1CDQA

Structure of a soluble, glycosylated form of the human complement regulatory protein cd59
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD59
publication title Structure of a soluble, glycosylated form of the human complement regulatory protein CD59.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complement regulatory protein
total genus 7
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cdqA00
1CREA 1NORA 1QKEA 2OFSA 2X8BB 3FEVA 1JBDA 2CRSA 1MAHF 2GOOC 4AEAA 1V6PA 3PLCA 1CVOA 2H62C 4OM5A 2CDXA 3BT2U 2MHYA 1BXPA 3NH7A 3KFDI 1HAAA 1ERGA 1KBSA 4DO8A 1CODA 1UG4A 1ZADA 2HLRA 1BTEA 1MR6A 1KC4A 1H0JA 1FSSB 1KL8A 1IKCA 1CXNA 4QTIU 3LAQU 1QM7A 1IQ9A 2GOOB 1LX5B 1ONJA 1NTXA 3U74U 1FRAA 1RGJA 5DZ5A 6EBXA 1B41B 2CRTA 2MJ0A 4IYEA 1IJCA 2QC1A 2MFAA 2MJ4A 4BDTB 2FD6U 2BTXA 2ABXA 3U73U 4BIKB 4UY2C 2K3GA 5EBXA 1COEA 1CDQA 4FAOE 1CRFA 4P7UA 1CDSA 2N99A 3NDSA 1VB0A 1CTXA 4RUDA 2QJAC 4XJJA 1QKDA 1F8UB 1FF4A 3NEQA 1TGXA 3ERAA 1TXBA 1LJZA 1LSIA 2LCRA 1RL5A 1W6BA 1L4WA 1ES7B 2JQPA 1NTNA 1KFHA 1LXGA 2UX2A 4OM4A 1S4YA 4ZQYA 1TXAA 1IDHA 1M9ZA 2MJYA 1IK8A 2PJYC 2H5FA 1YWHA 1KS6A 1CHVS 4FAOC 1LXHA 2BHIA 1ERAA 3BT1U 3EVSC 1KU6B 2QJBC 2CTXA 1NYUA 1FSCA 1FASA 2MUOA 5DO6A 3VTSA 2L03A 1CCQA 1CDRA 2UWRA 2ERAA 1HAJA 2PJYB 1I02A 2NBTA 2HLQA 1KXIA 2H62D 1ABTA 1DRSA 1JE9A 2H64C 4HQPF 1PLOA 2L5SA 1G6MA 1IDLA 3HH7A 1TFSA 2JVEA 1NEAA 3EBXA 1HOYA 1REWC 1F94A 1KTZB 2J8BA 2I9BE 4LFTA 4EY8B 1CB9A 1HC9B 1FFJA 2MUPA 5IMTD 2H8UA 1IDIA 1NYSA 2QJ9C 5DU1A 1HC9A 2H7ZB 1CDTA 1KBAA 2H64B 3KFDE 1JGKA 2H7ZA 5IMYC 1KBTA 3QB4B 2CCXA 2VLWA 1XT3A 2LA1A 1NXBA 1CXOA 1IDGA
chains in the Genus database with same CATH superfamily
1CREA 1NORA 1QKEA 2OFSA 2X8BB 3FEVA 1JBDA 2CRSA 1MAHF 2GOOC 4AEAA 1V6PA 3PLCA 1CVOA 2H62C 4OM5A 2CDXA 3BT2U 2MHYA 1BXPA 3NH7A 3KFDI 1HAAA 1ERGA 1KBSA 4DO8A 1CODA 1UG4A 1ZADA 2HLRA 1BTEA 1MR6A 1KC4A 1H0JA 1FSSB 1KL8A 1IKCA 1CXNA 4QTIU 3LAQU 1QM7A 1IQ9A 2GOOB 1LX5B 1ONJA 1NTXA 3U74U 1FRAA 1RGJA 5DZ5A 6EBXA 1B41B 2CRTA 2MJ0A 4IYEA 1IJCA 2QC1A 2MFAA 2MJ4A 4BDTB 2FD6U 2BTXA 2ABXA 3U73U 4BIKB 4UY2C 2K3GA 5EBXA 1COEA 1CDQA 4FAOE 1CRFA 4P7UA 1CDSA 2N99A 3NDSA 1VB0A 1CTXA 4RUDA 2QJAC 4XJJA 1QKDA 1F8UB 1FF4A 3NEQA 1TGXA 3ERAA 1TXBA 1LJZA 1LSIA 2LCRA 1RL5A 1W6BA 1L4WA 1ES7B 2JQPA 1NTNA 1KFHA 1LXGA 2UX2A 4OM4A 1S4YA 4ZQYA 1TXAA 1IDHA 1M9ZA 2MJYA 1IK8A 2PJYC 2H5FA 1YWHA 1KS6A 1CHVS 4FAOC 1LXHA 2BHIA 1ERAA 3BT1U 3EVSC 1KU6B 2QJBC 2CTXA 1NYUA 1FSCA 1FASA 2MUOA 5DO6A 3VTSA 2L03A 1CCQA 1CDRA 2UWRA 2ERAA 1HAJA 2PJYB 1I02A 2NBTA 2HLQA 1KXIA 2H62D 1ABTA 1DRSA 1JE9A 2H64C 4HQPF 1PLOA 2L5SA 1G6MA 1IDLA 3HH7A 1TFSA 2JVEA 1NEAA 3EBXA 1HOYA 1REWC 1F94A 1KTZB 2J8BA 2I9BE 4LFTA 4EY8B 1CB9A 1HC9B 1FFJA 2MUPA 5IMTD 2H8UA 1IDIA 1NYSA 2QJ9C 5DU1A 1HC9A 2H7ZB 1CDTA 1KBAA 4KSNA 2H64B 3KFDE 1JGKA 2H7ZA 5IMYC 1KBTA 3QB4B 2CCXA 2VLWA 1XT3A 2LA1A 1NXBA 1CXOA 1IDGA
chains in the Genus database with same CATH topology
1CREA 1NORA 1QKEA 2OFSA 2X8BB 3FEVA 1JBDA 2CRSA 1MAHF 2GOOC 4AEAA 1V6PA 3PLCA 1CVOA 2H62C 4OM5A 2CDXA 3BT2U 2MHYA 1BXPA 3NH7A 3KFDI 1HAAA 1ERGA 1KBSA 4DO8A 1CODA 1UG4A 1ZADA 2HLRA 1BTEA 1MR6A 1KC4A 1H0JA 1FSSB 1KL8A 1IKCA 1CXNA 4QTIU 3LAQU 1QM7A 1IQ9A 2GOOB 1LX5B 1ONJA 1NTXA 3U74U 1FRAA 1RGJA 5DZ5A 6EBXA 1B41B 2CRTA 2MJ0A 4IYEA 1IJCA 2QC1A 2MFAA 2MJ4A 4BDTB 2FD6U 2BTXA 2ABXA 3U73U 4BIKB 4UY2C 2K3GA 5EBXA 1COEA 1CDQA 4FAOE 1CRFA 4P7UA 1CDSA 2N99A 3NDSA 1VB0A 1CTXA 4RUDA 2QJAC 4XJJA 1QKDA 1F8UB 1FF4A 3NEQA 1TGXA 3ERAA 1TXBA 1LJZA 1LSIA 2LCRA 1RL5A 1W6BA 1L4WA 1ES7B 2JQPA 1NTNA 1KFHA 1LXGA 2UX2A 4OM4A 1S4YA 4ZQYA 1TXAA 1IDHA 1M9ZA 2MJYA 1IK8A 2PJYC 2H5FA 1YWHA 1KS6A 1CHVS 4FAOC 1LXHA 2BHIA 1ERAA 3BT1U 3EVSC 1KU6B 2QJBC 2CTXA 1NYUA 1FSCA 1FASA 2MUOA 5DO6A 3VTSA 2L03A 1CCQA 1CDRA 2UWRA 2ERAA 1HAJA 2PJYB 1I02A 2NBTA 2HLQA 1KXIA 2H62D 1ABTA 1DRSA 1JE9A 2H64C 4HQPF 1PLOA 2L5SA 1G6MA 1IDLA 3HH7A 1TFSA 2JVEA 1NEAA 3EBXA 1HOYA 1REWC 1F94A 1KTZB 2J8BA 2I9BE 4LFTA 4EY8B 1CB9A 1HC9B 1FFJA 2MUPA 5IMTD 2H8UA 1IDIA 1NYSA 2QJ9C 5DU1A 1HC9A 2H7ZB 1CDTA 1KBAA 4KSNA 2H64B 3KFDE 1JGKA 2H7ZA 5IMYC 1KBTA 3QB4B 2CCXA 2VLWA 1XT3A 2LA1A 1NXBA 1CXOA 1IDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRE A;  1NOR A;  1QKE A;  2OFS A;  2X8B B;  3FEV A;  1JBD A;  2CRS A;  1MAH F;  2GOO C;  4AEA A;  1V6P A;  3PLC A;  1CVO A;  2H62 C;  4OM5 A;  2CDX A;  3BT2 U;  2MHY A;  1BXP A;  3NH7 A;  3KFD I;  1HAA A;  1ERG A;  1KBS A;  4DO8 A;  1COD A;  1UG4 A;  1ZAD A;  2HLR A;  1BTE A;  1MR6 A;  1KC4 A;  1H0J A;  1FSS B;  1KL8 A;  1IKC A;  1CXN A;  4QTI U;  3LAQ U;  1QM7 A;  1IQ9 A;  2GOO B;  1LX5 B;  1ONJ A;  1NTX A;  3U74 U;  1FRA A;  1RGJ A;  5DZ5 A;  6EBX A;  1B41 B;  2CRT A;  2MJ0 A;  4IYE A;  1IJC A;  2QC1 A;  2MFA A;  2MJ4 A;  4BDT B;  2FD6 U;  2BTX A;  2ABX A;  3U73 U;  4BIK B;  4UY2 C;  2K3G A;  5EBX A;  1COE A;  1CDQ A;  4FAO E;  1CRF A;  4P7U A;  1CDS A;  2N99 A;  3NDS A;  1VB0 A;  1CTX A;  4RUD A;  2QJA C;  4XJJ A;  1QKD A;  1F8U B;  1FF4 A;  3NEQ A;  1TGX A;  3ERA A;  1TXB A;  1LJZ A;  1LSI A;  2LCR A;  1RL5 A;  1W6B A;  1L4W A;  1ES7 B;  2JQP A;  1NTN A;  1KFH A;  1LXG A;  2UX2 A;  4OM4 A;  1S4Y A;  4ZQY A;  1TXA A;  1IDH A;  1M9Z A;  2MJY A;  1IK8 A;  2PJY C;  2H5F A;  1YWH A;  1KS6 A;  1CHV S;  4FAO C;  1LXH A;  2BHI A;  1ERA A;  3BT1 U;  3EVS C;  1KU6 B;  2QJB C;  2CTX A;  1NYU A;  1FSC A;  1FAS A;  2MUO A;  5DO6 A;  3VTS A;  2L03 A;  1CCQ A;  1CDR A;  2UWR A;  2ERA A;  1HAJ A;  2PJY B;  1I02 A;  2NBT A;  2HLQ A;  1KXI A;  2H62 D;  1ABT A;  1DRS A;  1JE9 A;  2H64 C;  4HQP F;  1PLO A;  2L5S A;  1G6M A;  1IDL A;  3HH7 A;  1TFS A;  2JVE A;  1NEA A;  3EBX A;  1HOY A;  1REW C;  1F94 A;  1KTZ B;  2J8B A;  2I9B E;  4LFT A;  4EY8 B;  1CB9 A;  1HC9 B;  1FFJ A;  2MUP A;  5IMT D;  2H8U A;  1IDI A;  1NYS A;  2QJ9 C;  5DU1 A;  1HC9 A;  2H7Z B;  1CDT A;  1KBA A;  2H64 B;  3KFD E;  1JGK A;  2H7Z A;  5IMY C;  1KBT A;  3QB4 B;  2CCX A;  2VLW A;  1XT3 A;  2LA1 A;  1NXB A;  1CXO A;  1IDG A; 
#chains in the Genus database with same CATH topology
 1CRE A;  1NOR A;  1QKE A;  2OFS A;  2X8B B;  3FEV A;  1JBD A;  2CRS A;  1MAH F;  2GOO C;  4AEA A;  1V6P A;  3PLC A;  1CVO A;  2H62 C;  4OM5 A;  2CDX A;  3BT2 U;  2MHY A;  1BXP A;  3NH7 A;  3KFD I;  1HAA A;  1ERG A;  1KBS A;  4DO8 A;  1COD A;  1UG4 A;  1ZAD A;  2HLR A;  1BTE A;  1MR6 A;  1KC4 A;  1H0J A;  1FSS B;  1KL8 A;  1IKC A;  1CXN A;  4QTI U;  3LAQ U;  1QM7 A;  1IQ9 A;  2GOO B;  1LX5 B;  1ONJ A;  1NTX A;  3U74 U;  1FRA A;  1RGJ A;  5DZ5 A;  6EBX A;  1B41 B;  2CRT A;  2MJ0 A;  4IYE A;  1IJC A;  2QC1 A;  2MFA A;  2MJ4 A;  4BDT B;  2FD6 U;  2BTX A;  2ABX A;  3U73 U;  4BIK B;  4UY2 C;  2K3G A;  5EBX A;  1COE A;  1CDQ A;  4FAO E;  1CRF A;  4P7U A;  1CDS A;  2N99 A;  3NDS A;  1VB0 A;  1CTX A;  4RUD A;  2QJA C;  4XJJ A;  1QKD A;  1F8U B;  1FF4 A;  3NEQ A;  1TGX A;  3ERA A;  1TXB A;  1LJZ A;  1LSI A;  2LCR A;  1RL5 A;  1W6B A;  1L4W A;  1ES7 B;  2JQP A;  1NTN A;  1KFH A;  1LXG A;  2UX2 A;  4OM4 A;  1S4Y A;  4ZQY A;  1TXA A;  1IDH A;  1M9Z A;  2MJY A;  1IK8 A;  2PJY C;  2H5F A;  1YWH A;  1KS6 A;  1CHV S;  4FAO C;  1LXH A;  2BHI A;  1ERA A;  3BT1 U;  3EVS C;  1KU6 B;  2QJB C;  2CTX A;  1NYU A;  1FSC A;  1FAS A;  2MUO A;  5DO6 A;  3VTS A;  2L03 A;  1CCQ A;  1CDR A;  2UWR A;  2ERA A;  1HAJ A;  2PJY B;  1I02 A;  2NBT A;  2HLQ A;  1KXI A;  2H62 D;  1ABT A;  1DRS A;  1JE9 A;  2H64 C;  4HQP F;  1PLO A;  2L5S A;  1G6M A;  1IDL A;  3HH7 A;  1TFS A;  2JVE A;  1NEA A;  3EBX A;  1HOY A;  1REW C;  1F94 A;  1KTZ B;  2J8B A;  2I9B E;  4LFT A;  4EY8 B;  1CB9 A;  1HC9 B;  1FFJ A;  2MUP A;  5IMT D;  2H8U A;  1IDI A;  1NYS A;  2QJ9 C;  5DU1 A;  1HC9 A;  2H7Z B;  1CDT A;  1KBA A;  4KSN A;  2H64 B;  3KFD E;  1JGK A;  2H7Z A;  5IMY C;  1KBT A;  3QB4 B;  2CCX A;  2VLW A;  1XT3 A;  2LA1 A;  1NXB A;  1CXO A;  1IDG A; 
#chains in the Genus database with same CATH homology
 1CRE A;  1NOR A;  1QKE A;  2OFS A;  2X8B B;  3FEV A;  1JBD A;  2CRS A;  1MAH F;  2GOO C;  4AEA A;  1V6P A;  3PLC A;  1CVO A;  2H62 C;  4OM5 A;  2CDX A;  3BT2 U;  2MHY A;  1BXP A;  3NH7 A;  3KFD I;  1HAA A;  1ERG A;  1KBS A;  4DO8 A;  1COD A;  1UG4 A;  1ZAD A;  2HLR A;  1BTE A;  1MR6 A;  1KC4 A;  1H0J A;  1FSS B;  1KL8 A;  1IKC A;  1CXN A;  4QTI U;  3LAQ U;  1QM7 A;  1IQ9 A;  2GOO B;  1LX5 B;  1ONJ A;  1NTX A;  3U74 U;  1FRA A;  1RGJ A;  5DZ5 A;  6EBX A;  1B41 B;  2CRT A;  2MJ0 A;  4IYE A;  1IJC A;  2QC1 A;  2MFA A;  2MJ4 A;  4BDT B;  2FD6 U;  2BTX A;  2ABX A;  3U73 U;  4BIK B;  4UY2 C;  2K3G A;  5EBX A;  1COE A;  1CDQ A;  4FAO E;  1CRF A;  4P7U A;  1CDS A;  2N99 A;  3NDS A;  1VB0 A;  1CTX A;  4RUD A;  2QJA C;  4XJJ A;  1QKD A;  1F8U B;  1FF4 A;  3NEQ A;  1TGX A;  3ERA A;  1TXB A;  1LJZ A;  1LSI A;  2LCR A;  1RL5 A;  1W6B A;  1L4W A;  1ES7 B;  2JQP A;  1NTN A;  1KFH A;  1LXG A;  2UX2 A;  4OM4 A;  1S4Y A;  4ZQY A;  1TXA A;  1IDH A;  1M9Z A;  2MJY A;  1IK8 A;  2PJY C;  2H5F A;  1YWH A;  1KS6 A;  1CHV S;  4FAO C;  1LXH A;  2BHI A;  1ERA A;  3BT1 U;  3EVS C;  1KU6 B;  2QJB C;  2CTX A;  1NYU A;  1FSC A;  1FAS A;  2MUO A;  5DO6 A;  3VTS A;  2L03 A;  1CCQ A;  1CDR A;  2UWR A;  2ERA A;  1HAJ A;  2PJY B;  1I02 A;  2NBT A;  2HLQ A;  1KXI A;  2H62 D;  1ABT A;  1DRS A;  1JE9 A;  2H64 C;  4HQP F;  1PLO A;  2L5S A;  1G6M A;  1IDL A;  3HH7 A;  1TFS A;  2JVE A;  1NEA A;  3EBX A;  1HOY A;  1REW C;  1F94 A;  1KTZ B;  2J8B A;  2I9B E;  4LFT A;  4EY8 B;  1CB9 A;  1HC9 B;  1FFJ A;  2MUP A;  5IMT D;  2H8U A;  1IDI A;  1NYS A;  2QJ9 C;  5DU1 A;  1HC9 A;  2H7Z B;  1CDT A;  1KBA A;  4KSN A;  2H64 B;  3KFD E;  1JGK A;  2H7Z A;  5IMY C;  1KBT A;  3QB4 B;  2CCX A;  2VLW A;  1XT3 A;  2LA1 A;  1NXB A;  1CXO A;  1IDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...