1CEQA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
304
Chain Sequence
PKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
total genus 110
structure length 304
sequence length 314
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ceqA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ceqA02
3A28A 2H6EA 3GDOA 4DA9A 3R1IA 4TROA 5DBIA 4WLVA 1MG5A 3QJ5A 4K9DA 4XGKA 4E31A 4CMGA 1X7HA 1IPEA 4Q9NA 2NVBA 4HP8A 2OZPA 4EITA 1AN9A 4PG7A 3H2ZA 1PL6A 2CFCA 5JW6A 5CP8A 2CMDA 2X0JA 3MJSA 3N58A 3JQBC 3H3FA 1AHIA 1EDOA 3EY4A 3ANLA 3F4LA 1QMGA 1UP4A 2WEKA 3I5MA 4AL4A 4II2A 4RZIA 4G81A 1NP3A 1ZO8A 2G76A 2RIRA 4E3ZA 4ZD6A 3GNTA 1SOVA 1CIVA 3C24A 4ZQGA 3WYBA 5JAMA 2AQKA 4Z9YA 3IMFA 1J4AA 1E1LA 1PJTA 2X9NA 3V1TC 4LK3A 3QWHA 2XXJA 1R37A 2YHIB 3I52A 4UVEA 4DMLA 1MA0A 5BT9A 3FNEA 3RVDA 1CEQA 2X7HA 1R4MB 1HSOA 1B0AA 5L40A 2Y0DA 5AVOA 1B7GO 1I0ZA 1QYCA 2FRDA 1N7GA 1U7HA 4DXHA 4MINA 4RF4A 3OJFA 3D7LA 3DZGA 4FIZA 4IJKA 4J7CA 1K6IA 4EDFA 2NU6A 1V3UA 3NJ8A 1JTVA 3GG2A 3D0OA 3I9LA 4N5MA 5G4LA 4CM9D 1ZK2A 3WGOA 1EMDA 5HWSA 4JBHA 3O9ZA 4Y9DA 4YPOA 1R6DA 1E77A 2DTEA 4D0SA 1B15A 4RJTA 1E6EA 3OJOA 4YJFA 1LSOA 3G1TA 1FK8A 1LSSA 2ZKLA 2V6MA 5K0ZA 3QWIA 3DZJA 4KWHA 1C0IA 3QHAA 4UVDA 3ETEA 2OO5A 4WCDA 1M6HA 1NWCA 3WDSA 4CM7A 4BVAA 1KEWA 3VZQA 1PGJA 3ZZNA 1BXKA 4LGVA 2YFQA 1F0YA 1YB4A 1YONA 1CERA 2WM3A 4IJVA 4ID9A 3ZW9A 3U4DA 4YYZA 2YDXA 2B37A 4CLOA 1HYHA 3S2IA 1XWFA 2JD0A 2XF8A 4E30A 4M86A 1NQ5A 2GO1A 3GG9A 1KY5A 4Y6PA 3S2GA 4ROSA 5ENVA 4ND3A 4M54A 1KERA 3GC6A 2UUPA 3A14A 4BGVA 4IMRA 3D64A 3GF4A 2YFHA 4XR4A 5DOZA 2Q49A 4M49A 4LMRA 3PZBA 2JD2A 4TWRA 4W7HA 5I9NA 4GBJA 1XU7A 2VWQA 2CVQA 2DUUA 2OP0A 4YRBA 1ADBA 1H9BA 4LRSB 3GVHA 1E6UA 1GL3A 4ZN6A 1VLLA 3C7CB 3ROMA 2EXXA 4PLYA 4ZICA 3PHGA 3LF1A 1S7CA 3U62A 3C7AA 4A03A 5COAA 3K73O 2FR1A 1OAAA 1N7HA 3GFGA 3GMSA 3ONDA 3ZCXA 1EBFA 4HNGA 3RC2A 2A35A 1RWBA 3I9NA 4CJXA 2D4AA 4GLOA 3X2FA 4JBGA 3I9JA 3ZI0A 5TLSA 1GV0A 3JQEA 1KYQA 3EAGA 2LDXA 1DO8A 2NNLD 3QV1A 4DYDA 3KYDB 1JAXA 3RC1A 4TRRA 2JCXA 4FFPA 5G2OA 3H65A 4CMKA 3BMQA 3HHPA 1YH3A 1NQAO 3P2OA 4IY1A 3NTRA 4MO2A 2Y1GA 3VPGA 1E5LA 3QWAA 4GPD1 5CEJA 3ZWXA 2I67A 3OQ6A 5IN5A 4L8VA 5AXCA 3FWZA 3LT2A 2B83A 4YJFB 3OFSA 3E9QA 3ON5A 1NR1A 5EIOA 5IG2A 5ITWA 3OIFA 1JA9A 2I9PA 1X1EA 4BKRA 4UVIA 3G3EA 1A27A 4ALMA 3BMOA 5KVCA 4PVDA 5KKAA 3L4SO 3GVIA 4ZA2A 5IN4A 1DIHA 4Q39A 1E7SA 1VKOA 4BKQA 4O1MA 3DFUA 4TVBA 4CV1A 4E2XA 4XQCA 2NTNA 1K5HA 2X23A 1PQPA 1B8VA 2QX7A 3V2GA 4ESOA 4QSMA 4RPKA 1UDBA 4IZIA 1O6ZA 4Y6SA 2FPIA 4R3NA 3PLRA 4J7XA 2NU8A 4CM1A 2UVDA 1FJHA 1LJ8A 4TRJA 4A0SA 3M6IA 4MVJP 2IZ0A 5IZ4A 5LDGA 1B26A 1HEUA 2POQX 3VZSA 4IDAA 1O5IA 4RF5A 2VZ0A 3UW3A 4RLHA 3E18A 3G79A 4CMAA 1H6CA 2YJZA 3HFSA 4YT8A 3UKOA 1C14A 3L6DA 1DIAA 2CDCA 5DOVA 5A3JA 5IXSA 1WAMA 3CMMA 2EKPA 2ZB7A 4CM4A 1DDOA 4IMPA 3KBOA 4HBGA 4GMGA 5THQA 1UP7A 2VYNA 2VTDA 4J91A 4BNUA 4YB8A 1JAYA 4BGIA 1PS8A 3DWFA 3W4KA 1I3NA 3H5RA 5DZSA 3UN1A 3ZWPA 4R1TA 1NM5A 2X22A 2GZ3A 2PGLA 2VRBA 3JQGB 3DHEA 5TT0A 3VZRA 5CAEA 3EYWA 3JQAB 3L4BA 3BTSA 2Q2WA 3IS3A 1AUPA 3BMQB 4W4TA 4XGNA 4BQRA 4GVXA 4WLEA 3PDUA 3O8QB 1OBFO 3QVXA 2ZQZA 5CDGA 2WMDA 2QYSA 3PJFA 4L74A 5ADHA 3PGXA 5AXBA 1MC5A 1EBUA 3AU8A 3VTFA 1H6DA 3E5MA 3HUDA 3OF2A 4U6SA 4XB1A 3WQSB 1HZJA 1ISMA 5GY7A 2DPGA 2VOJA 1DRUA 3ETGA 3OEWA 5A3VA 3LVFO 4R16A 1MUUA 3GUCA 4HFMA 2D2IA 5F1OA 2NTVA 4K1LA 1NHGA 2Y66A 1C0PA 1KEPA 3V2HA 5C3MA 1ENYA 3RD5A 3Q11A 3Q2IA 1ULUA 4Z0PA 5DULA 4N18A 4BB5A 3WLFA 2CVZA 3KRTA 4XJTA 5BSFA 3AM4A 1A4UA 3MTJA 4UEKA 5TX7A 3H6KA 3WWYA 1T25A 4IDFA 4A73A 2O2SA 4WCFB 5TF4A 1A7AA 2V65A 1H5QA 2C07A 4MIEA 3RIHA 4BNKA 1GQ2A 3HDQA 1TVEA 2BI8A 1HYGA 4IDGA 2EW8A 2GD1O 1E1KA 1WDLA 3ENNA 1A9YA 3NTOA 1R4NA 2DU8A 2JAHA 3GFBA 4PFJA 4Z3KA 5I7VA 2PNFA 4FFRA 4GAEA 4MVJG 1JLLA 4RVUA 2EWMA 2Q1WA 1IB6A 4OOFA 2NVUB 4DLAA 3UHAA 1XA0A 3OQBA 5HS6A 4WKGA 4QECA 1YB1A 5DP1A 2PLAA 4AG3A 1KVUA 4NPCA 3WS7A 1ZBQA 3NEPX 1VJ0A 5DDIP 1V3TA 3HG7A 3UAGA 1C1XA 1D1TA 5I7EA 4O5OA 4XYGA 1UXJA 3VTZA 1LDGA 4N54A 1C1XB 2I5PO 3FF4A 3MJ4A 3AM3A 4KUEA 5JMWA 3ZHYA 2VCYA 5DCWA 3O26A 4NBVA 5JDCA 1P77A 1F8GA 1A72A 1VSVA 5FYDA 4XDZA 4IIUA 3JD1A 2R6JA 3FWNA 4BOYA 4J43A 2BMAA 2PY6A 3BHIA 2WYUA 3BTOA 4Y6RA 3ST7A 3IKTA 2E6UX 1IZ9A 4E13A 1E5QA 1DIBA 1YOVB 1H94A 5GZ1A 3NGLA 3HB4X 4OM8A 2Y1FA 5G0UA 3IP1A 1DPGA 3WGGA 4CV2A 2IYPA 4BNHA 4E0BA 2E82A 1UZNA 4HFRA 3JD2A 4DC1A 4P4NA 1YL6A 1FDWA 3KVOA 4URFA 2EERA 2HJRA 3WYCA 1GCOA 4JROA 4R9RA 1B8UA 3NDJA 3CZRA 3HN7A 1A9ZA 4BKPA 3DL2A 3SXPA 3WQRA 4DLLA 1VL8A 5C7OO 3NT5A 4R9SA 4YT5A 2DLDA 3AY6A 3M2TA 1K3TA 1OZAA 3EDMA 4ND4A 1YQDA 4UVHA 1GTMA 4FJ2A 3H9UA 2ILTA 3GNSA 4YJHB 3OETA 4F45A 4ZU3A 1QYVA 4GMFA 1ZNQO 2DBRA 4C7KA 3STHA 3I9KA 5G0VA 4NU6A 1TT5A 4BHTA 1UXIA 1F06A 5TT1A 1UDCA 4CLXA 3I6QA 3FNHA 4EEXA 3IL2A 4XGIA 4O59O 2ZTMA 3QW2A 4R51A 3NTQA 3RAJA 2JKVA 2CF6A 2WDZA 4WUVA 1CQIA 4J1QA 3GH3A 3AW9A 2ZTLA 3RUCA 3KOUA 5CDYA 1ZFNA 4HV4A 2J3IA 4BGEA 1ZMTA 1VRWA 2OBYA 4U8GA 5A1TA 4FS3A 1X15A 4ZQBA 5JPIA 1TA4A 1IZ0A 4I9NA 4KOAA 4L4RA 2DFDA 4B7UA 3DC2A 2VUUA 3C85A 3ZNPA 2XOXA 1R0SA 5JYDA 5EN4A 1N1EA 5DN9A 2Y1DA 1PZGA 4WASA 2Z1MA 3ZN2A 3ASUA 4JGBA 4PLHA 1HSZA 1IE3A 4RDHA 3VPSA 3E03A 1E7WA 5FEUA 5IAAA 4NK5A 3ICCA 4KQWA 3PFFA 3RWBA 4RPJA 1XIVA 1OI7A 1Y5RA 4CV0A 5T67A 4NZ9A 4AJLA 1QR6A 5A4DA 4E5NA 1JW9B 4GQAA 1GV1A 4J6FA 2J3JA 4YVFA 3ABIA 3WMWA 5A02A 3BHMA 3DHYA 1GUFA 1XELA 3O8QA 5ITVA 2Q2QA 3AFMA 1PR3A 3BMCB 3TL3A 4EYEA 5JCXA 3JQAA 3WGQA 1NXQA 1UP6A 1E3WB 4I5EA 1YJQA 1MP0A 2OBNA 4MKXA 3EC7A 4OIMA 3D5TA 5BSEA 1PU2A 1D3AA 1D1SA 5KCZA 4UAGA 3ZWYA 1GAEO 1QV6A 3Q1LA 3LF2A 4CM8A 4CQMB 2DPHA 5KTKA 4MPDA 4B7XA 1U5CA 2G17A 2X5JO 1QV7A 4W9NC 3C1OA 3WYEA 1KIFA 3M1AA 4J49A 2A9FA 4P38A 2YY7A 1JVBA 3AI2A 4BNTA 3PYLA 4CM4B 5C7LO 2FR8A 4N5LA 1PGOA 1GUZA 2X58A 4U0KA 1VJTA 4QEDA 2ZYGA 3OMLA 1PQUA 3FSRA 1SPXA 4JJFA 4FR5A 4WJZA 3ANNA 3W1VA 3N74A 3RFTA 4YBZA 4I08A 5A5FA 1GY8A 3CZMA 4NU5A 5U1PA 4UREA 5ES3A 4HUJA 4EJ6A 4IGFA 2AEJA 2P5UA 1KEUA 4Z3DA 2HU2A 2C20A 3IAHA 1Y9AA 4NG5A 1YWGO 2D59A 3I6IA 1PZHA 1SZJG 1OC4A 2C7VA 5F3RA 2EKLA 4DQUA 3ZWCA 4U6QA 3PK0A 1XSEA 2JFFA 1NTOA 2VHYA 1TI7A 1Z75A 1A5ZA 1Z6ZA 1VPDA 1X7GA 3HADA 3OBBA 3ROQA 1WMAA 3SJ7A 5KJEA 3RUAA 2ZQYA 4QUKA 1V8BA 2HK8A 4WLOA 3DZBA 1B3RA 1Y8QA 2NU9A 5KNLA 1CRWG 3AJRA 1GFSA 3WSWA 4WPGA 5KJFA 2DT5A 4DMMA 4JCOA 1WXDA 3IJPA 3M1LA 1T2DA 3FN4A 5BSGA 3IOYA 1UZLA 5CHEA 5H82A 4E21A 3RUHA 1EUZA 1U2GA 1NWHA 5JAIA 2HSDA 1FDSA 2QRJA 3U49A 2Q45A 3KSDO 4LSWA 5LCXA 3COSA 3C1AA 4B4VA 3KSZO 4J0FA 1YQXA 3ITKA 3ZU4A 3KYDA 3PHIA 3E1KA 1JKIA 2R2GA 3H7AA 3JYLA 4A2CA 2B35A 2WJPA 2VZ9A 4Z0HO 1ZK3A 3JQ9A 1Q2XA 4XX0A 5A9RA 4M8SA 3K9QO 1QLJA 4IDBA 1DOHA 2D1YA 3QVOA 2O23A 2PGJA 1EK6A 3OQ1A 5I9MA 4EBFA 1WZEA 2P9GA 3ADOA 5HM8A 1P9LA 1W4ZA 1HDGO 2IZ1A 1K2WA 1LTHR 2UV8A 3SEFA 5DT9A 3ZNOA 2GUGA 3VH4A 3GZNA 2O3QA 1BSVA 2PZKA 3OEYA 3UOGA 4EUEA 3ZWOA 3WOHA 4YAEA 1I5RA 1T4DA 4HWKA 4J2OA 1QYXA 1HRDA 3T7EA 3G49A 4F6CA 4KDEA 2Y05A 4IQ0A 3GRKA 4B3IA 1GZ3A 5TC4A 3WIDA 2BHLA 1Y6JA 4B8WA 4YTEA 2UUOA 3D5QA 4R69A 2PZMA 1Y1PA 2E49A 2C2XA 3IC5A 4BNXA 3WXBA 1EUCA 1R15A 1O8CA 1G6KA 4YQZA 1PJSA 2FOIA 3MOGA 4MVJI 3PPIA 1JKJA 2OORA 1ONNA 3FPCA 4NNJA 3VOSA 3KHUA 1DRWA 1DIGA 3EGOA 1D7OA 4OQYA 4OXNA 4BO6A 2EJWA 2VTEA 4H3VA 4Q3CA 4DLBA 2P9CA 2J5KA 5I8ZA 3E9MA 3WQQA 1X1TA 1PTJA 1UR5A 3L9WA 4IIVA 3KM0A 4MKRA 4CMEC 2JCVA 4CMIB 1AGNA 1GDHA 1U9JA 3GEDA 1O89A 1VC2A 3K2BA 1T2EA 1WZIA 2YZ7A 1F8FA 1QP8A 2YYYA 3NGXA 4OXYA 4O6VA 4JLWA 4DIBA 3CIFA 3A1NA 4UEOA 3WNQA 4OJNA 2CSUA 4XIYA 2Y0EA 5GZ3A 1NVMB 4BQPA 3GR6A 2B0JA 4ND1A 2JAPA 2HJSA 1T2CA 2V6GA 5F5NA 5H83A 3W4IA 3W6UA 4BB6A 5IXYA 1GQYA 1EE9A 3W6ZA 3ZWNA 1PJ3A 5B1YA 4ALNA 3QWBA 2O2YA 3UUWA 4QO8A 3PP8A 1E3WA 4GKVA 5L7YA 3A9WA 4E5MA 3S2FA 3BIOA 3GVPA 1M6WA 1I24A 4AJ4A 3DMTA 5TRTA 4R1NA 4U0JA 2GYYA 1YKFA 1OMOA 2Y67A 2JFGA 3VH3A 3V1YA 1E3SA 4CMCA 2HRZA 4L4SA 4MOWA 5B4TA 3F5QA 4OMUA 1TXGA 1DRVA 1ZMOA 5JO0A 2AA3A 4XQ9A 4XB2A 4J1SA 4GX2A 2Y1OA 1EUDA 4QFCA 1NVGA 3U4HA 5COBA 3RKUA 5EQDA 4BO3A 3DO5A 1CJCA 4CQLB 4YR9A 4MVJD 1O9BA 1PJCA 2NQ8A 1GQQA 4PLTA 3ZU5A 2DUWA 3JQ7A 4IS3A 1GYQA 5KJCA 2W98A 4D0RA 5JE8A 3HSKA 5U4QA 1L7EA 3LC7O 2Q1SA 5JAZA 1C1DA 1JKFA 5EQFA 1IHYA 3DAPA 1J6UA 4PLWA 1DJQA 4RF2A 2FMUA 4RVHA 1ZIDA 2GR9A 2PD6A 5H81A 5L7TA 3IP3A 1T1RA 1YJ8A 5ICMA 5GMOA 3TL2A 5G0WA 1W0CA 3SBOA 1B2LA 1J5PA 1CQJA 3DR3A 4I5FA 5AXAA 3EW7A 3GN1A 4TZTA 4G5HA 3WR5A 1BHSA 2ZJ0A 3WG9A 1MV8A 2BFPA 1U5AA 4FGWA 3WWZA 3S55A 4PG5A 4WECA 3VHRA 2J3KA 4BO0A 2OUIA 4KTTE 2GSDA 2GGSA 2GN9A 5DBFA 3TOXA 3PGJA 3JYQA 2FY8A 3DBLB 2VT2A 1F17A 5DP2A 4NR0A 2GN4A 2OL4A 1LRJA 4H16A 4IQGA 4NI5A 1MFPA 4IGEA 3WGTA 4R4JA 1LLQA 1IL0A 2F00A 3IJRA 3LC1O 3RUDA 1C0LA 1A7KA 3BHJA 1NFFA 2O7SA 4WLNA 3AUUA 3Q2KA 5FI5A 3RI3A 4TMFA 2BGLA 4BNIA 4YA6A 4YT2A 4AVYA 1O94A 4L0QA 3QY9A 1K6XA 1D4FA 1NNUA 1VL0A 2PV7A 2Y99A 1OC2A 3P19A 2GZ1A 4UUOA 5BNTA 1PL7A 4IJWA 2CNBA 1YDEA 1ZK1A 3ASVA 3NT4A 4DIOA 4B79A 4N5NA 3D4PA 3QA9A 2CD9A 2IEDA 4RL6A 1KOLA 5L4LA 1ZSNA 4ILKA 5A9SB 2IXBA 4PIVA 1LA2A 2AQ8A 3AM5A 1UAGA 2AE1A 3BTUA 3LYLA 1GEGA 3OHSX 1VSUA 4E2ZA 4IS2A 5KKCA 3F3SA 4AJEA 1N1GA 4CPDA 5A05A 5HRUA 4NBWA 4QX6A 4W6ZA 1HDCA 1PX0A 2B5WA 3I9OA 3CH6A 5JMPA 1YVEI 2C5AA 2PK3A 1DC3A 3DOOA 2Y1EA 2B36A 5G0SA 4UVGA 1P1FA 1X14A 2ZK7A 3LDHA 3IUPA 1L7DA 3KZVA 5FWNA 5I7SA 1UAYA 1NFRA 1WW8A 2GZ2A 3PTZA 3I23A 2FHSA 5JDIA 1R66A 1XEAA 1LUAA 1BW9A 1LSUA 3R3JA 3R6DA 3HDYA 3B1JA 3DAFA 5IDYA 2HRBA 2ZYDA 4HY3A 5JBIA 1Y8RB 3Q6IA 1Q0QA 3FBTA 4P8RA 1Y5MA 3GPDG 3LC2O 1Z74A 2I3GA 1UJMA 3IDSA 4U5QA 3ZHBA 1PGPA 4ALIA 1JWBB 3SVTA 1GCUA 3ZW8A 3PWZA 4GX1A 3RU9A 5JNLA 1FMCA 4LISA 2CZCA 3WJAA 1QKIA 5EJ2A 1AXGA 1BDBA 2VRCA 3HNPA 1HLDA 1MB4A 5JAQA 1E0DA 3PIIA 5CPBA 5MGBA 3IUSA 4YRDA 3DDNA 3VVBA 1RJWA 1RPNA 3E48A 3V5NA 1E3IA 4IDCA 3F47A 3H9JA 4DL9A 4RO0A 4XYEA 2VQ3A 3RFVA 4BNZA 2B4TO 3JYPA 5TNXA 4NBRA 2BFMA 1HDRA 2WSBA 1MXHA 1X0VA 1Z45A 5JCJD 1XHLA 3V8BA 4EGFA 1P1RA 1ORRA 3F5SA 4ITUA 2P91A 4BMSA 1VKNA 5A06A 4JIGA 4QTZA 2O3TA 3Q0EA 1WDMA 2B4QA 1DEHA 1FDUA 4KUHA 4R5MA 1QG6A 4DRYA 3ENKA 4NK4A 2GDZA 3IQDB 3DXFA 2JFHA 1YRLA 4FJ1A 2DTXA 1EVZA 1LDMA 4NMHA 1I32A 5F1PA 4CL8A 3QRWA 1PS0A 4J16A 1HE5A 3C3XA 4RDIA 2UDPA 1RKXA 4Q3NA 2FPGA 1MGOA 2C54A 3ZV4A 2VN8A 4MDHA 4MVJE 4WE3A 2H9IA 3H5AA 4OKNA 4LVCA 3TRIA 5JC8A 3ZHXA 2CDAA 3B70A 4BO4A 1Z7EA 1N9GB 4BNFA 4NFYA 4DPKA 1E92A 3T7CA 3GHHA 3EVNA 1SO8A 3RQSA 1EEHA 5U9CA 3D4OA 1U3VA 5G4KA 1PR9A 3GHYA 4RQTA 4FJ0A 1HE4A 4M89A 4BMVA 1I2ZA 4YAGA 4BNMA 3WBFA 3LT0A 2VZ8A 4LW8A 5T6BA 1DC6A 3WB9A 4PLVA 1T2AA 4BNGA 1NAIA 1GZ4A 3K5PA 4D43A 4W99A 3QP9A 2RHCA 4DBZA 4PG6A 1PGQA 1U3TA 1P74A 1YS4A 3LU1A 4TQGA 4LVUA 1WLYA 5IJZA 4DWVA 4BMNA 5CG1A 4EUHA 1YL7A 1DFIA 2HMSA 3KV3O 3MJTA 3D4NA 4GL4A 4ZQEA 4DBVO 5A5EA 1CF2O 1H2HA 1ONOA 4LSMA 3TFOA 2E37A 2IZZA 4F3YA 2O4UX 3MZ0A 1BXZA 1EZ4A 1E7MA 1HLPA 1NBOA 3SJUA 4Z0TA 2FP4A 4FD3A 4L76A 1ZKMA 5KVQA 4D42A 3WJ7A 3X2EA 9LDBA 3QVTA 2H5LA 4YWJA 4J4BA 1BRMA 4E5KA 1HDZA 4BNJA 2HK9A 2BELA 3PRJA 2BKAA 1T2FA 1JU9A 1E6WA 3PDJA 1M2WA 3TOZA 3V2UA 5ILOA 4Y67A 4R01A 2AG5A 1IYZA 4ZRMA 2YHUA 3DMTC 4CLRA 1H93A 1NVTA 5JS6A 1JVSA 3GQVA 4L73A 3TZ6A 2FSSA 1IY8A 5THKA 5FF9A 1U4SA 2BGMA 2GNAA 4I5GA 4DYVA 1YGYA 2ZB4A 4GI2A 4E33A 3AUAA 4EZBA 1IPFA 2GF2A 3DZHA 1PJ4A 4YDRA 3Q9NA 1NFQA 1ULSA 4XWYA 3RFXA 4JJGA 1MG0A 5A03A 3LLVA 4KP7A 5I9LA 3R0IA 4XD2A 1QLHA 5CEEA 4D46A 5HA5A 2B69A 2QQ5A 3D3EA 4XCVA 4WGGA 3ZWAA 2ZTUA 1ONPA 4ZHSA 4J4HA 4MVJM 2EP5A 2AG8A 3VH2A 3DAGA 1K0UA 3FI9A 5A9SA 1WP4A 3CUKA 1VL6A 1SCUA 2X9GA 4OXKA 5T57A 1Q0HA 4FW8A 1KC1A 1U7TA 1Q7CA 1H9AA 5JC1A 2G82A 3P5SA 4INAA 3JV7A 4YACA 3PQEA 5ENDA 1DJNA 5B4VA 2RH8A 3FBGA 3BMNA 2W2KB 1LEHA 2XXBA 1P1IA 1WDKA 3PVZA 3WMXA 4TKMA 3U0BA 2YUTA 3NV9A 1DFGA 1LBEA 2GLXA 1YOVA 4DQVA 2X0NA 5L51A 2P5YA 5HTOA 1P0CA 4A27A 1PWZA 3ADPA 1S6YA 3DBLA 4CL3A 1KEVA 4W82A 4BNYA 1ZW1A 3JD3A 3W8FA 3ZGYA 1PQWA 3ONFA 4I8XA 3BZUA 4Q3AA 4WLUA 3K96A 2P68A 3GA0A 1PZEA 3U4IA 4XJSA 3BXXA 5AOVA 3AI3A 2R00A 1IUKA 5KIAA 1RM5A 4CUJA 4EJ0A 4MVJH 2Q46A 3TWOA 1QYDA 3DONA 2HCTA 1DHTA 3I9MA 4FGSA 5DCUA 3GAZA 3HQ4O 2BFOA 1KVTA 4P22A 1ZSYA 2W2KA 1LI4A 3ROKA 1T4BA 4A10A 1AHHA 4AJ1A 3WGYA 2PFGA 3ZU3A 1GYRA 2BRUA 2GPTA 2B4RO 3D3WA 4GGOA 1DLJA 1I30A 1T24A 3QWFA 4DQXA 2D8AA 1P0FA 3I4CA 3PQDA 3UXYA 3KLMX 2Q1TA 1BVRA 3QQPA 3V1UA 4XKJA 4YAKA 3DOJA 1YO6A 3G1UA 1GU7A 4XRRA 2ZJ1A 3OJEA 4XRGA 4CQMD 5CDTA 1Q7GA 2JCYA 3WGHA 4CMJA 3VVCA 4BL5A 4E12A 2AEMA 1N5DA 1P44A 4MJLA 3QSGA 4ND5A 4B7CA 5CEFA 2JHFA 3JQ7B 4RF3A 4CM6A 1LU9A 3MJVA 1BMDA 4J90A 4FB5A 1HDYA 3L6OO 2V6FA 4YEDA 3NX4A 4WEOA 1PIWA 2P4QA 1C3VA 5JXWA 5BSHA 1PZFA 4RQUA 4DTIA 3GZ4A 4C4OA 1ARZA 2H63A 3IKVA 2D5AA 1XG5A 4HNHA 5HS4A 4LCEA 3RCBA 4NHEA 1ENZA 1B16A 2EG9A 1WVGA 3PJDA 3PI7A 4UUNA 5L3ZA 4I1IA 4CLRB 3WFJA 1SB8A 4FCCA 1IOLA 2VYND 2VOEA 4MP8A 2R00C 3RU7A 2NM0A 4JX8A 1IHXA 4CM3A 5EERA 3FTPA 3AY3A 1E7QA 1N2SA 3OH8A 4JP2A 8LDHA 1OFGA 3KYBA 5F1KA 2BF7A 3HDJA 1U3WA 2ZCVA 4D44A 3KEOA 4LN1A 1NASA 1I2BA 1Y81A 1RM3A 3DZIA 4RCVA 2VHXA 3RUFA 2VNAA 2YDYA 3VPFA 4CQLA 1ISIA 4TVOA 3L4BC 1KC3A 1UXKA 3QE3A 1E3LA 2RHRA 2QHXA 3JQ9C 3K92A 4BGUA 4XYLA 1BXGB 1XU9A 1UUFA 4HX5A 5BQFA 1JWAB 3ZWBA 1YL5A 3OICA 2NQTA 3KB6A 1MC4A 1XDWA 3O38A 2EW2A 3F6YA 2X0IA 4UEJA 3PWKA 4M55A 3BTVA 4OHUA 2NUAA 2VYVD 4WCFC 4AJPA 3G17A 3CTMA 4ZQHA 2BGKA 3H8VA 2HMWA 5JY6A 2DBVO 4HFJA 4QXMA 5K9ZA 4RVDA 4EI2A 4HADA 1ENOA 2VUTA 4ZQFA 2GN8A 1LQUA 4D3FA 3RKRA 1MX3A 1O0SA 3L0DA 1J0XO 3PJEA 5DCYA 4BNWA 5L4SA 3PQFA 4AJNA 1JN0A 4J7UA 4R5HA 2ET6A 3OECA 3SC6A 3NKLA 2Q1UA 1LQTA 2J6IA 2TMGA 3GY0A 1DAPA 4TSKA 1TT7A 4RGBA 1NX6A 2EHDA 3MWDB 4AJHA 2V6BA 2FSVA 4PLPA 5JO9A 1ZEJA 4BNLA 2FZWA 1CYDA 3D1LA 3DQPA 1N92A 1I2CA 5JY1A 1ZJYA 3WLEA 3GVXA 3L77A 3U9LA 1ADGA 3P2YA 3JD4A 5BNFA 2VWPA 5F5LA 5L7WA 4FDAA 4XQEA 2AHRA 1E3JA 3FNGA 1ADCA 2CDBA 1PJBA 3WFIA 1R12A 4B8ZA 1MXFA 3PZRA 3WIEA 2DFVA 4G2NA 3FRJA 5A9TA 2RCYA 4ALKA 4OSOA 3VAZA 1Y7TA 3HZZA 3DBHA 3JQ8B 2EP7A 3B1KA 1SEPA 2DTDA 1M75A 4S3MA 4J2HA 1GD1O 2YQ5A 3B1FA 3EVTA 3QVSA 3TZKA 5IDQA 2HMUA 2FR0A 1QYWA 3OA2A 2E4AA 3AOGA 5CDUA 5I8WA 4UUMA 3GNQA 2PKRA 3LT4A 2QRLA 5JDCC 5A04A 1E1MA 5B12A 3A4VA 2WTBA 3NUGA 2PWZA 4IINA 3RJ9A 1VI2A 2PD3A 2PKQO 3AFNA 2JHGA 3EZYA 2Z95A 1DBVO 3CKYA 1UH5A 1A4IA 1NQTA 1U8XX 5JSFA 1YXMA 2WWRA 2X4GA 4IM7A 3GZNB 1ZVMA 1LLCA 2HO5A 3E82A 4MP3A 3LK7A 2NSDA 4Z6KA 2HK7A 3MEQA 4J1TA 1KETA 3SLGA 1BWSA 4O63O 2X9VA 3OA0A 1NPYA 1DC4A 2VYVA 2Z5LA 3HFGA 1NQOA 1U4OA 3ZH2A 2AMFA 2DKNA 1G0OA 1Z73A 3B6ZA 4K6CA 1VM6A 1B8PA 1DB3A 3K30A 5CPFA 1BVUA 4L4XA 2OXIA 4CLOB 1ID1A 3ZHZA 1I3MA 5C5IA 3C1TA 3P7MA 5L9AA 1EDZA 1PJLA 4H15A 1FDTA 2ZATA 3ZV3A 1ISGA 3HE3A 2I6TA 3DBHB 4L75A 1EFKA 2WE7A 2CUKA 3I4FA 2D5CA 2O7QA 3RBZA 3RROA 4GH5A 4BIIA 2A4KA 3PJGA 2GASA 5K6AA 3PHLA 1DC5A 1KVRA 4CLDA 2AQHA 5JCJA 1DIRA 2GCGA 3PWSA 1GUYA 2BH9A 1I01A 4YAJA 4XR9A 4AICA 4YT4A 2DC1A 4C7JA 3AY7A 3JQAD 4I9HA 2Q3EA 2PH3A 4ND2A 4NIMA 4PGFA 4D3SA 2YV2A 4NH4A 5IZCA 1DLIA 3ANMA 1U2DA 1VJ1A 1P1KA 5B4UA 1CETA 2JL1A 2EEZA 2VNSA 3JSAA 5BR7A 1Z82A 3CMCO 4R1UA 3PXXA 4YAIA 4JQCA 3O03A 1DFHA 3AUTA 3FHLA 5EMHA 4QQRA 8ADHA 3CPSA 3VPXA 2YHIA 1SNYA 1KVQA 3S2EA 4WOKA 4HXYA 3KTDA 5L53A 3BMCA 4R1SA 4CR8A 3HDHA 4D7AA 2Q50A 2VWHA 1V35A 4BO2A 4RZHA 2I3AA 3B20A 5G4KB 4A5OA 1I8TA 5JDIC 2B5VA 4IZHA 3UCFA 3FPLA 3LZ6A 4OGWA 3F9IA 4GSKA 4P4GA 2DBZA 4ZRNA 2A94A 4P4LA 2A92A 5EL0A 4XQGA 3GLQA 3T4EA 2BFAA 4NBUA 2VHZA 2X5KO 2YV3A 4GKBA 3ONEA 5IDXA 2O3UA 4E2WA 4AJJA 4PRLA 1K6JA 4IDEA 3RJ5A 4FQ8A 2FZEA 1Z7BA 3JQBA 7MDHA 4CQMA 2Z1NA 4CM8B 2HMVA 3F1LA 4Q3DA 4MIYA 4CUZA 1ZJZA 4IDDA 3F4BA 4LCJA 3U09A 4OKIA 1NR7A 3VDQA 1ZEMA 4K28A 4IPTA 5JYEA 1ZCJA 2EJVA 2X8LA 5LDHA 3UICA 2D0IA 4KMSA 2RAFA 1YBMA 2DVMA 1XQ6A 2QYTA 1LC3A 4PZEA 9LDTA 1CWUA 1RYDA 3IIEA 1ZZEA 3DMYA 1FXSA 1P31A 4OAQA 3LLSA 4IXTA 5COQA 4YRAA 4WNIA 1B14A 3GOHA 1ISHA 2YV1A 4LMPA 4OO3A 4RPGA 3S1LA 2UYYA 2HMTA 3CEAA 1LDNA 2GERA 2HKIA 1RYEA 2NLOA 2WD7B 3AU9A 3S8MA 3EHEA 1UZMA 4XA8A 3WX0A 1P1JA 1BXGA 2VHWA 3JQDA 4B4UA 1SMKA 1TT5B 4G65A 4QFDA 3WICA 4D3DA 3DZKA 4NQZA 2NV6A 5HBRA 5TGDA 2HLPA 1I3LA 2O3JA 5T5QA 4XDYA 1P1HA 4DIFA 2W90A 4YJHA 3DZFA 3U4CA 3AUSA 4PVCA 4Z9XA 4PLZA 3PYMA 4L9RA 1VE9A 4JBIA 2QZZA 1BW9B 4N7RA 3GEMA 3PIDA 2HDHA 2VWGA 3BAZA 2SCUA 3FTNA 3JCZA 3WNVA 3U5TA 1EVIA 2VT3A 3TZCA 1HL3A 2IEBA 3JYNA 5EINA 3OIGA 4B4WA 3UVEA 5JFOA 2Y1CA 1NYTA 5FI3A 3DOCA 3JD0A 4HFNA 4PG8A 3UH1A 1GADO 1XLTA 3WGZA 4IUYA 2NADA 3WGIA 1G1AA 4Z9FA 2CF5A 2WYWA 3VZPA 5C7IO 3GEGA 2PD4A 3RC7A 4AJKA 3LQFA 4YCAA 2ZYAA 1U28A 4FOSA 2VRCD 5EPOA 3I83A 3PLNA 5IDWA 1LX6A 2NVWA 3VPHA 1KVSA 4BO5A 3ZV6A 2NWQA 1E3EA 3ZV5A 4JNKA 3JQ6A 1QXSA 1PEDA 4XYMA 5AXDA 3CINA 1HZZA 1M67A 1PJQA 3EZLA 4FC7A 4RPLA 1PWXA 1HTBA 1LLUA 5KVSA 2VUSA 2EV9A 4F46A 3DTYA 3BYZA 3K8ZA 3ITDA 3D3WB 4TRMA 3RBVA 4PZDA 5KVVA 1SAYA 5I7FA 3BMNB 4J9VA 1K89A 4CLHA 2G5CA 1P33A 3ZWMA 4RV9A 2EKQA 1ZSVA 3MJEA 3U3XA 3TPCA 1EQUA 1FDVA 3JQFA 5CG2A 2OGUA 4BKOA 5L45A 1HDOA 2C59A 2HAEA 4HKTA 4BV8A 2P9EA 3NJ4A 2FPPA 2AQIA 4CV3A 3OP4A 1N8KA 1L1FA 4B4OA 2IYOA 2W4QA 1JQBA 1UXHA 5BNIA 3DB2A 3QIVA 4I5DA 4JK3A 2P2SA 3JTMA 5ER9A 3DEYX 3TSCA 1HETA 3MCVA 5G0TA 4E6PA 1DSSG 2JD1A 4J9UE 1M76A 2Q2VA 4WLFA 4EW6A 2IDZA 2PGDA 3H9GA 4YJGA 3AWDA 3FR7A 2NVUA 4CM5A 2Y93A 4QT0A 1XCBA 3BA1A 1X13A 1R0LA 4WOJA 1I3KA 3NDRA 1LDBA 2EGHA 2FN7A 2PZLA 1LSJA 5TSDA 1PS9A 3GPIA 4PLGA 1R4NB 4AJ2A 4JP3A 2CY0A 5TJHA 3H4VA 4IBOA 3RUIA 1WMBA 2GN6A 3MTGA 3GDFA 4IJUA 2X1HA 4ZVVA 1ISJA 4IQ8A 4UUPA 2JJYA 2IE0A 1B3BA 2F1KA 1P3DA 4H7PA 4NJMA 1Q1NA 3UGKA 1O95A 1AXEA 3EK2A 3GGPA 3SC4A 4BO8A 4WEQA 5DBGA 1C0KA 1SEVA 2C82A 2J5RA 3INRA 4ZGWA 5LC1A 4CR6A 1PL8A 5AQ1A 3GAFA 3OJLA 2UAGA 1W6UA 2I99A 1JDJA 2PH5A 4FFNA 1X7DA 4AFNA 1AE1A 1TEHA 5EESA 1PJ2A 3OJ0A 2X0RA 3GDGA 3H9EO 3KYCB 1YQGA 3E5RA 3W8DA 3RUEA 3KEQA 3N7UA 4OSPA 3NT2A 1X0XA 3ZDFA 4TRNA 2NTJA 2C7GA 1ZH8A 4M87A 4UULA 3WBBA 4K6FA 3SLKA 4DREA 2EIHA 5IZCC 2ZTVA 1OOEA 1PGNA 2WD8A 3VKUA 1T26A 2OP1A 2ZB3A 4CR7A 2PZJA 1I10A 3TDKA 5ICSA 4O0LA 4FOOA 3TZQA 3ZWWA 4EJMA 3GVCA 4Q3EA 3OM9A 2C2YA 3ZWVA 1E7RA 1XYGA 2ZB8A 1LRLA 3SX2A 2C0CA 4B3JA 2BI7A 3ZNQA 1HDXA 5B37A 5TS3A 3RSHA 3R3SA 5K6AC 1GYPA 1U8FO 2YQ4A 3JQGA 2RH4A 2C29D 2HQ1A 5TJ9A 3W8EA 4BO1A 2D3TA 2TMDA 1N9GA 3HN2A 2J5QA 3KLPX 1EFLA 4PN3A 3DBRA 3Q9UA 4LRTB 4ALJA 1BDMA 1ADFA 1M66A 3VDRA 2XAAA 4A7PA 4OYRA 2AE2A 2I65A 4ZJUA 4F6LA 5ILGA 3MJCA 2I66A 4GVLA 4M1QA 1RM0A 3DBRB 4KTVE 3GMDA 3EMKA 2CVOA 2WE8A 4CMEA 4R41A 4XZ3A 3DHNA 4OH1A 3T4XA 3WTCA 2DM6A 4D41A 1FF9A 1SB9A 1HKUA 3FD8A 4PZCA 4R54A 5IFLA 1LDEA 1A71A 1CDOA 1F12A 3KO8A 3ORFA 3MOIA 4W9NA 4E32A 1HE3A 1NHWA 4CMIA 1XR3A 4EEZA 2AEFA 1H6AA 2H1SA 1LLDA 1NPDA 3OIDA 1IULA 2RBEA 2O48X 3CE6A 4K26A 3E8XA 1YB5A 1E1NA 4II3A 1T1SA 1UDAA 4NDNE 4CODB 7ADHA 4KZPA 5T64A 4JN6B 1GR0A 4DVJA 4KQXA 2V7PA 1ZXBA 2EF1A 4J4TA 3WSVA 3GT0A 2DQ4A 1LXCA 2DAPA 3GN2A 3KSUA 4WK6A 4DPMA 5KOIA 3BMOB 3RC9A 4DUPA 1XGKA 3A06A 1V6AA 5TIIA 2OMEA 4R68A 5KWEA 3PYXA 1DAOA 1U1IA 4DC0A 3KYCA 1HF3A 1HWYA 2W2LA 3I1JA 2NU7A 4BNVA 2FWMX 4U7WA 3KUXA 5C37A 1LDYA 2X86A 3K2EA 3LT1A 1WPQA 3OSUA 4CM9A 1Y8RA 4RORA 4CMBA 3L07A 3HJAA 3DFZA 1W8DA 1SOWA 4OL9A 1YBAA 3DTTA 3WTBA 3FR8A 4RPHA 3PEFA 1NPTO 4WNCA 1V0JA 3PHJA 5IF3A 3E9NA 2PKQP 3FNFA 1SC6A 4GLLA 3NYWA 5KJ1A 1ZK4A 2X6TA 1V3VA 3G0OA 4FFOA 2PTGA 4NJMB 4E4YA 2ZCUA 4BNNA 2I76A 2QW8A 3PFWO 1WNTA 3AOEA 3LSYA 2O3RA 4FBGA 4YJDA 1BG6A 4GWKA 3PHHA 5L95A 1F14A 1YBVA 2QRKA 3H3JA 3ZNNA 2NACA 5CFZA 4D45A 6ADHA 5MDHA 3INGA 3H2SA 3NAQA 2XPCA 4YJGB 1J49A 1YE3A 1U3UA 1TB4A 4X54A 1PSDA 1YDWA 4YQYA 4BUCA 3MWEB 4I9UA 2Q99A 2LDBA 1W73A 4RVFA 1P45A 3EUWA 4DGSA 2DBQA 4J0EA 2C5EA 4ALLA 3KETA 3E6AA 3ULKA 2O3SA 1Y9EA 4PRKA 2Y0CA 4GSLA 3H9QA 4JJIA 4J3FA 4GX5A 3VC7A 3F1KA 4OQZA 3ROPA 2Q4BA 3W4JA 4AJOA 3GUYA 1EE2A 4YXFA 1DXYA 4PLFA 1Q0LA 2Y68A 4AJIA 1ML3A 1GPJA 3CSDA 5CDSA 3TFQA 4W7IA 4J1NA 3HWRA 5T8KC 1H2BA 4Y98A 3C7DB 2J8ZA 1UXGA 2J3HA 3ICPA 1R0KA 2ZIZA 4BS9A 3K6JA 3GRPA 4GX0A 1Y8QB 1ZUD1 6LDHA 2Q4EA 3L9XA 5AYVA 4A26A 5KJ6A 4FC6A 5TQVA 3UCEA 4TKLA 2QG4A 1EQ2A 4FFLA 1I36A 1R4MA 3INTA 1KY4A 1RM4A 2OOSA 1MLDA 2O50A 1QSGA 1XQ1A 4FFMA 4PLCA 3VH1A 4FPXA 4B3HA 3I3OA 1E7YA 3JQ8A 2BD0A 4RLSA 3KXDA 3QVWA 5T8KA 5L4NA 3GK3A 3NDIA 3GGOA 1HT0A 1HXHA 4E5YA 4PG4A 5JLAA 2IODA 1Q7BA 2GRAA 3L6EA 2X5OA 4CLEA 1HE2A 1SBYA 3TN7A 4CMHA 1EK5A 3HB5X 1EVJA 2IXAA 2G1UA 4S1VA 3UCXA 5J23A 4PCVA 2W2LD 3RASA 4NJOA 3UF0A 4E2YA 2BLLA 1G0NA 4JXKA 3ZU2A 4KWIA 1QRRA 4Y8VA 2HUNA 2QZ9A 1ISFA 2IRWA 3TQHA 1EVYA 1BGVA 3FCOA 1V9LA 4QO7A 4DPLA 3C8MA 4KUGA 2G0TA 4D79A 4Q3BA 5DF1A 4WCFA 1LC0A 4XYBA 3AOEC 4XEHA 3VKVA 1XKQA 3M2PA 1QORA 3AI1A 1R16A 3Q3CA 1GPDG 1ENPA 3TJRA 1D8AA 2QIOA 4MVJF 4IXWA 5FFFA 2YW9A 1LRKA 4FSHA 2OHXA 1KBZA 2VHVA 1WWKA 3F46A 3JQFC 4ONEA 4CUKA 3O4RA 4BKUA 1GEEA 2AW5A 3K31A 4GGPA 4RVSA 4MKZA 3H5NA 5F21A 2WD7A 4KDFA 2O4CA 1H0KA 1H6BA 2PR2A 1NAHA 4RVGA 1DHRA 4XIJA 3RBXA 1MFZA 1TLTA 2OFPA 2EGGA 3TZHA 2PA3A 5ER6A 4R3WA 1HYEA 2P4HX 4BO9A 4FN4A 4BO7A 3GGGA 3UFXA 4GWGA 3JYOA 3TNLA 2AXQA 4MP6A 4NBTA 1I33A 3QLJA 4OOEA 3NRCA 4BV9A 4E5PA 4NFHA 2E48A 1BTOA 3ETDA 4MVJA 4NFSA 3JQCA 3CXRA 3AK4A 1C1DB 2W8ZA 1ZXLA 4TZKA 2WYVA 3TF5A 4EUFA 5GZ6A 3DBVO 1LNQA 1ZK0A 1KS9A 4MIOA 5DNAA 1GZ6A
chains in the Genus database with same CATH superfamily
3HM2A 1BVHA 5BV1A 4AS1A 2I1QA 2NYAA 3P94A 3V7YA 3Q7EA 4WLVA 4PNPA 3D6JA 4XGKA 3ZYCA 4E31A 1SRQA 3U9TA 2XYRA 4HP8A 3ZXSA 2ZJZA 3I9V6 3UJ6A 5K6TA 1PL6A 3AVVA 2I2CA 5JW6A 4MXDA 3IPCA 3D4IA 4V0OA 3OPXA 1XZBA 2DR3A 4I5IA 4QNNA 4G4SP 2WMNB 1AQUA 3F4LA 4RM3A 4DV6B 2E85A 4I50B 1C1YA 4QUGA 3FE2A 3ZZUA 2DFLA 4Z4IA 4EB6A 4ZT5A 2QK4A 1PKXA 1OWOA 3ED5A 1FXWA 1QK3A 2FG6C 4Z2YA 1ZO8A 5CB6A 1FJ2A 3ZDAA 1GPLA 1M6VB 2LXNA 1SOVA 2VI5A 2WHYA 3C24A 3C5EA 5CNKA 4YRQA 4LF4B 2ZRFA 4IDNA 4JJ8A 1J4AA 1KJIA 1UJ4A 1VIMA 1SWVA 1WDWB 2GVDC 2HY7A 2IW1A 2GK6A 2X9NA 3DWEX 5ICFA 5J59A 3V1TC 4ER6A 1R37A 1XZGA 3LHKA 4JBYA 4ZXFA 4F2DA 2WUDA 5KTYA 4MRMB 1B76A 3AIKA 3LLMA 1HSOA 1XVVA 2V98A 1USVA 5IC6A 4H77A 2Y0DA 4KQ9A 1Q44A 3AKCA 2FRDA 1SZDA 1Q0TA 3ZBUA 1JKJB 4M36A 1FFHA 4DXHA 3FB1A 3OJFA 1SUCA 2ZULA 1CUDA 3N8KA 4WERA 1JJFA 1GRCA 4IJKA 4J7CA 2JLQA 1K6IA 1KWGA 5KUTA 3NJ8A 1NVVR 4D4HA 4RUKA 3OCWA 5JQGA 3GG2A 2Q62A 3I9LA 4NOMA 5G4LA 2QBYA 1LPAB 1RMQA 1ZG3A 1OU4A 1Z6PA 2QR2A 4L22A 4R8KA 4X1OA 4NE2A 1ECGA 2PX5A 3HA5A 2PGIA 4D0SA 3WNDA 3JRWA 4RJTA 4YJFA 1NKTA 1ZPDA 3G1TA 4C06A 1BHQ1 1FK8A 3F71A 2GEJA 1TC2A 2BEJA 3QXCA 4X71A 3QWIA 4TYNA 1GSAA 1Q1ZA 1U9IC 1OGJA 2RHWA 821PA 2Q29A 2Q5FA 1E32A 1LPPA 3ETEA 3DPSA 3MCUA 4FZJA 4HF7A 3I01A 3KOZA 4BVAA 1VYTA 2PUJA 5EXXA 3N53A 3KQOA 5HG0A 1BXKA 5EPEA 2WHXA 4LGVA 4OQFA 3EJ6A 3T3DA 4BJ3A 1NLFA 1U6IA 3W6NA 1F0YA 4RTOA 3O8BA 1JT2A 2WM3A 4IJVA 3RYHB 4ID9A 2PUWA 3ZW9A 3U4DA 1TJNA 2VQDA 5H80A 4YYZA 3SQDA 5E38A 5DCLA 1M1UA 2R5FA 3IALA 2JFPA 5H1YA 4B34A 2QGFA 3WLIA 2QM0A 1NQ5A 4E30A 3B5IA 1KY5A 4U02A 2D1RA 4Y6PA 5T4EA 4B31A 3CX3A 2W4IA 5DBOA 5EIBD 2FN4A 3GQBA 2F1JA 5T6MA 3A9SA 3DMFA 2X9LA 1EP3B 2BGGA 4CTMA 3GLIE 1MH1A 1K8RA 1S4QA 3ELUA 4I55B 1YB6A 3NZEA 4NE9A 1UPTA 4O2LA 4GOMD 1XXHA 4CIVA 3N6XA 5E9JA 5HQJA 3V7UA 1VI5A 2NG1A 1Z5VA 3O7WA 4M49A 3T95A 3JZDA 2R6DA 3JQQA 3M4NA 1JR2A 3U6BA 1D6JA 1Z8FA 4B3XA 2VWQA 5C8VA 3CNQS 3W77A 1W2GA 1ZHOA 3SP1A 1UEJA 5F2KA 4YRBA 3GVHA 1CUYA 5DNCA 5BNZA 4ZN6A 2HTFA 3VZDA 2H1FA 3S0JA 5TQ0B 1K4MA 2OBMA 3WLAA 4NENB 4ZICA 2WINI 1T9BA 4DLUA 1EM8B 3R5HA 1OSNA 4G0YA 4TTIA 1I7DA 3JARB 3EEOA 1ABBA 4NU8X 4I55A 3SEQA 1FXWF 1I1HA 4LGCA 2FN3A 4A03A 1PT6A 4JSTA 2BF4A 2C31A 3C2QA 2H1LA 1H2XA 3ONDA 3ZCXA 5JH7A 4ZPJA 1ZNWA 3OQOA 3VSDA 4YWHA 2Z56A 4FKMA 4QDOA 2D4AA 3C6XA 4GLOA 4OIFA 4DCCA 1CEXA 2I7VA 5D3QA 3MELA 3I9JA 3RGWS 1U1EA 1ZKDA 3GCDA 2OV8A 1DO8A 2DHQA 2OBLA 1PR4A 1JAXA 3H18A 4ZODA 2IYZA 4N0DA 3W6PA 3TLKA 2R4TA 3OE5A 2GBFA 2JCXA 5G2OA 2I22A 1GU0A 1TAGA 1NJ2A 3B3JA 2QGNA 5A6SB 5KBYA 3AVXA 3RAGA 3BCSA 3P2OA 3W9SA 5HKLA 3NTRA 4MR8B 5AM4A 3CHYA 2ZYRA 5KYVA 1P9WA 4BFYA 3ZWXA 3KQNA 3OQ6A 3F5MA 3T5AA 1TKCA 5JAPA 4M0KA 2B83A 2IT1A 3OFSA 2WQZA 3LH5A 4U7GA 1RQ2A 3OG9A 3TXXA 2XT6A 5IMBA 2QW1A 4PAQA 4TT3A 1IN4A 1FJGB 2I9PA 2OYRA 3UT5A 1G5QA 1X1EA 3VSEA 4BKRA 2CZQA 4UDNA 4JJKA 3NBQA 1B0PA 4CW7A 4B3SB 1AQNA 1ZDMA 2H1IA 3BMOA 4PIPA 4PVDA 4YRPA 4G1FA 2P6NA 4K81B 1MHPA 1QO9A 1VCOA 4WZ6A 1NC1A 1RU3A 2CUNA 3EXFB 2OFFA 2MHCA 3GVIA 1COWD 1KJ9A 3M8KA 1E89A 1GZUA 3NATA 3PUJA 4BKQA 1O5OA 4O1MA 4XI9A 3TZLA 4E2XA 2NTNA 1K5HA 1WTCA 2WWGA 2GJ9A 4ITRC 3VHXA 4F60A 3L93A 3C5WP 3JZAA 2WT4A 4QSMA 4RPKA 2WZBA 4Q9DA 1NI4B 3IELA 5BWLA 5LKAA 4AJ9A 5CD1A 4Y6SA 2VF2A 4OHYA 3Q72A 1C9DB 4R3NA 3PLRA 3A36A 5L6MB 2ZB2A 3K7EA 4KIWA 1B42A 4XLTA 2R6AA 1LJ8A 2RAUA 2XRMA 3ABRB 5F52A 3M6IA 1WVIA 2RE8A 5BN4B 3VZSA 4C7OB 4O2BA 3GDHA 2XYHA 2AJCA 4DMUB 4RF5A 2VZ0A 5SY4A 3UW3A 2PX4A 2FQXA 3WLQA 4NCXA 3NUQA 1X92A 3ZK7A 3UKOA 4D56A 4F72A 1C14A 1TJ3A 3R3ZA 4XD7A 1DIAA 3ZJ4A 1ZMBA 3MBIA 4LRWA 1WAMA 4OGKA 2EKPA 4RD1A 1A96A 1M73E 1VA4A 4B3TB 3FDXA 3H2BA 2PYDA 2FX3A 3RC3A 1IATA 1CR6A 1PDOA 1RQRA 1U8EA 2VTDA 4FUTA 4CQNA 2C2KA 3C3AA 4J91A 4EEKA 4YV1A 3E9DA 3LY5A 2P6UA 4PGAA 1IXSB 1DAEA 3H5RA 4G84A 2Q6LA 3DM9B 2BIFA 4PZPA 3ZWPA 4MW0A 2P1RA 4R1TA 1V2HE 2X22A 4MA4A 1FSGA 4ES6A 2NP7A 2ZYHA 1I1QB 2C94A 2BEKA 3WZMA 4ARVA 4BLWA 5AOAA 4DQDA 5FXMA 2XMDA 2OHHA 4DSUA 1OBFO 1UF9A 5EGSA 4JV5B 1FTYA 1XJ5A 4A0HA 1RHRA 5J1SB 1SUPA 2WMDA 1MC5A 1JBQA 4ZOAA 4S1WA 3EXHC 2FMIA 2HBZA 2X8AA 2ZJYA 3HUDA 3I53A 4C01A 2E5FA 1IHOA 2VXCA 4BMOB 2SBTA 3OEWA 3N5KA 3SJZA 1SJ9A 1MUUA 2TECE 2XZDA 3OHMA 3GUCA 1QHGA 3WHPA 3QPWA 2NTVA 2N47A 3G85A 4K1LA 2PX3A 4Q12A 5AR1A 4BLQA 1DAKA 5CYGA 4JU8A 4M9ZA 3OZAA 3FFAA 5CNIA 3ZCRA 1QIEA 2OEPA 5C3MA 5K01A 2CUTA 5HUHA 5F98A 3Q11A 4N48A 5E7IA 3TLEA 3ZJ5A 3PGA1 1V16A 2I8CA 1GNRA 3HUUA 4N18A 5DULA 4BB5A 5KQPA 3WLFA 1WM1A 2CVZA 2G36A 4Q03A 5BSFA 3UMYA 2JAUA 3PXBA 4BVBA 2I1VB 1JFRA 2NYRA 3SZLA 3QOYA 4BZWA 3MTJA 3NKVA 1ZWKA 3HVJA 4QDUA 2PRZA 5LPNA 3G8DA 3VA7A 1Z2OX 2HR1A 2XSZD 1M74A 4WBXC 1T25A 1GPAA 2O2SA 4WCFB 5DO9A 4D81A 2V65A 1H5QA 2FDRA 3BCUA 1GQ2A 3TCKA 3X1MA 3HDQA 2HW8A 1TVEA 5EVJA 4YI3A 4AQ7A 5JD6A 1SXHA 4JB8A 5KMGA 4RTSA 4EPWA 4IDGA 2XB6A 3WOVA 4ME6A 3QY0A 3DDUA 2PNJA 1BRTA 1WDLA 1J1IA 3A9VA 3ENNA 3F96A 2V7EA 2AFIE 2J59A 1A9YA 2VG8A 4HPJB 1T8PA 3NTOA 1R4NA 2DU8A 3GFBA 1AUXA 4PFJA 5JQGF 1WE2A 2MYPA 2PNFA 2X5NA 4FFRA 1JLLA 5H68A 4RJ2A 1RJ9B 1L4UA 4Z7JA 2Q1WA 3KIPA 4QOGA 1XUOA 3CF0A 3DE0X 1MTOA 2ZQ5A 3G7NA 2NVUB 2B98A 4BEWA 5KQRA 1XA0A 1M6YA 5E8JA 4BLTA 2A9RA 3OQBA 3I0NA 5H59A 4QECA 5DP1A 5CFRA 4NPCA 3OTOB 1OB2A 3NEPX 4GKKB 5DDIP 5CM9C 1TA0A 3N59A 4TWIA 4LY9A 3UAGA 4XYGA 2QZ4A 5DSXA 2WTXA 5FI0B 1UXJA 3RDPA 1LDGA 3VVLA 1C1XB 1P0IA 4IZOA 2QRVB 4S2EA 5JMWA 2FPPB 1TYEB 3I8OA 1P77A 3LBHA 3PFIA 4HR7A 5FYDA 3DAYA 3PTLA 4L1KA 2WK1A 4IIUA 3FWNA 4QYMA 2C2WA 3QENA 1VZ3A 2WYUA 3ST7A 2HWKA 2GI4A 2E6UX 2GFHA 2HO4A 3B2EA 1PDVA 4E13A 3P4XA 3U9SA 2X8JB 3FYSA 4BJHB 1KJZA 3NHRA 3C48A 1II8A 3HFRA 4OEHA 4RCZA 2Y1FA 3AESA 1YF3A 5JXJA 4P2GA 2ZAGA 1YVRA 2GF9A 3QV2A 3ACBA 4UARA 5ERXA 1PV4A 1HNWB 3JATA 3RPEA 5LU8A 4JCCA 4M9CA 4BNHA 4JNCA 2HHJA 5KX5B 1U8ZA 3PCRB 4Y0VA 3NO4A 1YL6A 3E7WA 1HT2E 3N8NA 2HJRA 1JIIA 1WMDA 2OHFA 2G5PA 1M2OB 4I99A 4JC0A 1WF3A 3QLUC 5TY0A 3PR3A 3S5JA 4AAYA 3HN7A 4UDOA 2R1VA 3WQRA 4ZPXA 3WIBA 3SGLA 1VL8A 5C7OO 3KQMA 3FPEA 4HRVA 3NT5A 1ZVKA 4QOSA 1PW5A 5LBIA 3W5HA 4EHJA 1YBFA 1ZRHA 1J25A 3T9BA 3TSOA 2R8ZA 1TEXA 3IBYA 2V6JA 4FQ7A 4FJ2A 3ND7A 2F3SA 4HNSA 3TNDA 2YC2C 3GNSA 1E8NA 3OETA 4F45A 2TSYB 4LNAA 1NMZA 3FYUA 3HCAA 1L5WA 4G0OA 3DOFA 1EWYA 2OQVA 2HIMA 3V2IA 4MQMA 1J2RA 4ZT4A 2DBRA 1ZM7A 5CT4A 2Y4OA 3UMCA 3KKQA 3I9KA 2EQ5A 4XUGB 5DW0A 5JJLA 2I4IA 2C92A 4PQGA 3EGDB 3QEAZ 3SKVA 1UXIA 2FK7A 1EG7A 4ZIRA 4CLXA 3I6QA 3NHYA 2Y1KA 4EEXA 1MEOA 2Y6UA 5D87A 1U6JA 4UD6A 4G23A 4R51A 2IXTA 4Z1MA 2ODTX 5E7QA 2XT9A 2JKVA 2L2QA 3O8OB 3OO1A 4C2AA 4KHPB 3AG6A 2Z9BA 1IJKA 1P2VA 3GH3A 1KBOA 4HVCA 4I4NA 5CDYA 4TXMA 1DWUA 2AWOA 1ACLA 3IPLA 3PUVA 4U8GA 3EAFA 3L8EA 4RD4A 2MR6A 2IHYA 3ET4A 4W63A 4FINA 4ZQBA 2IYAA 3CPJB 5C32A 4KOAA 5CH5A 5LYJB 3VSAA 4P36A 4K6MA 3LJKA 4PO9A 3HNRA 3DC2A 4MYSA 3H2YA 2ZS8A 4QWWA 1OB5A 2QTAA 4LXIA 2HN9A 5IAKA 3PNLA 2QUBA 4Q02A 4WASA 1L9KA 2Z1MA 3DT8A 3L7NA 5CX1B 4URVR 3ZDYB 4ZYXA 1YJXA 3ASUA 2B5OA 1SCNE 1G66A 2GF0A 1C50A 4UNIA 4DY4A 4MYDA 1P62B 1B1AA 3FHJA 1E7WA 2P5TB 3H2KA 3Q41A 5FEUA 1JH9A 3ICCA 4FIDA 2R6ZA 4HDRA 4KPUB 1SG0A 1XAGA 3VYTB 4R0VA 1J1UA 1OI7A 1Y5RA 3VSBA 3RBAA 3QPBA 1WU7A 2BJHA 1GQFA 5FUVA 4CV0A 4EVQA 3M81A 5BW5A 5T3YA 2BHSA 2VRWA 5TDHA 1MB9A 4E5NA 4B3DA 4EVIA 1AK1A 3IMCA 4GQAA 4RJLA 4UUQA 1OJLA 5IH7A 3FB4A 4EM6A 1GV1A 1Z4KA 1WXXA 3ABIA 1USUA 2RI1A 1GUFA 3O8QA 4IIJF 2IV7A 4B48A 1QTRA 3BWVA 2OO7A 5D8DA 2F1RA 3JQAA 5TB5A 1NOKA 4Q7LA 1UP6A 4MAFA 3QVUA 2QLBA 3DULA 4MKXA 4B76A 3MQ4A 4OIMA 3D5TA 2NXNA 3PA6A 1G5FA 2BCGY 3PF8A 4IG9A 4Q3LA 3DBOB 3GJ7A 3O8DA 1W88A 2HREA 1Y48E 2CC2A 4KGXA 1GAEO 2VNKA 1QV6A 1ECLA 2HQSA 2XQVA 3JALB 1NLMA 3LF2A 4CM8A 1JJIA 5B7NA 3WC4A 1MIOA 5D2CA 1U5CA 2C8VA 3ECSA 5FWXA 1QV7A 3W3ZB 4NZOA 1KIFA 3PR1A 2AXEA 4J3JA 2A14A 2A9FA 4KJZA 5KX5F 1JVBA 2VTBB 1EUQA 4HH1A 4EHHA 3K1TA 5C7LO 4Y1EA 4P83A 4IOJA 4Q6WA 1W0KD 5F2NA 5BP7A 2F3UA 3R5JA 1H4TA 2C7BA 4OAPA 4U0KA 3ZE7A 1UL1X 2MINB 2ZYGA 3OMLA 4QEDA 3WGLA 2QJTA 5JV5A 3VDMA 6YASA 1PQUA 1JG7A 1NR5A 1RXCA 4C0LA 5C8ZA 1IMOA 4FR5A 4JJFA 1K2VN 2G63A 2KW5A 3ANNA 4G5XA 3N74A 4TLBA 3BQNB 2V55B 5EJ5A 3CUUA 1IY1A 1QC5A 4FSDA 1S4MA 1TCAA 2FW6A 1HA3A 1VKHA 2A9JA 2WIAA 4NU5A 4UREA 3S7TA 4EMBA 1OT3A 1JR3A 2DFPA 4WOPA 1Y9AA 5DHFA 1UFKA 1Q20A 3SYRA 2D59A 4QLAA 1PZHA 2C7VA 4EX6A 2RFLA 4Q66C 2IJGX 4TTAA 1TZJA 4DQUA 4YLYA 1ZNZA 3C3YA 3PK0A 1F1BA 2JFFA 1NTOA 4TMZA 1W76A 1Z75A 4NFLA 1N0UA 1T3SA 2DCUA 3DW1X 4OP2A 4F86A 1E5DA 2ENUA 1ONBA 3ROTA 1V8BA 4JZYA 3K0CC 4HWRA 4UOZA 1M0SA 1SELA 4WLOA 1W48A 3BORA 1GLNA 2QRQA 1BQEA 2ZWAA 1W30A 1N5RA 3L4EA 5KNLA 4CG0A 1G2PA 2HZ7A 4WCVA 4PYJA 2O5EA 3ESZA 3AJRA 3KQHA 2QR3A 3QX3A 2DT5A 4B3FX 2HWUA 4JCOA 4YS6A 4P35A 3ZDDA 4LZNA 1YQ9A 1UDXA 4MW4A 1GTG1 1G291 3M1LA 5E4JA 1OKKA 1YS1X 1M2NA 5BSGA 2IWRA 1SUWA 4UPVA 5CHEA 3FOFC 2TYSB 4TL8A 3RUHA 1MJFA 3UA3A 4D9CA 1U81A 1U2GA 5LYJF 1B23P 3UMVA 2BEWA 3VKFA 3ZDRA 1PT9A 4HGPA 4CVNA 5JAIA 1QU3A 3N8GA 4BX9A 2O6LA 1FDSA 4P1ZA 2XX3A 2QRJA 3EDOA 1DV1A 4YRJA 1J07A 3IAUA 3RSQA 1U5BA 1PW7A 1D03A 4LSWA 4AWXA 4B3IA 1ZM9A 5B7QA 5LQKA 4X64B 1NGSA 2GBIA 4JA2A 1CS0B 3C1AA 4PBRA 2IP4A 2BFEB 3ZI4A 4DFDA 1W5AA 2CMKA 4J0FA 1BS2A 1K66A 1Z2EA 4AK9A 2R1TA 4DV1B 4H7DA 3JAKB 3ZD6A 3WLJA 5KINB 1A1VA 3E1KA 1CE8A 4P32A 4DCUA 3H7AA 3JYLA 2B35A 1XEXA 4TX1A 4LFCB 3LX5A 2DBYA 5JROA 5EG5A 2VZ9A 2ZZNA 4L8WB 3C98A 3UQYS 2GHRA 3IMGA 4LOHA 3NCTA 3E9YA 3QVOA 5CBPA 4C0HA 2VHQA 1B00A 3P9NA 4RD3A 3TH5A 3EX7C 1M8JA 1G20B 1VJDA 5I9MA 1WZEA 1KO1A 5EZYF 3B1ZA 3S29A 4XVCA 2BFEA 1U3DA 2OZKA 1DWPA 1N5OX 2WFZA 3K0EA 4GM0A 4OI4A 5DT9A 3SEFA 3ZNOA 2GUGA 2PRIA 2Z57A 2CNLA 5DIZA 1BSVA 2PZKA 4EUEA 5DNEA 3ZWOA 2JAWA 1X3LA 5GJBA 4EFKA 2HCBA 6Q21A 2Y1XA 1CZLA 2YL2A 4IYJA 4K9SA 4AWBA 1H42A 5JVDF 1CUFA 1KXZA 3U4QA 4X41A 2NSYA 3M3DA 4EGSA 3VM6A 3T7EA 3W7AA 3WRXC 1NXPA 2ZPAA 3H16A 3PC3A 2QL7A 4IQ0A 3GRKA 4AZSA 1GN9A 1GZ3A 3NIDB 3EGXB 3D54D 2UUOA 3D5QA 4NONA 5LZ7A 4LRQA 3DJFA 2GZMA 5CLJA 3K9NA 2C2XA 2OKCA 1Q77A 2PJZA 3QNUA 1M5UA 2ODBA 4X0EA 4BNXA 3NTLA 1ADJA 1QVAA 1R15A 2LCFA 1ES9A 4KR3A 4ZAGA 1CUHA 3DL0A 1QQ6A 3AP3A 1GTZA 3NANA 4WX2B 1PJSA 3OJCA 4EG5A 1VXRA 1FTSA 2QRPA 3BB1A 3AR9A 5LXTF 7ABPA 4UOEA 2AZTA 2OORA 4O4LA 1ONNA 1FVOA 4MGIR 1BU8A 1R9MA 4R7GA 3WLLA 3ZHCA 1B8NA 4MA0A 1DPFA 3HVHA 5DTQA 1E9SA 2E0IA 2E21A 5KOHA 4GOKA 5KSWB 2J5KA 5I8ZA 3UMMA 2ACEA 2CDNA 2XVZA 3LHDA 2RMKA 3WQQA 5KYNA 3NWBA 3L9WA 1HOTA 1XCMA 4G6ZA 4ZMBA 3DVLA 3KM0A 3R7BA 4CMEC 2JCVA 2FU5C 2OXFA 3EDRA 5JS7A 2H4WA 5GONB 1AGNA 1GDHA 1U9JA 1UBHS 4GZ6A 3GEDA 4Y2RA 1VC2A 3K2BA 2YZ7A 4B32A 2B9EA 2J41A 2YYYA 3WWCA 2DUMA 4LYDA 3EXIB 4O6VA 2GESA 4JLWA 4EW2A 4YJ3A 3W8NA 4DNFA 2IZ7A 4UEOA 4YRNA 3MWKA 2GPWA 2C2OA 2VNHA 3EOAI 3OQMA 3QPUA 7YASA 1KI9A 1QWSA 1Z68A 3GR6A 2B0JA 4ND1A 4YP5A 2HJSA 2V6GA 5F5NA 1BCSB 2CHEA 2FSGA 3HLTA 4YHBA 2G83A 2NO6A 3W4IA 1Z0ZA 5CUQA 1FQWA 3P4UA 3G9XA 3S81A 5EHZA 3D8RA 3CW8X 1J97A 1K5PA 3SJCA 5K0JA 4W5QA 3QWBA 4PX5A 2ZIFA 5BN3A 2LIPA 4GMHA 5A4IS 5D3MB 2R96A 4PM4A 2IK8A 4XLLA 4A0RA 4B3RB 5FUWA 4MNTA 4Z53A 4IDQA 1NVWQ 4E5MA 1S3SA 1XZCA 4OHWA 2LWIA 4JIMA 4I3HA 3FSGA 3RSLA 3DKIA 3JWIA 3U0VA 2ZBVA 1Q0RA 3FOEC 3K0AB 2ZRJA 2AR0A 1OMOA 3MG9A 3YASA 5BQ3A 4MV5A 5D84A 1V96A 4GRIA 3V1YA 2XE7A 5LL6P 1NBMD 2HRZA 3ZR4B 1RPJA 4H0CA 4MOWA 4OUDA 1BE1A 1TXGA 3ZGXA 3U4AA 4EQZA 1ZMOA 1I7PA 1K08A 3QKSB 3RS7A 5BORA 2ZRBA 1V95A 4MS4A 2Y1OA 3CPEA 2ZREA 1J9GA 3QKSA 1O95D 1TQ4A 4H9GA 4LPSA 5DGHA 3RKUA 3HXOA 5IUJC 4BCDA 3DO5A 1CJCA 4X45A 1MQ8B 4MVJD 4YR9A 5HRCA 1GQQA 1KYWA 1L3CA 4B80A 1R3UA 3DLPX 1D5WA 1XRRA 2A7QA 5CB4F 3ZU5A 3K0BA 2BSQA 2FPXA 3ADKA 2AI1A 4GM1A 4TUYA 1GYQA 4LV6A 2IYNA 4HI0E 2REBA 2XHZA 4MZDA 3SCZA 2Q1SA 1C1DA 1PV2A 2EQAA 4R2XA 2P2ZA 3I5YA 2FWPA 2PU5A 3IA2A 4WK4B 2C5FA 4A8PA 3R3YA 5JJ5A 3HRHA 1IHYA 1U1DA 4PLWA 4UE2A 4EQ6A 1GVHA 1T0HB 5IC5A 5EHIA 4LF7B 3QFCA 3ZZMA 1PT8A 3VX3A 5JS8A 3IVRA 1EDEA 1SKYB 3ZY5A 1ZJ5A 2ZBEA 4X20A 5EZQA 1B2LA 3R5KA 4PF1A 1P2DA 3NFYA 3T6KA 3O2JA 1UBRS 1TVMA 1EIZA 4N6OA 5FLEX 1EB8A 1IVSA 3GU3A 4DMGA 4JKOA 2PUDA 2ZUWA 1SBHA 4TZTA 3WA7A 1JYSA 3WR5A 1BHSA 4HVAA 2Q3DA 4WWHA 5CX4A 1NW6A 1NSFA 3ETLA 5B1DA 1U5AA 1U8TA 3M5DA 4FGWA 2VL7A 2XNDD 1WPXA 4GXTA 1KY2A 4PG5A 3S55A 1GUDA 4WECA 4I8IA 4W1RA 4LV8B 3VHRA 3O2SB 3O7MA 1I4LD 4O2BF 1SULA 5IAOA 2YTZA 2GN9A 5GONA 4JI4B 4EHFA 1IWBB 1RWQA 3QXHA 5DBFA 3TOXA 2FY8A 3TSZA 1TEVA 5DP2A 3LXMA 2GN4A 4UCFA 2OL4A 1LRJA 4S35A 3KKEA 2J45A 1MFPA 4ETNA 3WGTA 1IL0A 1J2JA 5KOHB 3LC1O 1DAHA 4B1FA 2Z6QA 3TEFA 1C0LA 1A7KA 2EEPA 3BHJA 4CEHA 3NALA 3AUUA 1NIJA 3BB4A 4MB6A 3TQRA 4TMFA 3V33A 4YT2A 1KF0A 4LXUA 4YA6A 1CK4A 3DMDA 2EL9A 1FYWA 1LW6E 5BT8A 3VC2A 1JFSA 3DE3X 1K6XA 1UC9A 2Y99A 4C04A 3DZ8A 1I0LA 2JLXA 3P19A 1HZZC 3ADBA 3USES 4G25A 2FETA 4KR0A 4RHUA 1XPJA 3W5UA 3DEIA 3RG8A 3GLUA 3ESCA 3ASVA 4QBFA 2P40A 4B79A 2VQEB 4N5NA 4XIIA 3EGXA 3B89A 1ZH6A 4C4SA 2IEDA 5ICCA 3UJ7A 3C3MA 5L4LA 3ELDA 4E70A 4FYIA 4CZ2A 2DUNA 3U4QB 2X41A 1N75A 4G63A 1JL3A 1LA2A 5B1SA 1ESNA 2AQ8A 3QPDA 1CU1A 1UAGA 5HUJA 5ELLA 3W2GA 3TX2A 4LAFA 4D2IA 5M34A 1GEGA 4FYYA 3LYUA 4NU0A 1VSUA 2H7VA 3COWA 4ZFNA 2FN9A 1R0WA 2XCOA 1G8AA 2M1XA 2ZJBA 4N0MA 4NARA 4L4YA 1S8FA 1N1GA 3GLGA 1CZHA 1ZN7A 4W6ZA 2CNDA 1HDCA 2GK4A 2B5WA 4TSFD 3AF6A 3TIIA 4GYWA 4WJLA 3QU2A 2QM3A 3RS5A 1UBEA 5K3BA 2C5AA 2HWXA 2PK3A 3DOOA 1XZNA 16PKA 2B36A 2F3RA 4UVGA 3AEQA 4BJ5A 2PZGA 2ZT5A 1D9ZA 4ZHQB 1INLA 2EOAA 2ZDGA 4C88A 3G5MA 3IUPA 4OA5A 4RJJA 2JA1A 3E0XA 3KZVA 3MJDA 4R98A 4M60A 5FWNA 2B78A 4F1KA 1JLSA 2QEQA 2IHJA 1NFRA 1WW8A 1XEWX 2AIRA 3ETNA 1QUFA 2HF9A 4G26A 4LXXA 2FHSA 3CLSC 3IHLA 1R66A 1VOTA 1XQXA 4HYYA 3BGSA 4LS3A 3LSTA 1QKJA 3IQGX 5DLDA 1E1RA 3HDYA 5F12A 1HOXA 3T7SA 2DQSA 3EBLA 3FDZA 3QUCA 1OPXA 3DAFA 1XVTA 2HRBA 2JK0A 2C9DA 4HY3A 2FEAA 1XC7A 2RHDA 3ND8A 3GPDG 3Q3JB 4P8RA 4KYVA 4LZLA 1YI1A 3PKIA 4ALIA 4URUR 1JWBB 1KXJA 1UPUA 1V3QE 4JLDA 3E70C 3PWZA 4V1CB 5JNLA 1CVRA 4LISA 3O82A 1QKIA 5I51A 1E18A 1FPQA 4UMDA 2IHZA 1G41A 4A91A 1MB4A 4HYEA 5HMMA 2IL1A 4DCMA 2Q5LA 3EXG2 5DYNA 4YRDA 1RPNA 1CJBA 2CK3D 1J20A 2CNOA 4OREX 1QAOA 1PYGA 1QG2A 1Z17A 3EQ8A 3MGKA 5DM0A 3WSTA 1XAJA 2A0FA 2VQ3A 4J94A 4BNZA 4MMYB 4LDQA 4F2GA 1P2SA 4YMLA 1XAIA 3HDVA 3KELA 1Z45A 2A33A 3V8BA 4HWOA 2WTMA 3ANXA 1ORRA 3F5SA 5LB4A 2P91A 1ECJA 2C88A 1PZXA 4FHDA 1ULZA 2JRCA 2DKFA 4QA9A 3HGQA 5LLTA 3Q0EA 2GO7A 1MX1A 2AG1A 3NEAA 1IEWA 1ITZA 1Z7YA 4C4PA 3KQSA 5A7HA 1KIAA 3HA2A 2F43B 4KXUA 4C89A 3DXFA 1SU6A 1YRLA 4XGQA 3INYA 4WRRA 4OHPA 5F1PA 2R8XA 3D3NA 2WHEA 4F97A 1MQAA 2CEKA 1HE5A 2Q0SA 1A3CA 4J16A 4RDIA 3AR8A 3OPVA 4NXNB 3C43A 2A0YA 3LIIA 4TTTS 2C54A 4YH1A 4JI1B 3ZV4A 3CLRD 2CNKA 1M34E 3PQ3A 2A67A 2FEPA 2H9IA 3FMOB 3W3AD 2QXTA 1WSBA 4QWMA 5JC8A 1XTJA 2CDAA 2G40A 4BO4A 4U8HA 4WXPA 1S2GA 1W88B 2OHVA 4NFYA 2FSVC 1XJ0A 3L7LA 2HI0A 2V74B 2CLIB 4MV3A 3RQSA 3RJMA 4MAAA 4OQXA 5U9CA 3BH6A 4PFKA 2BBSA 2Q3HA 3I6YA 3IBGA 4FJ0A 2FWJA 1IXZA 3IPRA 1QX4A 4L08A 4BMVA 2OPBA 3N05A 5D7BA 3D0KA 1CW2B 1AZLA 3TLGB 2H2GA 4LW8A 1RE1A 2OQRA 5T6BA 4OHZA 3RYFA 1DC6A 2MWMA 2QY6A 3EC2A 1GGKA 4UQOA 3VYRB 4D43A 1DZ3A 3IE1A 2UVQA 2RHCA 1C8LA 4RV4A 3CGGA 1P74A 3JASA 1Z63A 1A7UA 1WLYA 5IJZA 2WM9B 1G8GA 4FT2A 3UXHA 4FCWA 1X9GA 2VNIA 5CG1A 3HB1A 2I55A 4HGZA 2HMSA 3UGTA 3ZJVA 2R8EA 1P2GA 3SG0A 4ED9A 4A8JA 4U00A 3UENA 4RZUA 4ZQEA 3RRZA 3W9BA 2X14A 4IVQA 4KPYA 4C1BA 4UBMA 1CF2O 1ATIA 1R88A 2FFHA 2CSXA 1H2HA 1ONOA 3TFOA 4WBSA 4DXDA 4L51A 4YROA 3BIJA 4RWEA 2VDNB 4QZVA 3BB3A 1B74A 5CX1A 2FHPA 4QXRA 2CLOB 4TT8A 4BFVA 3A3YA 5NLLA 1NBOA 1C7FA 4JC5A 1S8OA 4Z0TA 4BFTA 4L76A 2X76A 1ZKMA 4OV6B 5DBHX 1KH2A 1EWVA 2IF0A 3D1VA 3WJ7A 3UUEA 3X2EA 2F8MA 3FGNA 1BRMA 4J4BA 3KKZA 1HDZA 4KFTA 4BNJA 2GD2A 2BKAA 1ODTC 4EYGA 3AZPA 1TM3E 3HJTA 3J7TA 1BAPA 2VS1A 1M2WA 1TF2A 1CCWA 2CFSA 2K2QB 1V8FA 3LDFA 4XM1A 5ALHA 4C0SA 1NZJA 2AG5A 2YXLA 3DMTC 4KMRA 2ZJFA 3GQVA 2IHUA 3AWIA 3IBCA 4L73A 3PUKA 4ZZ2A 1EK0A 5FF9A 4G1CA 2C95A 3OOHA 4DYVA 4G0ZA 2Q5JA 4EVSA 2ZPUA 1P4RA 2J6HA 2YASA 4H1UA 4QOEA 3CRQA 3A2LA 4EZBA 3WAJA 3S1AB 2GF2A 5T7BA 3KEGA 1GNPA 5DVZA 5FULA 3KJHA 5J5AA 4XWYA 4BNDB 5JAOA 4DKXA 4RGYA 1Z88A 2G80A 2GZHA 4PNZA 4XGRA 3R0IA 1PR0A 3PLAE 2CWWA 4ARSA 2XYVA 1QLHA 5LFAA 3FHCB 1EM8A 3A27A 3FWKA 2XI4A 4D46A 2A9PA 3EZ9A 4JJAA 4JKYA 4K46A 2QQ5A 3D0QA 4JVMA 4P84A 2X0EA 2G7ZA 4G4JA 4GKAA 2I62A 4DR2B 1QAQA 4ZQIA 3K0FB 2Q0QA 5EXTA 4MVJM 3WYNA 3MYYA 3AB8A 2PKYX 1T8YA 1K0UA 2OV4A 2OZLA 3VR6H 5A9SA 2AFIA 3FTCA 3CUKA 4IJ5A 2SECE 4UNQA 1W87A 1VSQA 1XDZA 3C4QA 3G0BA 3U19A 3CO5A 4H7HA 2PXHA 1SXJB 1CC1S 5KTNA 1DUSA 1KC1A 4LUCA 4F71A 3P5SA 5FLYA 4M7OA 4QBGB 4EO9A 4CKWA 3D2AA 5KX5A 4CIBA 1REQA 5D5PA 3WVNA 3ADDA 2YWRA 3JVEA 2CLFB 2OCGA 4C0XA 1BX0A 4CNQA 1LEHA 1P1IA 1WDKA 3TGLA 4ZO6A 3AESB 2YUTA 3ROXA 1LBEA 3OZTA 2YVLA 2X0NA 4QNRA 3AR2A 3KTOA 2ZUDA 2BM0A 3B3GA 5K99A 2QSYA 2BYTA 4HMOA 4MJ3A 1FTGA 4LXQA 4YMHA 3RTGA 1JHAA 2LP4Y 3W8FA 1KDPA 2X2FA 2GKSA 3BIFA 4OB8A 5CA1B 3BDAA 3ZBQA 1IQUA 3K96A 2X0DA 2P68A 3U56A 3ZVNA 1PZEA 3U4IA 4XJSA 3BXXA 3GA5A 1L5MA 3AI3A 5AOVA 4PRZA 4UEQA 3PX2A 5EFOA 3Q6MA 5KIAA 3C3EA 4WVFA 4CUJA 3UANA 1CY0A 4MVJH 1THTA 4I2NA 1QYDA 4X8MA 4BDTA 3AHJA 5CLLA 1X9HA 3J81A 3AVTA 3CCCA 1PHPA 4FGSA 5ALSA 4YONB 3ZK9A 3FYDA 1WY7A 1FU4A 3GAZA 3HQ4O 5KTSA 4YJ2A 2Q1YA 1RJ9A 1ZSYA 2W2KA 4TQAA 4YLGA 4J7AA 4A10A 1T4BA 1J09A 2QLTA 3E2PA 4UBLA 2BP7B 4AJ1A 1R0ZA 2DCMA 2PFGA 3JY6A 4OX9Y 3GI1A 4HAXA 5TGTA 1OTXA 3HCBA 1X1SA 4BWFB 2I1WA 4E2FA 2QTRA 3CZ9A 4FI3F 3UM9A 2JKZA 1T24A 2VDJA 2E7ZA 2ZIGA 3BRCA 3PCXA 1P0FA 3UXYA 3PQDA 4EAQA 5I5EA 4LC9A 3EUFA 4I8DA 1BVRA 3QQPA 4PZAA 4DWJA 4X6XA 1GT91 3G1UA 4LZPA 1GU7A 2F64A 3Q8LA 2ZWVA 2JVJA 2ZJ1A 3OJEA 4XRGA 2G88A 3FLBA 1AA9A 3OT1A 2BDUA 3WGHA 2QT0A 4E12A 4UHEA 5F77A 2C97A 1DO2A 1P44A 4L9AA 4M98A 4ND5A 1UPBA 4Y18A 4B7CA 5FTWA 1QLWA 3HV2A 4XDGA 3WRVA 4CM6A 1L2TA 1ZR4A 1J0AA 2P3OA 1DTWB 3F2IA 4J90A 3GP5A 2VP9A 2HH9A 3QFHA 4TTJA 4FB5A 1V1RB 3MMZA 5KB3A 2PBLA 2C84A 3BH0A 3ZGOA 4TYPA 1C3VA 3MLEA 2IKQA 1E59A 4MUBA 2JBAB 1PZFA 1Y7HA 4RQUA 3HXPA 1D0VA 3FPJA 3ZCQA 4BMYA 5DU2A 5I8PA 2H63A 2I9KA 4QC2A 2XUPA 3DMRA 1DCMA 3FGPA 5G3YA 4NHEA 4S05A 4FP9A 2XOKA 1Y9ZA 1OYWA 2D0DA 2OXCA 4M6WA 4RKQA 4DV4B 3KVNA 1P8AA 3DE7X 2FDCA 3H8WA 4OBEA 1B16A 4UUNA 1MD9A 2GDJA 1MORA 3AL0C 4PINA 3WFJA 4ZTZB 1SB8A 1S2MA 1Z6AA 2XITA 4FCCA 3MLBA 4ZOBA 4E5DA 1L4FA 1Z7WA 5EI5A 3ZHOA 3DV0A 1FDIA 2QWXA 3KCQA 2EU8A 2YNMC 3QXSA 2H52A 2DERA 2NM0A 1QNLA 2ZRPA 2QVLA 3C0KA 4TS3A 5EERA 5JG7A 4CM3A 3IR5A 1L4HA 3A2MA 3OH8A 4JP2A 4CG1A 4C07A 2B3TA 2PKCA 2D0PB 3UIEA 1QFYA 3KEOA 1X8LA 1Y81A 3T12A 4ZO7A 1RM3A 4HGNA 3EA0A 1AOXA 1IMJA 2D0OB 2O5CA 3VPFA 1A5SB 1QHNA 1ISIA 3G2NA 4Q7EA 3L4BC 5CTJA 3QFSA 2RHRA 3JPWA 1JT9A 4C6TB 2A5DA 3RC8A 5TARA 4MS3B 1UZUA 3ZWBA 3OICA 4FHGA 5AM0A 4AZTA 3P71T 1YIOA 3KJEA 1MC4A 3W0LB 4KDRA 1XRPA 5HKBA 2NPOA 4GU5A 2ZWOA 2PG3A 3PNPA 3ZOKA 5M29A 1FP7A 4BX0A 2OAGA 3E8SA 1O6GA 2VYVD 3O74A 4AJPA 1ETHA 1BKYA 2V5VA 3G17A 4XIFA 1FU7A 4UMVA 4EG1A 2CW5A 4F84A 2VSOA 3H8VA 4O2BB 2HMWA 3BILA 3B7WA 5JY6A 2PCJA 3F8WA 2XB2A 4HFJA 3UKJA 3L1HA 3B1VA 4QXMA 1L6RA 1MO3A 2JPDA 2HIAA 1U9ZA 3L05A 3NWPA 2VUTA 2YWDA 2GN8A 1LQUA 3QLEA 3GEEA 2IYLD 1U0NA 5FOTA 1YFLA 3KALA 1J0XO 1AGYA 1PTKA 3N9IA 3EG5A 4FCVA 2YWEA 2FMXA 2ACWA 3VVMA 2BPOA 3MGGA 2AMVA 1T8SA 2ET6A 4ASUA 5CM2Z 3SC6A 3KSRA 1FYVA 4R9VA 2J6IA 2TMGA 2C5BA 3GY0A 5DLQC 3MMPA 3K9BA 1NX6A 3QEJA