1CDQA

Structure of a soluble, glycosylated form of the human complement regulatory protein cd59
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD59
publication title Structure of a soluble, glycosylated form of the human complement regulatory protein CD59.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complement regulatory protein
total genus 7
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cdqA00
1RGJA 2GOOC 1FF4A 1HOYA 1HAAA 4ZQYA 2QJBC 1NTNA 1TFSA 1LSIA 1KU6B 2CDXA 2LCRA 2NBTA 2QJAC 2ERAA 1W6BA 1FRAA 1CCQA 2H7ZA 2X8BB 1CRFA 1LXGA 2UX2A 4EY8B 1ONJA 3FEVA 1JBDA 4BIKB 2VLWA 5DU1A 2I9BE 1VB0A 2H7ZB 1HC9A 1KL8A 3PLCA 1BTEA 1KC4A 1CVOA 1CTXA 2CCXA 4OM5A 2MJ4A 2N99A 1LXHA 2MUPA 1IDLA 1IJCA 1FSSB 1CXOA 2MUOA 3BT1U 1NXBA 1HC9B 2JQPA 1CREA 1QM7A 3NEQA 1IKCA 2JVEA 2L03A 3QB4B 4UY2C 1I02A 1FASA 2HLQA 2H62D 2H5FA 1CDTA 4LFTA 3VTSA 5IMTD 5EBXA 2QJ9C 2ABXA 2H62C 2H8UA 1KFHA 1IDGA 1PLOA 2HLRA 4FAOE 1TXBA 1KBSA 1ES7B 2GOOB 1IDIA 3KFDI 3KFDE 1NTXA 1DRSA 4QTIU 1CHVS 1YWHA 1L4WA 4HQPF 4DO8A 2LA1A 1B41B 2CTXA 1NYUA 2L5SA 1TGXA 1LJZA 1IQ9A 1MR6A 2UWRA 4IYEA 1IK8A 2MJYA 1CDRA 1MAHF 1G6MA 2CRTA 3EVSC 3NH7A 1CDQA 1KXIA 1NEAA 1CODA 1BXPA 3U73U 1QKDA 5IMYC 1M9ZA 1QKEA 1CXNA 3EBXA 2MHYA 4OM4A 1H0JA 1FFJA 2H64C 1F8UB 1REWC 2J8BA 3U74U 1NORA 1FSCA 2MJ0A 2PJYC 4BDTB 1KBAA 1KS6A 1KBTA 1XT3A 2FD6U 1HAJA 1ABTA 4XJJA 1CDSA 1JGKA 1RL5A 2QC1A 4P7UA 4AEAA 4FAOC 1ZADA 1CB9A 2H64B 1UG4A 3BT2U 3NDSA 2CRSA 2OFSA 4RUDA 2MFAA 2BTXA 1S4YA 2BHIA 2PJYB 1ERGA 1COEA 1V6PA 3LAQU 1TXAA 1JE9A 1LX5B 2K3GA 1ERAA 1KTZB 1NYSA 5DO6A 1F94A 6EBXA 1IDHA 3HH7A 5DZ5A 3ERAA
chains in the Genus database with same CATH superfamily
1RGJA 2GOOC 1FF4A 1HOYA 1HAAA 4ZQYA 2QJBC 1NTNA 1TFSA 1LSIA 1KU6B 2CDXA 2LCRA 2NBTA 2QJAC 2ERAA 1W6BA 1FRAA 1CCQA 2H7ZA 2X8BB 1CRFA 1LXGA 2UX2A 4EY8B 1ONJA 3FEVA 1JBDA 4BIKB 2VLWA 5DU1A 2I9BE 1VB0A 2H7ZB 1HC9A 1KL8A 3PLCA 1BTEA 1KC4A 1CVOA 1CTXA 2CCXA 4OM5A 2MJ4A 2N99A 1LXHA 2MUPA 1IDLA 1IJCA 1FSSB 1CXOA 2MUOA 3BT1U 4KSNA 1NXBA 1HC9B 2JQPA 1CREA 1QM7A 3NEQA 1IKCA 2JVEA 2L03A 3QB4B 4UY2C 1I02A 1FASA 2HLQA 2H62D 2H5FA 1CDTA 4LFTA 3VTSA 5IMTD 5EBXA 2QJ9C 2ABXA 2H62C 2H8UA 1KFHA 1IDGA 1PLOA 2HLRA 4FAOE 1TXBA 1KBSA 1ES7B 2GOOB 1IDIA 3KFDI 3KFDE 1NTXA 1DRSA 4QTIU 1CHVS 1YWHA 1L4WA 4HQPF 4DO8A 2LA1A 1B41B 2CTXA 1NYUA 2L5SA 1TGXA 1LJZA 1IQ9A 1MR6A 2UWRA 4IYEA 1IK8A 2MJYA 1CDRA 1MAHF 1G6MA 2CRTA 3EVSC 3NH7A 1CDQA 1KXIA 1NEAA 1CODA 1BXPA 3U73U 1QKDA 5IMYC 1M9ZA 1QKEA 1CXNA 3EBXA 2MHYA 4OM4A 1H0JA 1FFJA 2H64C 1F8UB 1REWC 2J8BA 3U74U 1NORA 1FSCA 2MJ0A 2PJYC 4BDTB 1KBAA 1KS6A 1KBTA 1XT3A 2FD6U 1HAJA 1ABTA 4XJJA 1CDSA 1JGKA 1RL5A 2QC1A 4P7UA 4AEAA 4FAOC 1ZADA 1CB9A 2H64B 1UG4A 3BT2U 3NDSA 2CRSA 2OFSA 4RUDA 2MFAA 2BTXA 1S4YA 2BHIA 2PJYB 1ERGA 1COEA 1V6PA 3LAQU 1TXAA 1JE9A 1LX5B 2K3GA 1ERAA 1KTZB 1NYSA 5DO6A 1F94A 6EBXA 1IDHA 3HH7A 5DZ5A 3ERAA
chains in the Genus database with same CATH topology
1RGJA 2GOOC 1FF4A 1HOYA 1HAAA 4ZQYA 2QJBC 1NTNA 1TFSA 1LSIA 1KU6B 2CDXA 2LCRA 2NBTA 2QJAC 2ERAA 1W6BA 1FRAA 1CCQA 2H7ZA 2X8BB 1CRFA 1LXGA 2UX2A 4EY8B 1ONJA 3FEVA 1JBDA 4BIKB 2VLWA 5DU1A 2I9BE 1VB0A 2H7ZB 1HC9A 1KL8A 3PLCA 1BTEA 1KC4A 1CVOA 1CTXA 2CCXA 4OM5A 2MJ4A 2N99A 1LXHA 2MUPA 1IDLA 1IJCA 1FSSB 1CXOA 2MUOA 3BT1U 4KSNA 1NXBA 1HC9B 2JQPA 1CREA 1QM7A 3NEQA 1IKCA 2JVEA 2L03A 3QB4B 4UY2C 1I02A 1FASA 2HLQA 2H62D 2H5FA 1CDTA 4LFTA 3VTSA 5IMTD 5EBXA 2QJ9C 2ABXA 2H62C 2H8UA 1KFHA 1IDGA 1PLOA 2HLRA 4FAOE 1TXBA 1KBSA 1ES7B 2GOOB 1IDIA 3KFDI 3KFDE 1NTXA 1DRSA 4QTIU 1CHVS 1YWHA 1L4WA 4HQPF 4DO8A 2LA1A 1B41B 2CTXA 1NYUA 2L5SA 1TGXA 1LJZA 1IQ9A 1MR6A 2UWRA 4IYEA 1IK8A 2MJYA 1CDRA 1MAHF 1G6MA 2CRTA 3EVSC 3NH7A 1CDQA 1KXIA 1NEAA 1CODA 1BXPA 3U73U 1QKDA 5IMYC 1M9ZA 1QKEA 1CXNA 3EBXA 2MHYA 4OM4A 1H0JA 1FFJA 2H64C 1F8UB 1REWC 2J8BA 3U74U 1NORA 1FSCA 2MJ0A 2PJYC 4BDTB 1KBAA 1KS6A 1KBTA 1XT3A 2FD6U 1HAJA 1ABTA 4XJJA 1CDSA 1JGKA 1RL5A 2QC1A 4P7UA 4AEAA 4FAOC 1ZADA 1CB9A 2H64B 1UG4A 3BT2U 3NDSA 2CRSA 2OFSA 4RUDA 2MFAA 2BTXA 1S4YA 2BHIA 2PJYB 1ERGA 1COEA 1V6PA 3LAQU 1TXAA 1JE9A 1LX5B 2K3GA 1ERAA 1KTZB 1NYSA 5DO6A 1F94A 6EBXA 1IDHA 3HH7A 5DZ5A 3ERAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGJ A;  2GOO C;  1FF4 A;  1HOY A;  1HAA A;  4ZQY A;  2QJB C;  1NTN A;  1TFS A;  1LSI A;  1KU6 B;  2CDX A;  2LCR A;  2NBT A;  2QJA C;  2ERA A;  1W6B A;  1FRA A;  1CCQ A;  2H7Z A;  2X8B B;  1CRF A;  1LXG A;  2UX2 A;  4EY8 B;  1ONJ A;  3FEV A;  1JBD A;  4BIK B;  2VLW A;  5DU1 A;  2I9B E;  1VB0 A;  2H7Z B;  1HC9 A;  1KL8 A;  3PLC A;  1BTE A;  1KC4 A;  1CVO A;  1CTX A;  2CCX A;  4OM5 A;  2MJ4 A;  2N99 A;  1LXH A;  2MUP A;  1IDL A;  1IJC A;  1FSS B;  1CXO A;  2MUO A;  3BT1 U;  1NXB A;  1HC9 B;  2JQP A;  1CRE A;  1QM7 A;  3NEQ A;  1IKC A;  2JVE A;  2L03 A;  3QB4 B;  4UY2 C;  1I02 A;  1FAS A;  2HLQ A;  2H62 D;  2H5F A;  1CDT A;  4LFT A;  3VTS A;  5IMT D;  5EBX A;  2QJ9 C;  2ABX A;  2H62 C;  2H8U A;  1KFH A;  1IDG A;  1PLO A;  2HLR A;  4FAO E;  1TXB A;  1KBS A;  1ES7 B;  2GOO B;  1IDI A;  3KFD I;  3KFD E;  1NTX A;  1DRS A;  4QTI U;  1CHV S;  1YWH A;  1L4W A;  4HQP F;  4DO8 A;  2LA1 A;  1B41 B;  2CTX A;  1NYU A;  2L5S A;  1TGX A;  1LJZ A;  1IQ9 A;  1MR6 A;  2UWR A;  4IYE A;  1IK8 A;  2MJY A;  1CDR A;  1MAH F;  1G6M A;  2CRT A;  3EVS C;  3NH7 A;  1CDQ A;  1KXI A;  1NEA A;  1COD A;  1BXP A;  3U73 U;  1QKD A;  5IMY C;  1M9Z A;  1QKE A;  1CXN A;  3EBX A;  2MHY A;  4OM4 A;  1H0J A;  1FFJ A;  2H64 C;  1F8U B;  1REW C;  2J8B A;  3U74 U;  1NOR A;  1FSC A;  2MJ0 A;  2PJY C;  4BDT B;  1KBA A;  1KS6 A;  1KBT A;  1XT3 A;  2FD6 U;  1HAJ A;  1ABT A;  4XJJ A;  1CDS A;  1JGK A;  1RL5 A;  2QC1 A;  4P7U A;  4AEA A;  4FAO C;  1ZAD A;  1CB9 A;  2H64 B;  1UG4 A;  3BT2 U;  3NDS A;  2CRS A;  2OFS A;  4RUD A;  2MFA A;  2BTX A;  1S4Y A;  2BHI A;  2PJY B;  1ERG A;  1COE A;  1V6P A;  3LAQ U;  1TXA A;  1JE9 A;  1LX5 B;  2K3G A;  1ERA A;  1KTZ B;  1NYS A;  5DO6 A;  1F94 A;  6EBX A;  1IDH A;  3HH7 A;  5DZ5 A;  3ERA A; 
#chains in the Genus database with same CATH topology
 1RGJ A;  2GOO C;  1FF4 A;  1HOY A;  1HAA A;  4ZQY A;  2QJB C;  1NTN A;  1TFS A;  1LSI A;  1KU6 B;  2CDX A;  2LCR A;  2NBT A;  2QJA C;  2ERA A;  1W6B A;  1FRA A;  1CCQ A;  2H7Z A;  2X8B B;  1CRF A;  1LXG A;  2UX2 A;  4EY8 B;  1ONJ A;  3FEV A;  1JBD A;  4BIK B;  2VLW A;  5DU1 A;  2I9B E;  1VB0 A;  2H7Z B;  1HC9 A;  1KL8 A;  3PLC A;  1BTE A;  1KC4 A;  1CVO A;  1CTX A;  2CCX A;  4OM5 A;  2MJ4 A;  2N99 A;  1LXH A;  2MUP A;  1IDL A;  1IJC A;  1FSS B;  1CXO A;  2MUO A;  3BT1 U;  4KSN A;  1NXB A;  1HC9 B;  2JQP A;  1CRE A;  1QM7 A;  3NEQ A;  1IKC A;  2JVE A;  2L03 A;  3QB4 B;  4UY2 C;  1I02 A;  1FAS A;  2HLQ A;  2H62 D;  2H5F A;  1CDT A;  4LFT A;  3VTS A;  5IMT D;  5EBX A;  2QJ9 C;  2ABX A;  2H62 C;  2H8U A;  1KFH A;  1IDG A;  1PLO A;  2HLR A;  4FAO E;  1TXB A;  1KBS A;  1ES7 B;  2GOO B;  1IDI A;  3KFD I;  3KFD E;  1NTX A;  1DRS A;  4QTI U;  1CHV S;  1YWH A;  1L4W A;  4HQP F;  4DO8 A;  2LA1 A;  1B41 B;  2CTX A;  1NYU A;  2L5S A;  1TGX A;  1LJZ A;  1IQ9 A;  1MR6 A;  2UWR A;  4IYE A;  1IK8 A;  2MJY A;  1CDR A;  1MAH F;  1G6M A;  2CRT A;  3EVS C;  3NH7 A;  1CDQ A;  1KXI A;  1NEA A;  1COD A;  1BXP A;  3U73 U;  1QKD A;  5IMY C;  1M9Z A;  1QKE A;  1CXN A;  3EBX A;  2MHY A;  4OM4 A;  1H0J A;  1FFJ A;  2H64 C;  1F8U B;  1REW C;  2J8B A;  3U74 U;  1NOR A;  1FSC A;  2MJ0 A;  2PJY C;  4BDT B;  1KBA A;  1KS6 A;  1KBT A;  1XT3 A;  2FD6 U;  1HAJ A;  1ABT A;  4XJJ A;  1CDS A;  1JGK A;  1RL5 A;  2QC1 A;  4P7U A;  4AEA A;  4FAO C;  1ZAD A;  1CB9 A;  2H64 B;  1UG4 A;  3BT2 U;  3NDS A;  2CRS A;  2OFS A;  4RUD A;  2MFA A;  2BTX A;  1S4Y A;  2BHI A;  2PJY B;  1ERG A;  1COE A;  1V6P A;  3LAQ U;  1TXA A;  1JE9 A;  1LX5 B;  2K3G A;  1ERA A;  1KTZ B;  1NYS A;  5DO6 A;  1F94 A;  6EBX A;  1IDH A;  3HH7 A;  5DZ5 A;  3ERA A; 
#chains in the Genus database with same CATH homology
 1RGJ A;  2GOO C;  1FF4 A;  1HOY A;  1HAA A;  4ZQY A;  2QJB C;  1NTN A;  1TFS A;  1LSI A;  1KU6 B;  2CDX A;  2LCR A;  2NBT A;  2QJA C;  2ERA A;  1W6B A;  1FRA A;  1CCQ A;  2H7Z A;  2X8B B;  1CRF A;  1LXG A;  2UX2 A;  4EY8 B;  1ONJ A;  3FEV A;  1JBD A;  4BIK B;  2VLW A;  5DU1 A;  2I9B E;  1VB0 A;  2H7Z B;  1HC9 A;  1KL8 A;  3PLC A;  1BTE A;  1KC4 A;  1CVO A;  1CTX A;  2CCX A;  4OM5 A;  2MJ4 A;  2N99 A;  1LXH A;  2MUP A;  1IDL A;  1IJC A;  1FSS B;  1CXO A;  2MUO A;  3BT1 U;  4KSN A;  1NXB A;  1HC9 B;  2JQP A;  1CRE A;  1QM7 A;  3NEQ A;  1IKC A;  2JVE A;  2L03 A;  3QB4 B;  4UY2 C;  1I02 A;  1FAS A;  2HLQ A;  2H62 D;  2H5F A;  1CDT A;  4LFT A;  3VTS A;  5IMT D;  5EBX A;  2QJ9 C;  2ABX A;  2H62 C;  2H8U A;  1KFH A;  1IDG A;  1PLO A;  2HLR A;  4FAO E;  1TXB A;  1KBS A;  1ES7 B;  2GOO B;  1IDI A;  3KFD I;  3KFD E;  1NTX A;  1DRS A;  4QTI U;  1CHV S;  1YWH A;  1L4W A;  4HQP F;  4DO8 A;  2LA1 A;  1B41 B;  2CTX A;  1NYU A;  2L5S A;  1TGX A;  1LJZ A;  1IQ9 A;  1MR6 A;  2UWR A;  4IYE A;  1IK8 A;  2MJY A;  1CDR A;  1MAH F;  1G6M A;  2CRT A;  3EVS C;  3NH7 A;  1CDQ A;  1KXI A;  1NEA A;  1COD A;  1BXP A;  3U73 U;  1QKD A;  5IMY C;  1M9Z A;  1QKE A;  1CXN A;  3EBX A;  2MHY A;  4OM4 A;  1H0J A;  1FFJ A;  2H64 C;  1F8U B;  1REW C;  2J8B A;  3U74 U;  1NOR A;  1FSC A;  2MJ0 A;  2PJY C;  4BDT B;  1KBA A;  1KS6 A;  1KBT A;  1XT3 A;  2FD6 U;  1HAJ A;  1ABT A;  4XJJ A;  1CDS A;  1JGK A;  1RL5 A;  2QC1 A;  4P7U A;  4AEA A;  4FAO C;  1ZAD A;  1CB9 A;  2H64 B;  1UG4 A;  3BT2 U;  3NDS A;  2CRS A;  2OFS A;  4RUD A;  2MFA A;  2BTX A;  1S4Y A;  2BHI A;  2PJY B;  1ERG A;  1COE A;  1V6P A;  3LAQ U;  1TXA A;  1JE9 A;  1LX5 B;  2K3G A;  1ERA A;  1KTZ B;  1NYS A;  5DO6 A;  1F94 A;  6EBX A;  1IDH A;  3HH7 A;  5DZ5 A;  3ERA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...