1CEQA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
304
Chain Sequence
PKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 110
structure length 304
sequence length 314
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ceqA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ceqA02
5B4TA 1XHLA 4F3YA 4AJ2A 1GEGA 3VPFA 4RORA 4EW6A 1G1AA 2DC1A 2AG8A 4B3JA 2ZB7A 3F4BA 4W7IA 4NBWA 3CH6A 2VN8A 2B69A 1GPDG 4Y67A 1M76A 2EW8A 1VI2A 3JQFA 3FF4A 3D1LA 4NJOA 1K3TA 4E2XA 4KDFA 5CHEA 4GMGA 3PRJA 3KYDB 2WD7B 2WEKA 3GUYA 3KXDA 4FJ1A 4XJSA 1ADCA 1SO8A 3ZGYA 4BNWA 3WGYA 1YO6A 4FCCA 4R9SA 3RQSA 1I2BA 2Q50A 4XCVA 4BMVA 2Y68A 1D7OA 4BKPA 2X6TA 1ISGA 1WLYA 3GAFA 1EVZA 3OJFA 4RCVA 5JAZA 1PJ2A 4FIZA 5EERA 2Q99A 2B35A 3DFUA 3S8MA 1E7SA 2FPGA 3WJAA 1YDEA 5GY7A 4D42A 1LRLA 4IMPA 3GVIA 2C20A 1Y8RB 4LVUA 2VYND 1I5RA 1BWSA 4CM3A 1A27A 1R4NB 2B4TO 2HMUA 4NG5A 3A14A 3K73O 2EJWA 4GPD1 2C82A 4PVDA 3ZWBA 4PG5A 1ZEJA 4QFCA 4XR4A 3VPXA 1ZCJA 2YV3A 1HDXA 4PVCA 4U6SA 1NVGA 5DCUA 3OA2A 3COSA 3RU9A 4AJ4A 4DQVA 1EFKA 3DAPA 4JIGA 1E3LA 2RCYA 4X54A 4KP7A 4CLEA 3N7UA 4DWVA 5JS6A 2WTBA 1O5IA 3ASUA 3ULKA 3LC1O 2PGDA 3KHUA 4FFPA 2DTEA 4TVBA 3G3EA 4D3FA 2FRDA 1U7TA 4XIYA 2VT3A 2Y93A 3ZI0A 5A9TA 4EEZA 3HB4X 3TOXA 4PFJA 1H6AA 1Y5RA 2G5CA 3KLPX 5A5EA 4AL4A 1C1XA 1Q0LA 2P68A 1EZ4A 1TT5B 3VKVA 4YPOA 1P1KA 1B14A 3I5MA 1I8TA 2NU9A 1EUDA 1Z82A 2A4KA 1NR1A 2O23A 1F14A 1YVEI 5CDYA 1SEPA 3DZKA 1GZ3A 1LC3A 1NQAO 2F1KA 2ZATA 3F47A 3ON5A 4AJNA 4DMMA 5L95A 1R66A 4A27A 1XKQA 2IZZA 4N7RA 1H94A 3GLQA 3OQBA 4WASA 1HT0A 5KKCA 3HJAA 4MIOA 1KVUA 4B4WA 1DAPA 4D79A 1E1NA 2UAGA 2HK9A 1V0JA 1PS8A 4PZDA 3ZWOA 5IJZA 3QVWA 1E5LA 1H9BA 1ZJZA 2O3RA 1FMCA 4CMGA 3RC9A 2BF7A 5JO9A 4ILKA 3DL2A 4JX8A 4JXKA 4GQAA 4IJVA 3TL3A 4ZRNA 4C7KA 2DFVA 5FF9A 5IXSA 3HFSA 1VJ0A 1DIRA 4CM7A 4J1QA 1LLQA 2ZQZA 1P74A 2RIRA 3W8EA 2VHZA 4JJIA 4WNIA 4DA9A 5I7EA 1PQPA 1PZEA 2W2LA 4Z9XA 1N7GA 3JSAA 4NU6A 2QHXA 3QWFA 5U1PA 3DMTA 5MGBA 2RAFA 1KEWA 4ZU3A 3WQSB 4XA8A 1YQXA 3U49A 1E3SA 2ZKLA 2JKVA 3E5MA 4FFMA 4HFMA 3I6IA 1Q1NA 3EAGA 4AJEA 4OH1A 3U4CA 4IDCA 1I2ZA 2D8AA 3FCOA 3GR6A 3VOSA 2OGUA 3A06A 5BNIA 4DTIA 2IEBA 3FRJA 1GYPA 1I3NA 3KRTA 3BMNA 4Y98A 1OZAA 1UXIA 4R51A 1HDYA 3LU1A 4JBGA 5TX7A 2EKLA 5I9MA 1X0VA 4ND3A 1XIVA 2YFQA 1PR3A 1SBYA 4M8SA 3MTJA 4HP8A 3U9LA 2FSSA 1KYQA 1X13A 3GN1A 2EGHA 5CDTA 1EEHA 5JDCA 4C7JA 2CUKA 3BTUA 4RVFA 4KQWA 5HWSA 4Z3DA 1B8PA 2FY8A 3EW7A 1E77A 3GG2A 1QRRA 3K5PA 3UN1A 1WMAA 3E1KA 4RL6A 4YT8A 4FS3A 4NK4A 3VVCA 2VT2A 3OMLA 1M67A 4BO8A 3AFMA 4ND2A 4HFNA 4MVJE 5CP8A 2XPCA 2C5EA 1ZH8A 1GFSA 4PCVA 3ANLA 1I0ZA 2O3SA 4CUKA 4FGSA 2D5CA 4BL5A 1LDGA 2OUIA 4UUNA 4INAA 2W2KB 4XGIA 3EZYA 3JQ9A 5DZSA 1GZ4A 2Q1WA 4LGVA 4XQEA 2XF8A 3PK0A 2CVZA 1EVIA 3DBLA 1VJ1A 2TMDA 4MVJP 2EERA 4TKLA 4KUHA 3ZWPA 2VWGA 4BGUA 3NTRA 3KZVA 4I9NA 1PEDA 3F4LA 5G0TA 1U2GA 3JD2A 3K30A 3SC4A 2B83A 2P9EA 3W4IA 3UOGA 4JJGA 3UICA 5IAAA 3ZH2A 3DEYX 3H5NA 3GNQA 2RHRA 1O95A 3W8DA 2NACA 1FDTA 1PJTA 4LSWA 3KB6A 2Z1NA 1C0LA 4RZHA 2Q3EA 1PX0A 1LDYA 4II3A 4NK5A 2JCVA 2WE7A 3DTYA 3LT2A 3UHAA 2O2SA 2VQ3A 3QA9A 2GO1A 2EIHA 3TQHA 4CM6A 1NX6A 3WNVA 3Q2IA 3WLEA 4KUEA 3IP1A 2EP5A 2PZKA 4B7CA 1V6AA 2NV6A 4MVJD 4CODB 1E3WB 2DAPA 5LDHA 3JD0A 1V8BA 3WSVA 1UUFA 2VHVA 1VLLA 1YL5A 2W4QA 4CLDA 3D3WA 2IZ0A 2FOIA 3WDSA 4CM8B 1R6DA 2FR0A 2PZLA 3S2GA 2PD3A 3K9QO 2DTDA 3VAZA 1EE9A 2NVBA 1GUYA 3IKVA 1B15A 3HSKA 4ALJA 1EUCA 4D0SA 3AI3A 1B3BA 3U0BA 4XYLA 2VOEA 3MCVA 1GQYA 3H9JA 2BRUA 1RPNA 3D7LA 2PGLA 4ZD6A 2D2IA 3BA1A 1VC2A 2Y1FA 1JWBB 3ZU4A 1UZMA 1OMOA 4UEOA 4CM9D 2QX7A 3C1OA 3G17A 2YV1A 3SBOA 1IYZA 4JGBA 4P4GA 1BVUA 3VPSA 5GZ3A 3CZMA 5J23A 3UUWA 3GVPA 4Y6RA 4WLVA 3AWDA 1JW9B 1H93A 1ZXLA 3IUSA 1L7EA 4MIEA 1MX3A 2ET6A 1KOLA 1EUZA 4KMSA 4TSKA 1LA2A 4K6CA 1E6WA 4WJZA 1VRWA 4LW8A 3TZCA 4Y6PA 1DPGA 1JTVA 1NAHA 3K2EA 1DIGA 4RVSA 2X58A 3R0IA 1G6KA 3CMMA 3DHEA 4KUGA 3WGHA 5I9LA 1WNTA 1ID1A 4I1IA 1AXGA 3UXYA 4J0EA 3DOOA 1WWKA 4YTEA 2NTJA 4E12A 2Y1EA 3HDJA 1F17A 2IEDA 4WCFB 5ES3A 1HE3A 3RWBA 5T64A 5MDHA 1JVBA 4PG8A 1HYHA 4W7HA 1FJHA 2Y0DA 4HNHA 4M86A 3WMXA 2I76A 1WDKA 1MB4A 2G17A 4RF2A 3ZN2A 1U4SA 1UZLA 3D4OA 3R1IA 3BYZA 3LF1A 1DC5A 3BTOA 3NYWA 3WOHA 4AJLA 5GZ1A 4LSMA 3BMOB 4GWGA 1Z6ZA 5IDXA 1JA9A 5KVCA 1FK8A 3JQ8B 1PJQA 3ROQA 5IF3A 4IMRA 5EIOA 5LC1A 4R41A 5BQFA 3LK7A 1Y5MA 2EG9A 3AUAA 1DRWA 2JD1A 3MWDB 1UH5A 3G0OA 1C1DA 2LDBA 3B6ZA 3KYCB 1ONOA 2YY7A 1IHXA 3VDRA 3JQAD 1R4MB 5IZCC 4GVXA 2XXBA 1J4AA 3UVEA 1Z7BA 4RV9A 3ZWXA 1XSEA 3O8QA 1MFZA 5JDIC 5K0ZA 1MG5A 2DUWA 5COAA 2WYWA 4GBJA 3VPGA 3GAZA 4JP2A 4TWRA 2W8ZA 3WWYA 3JYNA 2B5VA 4XRGA 2D4AA 3NRCA 2GN4A 3OIGA 4QECA 3M1AA 2AG5A 1EFLA 3SVTA 3GGOA 2OFPA 2BFAA 2NQTA 3LLSA 2J5KA 2NSDA 2P9CA 4IQGA 3LF2A 1T2DA 3U4DA 3PJDA 4YJDA 5F1KA 3WQQA 2D59A 1QYCA 4D41A 5JYEA 4RF3A 3S2EA 3NDIA 3HE3A 4YEDA 1P1HA 5JXWA 4Z6KA 3DC2A 4RGBA 1R37A 3ZW8A 2A94A 3EK2A 1EMDA 3JYPA 3P19A 1JN0A 1KVSA 3S2IA 1UP6A 3OH8A 1LDBA 4ZQHA 5I7FA 3ETDA 3L4BA 4D3SA 3DHNA 4GKBA 3W1VA 3VZPA 4BO4A 5JW6A 4CMKA 2F00A 2FSVA 3MJCA 4I5DA 4U0KA 4DL9A 3OQ1A 4YT4A 5A9SB 4BIIA 4NFHA 2VUUA 3EVTA 4DLLA 3ITKA 3WJ7A 5B4UA 4YQYA 1HYGA 3I6QA 1T2EA 3JQ7B 3O9ZA 1HDRA 3AJRA 4ND4A 3QP9A 5BSGA 4R1TA 5AXDA 9LDBA 1H2HA 3OQ6A 3E8XA 3S1LA 2A9FA 2R00C 4BQRA 2WYUA 2I65A 3QWBA 2ZYGA 2Y1CA 2ILTA 2XOXA 3KYDA 3DBLB 2G0TA 4ZQBA 4YAEA 3MJEA 3WTCA 5C7LO 1VSVA 5T8KC 3LLVA 2D0IA 1MV8A 3ZU2A 2E82A 2YFHA 1LTHR 3DR3A 2IYOA 5KVSA 3JYOA 1GYRA 2PZJA 3GPIA 5BR7A 4ONEA 5ADHA 4KDEA 3H2SA 3HFGA 3SXPA 1ZK3A 1JLLA 2OP0A 4NBRA 3WBBA 4B4VA 1Y8RA 4FC7A 1WAMA 3RAJA 4A0SA 4QEDA 4LK3A 1R4NA 2Q49A 1GDHA 4MVJG 3GNSA 3MZ0A 3IOYA 4NHEA 4H3VA 1LBEA 1VKOA 4A03A 5BSFA 3ZW9A 3DB2A 1RYEA 5A03A 3BMQA 4ROSA 2VHXA 5JMWA 4YACA 1MP0A 4J6FA 4AJOA 3RASA 2WJPA 2CDBA 1T25A 1ZW1A 4CM4B 3WYCA 5TRTA 3TOZA 1PJLA 4O59O 1T4DA 5C5IA 4NDNE 1DSSG 4M87A 1NYTA 3GC6A 3INGA 1PGJA 2X0IA 4Q3DA 1JU9A 3EY4A 1PJSA 3WQRA 5JAIA 2BHLA 5G0VA 1QR6A 5L7YA 5KNLA 1UP7A 3DONA 4QQRA 4BO2A 1U2DA 1TT5A 4OAQA 2LDXA 3IC5A 1L1FA 2GYYA 1G0OA 3CTMA 3IDSA 3AY7A 3FR8A 1DDOA 2DT5A 1XU7A 1K89A 1YL7A 4J1TA 1ENZA 3O38A 4EI2A 3WLFA 1Q0HA 1IZ9A 4F6LA 3G1UA 3Q11A 4Q3EA 1CETA 4DPKA 5KJEA 3C85A 2ZYDA 3PXXA 4PLGA 5F3RA 2PH5A 4XGKA 4GI2A 3UKOA 3PI7A 2AE2A 3CZRA 2IE0A 4R01A 1HL3A 3GNTA 3VTZA 1VL6A 2Q4EA 4BKQA 3C8MA 1U5AA 1DRUA 2BFPA 1P0CA 5TT0A 4CJXA 4OXKA 3AM3A 2EWMA 4P4NA 4GH5A 4NR0A 4JBHA 2OP1A 5JFOA 1Q0QA 1ZO8A 4HBGA 3HWRA 4D43A 3IKTA 2P9GA 1XLTA 2VNSA 4MDHA 1OI7A 4Y8VA 4WLEA 4D44A 1NBOA 2D1YA 5EN4A 4HKTA 5TF4A 3JQFC 5CG2A 4FQ8A 4CL3A 1E3JA 2X5JO 3KEOA 4EGFA 3UCXA 4OOFA 3EYWA 1HZJA 4KTVE 4WLNA 1TT7A 3DZGA 5TJ9A 1OOEA 3LT4A 3H2ZA 1P9LA 3PQEA 3D5TA 4RVGA 5BNFA 1LC0A 2DUUA 4OMUA 1KVTA 3VC7A 2SCUA 1BMDA 3ETEA 3L6EA 3QJ5A 4G5HA 4L8VA 4R3WA 1BG6A 4BNGA 1B8VA 4PLWA 5FI3A 3RVDA 2W98A 2Z1MA 1ISJA 3KVOA 4KWIA 1LSSA 1WPQA 3FR7A 5I9NA 1HSOA 2G82A 2I3AA 4J49A 3ENKA 2QRJA 2BH9A 1H9AA 5DULA 3W6UA 2OBNA 5KOIA 3EVNA 3KYBA 3O8QB 4ND5A 3GPDG 1H2BA 4GX0A 4CMJA 3TJRA 2O50A 4BKRA 3DXFA 1ENYA 1ZJYA 1E1KA 3EC7A 4XYMA 4ALIA 2W2KA 4J4BA 4WK6A 1E5QA 2PFGA 4BHTA 4DBVO 1P1RA 1T2AA 3ENNA 3PGJA 5U9CA 1ISIA 2BFOA 4RLSA 5AXCA 5AVOA 2HMWA 4L74A 5IDYA 3RBZA 3STHA 1DLJA 3VTFA 4BV8A 3PYXA 3W8FA 2QG4A 4R1SA 4ZA2A 2JHFA 4CLRB 4DBZA 2HQ1A 2VZ9A 1BDBA 2YW9A 2AQKA 1DC4A 4QUKA 3T7EA 5B12A 4BUCA 1KBZA 2GERA 3INTA 3IS3A 4J16A 1YGYA 2EP7A 4R69A 4BVAA 2EW2A 3AW9A 3L0DA 1DB3A 1GYQA 3PGXA 3DZFA 2G76A 1I36A 4FPXA 2PKQP 4IUYA 3UAGA 3GY0A 2OHXA 2Q1SA 4LCJA 2AXQA 1QYXA 2POQX 2EEZA 3S2FA 3ST7A 3PHIA 2X1HA 3ZCXA 2GDZA 5JLAA 3K8ZA 1YDWA 3ZZNA 4E3ZA 1GUFA 1E3WA 3IMFA 3OEYA 1NR7A 3QWAA 4PG7A 2HK8A 4JROA 1C0KA 2IODA 4PLCA 4CM8A 4IIUA 1MXFA 3DHYA 1TB4A 5DCYA 1S7CA 4IS3A 4YCAA 4CMHA 2Y1DA 3R3JA 4TZTA 3I83A 3PDJA 2UUPA 4BNYA 2NUAA 2V6BA 1I3LA 3E18A 3CINA 2I6TA 3A9WA 5G4LA 3UH1A 3MEQA 3H8VA 5DNAA 3QY9A 4CQMB 3F46A 2DLDA 3DMTC 4R5HA 3WGOA 3QV1A 2CZCA 4CV2A 3DDNA 5EESA 3GZ4A 3U3XA 3SJ7A 4S1VA 2NNLD 3GH3A 1UR5A 1LLUA 3CXRA 3IQDB 4IJUA 3AOGA 3I9NA 4ZICA 4N18A 1ZK4A 1LRKA 3RD5A 3RC1A 2J3HA 4ZQGA 4JK3A 2HRZA 2HO5A 1KEPA 3PYLA 2NVUB 3V1UA 1Z75A 2E48A 5A04A 5C37A 3KLMX 1MFPA 3BMQB 1XELA 4XR9A 4WOJA 5JDCC 1KVRA 4MOWA 1HE4A 1VL0A 3WYBA 3Q6IA 1UJMA 1RM4A 2JFGA 1EVJA 5BSHA 2X86A 3LVFO 4YVFA 2QZ9A 3ABIA 1YB5A 1HE2A 2QYTA 4J43A 3PHHA 4WCFA 3UCFA 3K31A 1EQ2A 1LSUA 4ALLA 5T57A 4C4OA 3ADOA 3I9KA 4AG3A 2DBVO 1A4UA 1NPTO 2JFFA 3VH2A 2VRBA 3LC7O 3HDQA 2WD8A 1Y8QA 3ZV3A 3PP8A 3SLGA 4BO6A 5L51A 3JQ9C 3X2FA 4MIYA 4WEQA 4NMHA 4D46A 3JYLA 4IINA 4YA6A 3JYQA 2FN7A 2YQ5A 3AU9A 4FDAA 3BMOA 1U1IA 4MVJI 3IJRA 3QVTA 5CDGA 1SEVA 4GSKA 1KETA 4KOAA 4BO1A 1YQGA 4ALKA 3JQ8A 3GHHA 3UFXA 4Q3AA 3E9MA 5BSEA 1NHWA 1PGNA 2D5AA 1WMBA 4OGWA 4W82A 3ZWCA 4CV1A 3TSCA 1GY8A 3D4PA 4BQPA 4B4UA 1E7MA 2ZB3A 4E5KA 1DXYA 1EBFA 5A3JA 3V1TC 1ISFA 2O2YA 2W2LD 3L4SO 4QXMA 4E6PA 4YR9A 4EJ6A 3KYCA 4WEOA 4K6FA 1NQ5A 2X22A 3OJLA 1G0NA 1R4MA 3GT0A 4BNVA 4N5NA 5ITVA 3UGKA 4BGEA 1J0XO 4W4TA 1SC6A 3K2BA 1A9YA 3ROKA 3MJVA 1R16A 4NU5A 1ADFA 4OKIA 3BZUA 1I32A 1W6UA 4LRTB 3KETA 3TFQA 3MJTA 2Q2VA 5AYVA 5T67A 4UREA 3KSDO 4IQ8A 2I9PA 2X7HA 4H15A 1QLJA 3I1JA 3H7AA 3W4JA 2BI7A 4MP3A 2IZ1A 4CLOA 4MINA 1MA0A 4NFYA 1EK5A 2QZZA 1PWZA 3TPCA 1LQTA 1XG5A 2HUNA 4KTTE 4CPDA 3HDYA 1PGQA 3JQBC 1BXKA 3FI9A 3QW2A 3WYEA 2OXIA 1LQUA 1I33A 5IN5A 3WGZA 3NKLA 2X23A 4LMRA 3RU7A 5A9SA 2C2XA 1NPYA 4I5GA 4MJLA 2HCTA 3AUUA 4TRNA 1YBVA 5THQA 1CDOA 1S6YA 2NADA 3PWSA 2GLXA 4CL8A 4UVIA 2EHDA 1JVSA 3JQ7A 2VUSA 4I08A 4RF5A 1RJWA 2AHRA 1E7YA 3ZHBA 3FBTA 5C3MA 5TNXA 1IZ0A 1I2CA 1LSJA 1DO8A 2B37A 1XEAA 3HHPA 1U7HA 2V65A 4HXYA 2CMDA 4Z0TA 5IXYA 1GAEO 3JQEA 4FN4A 1JKIA 2ZTUA 1GCUA 4OXNA 4XYGA 1I3KA 1K6JA 4J90A 2P4QA 4FBGA 1GTMA 4BNXA 4M49A 4U5QA 4PLZA 5G0SA 3RI3A 1YKFA 4L9RA 2UVDA 1YBAA 4GX1A 4G81A 4TQGA 1KY5A 5ILGA 5JC8A 1GR0A 3ONFA 4XX0A 4GVLA 1PR9A 1YWGO 4WPGA 2O7QA 4IXWA 2IXAA 5F21A 3RUIA 1W73A 3VPHA 5JAQA 3BHIA 4D7AA 1NPDA 3ZDFA 1E7RA 1ONPA 4EEXA 2RH4A 3G1TA 5EMHA 2HLPA 1DFGA 1Y6JA 2Y05A 5I7VA 4DQUA 3I9JA 3V2UA 1SOVA 3DAFA 1EQUA 2IRWA 4XJTA 1LSOA 4BGVA 3DTTA 4YQZA 2C7VA 2CY0A 2GSDA 2NVWA 4TRRA 4DLAA 5HRUA 3GMDA 5C7OO 4EZBA 4G2NA 5ICMA 4XGNA 2GRAA 3VZRA 1XA0A 2X9NA 3GVXA 4CM4A 3TL2A 2PH3A 5ER9A 3JQGB 1TLTA 5ITWA 4RQUA 2Y0EA 4A26A 1ULUA 1Y7TA 2GF2A 3VVBA 3HUDA 1DFHA 2YHIB 2AE1A 3WGTA 5CPFA 4IDEA 5G4KB 4CMEA 1PGOA 3PQFA 3ZNPA 4TKMA 4PGFA 1MC4A 4DRYA 1F8FA 2PR2A 3ZWVA 4TVOA 3LDHA 1LXCA 1MUUA 1DJQA 1PJ3A 4BNLA 2YZ7A 4EUFA 2CVQA 3VDQA 1R12A 3DBRB 3GRPA 3KUXA 4XDYA 2Y67A 5T6BA 4A73A 2X0RA 2VOJA 3Q2KA 5TSDA 2QW8A 4M1QA 4CM5A 5ENVA 4F6CA 5CEEA 2CF6A 3RBXA 1I10A 3OETA 3AOEA 1MG0A 3V8BA 4CMCA 2Y1OA 4IBOA 1NFFA 2BI8A 4RJTA 2FR1A 4BNIA 2E4AA 1H0KA 4WLOA 5C7IO 1PZHA 4IGEA 3HN2A 3I9LA 3L4BC 4ID9A 4CM9A 2A92A 4QT0A 1LDMA 4N5LA 3D3EA 3S55A 5KIAA 4DGSA 4BNHA 3DO5A 4HV4A 4ZRMA 1Z45A 5A9RA 3PZBA 3FWZA 1OFGA 1UXJA 2GGSA 1PJBA 2Q1TA 1O8CA 2AQIA 4DPLA 1N1EA 4E5YA 4PN3A 3GDFA 1Y8QB 4U0JA 3C7CB 1MGOA 3C1AA 1J6UA 3H6KA 1DC3A 1XU9A 2FPIA 5L3ZA 1SB8A 4OOEA 4RPHA 4XYBA 4J3FA 2X0JA 1DOHA 3PIIA 4B4OA 5TJHA 3HZZA 3JCZA 2GPTA 4L4XA 5JAMA 3QVXA 1ISHA 2IXBA 2BGLA 4GKVA 4E2ZA 4E4YA 3MOGA 4J7UA 4XD2A 3GZNB 4RF4A 3PWZA 5JC1A 3FTPA 4PLFA 2P5YA 1EK6A 2C54A 1YL6A 1QYDA 4R3NA 4XKJA 5DT9A 3PJFA 5G0WA 1TEHA 4NQZA 5EPOA 1PL6A 2Y0CA 8ADHA 5JCJD 1E0DA 1FXSA 4E5NA 4DYDA 1F8GA 4CQLB 2I99A 2OL4A 2VHWA 4PRLA 5IG2A 1PJ4A 1QLHA 2H9IA 2QQ5A 4U7WA 3K92A 1D4FA 1NM5A 3W6ZA 3QQPA 5ER6A 1SB9A 2V6GA 4ZJUA 4NJMA 3ZWWA 2VTEA 3RUFA 4UUOA 4YT5A 1M75A 5GZ6A 1C3VA 5A5FA 3F1KA 3U5TA 4NBTA 3PIDA 3WGGA 1HLDA 1KERA 4HX5A 4L4RA 4DIBA 2FZWA 3NT4A 5JE8A 3IIEA 4BNNA 2P91A 4CLOB 2UYYA 3D64A 4ESOA 1K0UA 3MWEB 4BNKA 4DLBA 1LEHA 2ZB8A 2ZQYA 3C24A 3KOUA 4CLRA 1H5QA 5A1TA 4JQCA 4J4HA 1WW8A 1XWFA 4BNTA 3QWIA 2EF1A 3V5NA 5K6AA 3JQAA 1T2FA 4IXTA 4XB1A 4IDGA 2EGGA 3CUKA 2OOSA 2GUGA 1HRDA 1DC6A 2HJRA 3H9GA 1ZVMA 4RVDA 1BDMA 3V2GA 3F1LA 4CR6A 4FOOA 1MC5A 1CYDA 5KVQA 1NVMB 3NGXA 1XQ6A 4RPJA 4CV3A 1WDLA 4D0RA 5A06A 2YV2A 4N54A 4PRKA 3QVOA 3G79A 3VKUA 1QP8A 4MPDA 3H5RA 4JNKA 4EDFA 4HADA 2Q2QA 2BD0A 3FNHA 3LYLA 1KY4A 4LCEA 1DRVA 4DUPA 1X7HA 1FF9A 1VJTA 1GU7A 4FD3A 4U8GA 1CRWG 4IY1A 5B1YA 3EMKA 3PHJA 3H65A 3KM0A 1UP4A 4N5MA 3DZHA 3OHSX 4OHUA 3QVSA 1UAYA 1E3EA 2DM6A 4MKXA 4CQMA 3RIHA 1U4OA 3U4IA 4E0BA 1ORRA 4BV9A 4GGOA 3B1JA 3DFZA 4QO7A 5KTKA 1VPDA 2J3KA 1E1LA 3PFFA 2ZTMA 3H9EO 3OP4A 3JD1A 2ZTLA 1YQDA 4QX6A 1RM0A 4E13A 1IUKA 4B7UA 4PLHA 2HRBA 3LC2O 4AJHA 3F3SA 3FPLA 4QO8A 4J9UE 1YRLA 5L7TA 1N5DA 4Z9FA 3O03A 1CEQA 3Q3CA 1HDCA 2YUTA 4YB8A 4OKNA 3SLKA 1U28A 1BVRA 5HA5A 4BO5A 2NVUA 4RLHA 1PQWA 1GL3A 1GUZA 4L73A 2YYYA 5DOZA 3SC6A 1BXZA 3UCEA 3DQPA 5IFLA 4YJHA 5JYDA 1N9GA 1PIWA 1PJCA 4UVDA 4A10A 3P2OA 2VYVA 4J2HA 5HM8A 2YJZA 1HDZA 3BXXA 3RFXA 2B4RO 3B70A 4O0LA 4AFNA 4YRBA 1QMGA 1ZZEA 1M6HA 1D8AA 4RVHA 5DDIP 5F1PA 1O0SA 1R15A 3A4VA 1X7GA 2B4QA 4FJ0A 3OJOA 4UUPA 4DREA 3E03A 3E5RA 3MJSA 2NTNA 4ITUA 4XZ3A 2VZ0A 4BKOA 1A71A 2RBEA 4JN6B 3F6YA 3TNLA 4CR8A 1I3MA 4E21A 2V6FA 4FOSA 1QXSA 2ZJ0A 4DYVA 2J5QA 4DIFA 2QIOA 2FHSA 2BGKA 4CUJA 5KJ6A 3L07A 2IYPA 4DPMA 4YWJA 1XCBA 3NJ8A 1RM3A 4RPLA 3RC2A 4RDIA 4E31A 1U3TA 4YAKA 1JAXA 2J8ZA 2AEFA 1H6DA 4MVJF 4ZGWA 4WLUA 3D0OA 1E1MA 3BTVA 4IS2A 1AXEA 2E6UX 4DC1A 2EV9A 1DLIA 5JMPA 2AA3A 1ZXBA 3T7CA 1SNYA 1E7QA 1P1FA 3NJ4A 3HADA 1TI7A 4CLXA 4J4TA 5A02A 4YYZA 5I8ZA 4XEHA 1VKNA 3GMSA 4JCOA 4CLHA 2ZK7A 3OF2A 2ZTVA 1U3VA 1WVGA 2ZYAA 4M54A 5TC4A 1HYEA 2P2SA 1KC1A 3LQFA 1JDJA 1Q7BA 2H63A 4LISA 2C29D 1M6WA 2V6MA 4CMAA 4W6ZA 4FFLA 1HWYA 2VUTA 3P5SA 3Q0EA 3UF0A 2FMUA 1Y1PA 1GD1O 1QYWA 3AU8A 2PY6A 4I9UA 3AM4A 5ENDA 3TZHA 1PSDA 3VHRA 1RM5A 2O3JA 5IZ4A 2I5PO 1QV6A 3SJUA 1DHTA 1ZNQO 5EQFA 4ZQEA 1H6CA 1V3VA 5I8WA 3NT5A 1BHSA 5CG1A 3WTBA 3RC7A 1U9JA 1LX6A 2RH8A 4IIVA 1NAIA 2D3TA 3KO8A 4IDDA 1OC2A 1LI4A 1DIBA 5LCXA 2XAAA 3GN2A 3CPSA 3D5QA 1BW9B 1F12A 3BTSA 3GG9A 4LRSB 4MKRA 2VWQA 4OQYA 1IPFA 1KC3A 4FFRA 3PPIA 3O26A 1LLDA 3H4VA 4YXFA 4UVGA 5B4VA 2HU2A 4NJMB 1SAYA 2EKQA 4WGGA 1QSGA 4I8XA 2RHCA 4MP6A 1C14A 5KCZA 5HS6A 1E3IA 4CV0A 1M66A 2J3JA 4W9NA 1EE2A 5JBIA 3DAGA 2GR9A 3OJ0A 2YQ4A 4S3MA 4AJ1A 4WCFC 5EL0A 3F5SA 3L6DA 3GF4A 3CSDA 4IPTA 3JQAB 4YDRA 3B20A 3R6DA 4II2A 2ZJ1A 3GHYA 3KSZO 1C0IA 4FC6A 3NTQA 4I5FA 5HTOA 3B1KA 2JCXA 3GRKA 4CMIB 1DFIA 2BGMA 1RWBA 3WIDA 5FWNA 2NU6A 1Y81A 4OL9A 1ZEMA 4BNJA 4E32A 1XDWA 1B0AA 1B2LA 3AY6A 3BAZA 4PLYA 3RSHA 4YT2A 3TZ6A 5L9AA 4EJMA 3NTOA 1BSVA 4OM8A 3I9OA 4ZVVA 1HSZA 1AHHA 3JQGA 1U3WA 3WNQA 4WCDA 2WM3A 4OSOA 1P45A 3ICCA 4BO7A 2YHIA 3M1LA 1NFRA 3DWFA 4GWKA 3IUPA 3ZWMA 1MXHA 1X15A 2H5LA 3FN4A 5G4KA 1HE5A 1UDAA 4R5MA 4XQCA 1IB6A 2NU8A 2VRCA 3RJ5A 1ML3A 3K6JA 1IOLA 1LNQA 1PTJA 4UUMA 2JJYA 2AQ8A 4GX5A 3DBRA 3RBVA 2WYVA 4HFJA 4R68A 4FW8A 4J91A 3ORFA 1GQQA 3QSGA 2WWRA 4YJFB 5ICSA 1T1SA 5CDSA 4F46A 4PLVA 3LT1A 1JKFA 3PQDA 5AXBA 4XDZA 1LLCA 2B36A 3ZNNA 3FSRA 1CF2O 1UXHA 1GCOA 3EHEA 3E9QA 4OIMA 1W4ZA 4YAGA 5EINA 3AM5A 3QRWA 4YJHB 3L9WA 4B7XA 2AQHA 1N9GB 4M55A 1DBVO 3K96A 3M6IA 1U8FO 1ZK2A 3PYMA 1ARZA 5DBGA 5L4NA 1NTOA 2YDYA 1K2WA 5DBFA 3GEGA 2DFDA 3KTDA 4GLLA 2HMSA 3MJ4A 4NBVA 3P7MA 2R6JA 3UW3A 2EXXA 2VYNA 4MVJM 4FFNA 1DEHA 1EVYA 3KV3O 3FD8A 1E6UA 3T4XA 5JSFA 1QKIA 5FYDA 3KSUA 4IGFA 1JWAB 2PWZA 1HLPA 2HSDA 4P4LA 2XXJA 3OIFA 5L4LA 2AW5A 3GEMA 4BB5A 5DP2A 1VE9A 2GCGA 2CDAA 1PWXA 1LJ8A 3RUEA 1EBUA 3RKRA 1KS9A 4BGIA 3U09A 3QE3A 5U4QA 1QYVA 3JD3A 1PS9A 2ZB4A 4PZEA 4E5MA 7MDHA 3ANMA 4WE3A 3DBHA 4QFDA 1ENPA 4Z3KA 1CQJA 2ZCVA 3BMCA 5L40A 3G49A 1YJ8A 1XR3A 1F06A 4O6VA 1FDWA 3TDKA 1ZKMA 3I3OA 4B79A 2BFMA 1VL8A 3GZNA 1HF3A 4R1UA 1BXGB 3E48A 3FNGA 1N8KA 1WDMA 3WWZA 1LRJA 1NNUA 3PZRA 4TRJA 4TZKA 2X5OA 3RJ9A 4CQLA 4OXYA 4A7PA 2GASA 5IDWA 2PLAA 1NQOA 1U8XX 1WP4A 2Y99A 3ZHZA 5KWEA 4JJFA 1AUPA 3E9NA 1BGVA 4FJ2A 4K9DA 2O4UX 1B26A 5B37A 4BNMA 3NDJA 5TIIA 2GD1O 3U4HA 1HDOA 4WUVA 5TS3A 3H9QA 5AQ1A 5KVVA 2FR8A 2CF5A 3I9MA 2A35A 3EUWA 5KJ1A 3ONEA 4P38A 2WSBA 4O63O 3ADPA 4GGPA 3H5AA 4OSPA 5F1OA 1T1RA 1A7AA 4UULA 1KEUA 2EKPA 1DAOA 3AY3A 3DZBA 2PD6A 4IZHA 1W0CA 4Y9DA 3LSYA 3ICPA 5A05A 4CMEC 4A2CA 1CQIA 2Q1UA 4NI5A 2DQ4A 4ALMA 5K9ZA 3LZ6A 2UV8A 4GL4A 4GLOA 4JP3A 3NEPX 1T26A 3P2YA 2WMDA 1K6IA 1ZK0A 1GEEA 3INRA 3Q9NA 1BTOA 4IDBA 1YBMA 4EBFA 2Z5LA 1ADGA 2NLOA 1PL7A 1V3TA 3VH1A 3JTMA 1K5HA 2PGJA 3Q9UA 3TF5A 3FHLA 3AOEC 4OJNA 3AK4A 1QORA 1I30A 1YONA 4Q3BA 4O1MA 4RQTA 1X14A 1L7DA 1HZZA 3U62A 1R0KA 2B5WA 3JQCA 1M2WA 3PWKA 1E6EA 5H83A 3EDMA 4DMLA 3OM9A 3X2EA 2GZ3A 3GK3A 4BO3A 4PIVA 5DBIA 3HN7A 4FSHA 1JQBA 5FFFA 4Q9NA 1SCUA 4J2OA 3OIDA 4TMFA 1YJQA 6LDHA 4AJJA 4BS9A 2O48X 1J5PA 3VH4A 4YJGB 3PDUA 1NHGA 1YOVB 3ZWNA 3H3FA 3HDHA 3ZWYA 1XYGA 1P1IA 4LVCA 2GN6A 1A5ZA 1DHRA 2E49A 3GQVA 4K1LA 2CVOA 5TQVA 3GGGA 3V2HA 1ENOA 2VTDA 1AE1A 4BO9A 1HXHA 1T4BA 3OBBA 1V3UA 3MTGA 2Q4BA 4IZIA 2DU8A 4NNJA 4PZCA 5ILOA 3OECA 3OA0A 4D45A 1QG6A 3VH3A 1Q2XA 5FEUA 6ADHA 1ZBQA 5DCWA 5G2OA 2CD9A 3C7DB 3N74A 2DTXA 3I23A 1TA4A 3QHAA 1I24A 4D3DA 1D3AA 3ASVA 2PV7A 3RKUA 1B7GO 2J5RA 3WS7A 4AJPA 5KJFA 5KKAA 3ITDA 2BKAA 2Q46A 4IJKA 5CDUA 1SZJG 1IPEA 3AFNA 1RYDA 2Q2WA 4E5PA 1T2CA 4AJIA 4YAIA 1OAAA 1NP3A 1N1GA 2C2YA 4G65A 2HMTA 3E6AA 3FNEA 3PEFA 4E2WA 3ZU5A 2PNFA 3OFSA 1GV1A 2VWHA 3C1TA 3RUAA 4RPGA 4H7PA 7ADHA 4BB6A 4EUHA 3FWNA 4P22A 1U3UA 2UUOA 1V35A 3GDOA 4XRRA 4MVJA 3PTZA 5EQDA 9LDTA 2NWQA 3DZJA 3F9IA 2JHGA 3WR5A 4M89A 4J1NA 4IQ0A 4YBZA 4J1SA 4Z9YA 3MOIA 4NPCA 4WNCA 3RCBA 3T4EA 3L77A 3WSWA 2VWPA 3RFTA 2I66A 4MKZA 3JQBA 2H6EA 2OZPA 5FI5A 1R0SA 3CEAA 2VZ8A 3PJGA 3ZV5A 4DIOA 5K6AC 3DBVO 3PLNA 4W99A 1LUAA 2O7SA 1JAYA 4BO0A 2OO5A 1A4IA 3DZIA 4HUJA 1ISMA 2G1UA 5L4SA 1ZSNA 1CWUA 2V7PA 3ZHYA 2HKIA 1PU2A 1GV0A 1ZK1A 2PKQO 5JCXA 5A3VA 4L76A 2C59A 2ZIZA 1Z7EA 1IULA 3GEDA 3FBGA 3BHJA 4IJWA 4O5OA 3TFOA 2JAPA 2C0CA 2DBZA 1IY8A 1PZGA 4R1NA 1PQUA 4B3IA 1ZUD1 2WDZA 3L6OO 1UZNA 2CFCA 3C3XA 4L0QA 1VM6A 1DIAA 2C7GA 3PVZA 1O6ZA 2GN9A 3SEFA 4R16A 3DBHB 1XGKA 4B3HA 3BMCB 2NQ8A 4KQXA 5DOVA 5THKA 2OORA 1C1XB 2J3IA 3FPCA 1P3DA 5DP1A 2PD4A 1D1SA 1IE3A 3TN7A 1FDUA 5BNTA 2I3GA 2FZEA 1HTBA 2YHUA 3ETGA 1BW9A 3TRIA 3WFIA 3QWHA 4LMPA 3GDGA 1LDNA 1BRMA 1P33A 2AMFA 2NM0A 4BOYA 8LDHA 1P0FA 4GSLA 5JY1A 2VHYA 3PLRA 4L4SA 1VSUA 3FNFA 4XB2A 1Q7CA 2O3UA 1N92A 2ZCUA 3WXBA 4FR5A 4E2YA 3PHGA 4NH4A 2HJSA 4QTZA 5CPBA 3NDRA 1U5CA 4IDFA 4BNZA 1H6BA 3DMYA 1X1EA 3OSUA 5TGDA 3NUGA 5DF1A 3RUDA 2JFHA 5KJCA 1YE3A 1ONNA 4NBUA 1EDOA 2YDXA 3OEWA 5JCJA 1CIVA 3L9XA 1P77A 4NIMA 5I7SA 3R3SA 2P4HX 1X7DA 1W8DA 2CDCA 2HK7A 4R54A 4YRAA 4H16A 1YS4A 4WECA 2QRLA 1D1TA 2Q45A 3BMNB 4J7XA 1B3RA 4BMSA 1AGNA 4CMIA 1PGPA 2PA3A 2GZ2A 3OICA 4EUEA 3WX0A 1P44A 4AICA 3JD4A 3KBOA 4GAEA 4YAJA 1T24A 1Q7GA 1A7KA 3H3JA 3WGQA 3PJEA 3M2PA 5TLSA 1ZMOA 2P5UA 4CM1A 3QIVA 1RKXA 4HY3A 2X4GA 1O89A 1IHYA 5IDQA 4PLTA 2X0NA 2BLLA 4WOKA 4CQMD 2FWMX 3TWOA 1ZFNA 5AXAA 4B8WA 4ZN6A 3O4RA 1B8UA 2FPPA 4R9RA 3JQ6A 1C0PA 5COQA 4OO3A 4EJ0A 1YB4A 4Q3NA 2DVMA 5L7WA 4CR7A 3CE6A 1YXMA 2DPGA 4TROA 1R0LA 5TT1A 4ALNA 1IL0A 1NVTA 4XWYA 1FDVA 4Z0PA 2O4CA 4HNGA 4BKUA 4FB5A 1O94A 2NU7A 4EITA 2WD7A 4YJFA 3NAQA 4BNFA 3C7AA 3VZQA 3ANNA 1N7HA 2O3TA 3EGOA 3WFJA 1Y9AA 1ZSVA 2GN8A 2HAEA 2VYVD 1UDBA 4U6QA 1WZEA 4GX2A 5CAEA 2OMEA 4NFSA 1PL8A 3QLJA 1OC4A 3HQ4O 1A9ZA 4EYEA 2O3QA 3EZLA 1JKJA 3GOHA 4AJKA 3IAHA 5GMOA 5IZCA 3WIEA 3GFGA 1ZIDA 5EJ2A 4UEJA 5JDIA 3NV9A 5CFZA 4B8ZA 3TZKA 2UDPA 3NX4A 3CIFA 4A5OA 3AI2A 1UXKA 4Z0HO 4MP8A 4RO0A 2FP4A 3RUHA 1YH3A 4PG6A 3HB5X 1HKUA 2BMAA 3I52A 2Y66A 4JBIA 1TVEA 1AHIA 4OQZA 4RDHA 4L75A 1FDSA 3NGLA 3D3WB 3NT2A 1KEVA 5F5LA 4XQ9A 2X8LA 4NZ9A 4CUZA 2AEMA 2TMGA 4PLPA 1GADO 1LU9A 2JD0A 3M2TA 2C07A 2Z95A 3A28A 4W9NC 3PFWO 2CNBA 1ULSA 3AUTA 1X1TA 4YRDA 4K28A 1B16A 4DXHA 2PKRA 2QYSA 4IDAA 4R4JA 4WLFA 4WKGA 4MO2A 4RPKA 4P8RA 1PZFA 3AUSA 4DC0A 1BXGA 2HDHA 2AEJA 4PG4A 1A72A 3OJEA 1SOWA 2DBRA 5CEJA 4E33A 3PHLA 3KEQA 4TRMA 4JLWA 1X0XA 5AOVA 3ONDA 1SMKA 3GUCA 2I67A 2BELA 3IJPA 5JNLA 1OBFO 3HG7A 3JV7A 3HNPA 1SPXA 4HWKA 2X9VA 2DBQA 2VCYA 4HFRA 3RROA 1NWHA 4FGWA 4DVJA 2C5AA 2EJVA 2HMVA 5DN9A 1KIFA 1NFQA 3TZQA 1Y9EA 3GFBA 2R00A 5G0UA 2W90A 1WXDA 4QSMA 3E82A 1P1JA 3ZU3A 3B1FA 4GMFA 3IL2A 1TXGA 4UVEA 3ROPA 4UEKA 2DKNA 3ROMA 5T8KA 4URFA 4E30A 1P31A 1ADBA 4CMBA 4LN1A 1E7WA 1GQ2A 2CSUA 3WICA 1NXQA 4ND1A 1I01A 5JY6A 3ZHXA 3ZNOA 3IP3A 4Y6SA 1WZIA 1Z74A 3GVCA 3RUCA 3AI1A 5HBRA 5T5QA 3GA0A 1UAGA 1DIHA 5CEFA 3I4CA 2NTVA 1UXGA 3WMWA 5JPIA 3ZWAA 4I9HA 3ZNQA 4AVYA 1HETA 3W4KA 1GPJA 3F5QA 2OBYA 1N2SA 2B0JA 1ZMTA 4KWHA 4J7CA 4XIJA 4F45A 3SX2A 3WGIA 1NQTA 2JL1A 3V1YA 4BNUA 1HEUA 5HS4A 3LT0A 3Q1LA 2PZMA 2E37A 3JQDA 5COBA 2WE8A 2PTGA 1AN9A 1E92A 1HDGO 4OYRA 1C1DB 2IDZA 1DJNA 4RZIA 5F5NA 5H82A 3WBFA 2DPHA 3RFVA 5IN4A 2GZ1A 3VZSA 3WB9A 4UAGA 1GZ6A 1PS0A 3CKYA 1J49A 3D4NA 3H9UA 3GGPA 3DOCA 2VNAA 1MLDA 5L45A 4I5EA 1F0YA 1NWCA 4UVHA 1ZSYA 3A1NA 4MVJH 4YJGA 5JO0A 2X5KO 1YOVA 2H1SA 3WG9A 1YB1A 1UDCA 4FFOA 1QV7A 4Q3CA 5H81A 2J6IA 2R2GA 1KVQA 3BHMA 2QRKA 3DOJA 2JD2A 3BIOA 5A4DA 4BMNA 3CMCO 5L53A 1O9BA 5BT9A 4J0FA 1NASA 1LDEA 4RVUA 4DQXA 3ZV4A 2PK3A 3GVHA 2X9GA 4K26A 1V9LA 2Y1GA 1K6XA 1CERA 3FTNA 5LDGA 4KZPA 1Z73A 4Q39A 2JAHA 2GNAA 4IM7A 4XYEA 4J9VA 1CJCA 4ZQFA 2JCYA 4ZHSA 4XQGA 3ZV6A 3N58A 3I4FA 2VRCD 1EDZA 1XQ1A
chains in the Genus database with same CATH superfamily
2LCIA 3H7IA 4UHKA 2A59A 1P7CA 1PD0A 2PKCA 1JPJA 2OK8A 3ESXA 4Q02A 1TW2A 2WF8A 2AG8A 4Y30A 4HYYA 1Q0TA 5JEDA 1AHPA 3C6BA 4HCJA 4W7IA 4KXMA 2VN8A 3BRCA 2B69A 3IQGX 4OMCA 3ZI4A 2H0AA 4X7PA 2RGYA 3WK9A 2FMXA 3OZRA 4L6IA 4U7GA 2JBAA 5CHEA 3PRJA 3GPCA 3KYDB 3CRW1 3GLRA 4ERXA 2KQUA 2FJ0A 3V4SA 1E94E 3ZGYA 4BNWA 3P0EA 2H8KA 4FCCA 3OFND 3KZ1E 4CKXA 2Q50A 2WV7A 2Y68A 3FBWA 3PENA 4BKPA 4DLSA 2X6TA 1ISGA 2IP2A 4H7DA 4G5RA 3L2OB 3VU8A 1X9HA 2FWIA 1L7XA 5LQJA 3OJFA 5EJFA 5JAZA 1V8PA 4EHDA 3O0TA 4JB3A 4OXXA 1L4GA 4JVOA 2B35A 4WX2B 4B6PA 2IOQA 1E7SA 3WJAA 4KLNA 1E2DA 1Z5ZA 3EWNA 3R7DA 4ZJZA 1LRLA 3IEXA 1ZUNB 5ERYA 1Y8RB 3A3OA 3N8NA 2HWUA 5DLEA 1Y6FA 1BWSA 1QH8B 4FDUA 1A27A 1O5TA 2B4TO 2BCJQ 5EHXA 2O8FA 3F97A 3KE9A 1VA5A 3IUNA 2EJWA 2C82A 4PVDA 4J6EA 4PG5A 1ACJA 4XR4A 4XSGA 2NTEA 2V8OA 4HNQA 3HCOA 4U6SA 3FWYA 5F7ZA 4HWGA 2HF8A 2GYWA 3VISA 3MRVA 1YZ3A 3RU9A 3CBGA 1Y9DA 4AJ4A 4L16A 5C80A 4LRYA 3W5AA 2W0MA 3SSNA 5TQ2B 2GCPA 2RI0A 4DWVA 4AYTA 4ZDIA 3NUQA 2RB5A 5IKEA 1ZCBA 4RK1A 3VYSB 4NMLA 5DFAA 2PGDA 3KAJA 2FE4A 5LWHA 3ABOB 3G3EA 4D3FA 1TEZA 2IHZA 1YQEA 1NN5A 4XIYA 5J4VA 2Y93A 1WF3A 2R8RA 4IG9A 4MV3A 3GOQA 1PZNA 1KZ9A 2RHJA 3MPUA 1JG6A 1L5SA 1PYGA 3LJKA 5PGMA 1A8IA 1M10A 3KLPX 4MTCA 1LZLA 3RJMA 1AK1A 4JZKA 2M6LA 2VJKA 4MA0A 1U8TA 2EBWA 3HSYA 2P68A 3IQZA 3VKVA 1MX1A 1Z9BA 3AILA 2H1FA 4GMKA 2JFZA 4I50B 1EUDA 3GMIA 3ICOA 4FZJA 4CEHA 1WJGA 1P8AA 3KG2A 1QVZA 1RHRA 1F14A 1YVEI 2QS9A 3IUBA 2PMBA 1V6CA 2JVIA 5H02A 1WULS 3DZKA 2X0DA 4CG0A 1L4MA 2ZATA 3DVLA 4Q1CA 3W5IA 3QEAZ 4A27A 2IZZA 1K7XB 3F74A 4IEFB 4PCLA 1FFXB 3Q0TA 3NHUA 3HJAA 1XZBA 2IIQA 1KVUA 3ORHA 4B4WA 5CFLA 2UAGA 1JXAA 2PMEA 2HK9A 1V0JA 1PS8A 2Q9AA 4B32A 5J5VA 3O90A 1ECGA 3NB0A 2XZOA 1E5LA 1QX4A 1H9BA 2I33A 2O3RA 1FMCA 3PS9A 3A6KA 3RC9A 3ZE0B 5K99A 5KOJA 4MGYR 3FUVA 4QUIA 2OHIA 2QV7A 1ZQ9A 1L4NA 2REXB 3MWGA 5KWIA 1H8HA 4Q4HA 5E1BA 3SEZA 4CM7A 1FZTA 1JQLB 5LJLA 2QM8A 3A9UA 4A8JB 4A3SA 4WNIA 3T7DA 1PQPA 1ILEA 3TRHA 1N7GA 4NU6A 4ESHA 3PNMA 3IKMB 4HMPA 5FA8A 3ZCUA 4CU5A 4FMPA 1OHHA 1KEWA 3CVWA 1KJNA 2XRMA 4HB2A 1U3FA 2ZKLA 3E5MA 3FLBA 5IKOA 4JI2B 3I6IA 2C2BA 4F85A 1OH7A 5E3HA 3BWDD 3ORQA 2CFSA 4OH1A 5HFJA 2B98A 1UWCA 2OVBA 3ZBUA 4DSTA 3A06A 1U2ZA 2IEBA 3AINA 2BFFA 3G0DA 4FN5A 4IRUB 4IWYA 1VCOA 4L5JA 5DSXA 5HF5A 3V1LA 4NCAA 4Y98A 2Y9PB 2IYNA 4AU1A 3B12A 3MAGA 5ALEA 2IYSA 3GBPA 2QUKA 1WOYA 3BIXA 4J0QA 2GEDA 3H2KA 1ZM4A 3FI0A 1WW3A 2BC9A 3GJZA 4FGJA 4LCBA 4EB8A 4F1KA 3UMFA 1XIVA 2JI8A 2ZT8A 4RWEA 3U9LA 2FSSA 4W9MC 3CNHA 4KDRA 1M2JA 5D5QA 1XVVA 5JDCA 2SCUB 5BNZA 2Q0QA 4C7JA 5GV8A 3X1ZA 2C9MA 4GQIA 1XXHA 4BRZA 3UK0A 1UFOA 2XMCA 4DV5B 2AWNA 3F6PA 3AEKB 3K5PA 3UN1A 2LWIA 4PYIA 4P3OA 2F1HA 4N9WA 3KUDA 3MRTA 4FS3A 4RL6A 1AH2A 2WZDA 3V33A 1ZW6A 3T9BA 3AFMA 4R9NA 5CP8A 2Q4RA 4BLPA 2C5EA 1KPIA 4D6PA 5IT9A 1XRSB 4PXAA 3S3TA 5FQNA 5GAJA 5K3CA 5JZ9A 2ZWMA 1XEWX 1Z0SA 2D5CA 4WBXC 2VQSA 4IH1A 1JQ5A 1LDGA 4EHLA 1KI6A 4MEBA 4K9KA 1NLMA 2R5NA 2W2KB 3JQ9A 2W2NA 5I7HA 1B0ZA 1YK1A 2TYSB 4LGVA 4J8PA 1Y33E 1Y8CA 2PFSA 3D6UA 3GAAA 2DSNA 4M53A 5TEVA 2C3PA 1VJ1A 4JHXA 5EWMA 2TMDA 1LV8A 1RKVA 2EERA 3D7SA 3GCDA 4R84A 4TKLA 3ZWPA 3LGAA 4AG6A 4BGUA 4EHJA 1TD1A 3A3YA 3PITA 4I9NA 4IO1A 1PEDA 1XA4A 5EWJA 2DUMA 4FR0A 4TN1A 1WR8A 5DIFA 4Q7JB 1DCMA 4GMDA 4RPIA 1QP4A 5BWBA 1ZHOA 4YAWA 3OI7A 3FTDA 4C7XA 2B0CA 1LK7A 1QJCA 1XYVA 2QPOA 3ZH2A 2LCFA 1N6RA 1RWOA 2PL5A 2YIJA 1O95A 1SUWA 3HZOA 4IRMA 1SG9A 5DO9A 3W8DA 3OFKA 4BTEA 1N6LA 3QU2A 4CCSA 2JAOA 4LSWA 4Z0NA 3F6RA 1E9CA 2FSUA 2OFOA 1CY1A 1P3Y1 4PTYA 3ZD7A 2WBLC 1MAAA 4II3A 5C0OE 1TF5A 5K0SA 4GVPA 4DNQA 1Z0DA 4EPYA 4CF5A 3QA9A 2EIHA 1E3QA 1X8JA 1YAJA 4U3JB 1E4EB 1Y37A 3PVSA 3IP1A 3NWJA 4ZMRA 2P3QA 4YRFA 2FPLA 2QPLA 1V6AA 4OV6B 2NV6A 4UJ5A 5CX1A 3BXZA 1TU0A 1E3WB 4ZVPA 3HJBA 3JD0A 3EC1A 1Z56C 3T9DA 2VHVA 1DIOB 2W4QA 3BWBA 3R23A 2GUWA 2VA8A 1KFBB 3AG6A 5JZVA 4GPEA 1BN6A 4CM8B 3QLVA 4MITA 1KFCB 2FR0A 1VKZA 3VNRA 2PD3A 2A33A 3F3KA 2NVBA 3IKVA 4ALJA 4XGQA 4EI7A 2ESRA 3HSKA 3X1JA 1XQ9A 3UWOA 1EM6A 1B3BA 3NP9A 2NUAB 2NXNA 3IRUA 1ULBA 1TQ6A 3H9JA 1YK0A 1K1EA 2Q6IA 4JUAA 3P2IA 3HJRA 1N2XA 1EWRA 2PGAA 3BA1A 2Y1FA 4XASA 3ESRA 1JWBB 3OKPA 4WBNF 2J0UB 5GTDA 1OMOA 4ZRDA 1NSYA 3WKBA 4NCXA 5CB4F 4N0MA 4R9UC 5D6NA 5BSRA 1ISPA 1E2NA 3RIYA 5L3QB 1YUBA 5J2UA 4YAOA 4TV9A 1PT8A 2BFBA 3D3QA 3EDRA 3GJQA 5GZ3A 4DUGD 5JV5A 1E1CB 2XNDA 1M7HA 3C3AA 3E61A 3TJZA 1KIMA 1OY1A 1JW9B 1R5NA 3AP2A 1H93A 1RBMA 2YS7A 3AWDA 1KQPA 1WNFA 1ZXLA 4EA6A 2EKDA 3EIOA 1L7EA 5EPUA 3ZWKA 4TMKA 4MI9A 1H1LA 1MX3A 1UWLA 1EFTA 5JANA 2YJ3A 4N5DA 3OZDA 2AKYA 2XF2A 2ZRBA 4YP7A 1DQSA 1KYYA 1UC9A 3FA2A 4PO8A 2W2MA 4UU7A 2RKBA 1U2SA 3DCJA 3NHSA 5ANRB 3RAGA 4XFDA 5TR9A 1T8PA 1DPGA 5FIUA 1NAHA 1A76A 4IIYA 3WGNA 2QVZX 4QVGA 3QY0A 3EFOA 1XF1A 3R0IA 5KHAA 1G6KA 3CMMA 1RHJA 1GZ7A 4TM8A 1WNTA 1UPAA 2XUGA 2ZRJA 3H8WA 4FOPA 1KK1A 1KE2A 1GGKA 4E12A 2P2LA 1M7GA 1TTHA 3RW9A 2FPKA 3LCMA 2AMLA 4ECEA 1HE3A 1S2OA 2MYNA 1GAWA 1JVBA 3T7KA 3HVIA 4LPKA 4QIHA 2O2HA 3GEHA 4W7HA 3TGWA 1FJHA 2E89A 3RIEA 3TRJA 4HNHA 3WMXA 2Y1XA 3R7FA 4LMBA 1WBJB 2I76A 4LZJA 1RP1A 1RI5A 4OUDB 4GE3A 4ZO8A 3SC3A 2VDMB 5HZGA 2PO5A 2H85A 1TD9A 2XGSA 3CO0S 4PPNA 5F9MA 4DIMA 4FHCA 1P73A 1NRWA 3BTOA 3LPCA 4H4CA 1AVTA 2EYQA 2YN2A 4LJYA 3WOHA 5ABPA 4LSMA 4TM7A 1JEDA 3I5YA 3STYA 4B3TB 1Z6ZA 1U80A 1JA9A 2VJQA 5IDXA 3S2YA 1Z4KA 5TQJA 2PGIA 2L0XA 3JQ8B 1XFDA 5L6MB 3R7WA 4B4KA 1F2VA 4EZEA 5EIOA 1AUXA 1P19A 2PRIA 4HF7A 1XBTA 5JSKA 2PBLA 5CW1A 3JY6A 3RU2A 1IN5A 1FFEA 1Q74A 2C4MA 3LQKA 5FWXA 5AVSA 1Y5MA 2HFJA 4B43A 4PZPA 1GTJ1 3MWDB 2X3UA 1L2TA 1E2BA 1H85A 4Z7JA 4PC1A 2GHTA 5KYTA 1C9DB 1S2MA 2N46A 1IHXA 4MW1A 3M49A 2L69A 3P0JA 4QUDA 1R4MB 2KYRA 4NATA 3CB4A 4NEQA 5HF9A 3UVEA 4JUDX 5K7SA 1Z7BA 1MFZA 2C2ZA 2YVLA 3EWIA 4KGDA 3AGQA 3K20A 3VNVA 1ZOPA 1ORVA 1A8QA 4LBWA 3EGIA 2D4AA 5LDDC 4KE8A 4W5TA 1GNTA 4C9BA 2F17A 1A8PA 2H2WA 5I47A 4DSOA 3GGOA 2OFPA 1AGRA 4Q9IA 2JH9A 2NSDA 2P9CA 3Q5DA 3U4DA 1Q92A 3VSDA 5JYEA 4UQLA 2I91A 4P5DA 3ODPA 4DF3A 4RF3A 5C5DA 5JXJA 1OX5A 4FR2A 4NDAA 4DQDA 2PYZA 5JXWA 1BFDA 1N2HA 3DC2A 4RGBA 1P9WA 4GOKA 1PTKA 3UAVA 1SU6A 5EP3A 3CUYA 1XJCA 2V55B 1SC9A 1I2MA 1PJZA 2WM9B 3BRWA 3S2IA 3OH8A 1S2LA 3ETDA 5LP6C 4BEVA 4BO4A 2BTOA 2IYUA 3BK7A 3IH5A 4LZWA 5JW6A 2FSVA 4K05A 4E4TA 3OQOA 2J33A 5DK6A 3FHCB 5KYWA 2IW3A 3MTQA 4HD8A 4QEZA 4OLBA 4NFHA 3ZTYA 1BROA 2XMBA 1S8AA 3H2GA 4G41A 4HWOA 4KXYA 3BKWA 4JBYA 3NANA 2CFTA 2H0QA 3WJ7A 2F9FA 2FLKA 4GXRA 1GVHA 2BBWA 1TAUA 3FGZA 4JFAA 1OXUA 1JI0A 5AKHA 1FLVA 1ZC3A 3JQ7B 1F38A 4ND4A 3AJRA 1O94D 1PVVA 1TYBE 4Q3OA 5AICA 1Z18A 3THOA 5JADA 9LDBA 1ZCZA 2CXUA 4DCOA 2NAPA 1H2HA 2GMWA 3T5BA 3CKLA 3L7JA 2I65A 4JEIA 1AS3A 3QWBA 3RHZA 1P7ZA 3LX6A 1X87A 4LBVA 4Q0MA 3NMUF 3DKIA 4CTNA 1IBSA 2A1TS 8AT1A 5KTMA 2RD2A 5T8KC 3OY7A 4X8HA 1J39A 1CJBA 5G41A 1Z35A 2D0IA 3AIIA 3ZU2A 1UC8A 2CYBA 2HGZA 2E82A 3DR3A 3JZMA 2AN9A 2IYOA 3JPYA 3LUFA 3R6GA 4H7HA 4NOKA 4FOLA 4BP1A 2P3OA 1ETHA 3MUNA 3UTCA 3QBTA 2ZCJA 5HEKA 2NO0A 4KDEA 1JDSA 4WZAA 3H2SA 2HTEA 3CLKA 2VQEB 1SHLA 1A98A 2W6JD 3OZ7A 3WBBA 4MDEA 3CRNA 4KU4A 3KQWA 4FC7A 2NTYC 2OV6A 3RAJA 5B7NA 2V8BA 3TGPA 1BYIA 1R4NA 4Z54A 4MRMA 4MWBA 3G2KA 4C2BA 4MVJG 4ZK2A 2EKZA 5AW9A 4N4AA 4WNAA 3QX8A 3H5VA 3LGXA 5A7FA 3AB3A 3EIQA 1LBEA 4A03A 2EU8A 1RYEA 1Q1EA 3GLSA 2Z83A 5EUCA 5EZSA 4C78A 4ZEVA 5JMWA 4L0MA 2BMWA 1MP0A 3ZZUA 5GIOE 4AY3A 4DLVA 3NOVA 3RVNA 1QRSA 2UUAB 1T25A 2OO7A 3CPJB 5DTQA 3WKDA 1VE3A 3HU3A 5TRTA 3PXEA 1C8VB 1CW2B 3TOZA 1KAEA 1M2FA 2CE7A 3C5WP 4M1EA 3DTVB 3V4RA 3KXKA 3IVXA 1YZTA 3VSBA 4N65A 1GQFA 2V97A 1KJIA 3GBVA 1SC1A 4M87A 1D6NA 1ZMRA 2Z4RA 3INGA 4NESA 1ABBA 2AMJA 1R9NA 4UOQA 4U7TB 3DZDA 3EY4A 3NCTA 4Y2SA 1PJSA 1W5AA 2EZ8A 2BHLA 1KS2A 2ZSFA 4P0TA 1QZUA 4L8GA 2GQ0A 1V47A 2BJVA 1WQ4A 1NNSA 2ID7A 5TMDA 2PLFA 3O84A 1KQNA 2E6KA 1U2DA 2IX3A 1U1CA 1JIIA 3IC5A 5I4CA 4NVRA 4OBWA 2GYYA 5HJ2A 1L1FA 3CTMA 3WOVA 1NQVA 1NRIA 2EFCB 5AW6A 3AY7A 4C5BA 5DNCA 4K9QA 4W8HA 1SHKA 1CU1A 3GL9A 4WY5A 3TZBA 1I4TD 5ALFA 4JLNA 4GM1A 2BJWA 3FIJA 4J1TA 5M5BA 1URPA 1KJ9A 1QCYA 2IQ5A 2P90A 2Q0XA 3V6MA 1Q0HA 4LPSA 3WLFA 4F6LA 3G1UA 5ECYA 1QF6A 2RGBA 4UM8B 2IEAA 2B1JA 1F0KA 4AZTA 3Q11A 4F3NA 4RH0A 4DPKA 3A26A 3B89A 3TK1A 4LNUB 1KZHA 1XWIA 2WJYA 2RK6A 3KR1A 1CZKA 2KBEA 1E2HA 3L8MA 3UKOA 1A97A 2FFBA 3HL4A 1HYQA 4YP6A 3DEAA 1AS0A 2P9ZA 2XNKA 3OIUA 4Q5IA 1VL6A 4N48A 1G8SA 2CXNA 3CNOA 1XAIA 2C0PA 1TLFA 3IT1A 4WA8A 2R7LA 4URVR 1U5AA 3SBDA 4KYUA 2BFPA 2F62A 1P0CA 5TT0A 4EF6A 5J59A 3I5XA 2HZBA 1S2NA 3AM3A 3ECCA 4GH5A 4DJDC 4NR0A 1D07A 4JBHA 1G20B 3VTKA 5LP1A 2V5UA 2WMOB 3B8EA 3JU3A 1MHPA 4HBGA 2JIMA 1DAEA 1ODIA 4K9OA 5GM2A 1TIPA 1ODLA 1XLTA 2BEUB 1RWKA 3G7NA 4MDHA 3SQXA 1G5PA 1XDBA 1J8YF 1SKYB 2D1YA 3H04A 3H5LA 4DIUA 3MN1A 4XUCA 1A0OA 3H1GA 1E3JA 4FQ8A 4PN7A 4O4HA 4RKEA 4KAJA 4QDKA 1DKLA 1V11B 1Z4OA 3B7GA 4OOFA 2LV8A 3UCXA 1HZJA 1IHPA 1U7PA 4G8JA 1DX6A 4GYWA 4KTVE 4ENPA 5LWQA 3IHTA 3DVAB 4H18A 3TG8A 4QU5A 5JISA 5TJ9A 4EMSA 1SK9A 3LT4A 3DE6X 3IVCA 2X6RA 3OT1B 4AIIA 1GU1A 2REQA 3D5TA 2CXHA 4FQ7A 5BNFA 1LC0A 2VH2A 5EP4A 1KVTA 1LJLA 4LTNA 2I80A 4RE6A 1OU4A 4FGZA 1AV7A 1PNOA 3KHSA 4L8VA 4R3WA 2HSEA 1BGXT 1B8VA 4PLWA 1E4VA 2L17A 4BN0A 3FLEA 2ZZMA 4EA8A 2Z1MA 1KMQA 1CVIA 4KWIA 1JG7A 3MXTA 3MUOA 1DEKA 1CZHA 1ZXXA 2VXCA 1J1UA 1IN1A 5LZ4A 3LVRE 2O19A 4FSXA 4KN5A 3T3OA 4HGRA 2C31A 3PC8A 1SHJA 4RGQA 2OBNA 1O6GA 1EH5A 3W5DA 3D7NA 3O8QB 2Y2VA 3IBFA 1Y5NA 1N0VC 3DXFA 3RC8A 5IJ9A 4MJXA 4PSCA 2TMKA 1AB5A 3KTOA 1TC1A 1P0QA 2ZS9A 1SRRA 1K06A 3LDFA 1DJMA 4O2RA 2A0WA 2PFGA 1KKUA 1IXKA 4HK4A 5EHZA 1QO0D 1P39A 3FFWA 4C03A 4BHTA 3OMWA 3UPUA 4IHAA 3ENNA 3PGJA 5U9CA 3C8ZA 1KK0A 3RBZA 1M34A 1ZYUA 2BZ1A 4WV3A 1DUVG 4M9XA 5KAPA 1YRBA 4YX9A 3CLHA 3RSLA 4G23A 2ZREA 3DC7A 2GPNA 2VDLB 1ZGCA 3Q3HA 1J56A 4ZT4A 3Q9LA 4P33A 4A6PA 2HQ1A 1WG8A 1BDBA 2O8DB 2XCIA 1TL7C 1U8UA 4CCWA 2O8CB 1Z0FA 1GPKA 3KJGA 3LWBA 4QUKA 3T7EA 1KBZA 1TJYA 3INTA 3PUIA 4J16A 3Q9SA 3AVYA 1R0XA 4FI3F 4R69A 3NU1A 2WSLA 2JVJA 4LOKA 3AW9A 1EZZA 4QTYA 2WWWA 2WU8A 4FPXA 4QXOA 3DEHA 5KSPA 3UAGA 3GY0A 2OHXA 3HKBB 3EXAA 4LCJA 4MAMA 4JU8A 5IVKA 4TYNA 2XODA 3PHIA 1T3ZA 1NJ2A 2X1HA 2C9OA 3ZCXA 5JLAA 4JA2A 2JEZA 2ATCA 4OATA 1GFZA 2NUPA 4OFWA 3CU5A 2G77B 4WJLA 2ERXA 4ZZ0A 3U1TA 5E2BA 1N0UA 1E89A 2H7YA 2WJVA 3HL0A 2VSYA 4TKZA 3ZK9A 5EXSA 4JROA 3DV0A 3KKOA 5C8ZA 2LR0A 3WWCA 2CW5A 2YASA 3SQNA 4XLTA 2O7RA 3D3NA 3DHYA 2XWSA 3N2KB 1HH4A 5SV2A 4ZCPA 1N4AA 4RAQA 5BWMA 1GA4A 2DT8A 2Y1DA 3FXAA 4KVFA 3R3JA 4TZTA 3I83A 3RSSA 3VJMA 3PDJA 2GO7A 2UUPA 4IDOA 3WAKA 3HBNA 1T6XA 4KFUA 4Y6OA 3ZYZA 5TV2A 1ZH2A 2VJMB 3E18A 3BM5A 2I6TA 4LXUA 5EJAA 4L08A 3QY9A 1JG2A 3F46A 5KMGB 4L6CA 3QV1A 2Z9BA 1UBKS 1UPTA 3O82A 5EESA 1RWQA 2JKZA 2UYOA 2ZR9A 1XRJA 1RC0A 3VNAA 4IHJF 2JH3A 4KWEA 3S44A 1UR5A 3ESQA 1G66A 5EGSA 4HHEA 4XM2A 5HCIA 5D51S 2DBYA 1KGSA 4NL4H 5CITA 1WLSA 3I9NA 2O2JA 1JH8A 1ZK4A 2JLSA 4N18A 5A5GA 5KYXA 1SQ6A 3LYHA 1JAZA 1XD2A 4M0EA 5EJ9A 1Y6GA 1WS6A 1E9SA 4JK3A 2YOHA 5FP0A 4N3BA 4F04A 1JMYA 5IRCD 3RYIA 1KEPA 3PYLA 3IV7A 5JCOA 5DNUA 2E48A 7ABPA 4O4IA 5I4BA 3OM0A 3QEJA 5LOVA 4BZWA 3BMQB 2FE1A 6REQA 3P0IA 5JDCC 1EFPB 1KVRA 3T54A 3D4LA 3KP1A 3WYBA 2UUBB 3G0GA 1EGMB 2J3MA 3CZCA 3HJNA 3HZRA 2Q6VA 3IO3A 2YXPX 1N2OA 3EAQA 3OPXA 4RHUA 3REFA 1SPBS 2HLNA 3LVFO 1XTZA 1N2IA 4MVWA 4O0MA 1R88A 2QYTA 2YBDA 3HWX1 4OQQA 3UCFA 2PT9A 1O9GA 5BSUA 3BF7A 3G8DA 3LO8A 4ID3A 1ULAA 3STWA 2NW6A 3OQIB 4N0QA 2VRBA 3A04A 3HDQA 2WD8A 5IX8A 1BHJA 2GKOA 5IM4F 3DDHA 3JQ9C 4DMKA 2DRIA 4MZDA 2I0FA 3OZEA 4U00A 1Z4JA 3B2EA 1L7NA 1P5ZB 1DKOA 2EJUA 1JVNA 2C99A 3GCGA 2X2FA 1AZLA 2FN7A 1T9CA 2ZRLA 3E70C 3NKVA 4FDAA 2HCFA 1JEAA 4MVJI 2YWEA 2XKBA 3DFKA 2WAYA 1SEVA 2QUBA 1W1IA 4XTRA 1YA4A 5HJEA 2K7FA 1LGYA 2OV8A 4ALKA 1JEEA 2LP4Y 5BXQC 5CVDA 4QNNA 2PX8A 5FPHA 2EF0A 1GUBA 3CEJA 1E6MA 2HJVA 4OGWA 2RBKA 1UMCA 3LW8A 2HR1A 4C3UA 2YZGA 3IPRA 4LBYA 4YUXA 2R66A 2ECQA 4PR3A 2YXDA 4M2LA 3RTGA 4RFVA 3VVLA 1NF2A 2G88A 2ZB3A 1K5DA 2RHMA 2ZIAA 4MXDA 2JFWA 4E5KA 2W2TA 3ACCA 1O95C 3G13A 2ZG6A 2HCJB 3W5HA 5K0CA 4FMDB 4P4UA 5AK4A 2D2EA 3P9XA 4L2IA 4ADSG 4EJ6A 5CLGA 1PLKA 1TCCA 1AKRA 1FMTA 1QIIA 3A25A 3B51X 4JIMA 4K6FA 2PM8A 4RXTA 4AUMA 2IHYA 4AP5A 2FJUA 4BNVA 4C7MA 1XTQA 4LZOA 5ITVA 2PKXA 2H59A 5KREA 3E1GA 3QNWA 2J0EA 4D9BA 1V16A 2IH5A 1R16A 2I2CA 3DXYA 4LRTB 4GOND 3KETA 1PDVA 3TFQA 5T67A 2J5XA 3D81A 3H4MA 4N03A 5AYVA 1W0JD 2JK1A 3KKKA 4J0HA 2OA0A 2QI9C 1YCGA 3FW1A 4MLCA 5FX2A 5FOQA 2I9PA 3KL2A 2A88A 3B2NA 2J85A 4F8YA 4YHHB 2R751 5C8YA 3W4JA 1MVNA 3HJCA 4YA6A 3QLVC 4RGYA 1VTKA 1TKAA 4MINA 3SJAA 5KQRA 1ZNYA 4H0CA 2IE8A 2L82A 5DKFA 5BN5B 4BQSA 2QZZA 1PWZA 5CTJA 1UWKA 4B71A 3IQIX 3H4IA 1GTRA 2B94A 2VEOA 1DQYA 3SKXA 2HUNA 1GT6A 4KTTE 4C43A 4ME6A 4OUKX 3DL7A 2CUNA 2IS1A 1PGQA 2I1VB 5G40A 3HYNA 3WYEA 3QW2A 4EVRA 1RWVA 1AF4A 2JZNA 2OXIA 1EB8A 3HP1A 5IN5A 2R11A 2JAXA 3KQPA 1W75A 3NFRA 3OCUA 3P20A 3R3ZA 2QMHA 2LTAA 4Y1RB 2C1EA 2C2XA 3MERA 3UGTA 2OXRA 3AUUA 1M8GA 1YBVA 2PT6A 2BFWA 2BAGA 5THQA 1ULZA 4BE4A 2C1ZA 3BHNA 2WB2A 3HVKA 3R3WA 4HB0A 1CY0A 1S3FA 1UCFA 4UVIA 3VSCA 4B31A 4DDUA 1Q17A 5FBLB 2WP8J 1KI3A 3HYSA 2I4RA 3W5CA 4JOQA 4G4GA 4A4DA 1E7YA 3ZHBA 4V24A 4LHXA 4Z51A 1FFSA 5F5XA 1WX1A 5C3MA 2F8MA 1ZI9A 2ON6A 2ZTSA 2B37A 1A2KC 2V65A 1IZ8A 2NV0A 2GAFA 1L8LA 3Q7RA 1UBFA 2G9ZA 2XZTA 5GJCA 3ZLBA 2OQIA 4FN4A 3DMRA 3K0AA 1JKIA 3OKFA 5A7GA 4BFYA 1I3KA 1K6JA 3DDWA 3E3NA 3M6UA 1CQZA 2F9LA 2XRYA 4C76A 4FBGA 4ZYXA 3ANTA 5DM4A 1T2UA 4C4RA 4M0UA 5H1YA 3OPYI 3PGVA 3Q40A 4G1VA 4JLKA 4FNAA 3JAWB 4RENA 7REQA 2VYQA 3DEJA 1N6NA 3BWVA 4YDQA 4Q6WA 2PUJA 5DGTA 2VTBB 1WTAA 4KQ2A 5A6VA 1ZH4A 2OBMA 5JS2A 4AQDA 5F21A 3RUIA 1T43A 4INJA 4ANFA 3BHIA 3GU3A 3GRZA 3AHDA 3SQLA 3KZMA 1DPFA 4QXRA 3TAUA 3WRWA 1DFGA 3ABRB 3E0XA 3FVQA 3UXEA 1EQUA 1VJCA 2GK7A 1L7VC 4YQZA 4HTFB 5KCMA 4IW3B 4TRRA 3ADCA 5C7OO 4EZBA 4XGNA 1DZ3A 1T1JA 3WP1B 2WFMA 1QNLA 1VLJA 2Y3IA 3IIIA 2PH3A 4UM9D 5JI2E 4KBFA 5ITWA 1UMDA 2Y0EA 3VSEA 3HGQA 1ULUA 1G7CA 4K5QA 1Z5PA 1DWQA 3FOWA 2AE1A 3EXIB 3GIWA 3EDYA 3PC4A 2YIDA 2OCYC 5EXPA 3T7IA 4CMEA 3RADC 2YWCA 4KNVA 5DX0A 3T3PB 1KI7A 4EW1A 5IJ0A 5IULC 2ZJYA 3QJYA 4OHXA 4N0DA 4TVOA 3UB4A 1LXCA 1MUUA 3EGCA 4QREA 2OHFA 3BGVA 3T5AA 2E4WA 5EWLA 4MUEA 1IBRA 5B3KA 5AI9A 4OK6A 2B8WA 3DUWA 3KUXA 5KNCD 5LMCA 4MW2A 2CXOA 1REQB 5C4MA 1D04A 3K70C 3Q2KA 5AR1A 5TSDA 2VPIA 1Y89A 3GJYA 4M1QA 1SWVA 2YY6A 5K1ZA 2C9DA 5ENVA 5CEEA 1QE0A 4ZO7A 2V1UA 3OETA 2B21A 4LV6A 3GD7A 1S7GA 2CDRA 4K86A 3GQBB 3C3PA 3MINA 5ALKA 1JXOA 1T8YA 3CYFA 3ONWA 4IBOA 2BI8A 3UNXA 3CXUA 2D1TA 1QK5A 2FEXA 4BNIA 4RJTA 1TM1E 4PRZA 4DDTA 2XOKA 2PRSA 4WLOA 1N1MA 1YKGA 4QOJA 2PX6A 3HN2A 5EZ6B 4ID9A 5CURA 4JOSA 4X90A 1ZICA 1K4YA 3HB1A 1ZD2P 2A92A 2FSVC 3Q7IA 4KXNA 1LDMA 3O95A 5CTAA 2GT1A 1T0IA 2BHNA 3ZXXA 3DFIA 4IFIA 1TZMA 4DGSA 1VIMA 3TMAA 1GKLA 3TI9A 4YRNA 4HDMB 1WIWA 3IODA 1Z45A 1K3UB 2C88A 4CNQA 4JJ7A 1OFGA 1OI3A 2GGSA 1PJBA 4O25A 1A4XA 2AQIA 3ZG6A 4E5YA 5G3ZA 1W36D 3PF8A 2TSYB 4E5VA 1VHLA 2GBLA 1NV9A 3PV0A 3RT7A 4HNAA 3SYRA 4DZZA 3H6KA 2IEIA 2O57A 1PK7A 1F5NA 1SB8A 2HT6A 5DGIA 5L3ZA 2VO1A 2FMTA 3M4YA 3LOPA 3FMVA 4BX9A 4C0AC 3RC3A 3FMFA 2VXBA 2GYVA 4ZZ3A 2XE6A 1JQAA 3RK1A 3UFXB 4B4OA 4LECA 5B1EA 3W2IA 1NNEA 3HGTA 3QVXA 3COZA 1LWNA 2QQFA 1MO2A 2Q5IA 4GKVA 1P81A 3ER6A 3MOGA 5C34B 4J7UA 2ZSDA 3LYAA 3B3QA 3KKNA 4PWYA 4Q66C 3UAYA 4UUAA 2CHFA 3PWZA 4MW6A 2XCSB 3G59A 5DNYB 3HY3A 4PC2A 3SHWA 2C54A 1DBWA 2NO4A 2XGJA 5DT9A 1EJ2A 4OQFA 1TEHA 1PL6A 2MSDB 4JMPA 5LQUA 1E0DA 2GPAA 2YN4A 1FP7A 1MW8X 2C4UA 3AYZB 1IH8A 1G8HA 4IICA 1GTSA 4KVGA 2I99A 4RD4A 1ZOLA 2C5FA 2OL4A 2VHWA 1PJ4A 1CNFA 1IVNA 1LX7A 1W4CA 2H9IA 2QQ5A 2YRXA 3NVDA 4O4JB 3E7WA 5DM2A 2D1QA 4GPZA 3SHVA 1D4FA 2QM3A 3W6ZA 1T34A 3KE8A 3QQPA 1DJLA 1SB9A 1JMKC 2GPJA 1T4CA 1V2HE 2JGDA 3DEIA 4NJMA 3ZWWA 1XUOA 2XVZA 4JLPA 4P93A 4MI6A 4DMCA 2JLUA 4ZAVA 4RSMA 4EY3A 4RD2A 5B7PA 1HLDA 3O2QB 3FM9A 4L5CA 5LA6A 4KZKA 3NHBA 2FAXA 3NT4A 3OPNA 3QKRB 2GPSA 3HPRA 1XX6A 1K0UA 1R6TA 5GONA 5HKOA 2PL1A 1ZS9A 1LEHA 1IEVA 4AQYB 1DS6A 1FYVA 2ZQYA 3KOUA 4V2UA 1CNEA 3FROA 1YU6A 1VE5A 2OFFA 5A1TA 4CLRA 3NZEA 1MN6A 2GARA 2LXNA 2XVMA 2EF1A 3MHTA 3EYAA 5CXQA 4ND8B 1L8QA 1ZD5A 2HH9A 3MFYA 2YXEA 4IXTA 5EVCA 5M2QA 1ZESA 3HXLA 2EGGA 2C2KA 3CUKA 4JUFA 2OOSA 5BNWA 8GPBA 4ENWA 4G24A 2I6FA 1DC6A 2HJRA 5LD2C 4R8SA 2FWBA 4RJIA 4EFLA 1UJ5A 1IDN1 4KVAA 4RELA 3HB9A 5LU8A 1MC5A 1UPFA 5KVQA 4DUYB 3NGXA 1PQYA 1XQ6A 1WDLA 3HBAA 2VQFB 4GBMA 4XARA 4IDNA 3QVOA 4ICIA 4LYYA 4PSDA 4JNKA 4BP3A 4FKMA 4KO2S 3UBTA 3FNHA 1JHMA 3LYLA 1OZHA 2BMVA 4LCEA 4L8WB 2Z8YA 3TTSA 3E8SA 1IBKB 1X7HA 3HXPA 2O5RA 4IQ4A 4ZT3A 3SHFA 2HYIC 1PFGA 4ENRA 4U8GA 3B52X 3WGLA 2HPHA 4LHWA 4DDWA 1TTPB 5FL7D 4J0CA 1F51E 3PHJA 1YD7A 1OFTA 5EY5B 4PC6A 4M1YA 2O0MA 3GJ8A 2R6FA 2PEZA 3R7LA 5JZOA 1GZHB 1ULTA 4N5MA 3FVRA 3KKQA 1YI0A 3L7YA 3RT9A 2HPZA 1IOWA 2CMKA 2P9HA 4MGHA 2DM6A 4MKXA 3UATA 3TR5A 1SKQA 2AR9A 1YE5A 4FYVA 5K01A 1SURA 4ZYYA 3OG9A 4E09A 2Q6LA 1X80A 4KW7A 4I7EA 4FQ5A 4EI9A 3DFZA 5LU9A 1QTNA 4QO7A 1VPDA 2C7PA 4FHZA 4DM7A 3H9EO 1Z13A 2ZTLA 3C8DA 3JD1A 4PHHA 3HTXA 4QX6A 1RM0A 1M2OB 1XMJA 3ZD8A 1JYSA 1XLTC 2A57A 4N82A 2FZGA 3LC2O 3QUCA 3SQOA 3F3SA 1RYMA 2R1VB 3SE7A 2EFJA 4QWWA 3RIGA 3KEMA 2JCGA 3D6FA 3IE0A 3OCZA 4KXQA 5L7TA 1N5DA 4ABYA 3EW9A 2OWDA 3Q3CA 4Z7OB 1J23A 3KYJB 5B36A 1TJ3A 1U28A 5T6MA 4HZGA 1NZJA 3OE7D 4RLHA 1CLUA 1GL3A 1GUZA 1DT5A 1OIVA 5EMJA 5IHPA 5DOZA 4H27A 1IBMB 2FMKA 1HOXA 2EJTA 3DQPA 1E8NA 2RK4A 3PT9A 3UCEA 3DNFA 1K5PA 2A1UA 2RH5A 5JYDA 1PIWA 1PJCA 4A10A 5J58A 2XCTB 5J3JA 2DQSA 2YJZA 1L7QA 1FS4A 3BXXA 3HU5A 1E1QD 3GLGA 2AJ8A 2QGZA 1OVMA 1CUWA 2H16A 1A04A 1ZZEA 1QMGA 1WO8A 1QB8A 1M6HA 3Q15C 3KYIB 5DNDA 5DDIP 3A4VA 3I2JA 4GG1A 2P8JA 2JIZD 1T2VA 3I39X 1U98A 3PQ3A 5H4GA 3PC8C 5BN3B 3FDFA 4ITUA 4QE3A 5DI3A 3TQIA 3TFOA 2WFAA 4BKOA 3RM3A 1CUXA 1UKEA 4CKYA 1UFVA 2XBMA 5KQMA 2R6CA 1QGUB 3PCXA 2ZWOA 1I3MA 4LVNA 2IUUA 3IOMA 1JU4A 4E21A 1QXSA 1RJ9A 2J5QA 4PSKA 4DIFA 3AMVA 3HYTA 2QIOA 4YLEA 4X95A 1MKYA 4M0KA 5FUMA 3FPFA 3L07A 4R0VA 3NBFA 3BDAA 4DPMA 1GRCA 4IV0A 1KJ8A 1LKZA 4YI3A 5EJ7A 5BVGA 5K0JA 1VMEA 4TTRA 4MDFA 4RPLA 2PSHA 4EG7A 2XTAA 4DWOA 4TYQA 1JAXA 2AEFA 1H6DA 4A8HA 4BLSA 1XRPA 2RAVA 2OHOA 1AXEA 1LBSA 2DH5A 3BL5A 3N07A 4HH1A 4IS2A 4MWSA 4DC1A 1Y9JA 2FZ4A 5H59A 3R9IA 5LLTA 1YCFA 1DLIA 1QHFA 3S1AB 1ZXBA 5C4IA 3F73A 4O4LA 4H1TA 1V1RB 3RS2A 4F97A 4J16C 1QUEA 2XIJA 4OHYA 1A3CA 5L8VA 1QIMA 2H0RA 3NAGA 3NJ4A 3HADA 5JIBA 4CKWA 4J4TA 2C84A 5A02A 2Q3CA 3EVCA 5IK2D 5I8ZA 3A9VA 1VKNA 4JCOA 4MZXA 4XEHA 1FFWA 2ZK7A 1Z5UA 4HQRA 4KAAA 2ZTVA 3ZQ6A 3CRMA 3U48A 5ALSA 5J4LA 1Z2AA 5KZMB 3LZDA 2HHHB 3OCVA 3ZEAA 3UMSA 1JL3A 1XZJA 4LFCB 1KOGA 4LQ4A 1CQPA 1PWYE 2FUKA 3HDTA 1GLNA 3TSYA 4R8KA 1P4SA 3CX7A 4NV3A 4D4MA 821PA 3A0UA 4D8TA 4GNRA 1HWYA 5JOQA 3Q0EA 3NETA 4RESA 4DY6A 2FMUA 3FE2A 1QFMA 2PY6A 1EVLA 1M2VB 4DV4B 1CEEA 3CVYA 1IU9A 2HDWA 2I5PO 1SHTX 2G63A 4M9RA 1ZNQO 1SJ9A 1IWOA 2PS3A 4LFAB 3V3TA 1PW7A 2C98A 4ZQEA 1Z07A 3VHQA 3ZV7A 4F2GA 3DLHA 2EL7A 1V5WA 5A3SA 1V7ZA 3RC7A 1U9JA 4YUYA 4NICA 4GR9A 4YUWA 2WSMA 1G1MA 1NAIA 1Q5PA 3IHWA 1TZBA 4G36A 1OYYA 1ONSA 2EW1A 1V48A 1OC2A 2PZBA 3QE2A 1Y82A 4IDDA 4HGOA 2DY1A 2BY4A 4AKTA 2EFGA 3DT9A 4WY8A 5LB4A 2VYCA 3L8CA 3K0SA 3BTSA 1Z4NA 4P5PA 3GG9A 3C16C 3O73A 1PV4A 1MENA 1V96A 4MKRA 4D92A 2I7DA 3L01A 5HVNA 4NCJA 1J20A 1I4OA 3O26A 4JJEA 5ALMA 1C50A 2X19A 4QEKA