1CDTA

Cardiotoxin v4/ii from naja mossambica mossambica: the refined crystal structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN VII4
publication title Cardiotoxin VII4 from Naja mossambica mossambica. The refined crystal structure.
pubmed doi rcsb
source organism Naja mossambica
molecule tags Cytotoxin
total genus 12
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cdtA00
1JGKA 1ONJA 1G6MA 1ES7B 4LFTA 1RGJA 1NTNA 1LXHA 4DO8A 2J8BA 3HH7A 1LSIA 3NDSA 1COEA 1KTZB 1KC4A 5DO6A 1YWHA 2LCRA 1TFSA 1TGXA 4QTIU 1CCQA 2PJYB 1FRAA 2HLQA 1KL8A 1CDTA 1NXBA 1CDRA 1KFHA 3BT2U 1ERAA 1KBAA 2QJBC 3PLCA 1QM7A 2MJ4A 2MJ0A 4HQPF 1FF4A 1IQ9A 5IMTD 2UWRA 3QB4B 2MUPA 4BIKB 1IKCA 1MAHF 1NEAA 1NYUA 2GOOB 2H62C 1PLOA 2MJYA 1M9ZA 2I9BE 1CDSA 1KBTA 3BT1U 4FAOE 2PJYC 2JVEA 1KS6A 4AEAA 1REWC 1FSSB 2QJAC 3ERAA 2N99A 3U73U 1BXPA 4XJJA 1NYSA 1IK8A 1MR6A 2MHYA 1W6BA 1ABTA 1FASA 2L03A 1H0JA 1IDIA 2GOOC 2H64B 4BDTB 2QC1A 1LXGA 1CHVS 3LAQU 1VB0A 1NORA 4RUDA 2BTXA 1F8UB 2UX2A 4P7UA 1HAJA 1IDLA 1HC9A 2HLRA 1KXIA 1ZADA 1FFJA 2MUOA 5DU1A 1KBSA 1ERGA 1I02A 3U74U 3EVSC 1L4WA 1FSCA 1HC9B 4FAOC 1CVOA 3NEQA 1CXOA 4UY2C 4EY8B 3KFDE 1CTXA 2H64C 4ZQYA 1QKEA 2NBTA 1BTEA 1IDHA 1S4YA 2H5FA 1JE9A 1UG4A 2FD6U 5DZ5A 1TXAA 2OFSA 5EBXA 1CB9A 2L5SA 1HAAA 1QKDA 1HOYA 1V6PA 2JQPA 2H8UA 1NTXA 1CODA 2LA1A 2VLWA 1LX5B 2CDXA 1DRSA 1B41B 1KU6B 1IJCA 4OM4A 1TXBA 2CTXA 2CRTA 2CCXA 3NH7A 2BHIA 1CDQA 1JBDA 1CXNA 2ERAA 3FEVA 2H7ZA 2CRSA 3EBXA 1CREA 1XT3A 1F94A 3KFDI 2K3GA 4IYEA 3VTSA 5IMYC 2X8BB 6EBXA 2QJ9C 2MFAA 4OM5A 2ABXA 2H62D 1CRFA 2H7ZB 1LJZA 1IDGA 1RL5A
chains in the Genus database with same CATH superfamily
1JGKA 1ONJA 1G6MA 1ES7B 4LFTA 1RGJA 1NTNA 1LXHA 4DO8A 2J8BA 3HH7A 1LSIA 3NDSA 1COEA 1KTZB 1KC4A 5DO6A 1YWHA 2LCRA 1TFSA 1TGXA 4QTIU 1CCQA 2PJYB 1FRAA 2HLQA 1KL8A 1CDTA 1NXBA 1CDRA 1KFHA 3BT2U 1ERAA 1KBAA 2QJBC 3PLCA 1QM7A 2MJ4A 2MJ0A 4HQPF 1FF4A 1IQ9A 5IMTD 2UWRA 3QB4B 2MUPA 4BIKB 1IKCA 1MAHF 1NEAA 1NYUA 2GOOB 2H62C 1PLOA 2MJYA 1M9ZA 2I9BE 1CDSA 1KBTA 3BT1U 4FAOE 2PJYC 2JVEA 1KS6A 4AEAA 1REWC 1FSSB 2QJAC 3ERAA 2N99A 3U73U 1BXPA 4XJJA 1NYSA 1IK8A 1MR6A 2MHYA 1W6BA 1ABTA 1FASA 2L03A 1H0JA 1IDIA 2GOOC 2H64B 4BDTB 2QC1A 1LXGA 1CHVS 3LAQU 1VB0A 1NORA 4RUDA 2BTXA 1F8UB 2UX2A 4P7UA 1HAJA 1IDLA 1HC9A 2HLRA 1KXIA 1ZADA 1FFJA 2MUOA 5DU1A 1KBSA 1ERGA 1I02A 3U74U 3EVSC 1L4WA 1FSCA 1HC9B 4FAOC 1CVOA 3NEQA 1CXOA 4UY2C 4EY8B 3KFDE 1CTXA 2H64C 4ZQYA 1QKEA 2NBTA 1BTEA 1IDHA 1S4YA 2H5FA 1JE9A 1UG4A 2FD6U 5DZ5A 1TXAA 2OFSA 5EBXA 1CB9A 2L5SA 1HAAA 1QKDA 1HOYA 1V6PA 2JQPA 2H8UA 1NTXA 1CODA 2LA1A 2VLWA 1LX5B 2CDXA 4KSNA 1B41B 1DRSA 1KU6B 1IJCA 4OM4A 1TXBA 2CTXA 2CRTA 2CCXA 3NH7A 2BHIA 1CDQA 1JBDA 1CXNA 2ERAA 3FEVA 2H7ZA 2CRSA 3EBXA 1CREA 1XT3A 1F94A 3KFDI 2K3GA 4IYEA 3VTSA 5IMYC 2X8BB 6EBXA 2QJ9C 2MFAA 4OM5A 2ABXA 2H62D 1CRFA 2H7ZB 1LJZA 1IDGA 1RL5A
chains in the Genus database with same CATH topology
1JGKA 1ONJA 1G6MA 1ES7B 4LFTA 1RGJA 1NTNA 1LXHA 4DO8A 2J8BA 3HH7A 1LSIA 3NDSA 1COEA 1KTZB 1KC4A 5DO6A 1YWHA 2LCRA 1TFSA 1TGXA 4QTIU 1CCQA 2PJYB 1FRAA 2HLQA 1KL8A 1CDTA 1NXBA 1CDRA 1KFHA 3BT2U 1ERAA 1KBAA 2QJBC 3PLCA 1QM7A 2MJ4A 2MJ0A 4HQPF 1FF4A 1IQ9A 5IMTD 2UWRA 3QB4B 2MUPA 4BIKB 1IKCA 1MAHF 1NEAA 1NYUA 2GOOB 2H62C 1PLOA 2MJYA 1M9ZA 2I9BE 1CDSA 1KBTA 3BT1U 4FAOE 2PJYC 2JVEA 1KS6A 4AEAA 1REWC 1FSSB 2QJAC 3ERAA 2N99A 3U73U 1BXPA 4XJJA 1NYSA 1IK8A 1MR6A 2MHYA 1W6BA 1ABTA 1FASA 2L03A 1H0JA 1IDIA 2GOOC 2H64B 4BDTB 2QC1A 1LXGA 1CHVS 3LAQU 1VB0A 1NORA 4RUDA 2BTXA 1F8UB 2UX2A 4P7UA 1HAJA 1IDLA 1HC9A 2HLRA 1KXIA 1ZADA 1FFJA 2MUOA 5DU1A 1KBSA 1ERGA 1I02A 3U74U 3EVSC 1L4WA 1FSCA 1HC9B 4FAOC 1CVOA 3NEQA 1CXOA 4UY2C 4EY8B 3KFDE 1CTXA 2H64C 4ZQYA 1QKEA 2NBTA 1BTEA 1IDHA 1S4YA 2H5FA 1JE9A 1UG4A 2FD6U 5DZ5A 1TXAA 2OFSA 5EBXA 1CB9A 2L5SA 1HAAA 1QKDA 1HOYA 1V6PA 2JQPA 2H8UA 1NTXA 1CODA 2LA1A 2VLWA 1LX5B 2CDXA 4KSNA 1B41B 1DRSA 1KU6B 1IJCA 4OM4A 1TXBA 2CTXA 2CRTA 2CCXA 3NH7A 2BHIA 1CDQA 1JBDA 1CXNA 2ERAA 3FEVA 2H7ZA 2CRSA 3EBXA 1CREA 1XT3A 1F94A 3KFDI 2K3GA 4IYEA 3VTSA 5IMYC 2X8BB 6EBXA 2QJ9C 2MFAA 4OM5A 2ABXA 2H62D 1CRFA 2H7ZB 1LJZA 1IDGA 1RL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JGK A;  1ONJ A;  1G6M A;  1ES7 B;  4LFT A;  1RGJ A;  1NTN A;  1LXH A;  4DO8 A;  2J8B A;  3HH7 A;  1LSI A;  3NDS A;  1COE A;  1KTZ B;  1KC4 A;  5DO6 A;  1YWH A;  2LCR A;  1TFS A;  1TGX A;  4QTI U;  1CCQ A;  2PJY B;  1FRA A;  2HLQ A;  1KL8 A;  1CDT A;  1NXB A;  1CDR A;  1KFH A;  3BT2 U;  1ERA A;  1KBA A;  2QJB C;  3PLC A;  1QM7 A;  2MJ4 A;  2MJ0 A;  4HQP F;  1FF4 A;  1IQ9 A;  5IMT D;  2UWR A;  3QB4 B;  2MUP A;  4BIK B;  1IKC A;  1MAH F;  1NEA A;  1NYU A;  2GOO B;  2H62 C;  1PLO A;  2MJY A;  1M9Z A;  2I9B E;  1CDS A;  1KBT A;  3BT1 U;  4FAO E;  2PJY C;  2JVE A;  1KS6 A;  4AEA A;  1REW C;  1FSS B;  2QJA C;  3ERA A;  2N99 A;  3U73 U;  1BXP A;  4XJJ A;  1NYS A;  1IK8 A;  1MR6 A;  2MHY A;  1W6B A;  1ABT A;  1FAS A;  2L03 A;  1H0J A;  1IDI A;  2GOO C;  2H64 B;  4BDT B;  2QC1 A;  1LXG A;  1CHV S;  3LAQ U;  1VB0 A;  1NOR A;  4RUD A;  2BTX A;  1F8U B;  2UX2 A;  4P7U A;  1HAJ A;  1IDL A;  1HC9 A;  2HLR A;  1KXI A;  1ZAD A;  1FFJ A;  2MUO A;  5DU1 A;  1KBS A;  1ERG A;  1I02 A;  3U74 U;  3EVS C;  1L4W A;  1FSC A;  1HC9 B;  4FAO C;  1CVO A;  3NEQ A;  1CXO A;  4UY2 C;  4EY8 B;  3KFD E;  1CTX A;  2H64 C;  4ZQY A;  1QKE A;  2NBT A;  1BTE A;  1IDH A;  1S4Y A;  2H5F A;  1JE9 A;  1UG4 A;  2FD6 U;  5DZ5 A;  1TXA A;  2OFS A;  5EBX A;  1CB9 A;  2L5S A;  1HAA A;  1QKD A;  1HOY A;  1V6P A;  2JQP A;  2H8U A;  1NTX A;  1COD A;  2LA1 A;  2VLW A;  1LX5 B;  2CDX A;  1DRS A;  1B41 B;  1KU6 B;  1IJC A;  4OM4 A;  1TXB A;  2CTX A;  2CRT A;  2CCX A;  3NH7 A;  2BHI A;  1CDQ A;  1JBD A;  1CXN A;  2ERA A;  3FEV A;  2H7Z A;  2CRS A;  3EBX A;  1CRE A;  1XT3 A;  1F94 A;  3KFD I;  2K3G A;  4IYE A;  3VTS A;  5IMY C;  2X8B B;  6EBX A;  2QJ9 C;  2MFA A;  4OM5 A;  2ABX A;  2H62 D;  1CRF A;  2H7Z B;  1LJZ A;  1IDG A;  1RL5 A; 
#chains in the Genus database with same CATH topology
 1JGK A;  1ONJ A;  1G6M A;  1ES7 B;  4LFT A;  1RGJ A;  1NTN A;  1LXH A;  4DO8 A;  2J8B A;  3HH7 A;  1LSI A;  3NDS A;  1COE A;  1KTZ B;  1KC4 A;  5DO6 A;  1YWH A;  2LCR A;  1TFS A;  1TGX A;  4QTI U;  1CCQ A;  2PJY B;  1FRA A;  2HLQ A;  1KL8 A;  1CDT A;  1NXB A;  1CDR A;  1KFH A;  3BT2 U;  1ERA A;  1KBA A;  2QJB C;  3PLC A;  1QM7 A;  2MJ4 A;  2MJ0 A;  4HQP F;  1FF4 A;  1IQ9 A;  5IMT D;  2UWR A;  3QB4 B;  2MUP A;  4BIK B;  1IKC A;  1MAH F;  1NEA A;  1NYU A;  2GOO B;  2H62 C;  1PLO A;  2MJY A;  1M9Z A;  2I9B E;  1CDS A;  1KBT A;  3BT1 U;  4FAO E;  2PJY C;  2JVE A;  1KS6 A;  4AEA A;  1REW C;  1FSS B;  2QJA C;  3ERA A;  2N99 A;  3U73 U;  1BXP A;  4XJJ A;  1NYS A;  1IK8 A;  1MR6 A;  2MHY A;  1W6B A;  1ABT A;  1FAS A;  2L03 A;  1H0J A;  1IDI A;  2GOO C;  2H64 B;  4BDT B;  2QC1 A;  1LXG A;  1CHV S;  3LAQ U;  1VB0 A;  1NOR A;  4RUD A;  2BTX A;  1F8U B;  2UX2 A;  4P7U A;  1HAJ A;  1IDL A;  1HC9 A;  2HLR A;  1KXI A;  1ZAD A;  1FFJ A;  2MUO A;  5DU1 A;  1KBS A;  1ERG A;  1I02 A;  3U74 U;  3EVS C;  1L4W A;  1FSC A;  1HC9 B;  4FAO C;  1CVO A;  3NEQ A;  1CXO A;  4UY2 C;  4EY8 B;  3KFD E;  1CTX A;  2H64 C;  4ZQY A;  1QKE A;  2NBT A;  1BTE A;  1IDH A;  1S4Y A;  2H5F A;  1JE9 A;  1UG4 A;  2FD6 U;  5DZ5 A;  1TXA A;  2OFS A;  5EBX A;  1CB9 A;  2L5S A;  1HAA A;  1QKD A;  1HOY A;  1V6P A;  2JQP A;  2H8U A;  1NTX A;  1COD A;  2LA1 A;  2VLW A;  1LX5 B;  2CDX A;  4KSN A;  1B41 B;  1DRS A;  1KU6 B;  1IJC A;  4OM4 A;  1TXB A;  2CTX A;  2CRT A;  2CCX A;  3NH7 A;  2BHI A;  1CDQ A;  1JBD A;  1CXN A;  2ERA A;  3FEV A;  2H7Z A;  2CRS A;  3EBX A;  1CRE A;  1XT3 A;  1F94 A;  3KFD I;  2K3G A;  4IYE A;  3VTS A;  5IMY C;  2X8B B;  6EBX A;  2QJ9 C;  2MFA A;  4OM5 A;  2ABX A;  2H62 D;  1CRF A;  2H7Z B;  1LJZ A;  1IDG A;  1RL5 A; 
#chains in the Genus database with same CATH homology
 1JGK A;  1ONJ A;  1G6M A;  1ES7 B;  4LFT A;  1RGJ A;  1NTN A;  1LXH A;  4DO8 A;  2J8B A;  3HH7 A;  1LSI A;  3NDS A;  1COE A;  1KTZ B;  1KC4 A;  5DO6 A;  1YWH A;  2LCR A;  1TFS A;  1TGX A;  4QTI U;  1CCQ A;  2PJY B;  1FRA A;  2HLQ A;  1KL8 A;  1CDT A;  1NXB A;  1CDR A;  1KFH A;  3BT2 U;  1ERA A;  1KBA A;  2QJB C;  3PLC A;  1QM7 A;  2MJ4 A;  2MJ0 A;  4HQP F;  1FF4 A;  1IQ9 A;  5IMT D;  2UWR A;  3QB4 B;  2MUP A;  4BIK B;  1IKC A;  1MAH F;  1NEA A;  1NYU A;  2GOO B;  2H62 C;  1PLO A;  2MJY A;  1M9Z A;  2I9B E;  1CDS A;  1KBT A;  3BT1 U;  4FAO E;  2PJY C;  2JVE A;  1KS6 A;  4AEA A;  1REW C;  1FSS B;  2QJA C;  3ERA A;  2N99 A;  3U73 U;  1BXP A;  4XJJ A;  1NYS A;  1IK8 A;  1MR6 A;  2MHY A;  1W6B A;  1ABT A;  1FAS A;  2L03 A;  1H0J A;  1IDI A;  2GOO C;  2H64 B;  4BDT B;  2QC1 A;  1LXG A;  1CHV S;  3LAQ U;  1VB0 A;  1NOR A;  4RUD A;  2BTX A;  1F8U B;  2UX2 A;  4P7U A;  1HAJ A;  1IDL A;  1HC9 A;  2HLR A;  1KXI A;  1ZAD A;  1FFJ A;  2MUO A;  5DU1 A;  1KBS A;  1ERG A;  1I02 A;  3U74 U;  3EVS C;  1L4W A;  1FSC A;  1HC9 B;  4FAO C;  1CVO A;  3NEQ A;  1CXO A;  4UY2 C;  4EY8 B;  3KFD E;  1CTX A;  2H64 C;  4ZQY A;  1QKE A;  2NBT A;  1BTE A;  1IDH A;  1S4Y A;  2H5F A;  1JE9 A;  1UG4 A;  2FD6 U;  5DZ5 A;  1TXA A;  2OFS A;  5EBX A;  1CB9 A;  2L5S A;  1HAA A;  1QKD A;  1HOY A;  1V6P A;  2JQP A;  2H8U A;  1NTX A;  1COD A;  2LA1 A;  2VLW A;  1LX5 B;  2CDX A;  4KSN A;  1B41 B;  1DRS A;  1KU6 B;  1IJC A;  4OM4 A;  1TXB A;  2CTX A;  2CRT A;  2CCX A;  3NH7 A;  2BHI A;  1CDQ A;  1JBD A;  1CXN A;  2ERA A;  3FEV A;  2H7Z A;  2CRS A;  3EBX A;  1CRE A;  1XT3 A;  1F94 A;  3KFD I;  2K3G A;  4IYE A;  3VTS A;  5IMY C;  2X8B B;  6EBX A;  2QJ9 C;  2MFA A;  4OM5 A;  2ABX A;  2H62 D;  1CRF A;  2H7Z B;  1LJZ A;  1IDG A;  1RL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...