1CDTA

Cardiotoxin v4/ii from naja mossambica mossambica: the refined crystal structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cardiotoxin VII4 from Naja mossambica mossambica. The refined crystal structure.
pubmed doi rcsb
source organism Naja mossambica
molecule tags Cytotoxin
molecule keywords CARDIOTOXIN VII4
total genus 12
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cdtA00
1NORA 1ERGA 2CCXA 1TXAA 4OM4A 1FFJA 2H5FA 1IDHA 2LA1A 1IDIA 3ERAA 1LXHA 1CXNA 1NEAA 1FF4A 2L5SA 4BIKB 5IMTD 1ONJA 1HC9A 2ERAA 2QJAC 3U74U 3EBXA 1ZADA 2UX2A 2X8BB 1UG4A 2H62C 2L03A 1CXOA 4XJJA 5DZ5A 1IKCA 1M9ZA 1YWHA 1KBSA 2QJ9C 4OM5A 4AEAA 1JBDA 2PJYC 1FSSB 2OFSA 1KFHA 5DO6A 1I02A 2BHIA 1TGXA 2H8UA 1B41B 2N99A 2UWRA 1CDTA 1HAJA 4FAOE 2JVEA 1TXBA 4BDTB 1CCQA 1CDSA 1QKDA 3LAQU 2H62D 1HAAA 2CTXA 2MUPA 1NXBA 5DU1A 2ABXA 2PJYB 3HH7A 2GOOC 1BXPA 1QKEA 1LSIA 1ES7B 1JE9A 1IJCA 3FEVA 1F8UB 1ERAA 4QTIU 1CVOA 1FRAA 1QM7A 1TFSA 1DRSA 1CHVS 1MAHF 1LXGA 4EY8B 2QJBC 2I9BE 1FASA 4HQPF 1IDGA 2MJ0A 2QC1A 1NTNA 1IDLA 1KXIA 3EVSC 4P7UA 1PLOA 5IMYC 3BT2U 2BTXA 2MJ4A 3VTSA 4RUDA 1REWC 1HC9B 4LFTA 1KS6A 1F94A 3NDSA 1NYSA 4ZQYA 1G6MA 3BT1U 3NH7A 1CTXA 2NBTA 1KC4A 3PLCA 1CRFA 1IK8A 2K3GA 1CB9A 1KBTA 1KU6B 1S4YA 1W6BA 1RL5A 1VB0A 2GOOB 5EBXA 3KFDI 1RGJA 2H64B 2CRTA 1CDRA 1ABTA 1LX5B 1H0JA 1NTXA 2LCRA 1V6PA 1NYUA 4FAOC 1KBAA 2CDXA 2H7ZA 2H7ZB 1XT3A 2CRSA 1JGKA 2H64C 3KFDE 1HOYA 2MFAA 3U73U 1KTZB 3NEQA 4DO8A 2HLQA 3QB4B 1CODA 2FD6U 6EBXA 1CDQA 1KL8A 2MUOA 2MHYA 2HLRA 2JQPA 4IYEA 2VLWA 1MR6A 4UY2C 1FSCA 1IQ9A 1LJZA 1CREA 2J8BA 2MJYA 1COEA 1L4WA 1BTEA
chains in the Genus database with same CATH superfamily
1NORA 1ERGA 2CCXA 1TXAA 4OM4A 1FFJA 2H5FA 1IDHA 2LA1A 1IDIA 3ERAA 1LXHA 1CXNA 1NEAA 1FF4A 2L5SA 4BIKB 5IMTD 1ONJA 1HC9A 2ERAA 2QJAC 3U74U 3EBXA 1ZADA 2UX2A 2X8BB 1UG4A 2H62C 2L03A 1CXOA 4XJJA 5DZ5A 1IKCA 1M9ZA 1YWHA 1KBSA 2QJ9C 4OM5A 4AEAA 1JBDA 2PJYC 1FSSB 2OFSA 1KFHA 5DO6A 1I02A 2BHIA 1TGXA 2H8UA 1B41B 2N99A 2UWRA 1CDTA 1HAJA 4FAOE 2JVEA 1TXBA 4BDTB 1CCQA 1CDSA 1QKDA 3LAQU 2H62D 1HAAA 2CTXA 2MUPA 1NXBA 5DU1A 2ABXA 2PJYB 3HH7A 2GOOC 1BXPA 1QKEA 1LSIA 1ES7B 1JE9A 1IJCA 3FEVA 1F8UB 1ERAA 4QTIU 1CVOA 1FRAA 1QM7A 1TFSA 1DRSA 1CHVS 1MAHF 1LXGA 4EY8B 2QJBC 2I9BE 1FASA 4HQPF 1IDGA 2MJ0A 2QC1A 1NTNA 1IDLA 1KXIA 3EVSC 4P7UA 1PLOA 5IMYC 3BT2U 2BTXA 2MJ4A 3VTSA 4RUDA 1REWC 1HC9B 4LFTA 1KS6A 1F94A 3NDSA 1NYSA 4ZQYA 1G6MA 3BT1U 3NH7A 1CTXA 2NBTA 1KC4A 3PLCA 1CRFA 1IK8A 2K3GA 1CB9A 1KBTA 1KU6B 1S4YA 1W6BA 1RL5A 1VB0A 2GOOB 5EBXA 3KFDI 1RGJA 2H64B 2CRTA 1CDRA 1ABTA 1LX5B 1H0JA 1NTXA 2LCRA 1V6PA 1NYUA 4FAOC 1KBAA 2CDXA 2H7ZA 2H7ZB 1XT3A 2CRSA 1JGKA 2H64C 3KFDE 1HOYA 2MFAA 3U73U 1KTZB 3NEQA 4DO8A 2HLQA 3QB4B 1CODA 2FD6U 6EBXA 1CDQA 1KL8A 2MUOA 2MHYA 2HLRA 2JQPA 4IYEA 2VLWA 1MR6A 4KSNA 1FSCA 4UY2C 1IQ9A 1LJZA 1CREA 2J8BA 2MJYA 1COEA 1L4WA 1BTEA
chains in the Genus database with same CATH topology
1NORA 1ERGA 2CCXA 1TXAA 4OM4A 1FFJA 2H5FA 1IDHA 2LA1A 1IDIA 3ERAA 1LXHA 1CXNA 1NEAA 1FF4A 2L5SA 4BIKB 5IMTD 1ONJA 1HC9A 2ERAA 2QJAC 3U74U 3EBXA 1ZADA 2UX2A 2X8BB 1UG4A 2H62C 2L03A 1CXOA 4XJJA 5DZ5A 1IKCA 1M9ZA 1YWHA 1KBSA 2QJ9C 4OM5A 4AEAA 1JBDA 2PJYC 1FSSB 2OFSA 1KFHA 5DO6A 1I02A 2BHIA 1TGXA 2H8UA 1B41B 2N99A 2UWRA 1CDTA 1HAJA 4FAOE 2JVEA 1TXBA 4BDTB 1CCQA 1CDSA 1QKDA 3LAQU 2H62D 1HAAA 2CTXA 2MUPA 1NXBA 5DU1A 2ABXA 2PJYB 3HH7A 2GOOC 1BXPA 1QKEA 1LSIA 1ES7B 1JE9A 1IJCA 3FEVA 1F8UB 1ERAA 4QTIU 1CVOA 1FRAA 1QM7A 1TFSA 1DRSA 1CHVS 1MAHF 1LXGA 4EY8B 2QJBC 2I9BE 1FASA 4HQPF 1IDGA 2MJ0A 2QC1A 1NTNA 1IDLA 1KXIA 3EVSC 4P7UA 1PLOA 5IMYC 3BT2U 2BTXA 2MJ4A 3VTSA 4RUDA 1REWC 1HC9B 4LFTA 1KS6A 1F94A 3NDSA 1NYSA 4ZQYA 1G6MA 3BT1U 3NH7A 1CTXA 2NBTA 1KC4A 3PLCA 1CRFA 1IK8A 2K3GA 1CB9A 1KBTA 1KU6B 1S4YA 1W6BA 1RL5A 1VB0A 2GOOB 5EBXA 3KFDI 1RGJA 2H64B 2CRTA 1CDRA 1ABTA 1LX5B 1H0JA 1NTXA 2LCRA 1V6PA 1NYUA 4FAOC 1KBAA 2CDXA 2H7ZA 2H7ZB 1XT3A 2CRSA 1JGKA 2H64C 3KFDE 1HOYA 2MFAA 3U73U 1KTZB 3NEQA 4DO8A 2HLQA 3QB4B 1CODA 2FD6U 6EBXA 1CDQA 1KL8A 2MUOA 2MHYA 2HLRA 2JQPA 4IYEA 2VLWA 1MR6A 4KSNA 1FSCA 4UY2C 1IQ9A 1LJZA 1CREA 2J8BA 2MJYA 1COEA 1L4WA 1BTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NOR A;  1ERG A;  2CCX A;  1TXA A;  4OM4 A;  1FFJ A;  2H5F A;  1IDH A;  2LA1 A;  1IDI A;  3ERA A;  1LXH A;  1CXN A;  1NEA A;  1FF4 A;  2L5S A;  4BIK B;  5IMT D;  1ONJ A;  1HC9 A;  2ERA A;  2QJA C;  3U74 U;  3EBX A;  1ZAD A;  2UX2 A;  2X8B B;  1UG4 A;  2H62 C;  2L03 A;  1CXO A;  4XJJ A;  5DZ5 A;  1IKC A;  1M9Z A;  1YWH A;  1KBS A;  2QJ9 C;  4OM5 A;  4AEA A;  1JBD A;  2PJY C;  1FSS B;  2OFS A;  1KFH A;  5DO6 A;  1I02 A;  2BHI A;  1TGX A;  2H8U A;  1B41 B;  2N99 A;  2UWR A;  1CDT A;  1HAJ A;  4FAO E;  2JVE A;  1TXB A;  4BDT B;  1CCQ A;  1CDS A;  1QKD A;  3LAQ U;  2H62 D;  1HAA A;  2CTX A;  2MUP A;  1NXB A;  5DU1 A;  2ABX A;  2PJY B;  3HH7 A;  2GOO C;  1BXP A;  1QKE A;  1LSI A;  1ES7 B;  1JE9 A;  1IJC A;  3FEV A;  1F8U B;  1ERA A;  4QTI U;  1CVO A;  1FRA A;  1QM7 A;  1TFS A;  1DRS A;  1CHV S;  1MAH F;  1LXG A;  4EY8 B;  2QJB C;  2I9B E;  1FAS A;  4HQP F;  1IDG A;  2MJ0 A;  2QC1 A;  1NTN A;  1IDL A;  1KXI A;  3EVS C;  4P7U A;  1PLO A;  5IMY C;  3BT2 U;  2BTX A;  2MJ4 A;  3VTS A;  4RUD A;  1REW C;  1HC9 B;  4LFT A;  1KS6 A;  1F94 A;  3NDS A;  1NYS A;  4ZQY A;  1G6M A;  3BT1 U;  3NH7 A;  1CTX A;  2NBT A;  1KC4 A;  3PLC A;  1CRF A;  1IK8 A;  2K3G A;  1CB9 A;  1KBT A;  1KU6 B;  1S4Y A;  1W6B A;  1RL5 A;  1VB0 A;  2GOO B;  5EBX A;  3KFD I;  1RGJ A;  2H64 B;  2CRT A;  1CDR A;  1ABT A;  1LX5 B;  1H0J A;  1NTX A;  2LCR A;  1V6P A;  1NYU A;  4FAO C;  1KBA A;  2CDX A;  2H7Z A;  2H7Z B;  1XT3 A;  2CRS A;  1JGK A;  2H64 C;  3KFD E;  1HOY A;  2MFA A;  3U73 U;  1KTZ B;  3NEQ A;  4DO8 A;  2HLQ A;  3QB4 B;  1COD A;  2FD6 U;  6EBX A;  1CDQ A;  1KL8 A;  2MUO A;  2MHY A;  2HLR A;  2JQP A;  4IYE A;  2VLW A;  1MR6 A;  4UY2 C;  1FSC A;  1IQ9 A;  1LJZ A;  1CRE A;  2J8B A;  2MJY A;  1COE A;  1L4W A;  1BTE A; 
#chains in the Genus database with same CATH topology
 1NOR A;  1ERG A;  2CCX A;  1TXA A;  4OM4 A;  1FFJ A;  2H5F A;  1IDH A;  2LA1 A;  1IDI A;  3ERA A;  1LXH A;  1CXN A;  1NEA A;  1FF4 A;  2L5S A;  4BIK B;  5IMT D;  1ONJ A;  1HC9 A;  2ERA A;  2QJA C;  3U74 U;  3EBX A;  1ZAD A;  2UX2 A;  2X8B B;  1UG4 A;  2H62 C;  2L03 A;  1CXO A;  4XJJ A;  5DZ5 A;  1IKC A;  1M9Z A;  1YWH A;  1KBS A;  2QJ9 C;  4OM5 A;  4AEA A;  1JBD A;  2PJY C;  1FSS B;  2OFS A;  1KFH A;  5DO6 A;  1I02 A;  2BHI A;  1TGX A;  2H8U A;  1B41 B;  2N99 A;  2UWR A;  1CDT A;  1HAJ A;  4FAO E;  2JVE A;  1TXB A;  4BDT B;  1CCQ A;  1CDS A;  1QKD A;  3LAQ U;  2H62 D;  1HAA A;  2CTX A;  2MUP A;  1NXB A;  5DU1 A;  2ABX A;  2PJY B;  3HH7 A;  2GOO C;  1BXP A;  1QKE A;  1LSI A;  1ES7 B;  1JE9 A;  1IJC A;  3FEV A;  1F8U B;  1ERA A;  4QTI U;  1CVO A;  1FRA A;  1QM7 A;  1TFS A;  1DRS A;  1CHV S;  1MAH F;  1LXG A;  4EY8 B;  2QJB C;  2I9B E;  1FAS A;  4HQP F;  1IDG A;  2MJ0 A;  2QC1 A;  1NTN A;  1IDL A;  1KXI A;  3EVS C;  4P7U A;  1PLO A;  5IMY C;  3BT2 U;  2BTX A;  2MJ4 A;  3VTS A;  4RUD A;  1REW C;  1HC9 B;  4LFT A;  1KS6 A;  1F94 A;  3NDS A;  1NYS A;  4ZQY A;  1G6M A;  3BT1 U;  3NH7 A;  1CTX A;  2NBT A;  1KC4 A;  3PLC A;  1CRF A;  1IK8 A;  2K3G A;  1CB9 A;  1KBT A;  1KU6 B;  1S4Y A;  1W6B A;  1RL5 A;  1VB0 A;  2GOO B;  5EBX A;  3KFD I;  1RGJ A;  2H64 B;  2CRT A;  1CDR A;  1ABT A;  1LX5 B;  1H0J A;  1NTX A;  2LCR A;  1V6P A;  1NYU A;  4FAO C;  1KBA A;  2CDX A;  2H7Z A;  2H7Z B;  1XT3 A;  2CRS A;  1JGK A;  2H64 C;  3KFD E;  1HOY A;  2MFA A;  3U73 U;  1KTZ B;  3NEQ A;  4DO8 A;  2HLQ A;  3QB4 B;  1COD A;  2FD6 U;  6EBX A;  1CDQ A;  1KL8 A;  2MUO A;  2MHY A;  2HLR A;  2JQP A;  4IYE A;  2VLW A;  1MR6 A;  4KSN A;  1FSC A;  4UY2 C;  1IQ9 A;  1LJZ A;  1CRE A;  2J8B A;  2MJY A;  1COE A;  1L4W A;  1BTE A; 
#chains in the Genus database with same CATH homology
 1NOR A;  1ERG A;  2CCX A;  1TXA A;  4OM4 A;  1FFJ A;  2H5F A;  1IDH A;  2LA1 A;  1IDI A;  3ERA A;  1LXH A;  1CXN A;  1NEA A;  1FF4 A;  2L5S A;  4BIK B;  5IMT D;  1ONJ A;  1HC9 A;  2ERA A;  2QJA C;  3U74 U;  3EBX A;  1ZAD A;  2UX2 A;  2X8B B;  1UG4 A;  2H62 C;  2L03 A;  1CXO A;  4XJJ A;  5DZ5 A;  1IKC A;  1M9Z A;  1YWH A;  1KBS A;  2QJ9 C;  4OM5 A;  4AEA A;  1JBD A;  2PJY C;  1FSS B;  2OFS A;  1KFH A;  5DO6 A;  1I02 A;  2BHI A;  1TGX A;  2H8U A;  1B41 B;  2N99 A;  2UWR A;  1CDT A;  1HAJ A;  4FAO E;  2JVE A;  1TXB A;  4BDT B;  1CCQ A;  1CDS A;  1QKD A;  3LAQ U;  2H62 D;  1HAA A;  2CTX A;  2MUP A;  1NXB A;  5DU1 A;  2ABX A;  2PJY B;  3HH7 A;  2GOO C;  1BXP A;  1QKE A;  1LSI A;  1ES7 B;  1JE9 A;  1IJC A;  3FEV A;  1F8U B;  1ERA A;  4QTI U;  1CVO A;  1FRA A;  1QM7 A;  1TFS A;  1DRS A;  1CHV S;  1MAH F;  1LXG A;  4EY8 B;  2QJB C;  2I9B E;  1FAS A;  4HQP F;  1IDG A;  2MJ0 A;  2QC1 A;  1NTN A;  1IDL A;  1KXI A;  3EVS C;  4P7U A;  1PLO A;  5IMY C;  3BT2 U;  2BTX A;  2MJ4 A;  3VTS A;  4RUD A;  1REW C;  1HC9 B;  4LFT A;  1KS6 A;  1F94 A;  3NDS A;  1NYS A;  4ZQY A;  1G6M A;  3BT1 U;  3NH7 A;  1CTX A;  2NBT A;  1KC4 A;  3PLC A;  1CRF A;  1IK8 A;  2K3G A;  1CB9 A;  1KBT A;  1KU6 B;  1S4Y A;  1W6B A;  1RL5 A;  1VB0 A;  2GOO B;  5EBX A;  3KFD I;  1RGJ A;  2H64 B;  2CRT A;  1CDR A;  1ABT A;  1LX5 B;  1H0J A;  1NTX A;  2LCR A;  1V6P A;  1NYU A;  4FAO C;  1KBA A;  2CDX A;  2H7Z A;  2H7Z B;  1XT3 A;  2CRS A;  1JGK A;  2H64 C;  3KFD E;  1HOY A;  2MFA A;  3U73 U;  1KTZ B;  3NEQ A;  4DO8 A;  2HLQ A;  3QB4 B;  1COD A;  2FD6 U;  6EBX A;  1CDQ A;  1KL8 A;  2MUO A;  2MHY A;  2HLR A;  2JQP A;  4IYE A;  2VLW A;  1MR6 A;  4KSN A;  1FSC A;  4UY2 C;  1IQ9 A;  1LJZ A;  1CRE A;  2J8B A;  2MJY A;  1COE A;  1L4W A;  1BTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...