMME 3W11C 5DJ8B 2C3VA 2UWEF 4X7CC 5HGGS 1TZGH 2R15A 5F89B 3RL1B 3W5NA 3U7YL 4XXCC 4P9HL 2XWTB 4OZGB 4BQ8A 4P5TB 1NCCL 3KJ6L 2FWOB 4JZJB 3RWCB 4JVUA 5E8EB 4M61A 3DBXA 1MI5A 2B8OT 3ZYIA 4PJDB 3EYUL 2PYFA 5DJAB 4N9GA 3ZE2F 4LCWA 2ED7A 3SE4C 1PYWB 3CC5B 4KKBC 3MUZ1 5K9KA 5KJRH 4JPKL 4PJ7B 3TFKD 3HFMH 4JO2H 4R7DB 3RU8L 5C2BH 2D3VA 3WUWG 3QH3B 2MQCA 4PPTA 2A74B 3K1DA 4KGJA 4ZTOL 3WO4B 1QYGH 1T66C 2GJ6B 4HX1B 1PZ5A 3AGVA 2IWGA 2YA0A 4X6FB 2PW2A 4PJFB 1W0WB 5EZIH 4OGYL 5CEZL 2EYTB 4ONGH 5LG1A 1YNKH 4KJYB 4XVJH 2A6DA 4MJ4A 3UJJH 5CZVH 1M7DB 1T4KA 3B9KB 5DVLA 2Q6WA 3UDWA 4BQ6A 2C5DC 1INEL 1ZT1B 2YZ8A 4F37K 5HI5C 3KPSD 1P7HL 2I24N 4RQQB 2XQYK 5HPMB 1CGSL 1LEGA 4K94L 3LKOB 1MHCA 3GNML 2YHGA 3T0XA 2NZIA 1NKRA 4PJHA 3MNZA 1TTFA 4G6FD 5DC0A 1D5IH 4I3GA 1WCBB 2O5ZL 4LRNL 4X6EB 3F6IA 1GSMA 4OI7A 1S7RA 5HHOE 3QJFA 3O2DL 5KOVC 4XC1H 1B0RA 2P8PB 3TO2A 1DQTA 2QEJA 1K4CA 3NGBC 4HIXH 4R26H 5GGSB 1B0GA 3MRDA 3R0MA 2MPAH 1XGPB 2UZIL 1IAII 3HNVL 4QRTA 5E4EC 5J11C 2VDPL 1BFTA 1R3JA 3HNSH 5B8CC 4I2XB 2X2YA 1J1OH 3QHZL 4RAUB 4BH8A 1AGFA 5B39B 4TOYH 5FUOH 3NN8A 4UQ3A 4I0PC 4TQEH 4YFDB 2BVOB 2HT2D 3WJLA 5E0QA 3SHSA 5JZ7C 2RJMA 3RX8A 4JVPA 3VXUA 1AI1H 4F57L 2DN7A 3IXTB 4U1LA 5DVNA 1NC2D 2ZSVB 2DI9A 4XNYH 1J8KA 3GKZA 4P2CG 4R4FH 1U58A 4U05A 4HCRL 5TE7L 3QPQD 5I1LA 2VR5A 1G9MH 1KTRL 1ZA3B 5IB5A 5E2TH 5J6GA 4HXBL 1JBJA 2A1WL 4ZTPH 3EFDH 3PWLA 2VQ1B 3GMNA 1H3PH 2DWEA 3VGDA 1YEGH 2FDBP 4PR5B 2HT3C 2NXZD 3S5LB 1BGXL 4J3WA 1NCNA 1F3DJ 3VXRE 3QHTC 4G80A 3KYNA 4Z7WB 1CT8B 3I6KA 4XCFH 1KJ2L 5I1DB 2NLJB 1KB9K 3VFRA 2Q3ZA 5J06A 1GIGL 1DBJH 3T0EC 2R1XB 5DQ9B 1XEDA 3K74B 1OARL 1FDLL 3O6FB 5FAAA 3PWJA 3FB8B 5BS0B 1TIUA 4KKCC 4ZO8A 1UACL 3QUML 5L88L 2FX8H 2X6MA 4Y0GA 2EDQA 4MNQB 3DVIA 4NQXA 4IOFC 43C9A 1NMCB 2YUZA 1Q38A 1EUTA 2KUTA 4I18A 4PJ9D 4G43A 1U8LA 4JVWA 1J1PH 5GS1C 4HULB 2NW2B 1YMMA 4RMQA 3FN0H 1TZHB 1NPUA 1EZVX 3TBTA 1LEIA 3DGCR 2G9HB 3OXSB 4OD2B 3OXRA 2ED8A 4L29B 4J4PA 5L0QB 4P49A 1YEJH 1XAUA 4K9EH 1DQQB 1QVOB 3CMOL 5IROA 2X44D 1S7XB 1BFSA 1NKOA 3SKMA 3WL9A 2FL5A 2C1PB 3G6AA 1MCNA 5L9DL 5DUPL 3E2HC 5DSCA 1AR2A 2BVPB 2A6KA 2CMRH 3GZKA 1TJGL 1BOGA 1HIMH 4E41D 1FLRL 1SBBA 1V7NH 2P5WD 5FUZL 2NX5B 3CDYA 3REVA 4AM0A 2NTFB 1FYTE 3IGAA 4CN6A 3FO9B 5FB8B 4YHPA 5IFHL 4QTIL 3B9DA 3Q1SH 5D7IF 1CXIA 3MGOB 3BZEA 4GMTH 4PRNB 4C56D 4Z7QF 3U48A 1TVBA 3RX7A 1JYWA 1B2WH 2OL3A 4HS8L 1E4KC 4DZBA 1I3GH 1V05A 2WK2A 5CJOH 5F7EL 3GKWL 3GEWB 3CLFH 2P24A 3LRSA 1MIEL 2F54A 2KPNA 4QRPB 2YWZA 5HD8C 3CVHL 4G8GB 2AXGA 4U1MA 4U1IB 3VWKA 5IM7A 5E9DB 1H5BA 5E99L 5F1SA 1KB5L 3P11H 4AIZA 1DBML 4G6KH 3X11A 1N6VA 3W2DH 3N1PC 3O3EB 3PDOA 3CFCH 2VLJB 3K3QA 2R0KL 1HZHH 1IQDA 4GKZA 4LFHG 4PJBF 3C8HA 1SHMA 3VFWA 1FG2B 1NCDH 5E6IB 2XTJC 1A02N 2QADC 3LV3B 4ZXBA 4N0UB 4Y19B 4OUUA 4WHYH 5I2IA 1OLLA 5B4MC 5DEGA 4S11A 4PRDA 4HUKB 4X5LA 1UM4H 2J5LC 4F2MB 3SQBA 4BQBA 4PREB 1GGTA 5TQ2H 5IKCB 2V17H 1FPTL 1HKLH 1BJ8A 4ELME 4PP2A 3WBDA 3C6LC 3PWPD 3QAZB 4PP1C 4Z0XB 4RMRA 5SX5K 1YY9D 1HQ4B 2FHCA 3PXHA 3Q5YA 1F58H 3ARDD 1JHKL 1ZTXH 3C2SA 1I7UA 1LE5B 3IDJB 4GW5B 5ITFB 5GJTH 4WHTB 4X5XB 5INCB 4S2SB 4CRPA 1E4JA 4NC1C 1MFDL 3EO0A 4GRWE 1BBJA 3E3QC 1KACB 1KTLB 1XR8B 4GKSA 1SVZA 1F8TH 3BXNB 4HAGA 4ORGB 1CGUA 4LIQL 3BPOC 5BVPL 5LGHL 1FGVL 4RWYL 1SVCP 1R24B 4MYWB 4NQCE 1OAZL 4U31A 1NEZG 4HG4K 3BGMB 1LWRA 2DKUA 1A0QH 2GAZB 5C6WH 2Z8SA 5IHBA 5EZJB 3ALPA 2CR3A 3VXRA 2V7HB 4GMSH 3PWNA 1LEKA 3IRPX 1KOAA 4OFYD 2W0PA 4QKXB 5EUOF 2FYYB 4EIZC 1PG7H 3WFHB 3QWRD 3D0VB 5DLML 5DRXA 3VI3F 3TGXA 3O8XB 3F12B 4U6VL 1CBVH 3P0GB 3AS3A 1HSAA 2X89D 3FCTB 1GZQA 1VERA 3VW3L 1QD0A 1GL4B 3SDDD 1RK0B 3KPNB 4UV4H 2LVEA 4WTZG 2KQNA 4P3CL 2FX9L 2DDQL 4FQ2H 2APVA 3VGGA 1BZ9B 5FHAH 2Z91B 4F7EB 1N26A 4PJEB 5D2LB 1QRNE 2FJFA 1YJDC 4HF5L 4WWKB 1SJHA 4TNVF 5EU7E 3E1F1 3K2UL 4WW2F 3C60B 5F8RC 3O6ML 3MLZL 5HHMB 4PJIE 3MRFA 4KFZC 3CDGA 5AWNL 2MKWA 1EBAA 4HJGB 4MD0B 1QSED 5DJXB 2FEDD 1FJ1A 3MJGX 3FMGL 4Y5XA 4JFYA 4Z7VA 2CSPA 2FIKB 1JNNH 2BNQD 4B7LA 2VDML 4M4PA 4WI5A 1EIBA 4X4YB 2DQEH 5JMOC 5C0AD 2WIMA 5EA0H 1RIHH 3RDTD 4TTDD 2DM3A 1UM6H 3TBWA 4ENEC 1FRGH 4I8DA 1M4KA 3IDXH 1LE9B 2H2PC 3L1OH 3C08L 1DTUA 4N0YL 2H2SD 1P1ZB 2LFGA 3CD4A 2ILLA 5J1SC 4G8IA 3KYOB 4MJ2A 4ZAKA 4X6DF 1QTYT 3L3IB 3OR7A 4EDWL 4HUMB 2LU7A 2Y36H 3RWGB 2D4DA 3P73A 2CUIA 4KKAD 3WFDH 4NM4L 4NP4L 3SCMA 5D71H 4QF1B 4JFEE 5KVEL 1AIFA 4KQ4H 2XWBA 1SBSL 1DANT 3DGGB 4OAWA 3BP4A 3M17B 1DVFA 1T1ZA 4HUUA 4KMTL 3NVQA 4D8PA 1QR1B 2EYRA 4UILL 1TJIL 5LKNA 4OT1H 5IEKA 4G9DA 1G6RB 3P9LB 2DD8H 3HI5H 4P2OB 3D18B 4QOKD 3V7MA 4AL8L 4BUHA 7FABH 5D9SA 1A1OA 4MAYA 1U91A 3QEUA 3MA9L 4CJ1A 2ARJB 3JV6A 3LQMA 1W72H 1WAAE 4JG0H 3VJ6A 5E8NB 5JW3L 1IM9B 3Q6FA 4X6CE 1S7SB 4I0KA 4LRIC 1CDIA 3HZMA 3TO4B 4JHAL 1RUQL 2YMXH 2WBJA 5K9JH 5IBTL 5JXAL 1I7TB 2AABH 1JVKA 1FSKC 4JE4B 1OAQL 5T1LD 3EOAA 1XGUA 4QGTA 3RL2A 3TVMD 2X4RA 1YPZE 2OX5A 4OZIF 2A0LC 3ULUD 2R4RH 2OSLB 3H8NA 5FKPA 3SKNA 1NMAL 5ISZD 5I73C 4APQC 1A4JA 3GSXB 4O00A 1GC1L 3QZWB 3TIEB 4KRPB 2Y7QA 3RTQB 4NQCA 3CCHB 4XP9L 3ARBD 5IMMA 3MRMA 5HGBA 1OF2A 4NOBA 3WCYA 4NZUL 4KDVA 4RGNB 5MENB 3BP7B 4H0HB 3QUYA 4UDUB 3MV8D 1U3JA 5C0BD 2YPLA 3CFJA 4PY7B 4WU5A 2B4CC 5IB2A 3S96A 4UT7H 1KTDB 3W82A 2VC2H 1S7QB 1IZJA 1O7SA 1XF2B 1S9VA 5BXFA 1IAOB 5JLZA 3IVKB 3SGJA 4OM1L 1KIQA 3FQWA 4BZ1H 3R0NA 2LAAA 2W9LA 1T7XA 3A67H 4QHMB 4F7CA 3M8OL 4MMXC 2F19H 1I1FB 4MJIE 3NPSB 5FA3A 3UZQA 3IFLL 3B9VA 5JQ6H 1G7JA 4ZS7H 3GSNH 3IDNB 4JFXB 3AMKA 3VFSA 5FM5O 2XACC 5DRNB 3MUY1 5F96H 1D9KB 1S8DA 1MFCL 4GJTB 4LSSL 2IGFH 3PWUA 1KFAL 5EBGA 4MA1C 1TJHL 4EN3B 2H3NB 4OLXH 1RULH 2ICES 5GGQH 3MCKB 2BOCB 2AK1L 2DYPD 3V0VB 5J4MA 1G7HA 2J2ZA 5HGAA 3D25A 2X4OA 3MYZA 4YDVB 5C7XH 4OZFH 4DEPB 3DOSA 1MSPA 5D5MF 4JO1H 3LEYL 4PJIA 2EIBA 4Y4KA 2AV1B 5DD6B 3BKYH 4AMKL 3SJVE 3HI1B 3N1GC 3MUHL 1WZ1L 5C6PB 3MLRH 1EMTL 4RMWA 1I85C 4GG8B 1UWEH 3WNNA 1A4KA 1BFOB 3BOVA 2XI9A 4LCYB 5LWYH 4LLVA 3NOIA 1U8NA 4WFHD 3AXLA 3LS5H 2NMSA 3O81A 1DCLA 2I9TA 5SWZB 3LMJL 2BX5A 3V52H 1Q9OA 5E2UL 2NY7H 3LQAC 5CHNA 2UWEE 3WUWA 2R69L 4QWWD 3BQUB 1Y18A 1BF8A 1KXTB 5ID0B 4YAQB 3HAEG 5F72S 3MA7B 1MRFH 4LDOB 5C0IA 4XMPH 5J3HD 2UVFA 1P9MA 1M6OA 3B5HA 3DX9B 5E6ID 3VCLA 1JZ7A 5CJXA 2I26N 3VFNB 1FLTX 1P7KB 4NO3A 4HS6B 2IPTL 5J13C 4HQQH 2F5AL 1MUJA 3ZE2E 1ZHBB 3KXFA 4JFEA 3VXNA 4NO0D 3TN0A 1S9WA 1MFBH 1ZEAL 1U8IA 2BP3A 3VFVB 3LKQA 5KSAC 5GS2H 1RZIA 4M62L 3I9GL 2AVGA 3BWAB 2V5MA 9CGTA 4N5EC 3VXQB 2RAMA 4Y16C 1RUML 2BERA 4XP1L 5IOPA 3FKUS 3MBXL 1G7IA 4S0TD 3MRJB 1K9TA 3MREB 5ENWB 1DLHA 4U6HA 4ZFZA 1NLDH 4HUWB 4NJ9H 4OIAA 3OKKB 2FGWH 1JNLL 3VXUD 1GOGA 4U49A 1Z2KA 3O2VH 3N85H 1WAAA 1NFDB 4KK8D 3RWIA 4YHZL 1PW3A 3QT2A 3ULUL 5KW9H 4OCSH 1U8HA 3SPVB 2CKBB 3WJJC 4FRWA 4HKBA 4OGZA 2IANE 2M8XA 3MOQA 1G7LA 3UO1L 3EW3B 5C0CE 3MODL 4HPYL 4WNQB 3W9DB 4RDQF 1FGNL 1XF4A 3DECA 1MREL 2FBOJ 5F9JB 2X70A 2ZSWB 1D6VH 2VLKE 3ZT6A 3QG6A 3KLHC 1YPZA 4KRNA 4YHIB 1BF2A 5D1QB 1I8MB 4G3YH 4ONHB 4R97B 5DURB 2VISB 5DJ6A 5C0FB 3VFOA 3QDJD 4QHUB 1I9EA 4IRJD 1UM5L 4N0CC 1K2DA 1IJ9A 3WFZA 1BVKA 2D7OA 2ITDA 5T1KA 3NFPA 5E2WL 4WFEE 5GS0D 35C8L 5IB4A 1JCKA 3HC4H 4M93B 4WI9A 5C0ND 4HG4J 4EXPX 3GUTB 2JF1A 4PG9B 1F90H 3QDMD 4ZDHA 1EGJH 1QSFB 4H88H 4Z95H 1WBXA 3TJEL 1EZVY 4HKXB 5ELIA 4NKIH 3VXTB 2Z8WC 3LZFH 1PG7X 4AT6A 4OQ1A 2GSIA 2IAMC 3EOTL 4DTGH 4OCYH 3NABH 2Q8AH 5EU6B 5EZOH 1MELA 1N0LA 5D72H 4MQXD 1C5BL 3L6FA 1IAIM 3K8MA 2F58L 2HTLD 4DQOH 1BAFL 3NCJH 3U0TA 1MCOH 1N5AA 1DDHB 2IPUK 4JGMA 4ODUA 4V1DB 3S4SG 1U6AH 4J4PD 3TT1H 5CP3A 3V6BR 4BSWA 4DKEL 4ZFFA 1IFHH 3VXME 2Y06H 4OV5B 4AIOA 1CLYH 1P5UA 1YEIL 1EEQA 1Z3GL 2RFXA 4JR9H 1W72A 1L6ZA 5JO5B 4PJAE 5DYOA 3VFTA 1G7PA 1SYVA 2AJZB 3CZFB 4G9FB 4M1GL 1MNUL 3QXTA 4PRPA 4NQUA 1MIMH 2VYRE 4HH9A 1EHLH 4PB9H 5LXGH 3B6SA 4NHCH 4WI2A 1Z0NA 4UTAH 5I19L 2APXA 3MRRB 3CFKA 4RMSA 3SJVA 3SDCD 4Y7MA 5J57B 3ARXA 3E6FB 3KG5A 4MNGE 2IQAB 4KZDL 5I6XB 4KQ3L 2BNRE 3CH8A 4Z77A 1R3HB 1XGTA 3WN5B 3MRKA 3OR6B 1XF3B 3BKMH 1LDPL 2BRQA 1DFBL 2F74B 2HH0H 2UWEA 1BQSA 2MCG1 4WO4C 3G6JF 2ZUQC 5L7XL 2PTTA 3FO1B 1KLFA 1X4XA 1W0YT 4UIKH 3BE1H 2AJ3B 4IHOA 1PG7W 3SDAB 1ZVSA 3QNXA 1A1NA 4DGVH 2JCCB 4LNRA 2HVJA 1SJEB 3WNLA 2NY1C 4CMMA 3RZCC 3QHFL 2YUVA 1JPST 1I7ZB 1ODAA 4YHNB 5HHOD 2GTZB 4K7PH 4C59B 4MDIA 5D6CB 1QNZH 2YD5A 4H25A 5AG8A 4WCYL 1FVEA 5HY9A 1BP3B 3HPLB 2YXFA 4HGKC 5E5MB 3STZB 4JQXC 3RGVB 2CUMA 3GSNA 1UZ6E 4P9HC 1AXTH 1S5HA 5C2UB 1A7NL 5FGBA 3KYAA 2VN7A 3E8UH 4HPOH 4JPVH 4XPAH 1IKNA 4MXQC 3H9SB 5DD5H 4S1QL 5D7IE 4D3CH 4WV1A 5DT1L 4PJ8B 2IBZX 1DQMH 1UCBL 5IR1A 4XH2A 5GGRB 3KLDA 4KAQL 2ZJSH 4R2GD 4Y2DB 3CU1A 4ZSOB 1HDMA 5JW4M 4PRAA 2IANA 3WD5H 5IVXE 1F11A 3F58H 4QHKJ 3WFBH 5TGBA 2X9WA 5JIIA 2YBRB 5C0CA 2C7UB 3RHWF 4TN9A 1TCRB 5ESVA 4AY0A 2HWZH 2FATH 4DAGH 4PTUB 5GS0L 4HXAL 4YDKL 4P23D 5H2BB 5IHZB 3CVIL 1TPXB 2VLKA 3H6JA 2EKSB 1OLZA 3SY0B 2W65B 2MCPH 2Z4QB 1A14H 3K2MC 3VE0A 4LHQB 1J8HE 2I9LA 4MNHB 4NQDE 4PJBE 5J8OA 4RAVA 4WFGE 4Z7OF 1JHTB 3F7YA 1ZGLB 5D7KE 2J4WH 1OWRM 4NZRL 5CLTA 1WISA 3RY6A 5D2NB 4ISVB 1RUPH 1NGYA 1ZLSH 5EC2A 2BZDA 4K94C 2X7LB 1NEZA 1TLKA 5HHPA 3KWWB 3STLB 1FC1A 2D4FA 2OJZH 3LN4B 3QCVL 4JREC 1Q94A 2R56L 5BZDB 5I17A 3DI3B 3U36A 1EO5A 3HAEH 4H26A 4RDQG 4IOIB 2NY5H 2KZ1B 1JF1B 2FRGP 3EYSL 4EQ3A 4MX7A 2FZ3A 1RJYB 3P30H 1FVDB 1OL0A 3L3HB 1WTLA 4HWZA 4NO5B 5L8JB 3BZFA 3DVFA 1BFVL 4YNYA 3MUGA 2UUDK 4OCWL 4ZOEA 2PN5A 5HGHA 4FFVC 3GMPB 1NGPL 3PQYE 2J8UB 4NQSA 4XPHL 3CPLB 1CLOH 4LCCA 1RFDH 3VXMA 1FO0L 5CJQL 4NNXA 5D1XB 2E7LC 4WTZA 1ZT7A 5F6IC 2NW3A 4W81A 4PJAA 4KJPC 2X1PA 2DJ4A 1BPVA 3O9WD 1GGBL 3QIBB 4IS6A 2HKHH 3BGFC 3ETBF 3OAZK 5EUOE 1M7IA 4P4KA 4GW4A 1FYTD 5DHXB 1EERB 4JO4H 2YEZA 1QBML 3VI3E 4QHLA 1KEMH 4OLWL 2E6QA 1MQKH 2XQBL 3DSFH 1U0QA 3FO0L 5DUBA 3AUVA 4MWFA 5L6YH 3U30C 4L4VB 4UV7H 4KROD 2BNRA 4ONOA 4O2FA 4TYUA 3T0EE 4M6MH 3DMMD 5DD3H 4GRLC 1QOKA 1NC4D 4Z7NF 4JO3H 1R6VA 2UY7A 5C07B 3SBWC 3V6ZA 2VLRB 4FZEH 4IRSD 2LABA 1BWMA 2CK2A 1JMZA 4G5ZL 2YN5A 3GSQB 4L3CA 4JY6A 1JTTA 3QFDB 4N8VB 1OP3K 1DVFD 3HUJF 3WE6A 1VGEH 3MRLB 2XZCH 4PS4H 5IGXL 5TF1L 1I1AD 5FYKH 5HHQB 4YUEL 5KSBF 5B3JF 2L0DA 2AXFB 4M7KL 3QFJE 1MCFA 2EXYD 1ETZB 2EH7H 1KULA 3U0PA 5DQDH 4XXCA 3TFKC 2IALB 2AJYL 3WNPA 1HOCB 2RGSA 2YUXA 2X4PB 2XN9E 5FDYA 5FYJD 3VWJC 2EDRA 3FB5A 4WGWB 4JB9L 2R8SL 3BEVA 1DBBH 2Y23A 2NY2B 5C09E 3QNZB 4J12A 2F53B 3IU4L 3W0WB 3SE4A 1FV1A 5D7IA 3EO1A 1U95A 3ARYA 3M07A 5F9AC 4JGUA 4D0DA 3SE9H 5C0GA 3UTOA 3MJ8A 2PTUA 4QRRB 4R4BA 5F3BA 4P5MB 4X6DE 5I0ZA 3T4YA 3O2WH 2D31A 1AY1H 2ZOKA 4JY4B 4ETQB 3VFPA 1PZUB 3VG0H 1ZHKA 1UKSA 5HPOA 3ET9F 4JFPA 3HNTL 3ZDYE 1JRHL 3DRQB 3ROOB 2BSRA 2FD6L 4ZODA 1UYWH 2VQTA 1D5ZA 2OJEA 2QQLH 5I1JL 1XR9A 3N1FC 3LSOA 4YR6B 4X98B 2P49B 1Q9LA 5K59F 4EKXA 4F15C 1WGOA 3H9HB 2FX7H 4HT1L 5D4QA 5EO0A 1J8HA 2K7QA 3GK8H 3MLXH 3ARGB 4NQDA 1MWAH 4PJBA 4FP8H 2QQQA 4L3EB 1U8OA 4HGWA 4PRIB 3NMEA 1ZVHA 3MOAL 3EOBA 4FG6D 4QXTA 3X14A 1ACYH 1FZJA 1IGYA 3AY4C 4WFFD 4RIRA 4KK6D 1OB1B 4TSCL 2HAZA 2ZCKH 5I74C 1YMHB 2Z31B 1QFPA 4WDIA 1DQJA 3V4PH 2HT2C 3KPMB 1HILA 2NXYD 2HFEA 2BK8A 4JM2D 3TPKA 2C1OA 4OGXL 4ZG1A 2VABB 4XVSL 1KPRA 2J6EH 3N0PB 4YBQD 2CRZA 5D6DC 4U3CA 3I2CL 2GITA 1IGMH 1DN2A 5B8CA 1ZHNB 5C92A 5FO8B 5ID1A 3QPQC 4TUKH 1YJDH 1G9NL 1QRND 3QIUC 4OZIE 1JNHB 3MRPB 3DUUB 2A73A 4GO6B 4I0PA 3UC0L 1EHAA 3K81A 3DLQR 5DD1H 2LTQB 5F1NA 4ODSL 2CIKA 1AXSB 1E4WL 3BKJH 4FFZL 2V2WB 4PGCA 3V0WH 4KHTL 2NXZC 4NC1E 1E6JL 4FQXB 4CJ0A 3DX7A 1IC7H 1H8OA 1MAKA 3PXJA 3E3QE 1A3QA 5IFAH 1BZQK 3GSUA 4DN3H 2N4IA 3LKRB 1WCQA 2A6JA 1OP5H 4LSUL 4M7JH 3H3BC 1G7QB 1RHHB 2X41A 5EUOA 4RMUA 5F93C 3MRGB 4XBEH 2E6PA 3OZ9H 4N1CA 4OIBA 3WFEL 5T3XE 1OVZA 3BRDA 1RSFA 4ZO6A 5CD5D 5KVGL 4DVRL 1CE6B 4LF3B 4NRYA 4Z5RA 1G0XA 4PJ9C 3RAJH 1FQ9C 1VPOH 3MV7E 3MXWH 4UINH 2VZ1A 1F4YH 4YPGB 5GSRA 5TPWL 1AQKL 2ZNXA 3T0EA 2E8YA 3RP1A 1IGIL 2XIDA 3BH8B 3CMGA 1KT2A 5JW5B 4JPIA 2BMKA 2E7CA 2BXYA 4OV6F 3KYKH 3QDHA 2EEDA 5I71B 2HFFB 4PLKC 3QEGL 2AGJL 4P2RB 3VXSB 1CF8H 3O0RL 1QLRA 2JJSC 2VB5A 4ZPTB 4WUUE 2MQ3A 5EDXA 3VD4A 5FYJL 4PGEA 1C8PA 4H1LG 4NSKB 1WEJH 3P4NA 1F00I 1HYRC 2Y5TB 4I77L 1R0AL 1D5MB 5GS1A 4FQHB 4OCRH 2ADJA 3HAEA 1R3KB 2C3VB 5CWSA 4IOSD 4FXGA 3MC0A 2ARJQ 3ARED 3EJYD 3QFJA 1HI6A 1NCWL 4ZS6D 4D9QE 1KGCE 2K3TA 3IU3A 2XZQH 1D5XA 3R1GH 2XN9A 2C3XA 2E27H 4GAGH 3TA3D 15C8L 1MI5B 1YEEH 3ZHLA 1QFHA 1JWSA 5DZLA 3S88H 1OPGL 1WFTA 2X40A 1LVEA 4JZNA 4LCWB 3LEVL 1UA6H 5I1CL 1NCAL 5KZCD 5CSGA 3CFDA 3GBMH 1K6QH 2ZWLT 2C9AA 4JRYE 1EK3A 4X6DA 2H26A 5KANG 3N9GH 3RFZC 2A2QT 1ZHLA 3TBSA 4OSUH 3BD4A 4PJ5B 1RI8A 1CGTA 5EOQL 4D9LL 1CK0L 5ACLA 1Y6MR 1PZ5B 2IQ9L 3FQUA 3QWQB 3RIFF 2PW2B 5SX4I 1T20A 1HHGA 4BFBD 2A6DB 4IRZL 1T7VA 4XMLH 1UXWA 2B4CH 1IGJA 3O6KL 1T4KB 1E4KA 2Q6WB 4ODXA 3RVXD 4HSQA 5CJBA 3ARQA 4JANA 3V5DA 3R4DA 1F4XL 4L5FH 3U46A 3OX8A 1RUAL 1LEGB 5GGUA 2CDFB 1PQZA 1MHCB 3LDBC 4M8VA 3P0VH 4PJHB 3JV0A 3MNZB 4J3XA 3MROB 4MJID 3JWDL 5A2LH 1O0VA 2N7AA 5D8JL 1S7RB 4NQEA 3QJFB 1F02I 4EZMA 1B0RB 1P53A 3TO2B 1QFWL 1K4CB 1UADC 1YY9C 3HR5A 5GJSL 1B0GB 3ARDC 3MRDB 5H94A 3J8F7 3FB7A 3V7AE 2HKFL 2B1AL 3D39A 4QRTB 3I50L 1CR9H 1HNGA 3ZTJG 1FIGL 4HV8A 4HEME 1R3JB 1A6WH 3S35L 1LP9F 5EU3A 2BVTA 2A6IA 4BH8B 1AGFB 2OP4H 3RNKB 5HVGB 3NN8B 4UQ3B 5IQ9A 1O7VA 5CGMA 4OZIA 3C6LA 3LPGA 3MV9E 5HHXL 3S36L 2R1WB 4HZLB 3OKLA 3ILQD 3WSQL 3GIZH 4PGBA 1E0OB 3X3FL 3GM0A 4U1LB 4GT7A 4X83A 4HC1L 1CDBA 2JJTC 2BY1A 1J5OH 4RNRA 3S4SA 2ICEA 5IWLC 1U58B 5EO1A 1QPXA 4OB5H 1HHHA 5I1LB 2ZOLA 3BT2H 1QO3A 5IB5B 2X4UB 2R2HA 2XKSA 1SMAA 5J6GB 3BN3B 1NL0L 4G6AD 1FE8H 2AJVL 3PWLB 4K3JH 3T8XB 4DKFH 3GMNB 4XNXH 4XXDA 1GC1C 3GMRA 4U6XA 5B21A 3SOBH 4MAUL 3LQAH 4NZDA 1TQBB 4G80B 3KYNB 1IQWH 1UQSA 3ZTNL 2QV2A 1MJ7H 3VFRB 4JQIH 1KN2L 1MPAH 5I15H 1MWAA 2DF3A 3HI6H 3OHXB 3SDDC 3DROA 4MB4A 3PWJB 2LE9A 4NWTH 4Y1AA 5B38G 3GSOA 4XAWH 4K23H 3PL6B 4YQXL 5BJTA 1MCHA 2XOTA 4NQXB 3NBNA 4GXUN 2Q8BH 5DEFA 43C9B 4JCLA 1DQDL 4I18B 1BLNA 1CD0A 2JB5L 4G43B 1U8LB 4WUUA 4A2MA 1CFSA 5HHNA 5ADPH 3MCLL 2YRZA 1F5WA 4EUPG 4O2EA 1KNOA 3CSGA 1MFEL 5D5MA 1KXVC 1DL7L 1YMMB 3BJ91 4HWBH 2IBZY 5I9QC 1YNTB 2FEDC 3TBTB 1LEIB 3DUSB 1JPTL 5GRJH 3HG1E 2YSSA 3EDFA 4AEIL 1V3JA 3OXRB 2BDNH 2DLHA 3IDIA 3NCFB 1A6AA 3UPCA 4ERSL 4LPTA 2IG2L 4PYGA 2ZCHL 4L4TD 4O02L 5D70H 1PLGL 3RDTC 4TTDC 1G0YR 3SE8L 3SKMB 3WL9B 5C0CD 1JV5A 2FL5B 4LLDA 4GG6F 3G6AB 3DHJA 3WNOA 5KVDH 3G6JE 4XP5H 3P40A 4JFFE 5DSCB 5I1KL 3RJQB 5L2KE 2A6KB 4JRYA 3THMH 3RRQA 1RURL 5EN2A 1QUNA 2AJSL 3FHAA 1CXHA 1OW0C 1YEDB 1AQDB 2QQNL 1JHLH 4I1NB 3REVB 4AM0B 3IGAB 4PBWD 2HG5A 5J89A 1X5KA 4K71C 5LJYH 3BZEB 4KKAC 4XCEA 4M48H 2CH8A 4S1SL 1KCVL 1I9IH 1Y0LA 3MLYH 1TCMA 4JFDA 1AFVH 2EO1A 3MLSL 4FQJH 4WFED 2OL3B 4JAMA 5DUML 4DJMA 5MI0C 1I3RA 4OLYL 2P24B 2YPKA 5IMLA 5E08H 2ZG3A 3DUHA 3UJTL 2R0LH 2F54B 4JDTH 1MCLA 4LCIL 1CG9A 3PNWA 1P84K 2XV6B 1NSNH 4RGMB 1O5DT 1XCTA 4PYHA 5IM7B 3VWKB 4OFVA 1H5BB 4AIZB 2VKXA 3X11B 2V5TA 4O5LL 4H8WH 1IZKA 1A3RH 4N90E 1ADQA 2QKIA 4GAFB 1RZ7H 5BO1L 1JPSL 5FOBB 5JUEH 3KR3L 1JZ2A 3HE7B 5CMAB 1OD7A 3EJZD 5BRZD 2VZTA 3SDYL 5J12B 4J6RH 4ZXBB 5TE6H 5I2IB 4OUUB 3VXMD 4BUGA 5HYJE 4U1SA 2CK0H 1CICB 1CVRA 5DEGB 4L8CA 1DLFL 2DLGA 4JQVC 8FABB 4GBXB 2OR8A 2WUCH 3CU7A 5FCSH 5D96C 4LRIA 3ULUC 1S7TB 3MV9A 4NN5B 4TNVK 3T3MF 1IC1A 1TMCB 4LSPH 1CGXA 1TVHA 4LEXH 5I8OH 4Z7OE 3FN9A 3LD8C 5ERWA 3CK0L 3ARBC 3EO9H 1N4XH 3C8DA 1Q9WA 4AEHL 1L7IH 3EO0B 4GSDH 1BBJB 1FORL 4MLIA 4XCYA 1EXUB 2XPGA 2DL2A 3CLEH 3SKUD 4Y5YC 5EOCJ 4APQA 3OKNA 5C6TL 1PDKA 5F8QC 5DHYA 4U33A 3WXVH 2VXUL 1WIPA 1WIUA 3G6DH 5LAXA 2QSVA 5GRUL 4AIXA 1OQOA 3VXRB 1X5GA 3OGCA 2AP2A 1LEKB 3PWNB 1YEFH 1YYLH 1FZOA 4BFGA 5L0QC 3GO1H 4P46B 4HUVA 2XKUA 4JG1H 2CD0A 1CDCA 1E4XI 2G2RA 4WTWA 1ED3A 1MHHA 3AC0A 3SDXF 5JHDB 2JIXA 3E6HA 5MHSE 4B41A 1HSAB 5JOEA 4ZFOA 2OBGA 2QSCH 3U7YH 3EHBD 1GZQB 4R3SB 4XPGL 3D48R 4OLVH 2VDKL 4P9HH 1NCCH 3KJ6H 1CS6A 5DS8A 2YD7A 5HTSA 2X1QA 2ERJC 2X10A 2HJKB 5C0DA 5EULV 3EYUH 2OZ4L 3QDGE 5SV3A 2HN7B 1S7WB 2O5XH 3ZDXF 3QQ9C 1SJHB 2VITA 3O3UN 4R4ND 4OGAD 4K8RD 3ZTJH 3OKDA 3RU8H 1EJ6A 3MRFB 3CDGB 2W9EH 4OQTL 4PJ5D 2G5RA 4JJ5A 4NNYA 4YZFF 5EPMA 4ZMAT 2D7MA 3LHPL 3RY5A 4WEUD 2WMPA 4HHAA 3VRLE 3C09C 1DQLH 1FJ1B 4FNLL 4PJFF 4Y5XB 4ZTOH 4JFYB 4XVUD 2H32H 2LV4A 4Z7VB 1FH5L 3ZE0F 1I85A 3G6JA 3QQ3A 5HDQL 2P1YA 1LHZA 1S7UB 3JV5A 2OR9L 5CEZH 2CGRL 4OF5A 3HUJE 3ZE1F 5J3HC 4J3SA 1GHFL 4X7EC 5E6IC 1PKQE 1UKTA 3LEXA 4M5YL 3QI9A 1OSPL 3TBWB 5B3JE 3LS4L 2OYPA 5D7KD 4CMHC 4WENB 5MEQA 4G8IB 1PBYA 4RSVA 4ZAKB 4F8QA 1CGSH 1GPOH 5FM5M 3UTPE 1A21A 3MBEA 1NGQL 5A40E 2OTUA 3O4LE 3GNMH 3MLTA 3OR7B 1WZLA 4JFZH 3NAAL 5F7FA 3QAZC 2F8VA 2EE9A 1CFVL 4XCCH 1QG3A 1KJVA 2O5ZH 4LRNH 3RKPA 3RVVD 2VR4A 3P73B 1ZLUH 3EYOB 4QRSA 4Z6AT 5DD0L 1FIEA 2ADFH 3O2DH 3SCMB 4JKKA 5GZNC 3CUPA 5LCVH 1HINL 1I75A 5ABDE 3L3GA 2R29L 3BP4B 4OAWB 5EWIL 3HNVH 5KSAA 4KK8C 2VDPH 3WEXA 4D8PB 1L9NA 2DI8A 2EYRB 8CGTA 4FHBD 3Q5TA 3QHZH 1TDQA 4Y16A 1K8DA 4G9DB 3UPRA 4I0PD 3PQYD 4O58H 4RMTA 4HWBA 5D9SB 2OCFD 1A1OB 2IH1A 3BVNA 4MAYB 2D7TL 4JPWH 1U91B 3QEUB 1IC4H 2AKRA 5DJZA 3VJ6B 4F57H 3F6LA 5AZEH 5K9OB 3DTXA 3L7EA 3MGAA 4HCRH 3KDMA 2DQGL 3HZMB 5IBUG 5TE7H 4XX1E 5TE4H 3WJJA 2L4OA 4X5WA 4X99A 3JSSA 2CQVA 2WBJB 1C5CL 3UTSE 4XBGB 1ZXQA 4K3GA 1NUNB 3MGTA 3Q6GH 5IB1A 2A1WH 4IRJC 1ZSDA 5D7LE 4P2QB 1FYHB 3EOAB 3WIFA 1XGUB 3RWHA 3RL2B 5GS0C 2X4RB 1BGXH 4G7YL 5CEZE 1CFBA 1A6TB 4N1EA 5C0NC 3SKNB 4RFOL 5FKPB 2X4TA 3ULUF 4Z7UF 2ICWJ 2NY4D 4JRXA 4L8SC 2ZP0T 1A4JB 4OI8A 1KLGA 4N68A 4DW2H 4NQCB 2J8HA 5IMMB 3MRMB 5HGBB 3RI5F 1OF2B 3O4OC 1FDLH 2IMNA 3ARFD 3K8KA 4NOFA 2HFGL 3QUYB 1UACH 3QUMH 5LBSL 5L88H 1KIPA 2YPLB 3CFJB 4WWKC 4WU5B 3WIHA 2C3HA 4MQXC 1Q9KA 2DIAA 3C60C 5DMJB 2ORBL 1EEZA 1L0QA 1OP5K 5DMIL 1IKFL 5JLZB 2VDQL 1KIQB 3FQWB 3MRIB 2IAMA 4XPBL 1EFXD 4YGVA 1U3HD 1DBAL 4F7CB 5F9WB 4C83A 5FA3B 2DICA 3L3OA 4YXHL 4TULL 1NJ9A 2JK5A 1RIUH 3IFPB 5BV7L 3GMLA 4K8RL 3F7RA 2CLZA 3MLWH 1S8DB 1EJOL 3BPNC 4M3JA 1HXYA 2HJFB 4NPYA 4H1LA 3KPRE 5TH2A 3RKDC 4BKLB 5C09D 2Y07H 5E1AA 1VGKA 3CMOH 3QDGA 1YECL 2YD2A 3SDCC 4NZJA 4ZOCA 1G7HB 1VKXA 5HGAB 3D25B 2JELL 2X4OB 1CFTA 3MO1A 1P7QD 3UROR 5L9DH 5DUPH 4NKDB 5I8KL 2YK1L 1TJGH 1CU4L 3F5WA 1N6QL 1FLRH 1JZ8A 4Y4KB 2DI7A 1RJLA 4GQ9L 2ARWA 2VAJA 5IFHH 1ITBB 5AZ2L 1N5YL 1A4KB 1CIDA 3KPOA 4LOUD 3RWDA 1T0NA 4LLVB 4PG2C 1U8NB 3HUJA 2ZUSA 2WIIB 5E7FA 3HCVB 2I9TB