1CEQA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
304
Chain Sequence
PKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
total genus 110
structure length 304
sequence length 314
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ceqA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ceqA02
1IULA 4DPLA 3MTJA 3H5RA 1VC2A 1NNUA 4J4HA 1B0AA 3A06A 4IQGA 4BGEA 4BNJA 2O3RA 4KUGA 1HZZA 2P9CA 2YUTA 3ICCA 3WGOA 4P8RA 3CH6A 4UEJA 4KMSA 5HS6A 1BW9A 4CQMB 4B8ZA 4NBWA 4DC0A 3GVIA 1I2BA 3OF2A 4PLCA 1TLTA 2Z1MA 2ZIZA 3RUDA 3VHRA 4E5YA 4B7XA 4CQLB 4U7WA 4AFNA 1LDYA 4HV4A 1PS8A 4MP6A 1KEVA 3WICA 2EGGA 1HZJA 1EDZA 3BHJA 3DZFA 1O5IA 1G0OA 4ZQBA 3U4DA 2GO1A 2B37A 3RUAA 2AW5A 1NBOA 1U1IA 1WVGA 2JKVA 3G79A 1UXJA 3GFGA 3KVOA 4BO1A 1N2SA 1A7AA 1ISIA 4MVJG 1PGJA 2OBYA 5FF9A 1SNYA 2W2LA 1E3SA 1EFKA 1MXHA 3L77A 3O03A 4G2NA 4GMGA 4R16A 4TQGA 3ZW9A 3LC1O 1YL6A 2ZTLA 3GVCA 4FOOA 4CM9A 1N1EA 3FNFA 3SC6A 1GY8A 5K9ZA 4EUFA 4HWKA 4RJTA 2ZB4A 2VZ0A 4XR9A 3IKTA 1E7MA 1HDXA 1ML3A 1KVSA 5JPIA 3D5TA 1I3LA 4WCFC 1LUAA 3OMLA 2GERA 1UZNA 2EXXA 2GZ2A 3E5MA 3WDSA 2H1SA 3AOEA 5CDYA 5EMHA 2XXJA 2Z95A 2BH9A 3Q9NA 1C1DB 1A4UA 3G17A 5L4LA 1H6AA 5TC4A 1Z73A 2X9GA 5JFOA 3E8XA 4YT5A 3TZHA 3QVWA 5COQA 1GTMA 2YHUA 2Y1OA 1EUDA 2ILTA 4IGEA 1P1IA 4AJHA 4P22A 4MKZA 1HE3A 4PLVA 4BL5A 2P9EA 2OP1A 3PRJA 4DBVO 4JJIA 2BMAA 4IDEA 2BGKA 3GEMA 1Y8RA 4HKTA 2WD7A 1HE2A 3JQGA 1WDMA 2X5OA 4OSPA 1V8BA 5T8KC 5GZ6A 4KDEA 1K0UA 3WIEA 2NWQA 3OEYA 5G4KB 5JLAA 2B36A 2C54A 3AU8A 1YL7A 3TZCA 4Q3NA 3BMQB 3V2GA 3GNSA 1A72A 4GL4A 3QVXA 4RPKA 2FSVA 3FI9A 1WXDA 9LDBA 3RI3A 1P0FA 1T26A 3TDKA 2D59A 3LF2A 4DIBA 3SVTA 3WS7A 1ZXLA 5JYEA 1WAMA 4HFNA 2EV9A 1NAHA 3D1LA 4CM8B 3GOHA 4FC6A 1WZEA 5CDUA 4JX8A 3H65A 1A5ZA 3Q6IA 5ITWA 3N7UA 4WKGA 4XD2A 4BGVA 3FWNA 3IIEA 1QG6A 1DJQA 2AQ8A 5IAAA 3ONDA 4G81A 4WUVA 1NX6A 1SCUA 3WQSB 5JMWA 1HL3A 4J1NA 1I36A 1BGVA 3H3FA 4DWVA 5ES3A 2PA3A 1ISFA 4BS9A 3R1IA 1V9LA 1LLUA 1HRDA 1GEEA 3DHEA 2GDZA 3AUUA 2Z5LA 3PFWO 3GR6A 2W98A 5EERA 3RUFA 4F6CA 3B6ZA 3RFVA 2I66A 1HDGO 3CEAA 1DLJA 1CQJA 1Y8RB 3KSDO 1I32A 8ADHA 1CRWG 4LRTB 3GZNB 1HLPA 2Q50A 3F1LA 5C7OO 1PJ4A 2EIHA 1R4MB 4IDGA 2QYSA 4YPOA 1E7RA 1MP0A 1MC4A 4NH4A 3U5TA 3I9MA 1P31A 3HFGA 4J7XA 4ZN6A 4ZQHA 2BF7A 2HJRA 3RBZA 2YHIA 3QSGA 4L9RA 1LBEA 3H5NA 3TZ6A 1XR3A 3UCEA 2WTBA 4YRDA 4KOAA 2X1HA 2ZYAA 4DQXA 1XG5A 4K6CA 4Z9YA 2HMSA 3TSCA 4DLBA 2IDZA 2DQ4A 2Q2WA 2Y68A 4RDHA 1Z74A 5IDWA 1ZK4A 1B8PA 1MG5A 2X7HA 3I9KA 3KYCB 3IUSA 1QSGA 1V3TA 3DMTA 3DQPA 2JFFA 3QVSA 1BHSA 1VKOA 2FY8A 3SEFA 4CMEA 3MJ4A 3WR5A 1NPDA 5L9AA 5T57A 1WDLA 4YQYA 3VTFA 3VDRA 4MVJM 3LQFA 1DAPA 3DZBA 2Y0EA 2B83A 1UZLA 3AY6A 1SO8A 3ZHZA 1PZFA 4S3MA 1E1MA 3F46A 4BO9A 4C4OA 1PGPA 2O3TA 1W73A 1OI7A 3GHYA 4L4RA 5JW6A 5IXSA 3GUYA 1KS9A 1OFGA 5THKA 1PTJA 4GSLA 2NQTA 2P9GA 4XJSA 1Y8QB 2OL4A 3E1KA 1GDHA 1PQPA 2CDBA 3ZV3A 2P68A 4NU6A 4DTIA 4FS3A 4JBIA 4OO3A 5H82A 5L40A 4MVJD 3PWZA 2YYYA 1HSZA 1QYCA 2BGMA 4LMRA 3AY3A 3RD5A 1JTVA 3AUAA 4H16A 4DPKA 1NM5A 1VSVA 4WK6A 3WQRA 3RU9A 3UHAA 1PX0A 1E3IA 3JQEA 1Y6JA 2OOSA 4JXKA 1M2WA 1DIBA 1XYGA 3E5RA 4O59O 4XGNA 4ND1A 2FWMX 3WGIA 1VSUA 4ZD6A 1NTOA 1E6UA 1X0XA 5JDIA 4RF4A 4GX1A 4BKPA 2X0JA 1H2HA 1IZ0A 2OMEA 4R5HA 5EQDA 1LU9A 5F5NA 1LRLA 4TVOA 2GRAA 4FFOA 4ROSA 4R1NA 2C0CA 5IDQA 1LLDA 3PJDA 3WQQA 2E37A 3ROKA 1ZNQO 1ZK1A 3LF1A 1VJTA 4GX2A 3UGKA 2QRLA 4TZTA 2BRUA 5I7VA 4GX0A 3WFJA 3NX4A 4HXYA 4L74A 3O8QB 4Z3KA 3WGTA 4FBGA 2CVOA 3PI7A 3WGQA 4KUHA 4TMFA 1XKQA 4D45A 4YJFB 1HDRA 3ASVA 4DIFA 2YDYA 2PZMA 1ORRA 1OC2A 3Q1LA 3RU7A 1MUUA 4I5EA 3RUIA 1IHXA 1B3BA 1QXSA 1YB4A 4MP8A 2ZQYA 5LCXA 2X58A 3QV1A 4J2OA 2Y66A 4CR6A 2NTJA 4UVEA 3DAFA 2AE1A 4Q3AA 4CM5A 2XAAA 1PJ3A 4GKBA 4CM3A 3SBOA 4CM8A 1E3JA 4CM9D 5FI5A 1Y1PA 3Q9UA 5BSHA 5KJCA 3VZPA 1U8FO 4LGVA 1K6XA 4XDZA 5TT1A 5G0VA 1RM3A 1YBMA 2I9PA 3F4LA 4CR7A 5L7WA 3BMNB 1H9BA 5DP2A 2F1KA 3NDJA 4DYDA 2PTGA 2J3JA 3M1AA 3OQ1A 2EG9A 4B4WA 2I76A 3ZWPA 4DA9A 1KERA 1NQAO 3JTMA 4CMEC 4HADA 2EKPA 2IEBA 5LDGA 5JNLA 3ENNA 2GCGA 1JAYA 1ZMOA 1JAXA 5A9TA 4BV9A 1ZEMA 1F17A 1ADCA 4N54A 5IXYA 3RAJA 5KJ1A 3ETEA 1ZXBA 2BD0A 1JN0A 1JWBB 1QYXA 4NI5A 5TNXA 4EJMA 2CUKA 4P4LA 2JCXA 1GPDG 4DLLA 3WNVA 4ZA2A 2AE2A 4RVGA 4M86A 3OETA 5A3JA 3M6IA 3DBRB 3ZW8A 5EESA 2PGLA 3NTQA 4HFJA 1PWZA 1HKUA 1KEUA 3JQBA 1RPNA 3F4BA 1D1TA 5BT9A 3EW7A 3DWFA 4IGFA 5HS4A 4H3VA 3OQ6A 4UVGA 3NDRA 1EZ4A 1DPGA 4HFRA 4A26A 4YAEA 5KCZA 1UR5A 3Q0EA 1GUYA 3SJ7A 5JSFA 3QE3A 2R00C 3BMNA 5K6AC 2PZJA 5C5IA 2GGSA 3KZVA 2O4CA 1H2BA 2QZZA 3C7DB 3FNGA 1Q7GA 3NV9A 4PZCA 3GEDA 3PGJA 1YOVA 3F6YA 2VZ9A 3CE6A 5EJ2A 3W6UA 4IZHA 2C7VA 4PVCA 1PQUA 2FZWA 2RH8A 3KOUA 4II2A 5HM8A 5CPFA 4XYLA 3JCZA 4GVXA 4PLGA 3HDQA 3JYNA 2O3UA 3OA0A 1X1EA 1EBFA 2DBZA 4CODB 4MDHA 3ZH2A 4IQ8A 1XSEA 3F3SA 3ZV6A 2I6TA 2EERA 1JKFA 3PIDA 4ONEA 1U3UA 4YR9A 2DUWA 2I3AA 3ZWVA 1I0ZA 3C24A 4NMHA 4J0FA 2P91A 2EJVA 1WMBA 4WNIA 4XYEA 1V3VA 1T4DA 3GQVA 4YA6A 1V6AA 4XB1A 1PL8A 4JBGA 2AEJA 4YEDA 1VLLA 1NPYA 4NDNE 2A9FA 2O2YA 1GZ6A 1DAOA 2CF6A 3UFXA 4YB8A 3TJRA 1PJBA 4ITUA 1IPFA 3U62A 2NQ8A 3WJAA 3AUSA 4I9HA 4EITA 4IDCA 2O4UX 4CV0A 1OAAA 5BSGA 4GAEA 1C1DA 4YCAA 2X22A 4PLFA 4OSOA 4WCFB 3VTZA 4E13A 1K89A 5BR7A 3TF5A 5TS3A 1U4OA 3DMTC 1C0LA 2HSDA 3P2OA 1JU9A 3LT2A 3GN1A 2NNLD 4GQAA 2DBVO 4Y9DA 3ANNA 1B8UA 3AJRA 5LC1A 4CLHA 4YYZA 4XQCA 2BI8A 5L3ZA 1LQTA 4FW8A 4ND2A 5DBIA 4ZJUA 2IZZA 4QO7A 5JE8A 4Z0HO 4M87A 1UDBA 4CMCA 3NDIA 4BNYA 1F06A 1GAEO 4CM6A 3FWZA 3RSHA 3WSWA 2C2XA 1KEWA 2IEDA 4KWIA 1BXGB 2PD4A 3X2EA 2Q1TA 4LSMA 1OMOA 2Y1FA 1MA0A 3HJAA 3HN2A 4WLUA 1BTOA 2CVQA 4DXHA 4MIOA 1IY8A 2IZ0A 4KTVE 4O6VA 1DIGA 5TJHA 4KUEA 1KY5A 2AA3A 1TT5A 2DPHA 2Q4BA 1TB4A 1ZK0A 1FDTA 1Y7TA 4RV9A 1B14A 1T2AA 1Y9EA 4EBFA 3D4NA 3VVCA 4DVJA 1LDNA 2UUOA 3WMWA 2VOEA 2JCVA 4RF2A 4WNCA 3NKLA 2FR0A 4JQCA 4JP3A 3GG2A 3TWOA 3MTGA 4ALKA 1QLJA 3JD4A 4PLHA 3EZYA 1Q0QA 3NTOA 5U9CA 3ORFA 3MCVA 2HRBA 3EVNA 3ZNOA 5C7LO 1HYHA 4J7UA 4QXMA 4FPXA 1F12A 2YJZA 1MLDA 4PLTA 1P1RA 2VRCD 3MWDB 4Z0TA 1PZHA 5T5QA 4FFMA 4II3A 4PZDA 3CTMA 1YOVB 3ZWOA 4DQVA 3AI1A 1CYDA 2GR9A 1YONA 1Z75A 4KQXA 3PTZA 2J6IA 4UVDA 3WSVA 4Q3DA 1A71A 4NNJA 1JDJA 3BZUA 4NIMA 4IQ0A 4UUMA 1YQGA 3C7CB 5CDGA 3KTDA 3CUKA 4W7HA 3PHJA 4DQUA 1NR7A 4MVJI 1EE2A 2HK8A 2VWGA 2B0JA 3MJTA 3ZNQA 1W6UA 2AG5A 4BOYA 1Z6ZA 1ISGA 5GY7A 1KVTA 2NVWA 4ND3A 1GPJA 2BFMA 4R9RA 4IMPA 3ENKA 3QLJA 3GAZA 5JAZA 1ZEJA 1EDOA 1YDWA 2ZK7A 3U49A 2VOJA 4YJHB 3ZHXA 4D46A 1UXHA 5H81A 3U09A 2RAFA 3ZDFA 3D0OA 4A7PA 3H9QA 4UVHA 1JLLA 3DL2A 4OOEA 5F1KA 1PR9A 3U4IA 4RCVA 1PR3A 4AJOA 4L4SA 4RL6A 3ZI0A 5FEUA 1UXKA 2NM0A 3E82A 5FI3A 2JFGA 3W8EA 1P45A 5B4VA 2QRKA 2ZKLA 3GDGA 3PDJA 3KXDA 3QVOA 2DT5A 5KJEA 1EBUA 5DDIP 1HXHA 1BWSA 5JC8A 5G0UA 4DUPA 3GNTA 4BO4A 3WLEA 3W1VA 3ZWBA 2VHYA 3UF0A 2H6EA 4KDFA 4Y6PA 5JAIA 2X5JO 2J5QA 4M54A 2WD7B 1KY4A 3U4HA 4QFCA 5A06A 1KC1A 1VL6A 3Q2KA 4IDAA 2X8LA 4BNWA 3DZGA 4GWGA 3U9LA 1NFQA 1RWBA 4JROA 2G0TA 2YV1A 3WNQA 4R3WA 4WLNA 3VPSA 3EMKA 4TRMA 4Q3EA 1MFPA 3RBVA 2V7PA 4N5NA 1ZVMA 2IE0A 2PD6A 1AGNA 4TZKA 4GBJA 1LA2A 2YV3A 2LDBA 4IS3A 1LQUA 2BHLA 3JQFC 5A5FA 4I5DA 1H6CA 4DPMA 1X7DA 4Q39A 4PLYA 2QW8A 2ZJ0A 3I4CA 4J91A 3S1LA 1MXFA 1PSDA 3KSZO 5A04A 1WWKA 5K0ZA 4BNLA 5T6BA 1GQYA 1K3TA 3HG7A 1R4NB 2X0RA 1O94A 4GLOA 5J23A 1ZIDA 4W82A 1YWGO 4RZHA 3OA2A 1EQ2A 5F1OA 1ZO8A 3H4VA 1HE5A 3ICPA 5ILOA 1T2EA 1WMAA 1HWYA 4BB5A 4AJ1A 1WLYA 3DBHB 3VPGA 4CL3A 4FGWA 2DC1A 4RPGA 2UVDA 3GVXA 2JD2A 1R0KA 3JQ7B 2WYVA 3FSRA 4R69A 4XQ9A 5F1PA 2C5EA 3JQFA 1DOHA 1LXCA 2EHDA 5HBRA 5DOZA 1ZBQA 4I5FA 3HHPA 3S8MA 5I7SA 4A0SA 2B69A 4CM4B 1DC6A 1PZEA 3EVTA 2EW8A 1LSJA 4XGIA 1FXSA 3VKUA 4D3DA 3T4EA 2OXIA 4MJLA 1I2ZA 1ENYA 5A5EA 4NBVA 2PKQP 3VC7A 1T2FA 4PRKA 4OXKA 3KYCA 4CQMA 1UXGA 3CXRA 3DZJA 1YBAA 3OIGA 3OJ0A 3TZKA 2DBQA 3VH1A 1Q2XA 4GLLA 4D3FA 3LU1A 1MG0A 3K9QO 4RZIA 2I65A 2YDXA 4DC1A 3GPIA 3KUXA 3NGLA 3UVEA 4A5OA 4E33A 2CY0A 4AG3A 4LISA 4BO3A 4BNMA 1B8VA 4PZEA 4CR8A 4FB5A 4J0EA 3HE3A 2TMDA 3X2FA 1U7TA 2X0NA 4NU5A 4RVSA 5JCJD 2WDZA 3LT0A 3B1KA 1N7GA 3NRCA 3QA9A 2ZB3A 5KNLA 2H5LA 2VYVA 1VE9A 3QHAA 4A03A 5ER6A 1LLQA 4XWYA 2G76A 3RVDA 4GKVA 1T2DA 3BAZA 3ROQA 1EVYA 4OAQA 5TQVA 3GVPA 2Y1DA 2AXQA 4AJ4A 3CPSA 5B37A 1IPEA 4MVJH 3VH4A 5IZCC 4MVJA 1Y9AA 3E9QA 1ZUD1 3FBGA 3PPIA 4NZ9A 1Y81A 1O6ZA 5KVSA 3ZCXA 1F14A 4G65A 1C14A 3SJUA 1C1XB 1X7HA 4U8GA 5JXWA 3ROPA 3EC7A 1UZMA 1X7GA 2Q1WA 3ZV5A 3AM3A 2Z1NA 2BELA 4FQ8A 3KEOA 3KEQA 4YBZA 2D8AA 3FR7A 2CMDA 3I52A 2FPPA 2VHVA 1W0CA 5T8KA 3VAZA 3F5SA 5HA5A 3KRTA 5F3RA 4A73A 3H5AA 2JCYA 1UP4A 4TKLA 3RBXA 4MOWA 1EMDA 5ICSA 4YRAA 2PGJA 3DFUA 4R68A 1PJ2A 1DXYA 2DTXA 4ZQGA 4BO0A 3BA1A 3HDJA 1XCBA 3ST7A 4N18A 3K31A 3UICA 4TRJA 5DCWA 2VRCA 4PRLA 3DOJA 1A9ZA 4RVFA 4LW8A 3ZU5A 1AHIA 4JJFA 3WJ7A 3JD2A 1KIFA 4XIYA 3ZU2A 4A2CA 4YAJA 4RQUA 3JD0A 3QP9A 5A9SA 2C20A 4CQMD 4YTEA 4J1QA 3DTTA 1VJ0A 1P1HA 5COAA 1PJSA 2O23A 4PFJA 1XELA 3RCBA 4OJNA 3LLSA 2E48A 2X86A 3W4IA 3L4BC 1C0PA 4QFDA 5ILGA 5ICMA 3B70A 5L7YA 2Y05A 1KVUA 2ZTVA 1ZH8A 4ZQFA 3BMOB 3LZ6A 4G5HA 1DFIA 4D0RA 2W2KB 1CJCA 2X23A 3GGOA 4BIIA 3C7AA 1VM6A 1TEHA 1PL6A 3WMXA 4MKXA 3AM4A 3DOCA 4L73A 1YL5A 1ONNA 3OJEA 4XRRA 3WOHA 4XQGA 2I67A 3PJFA 5LDHA 3BXXA 4BGUA 1LDBA 3DHNA 3NTRA 2B5WA 1O0SA 4IDBA 4L76A 4RLHA 1KOLA 1AXEA 5CEFA 1L7EA 3DBRA 5IDYA 3V1YA 3D5QA 1EK5A 3H7AA 4TROA 3ASUA 2ZJ1A 3NJ8A 1LRJA 3IS3A 4Y98A 5ER9A 2D3TA 4CMJA 5JDIC 4RVHA 4Y8VA 3ZWCA 1U7HA 1J4AA 3GGGA 4LN1A 3BMCB 1YKFA 3HFSA 1PJTA 1LC0A 1GUZA 5CFZA 2VHZA 1PQWA 4IIVA 4BNIA 1B16A 1P77A 1G0NA 3GK3A 4NFHA 4M49A 3MJVA 3E9MA 3M1LA 5KIAA 1SPXA 1ZMTA 3I9OA 3ETDA 2PZLA 4Q3CA 3WGHA 4NFSA 3T4XA 3A28A 5ITVA 1GYQA 3PQEA 3S55A 3LSYA 1RM4A 3C3XA 4TWRA 4YDRA 3FRJA 1XA0A 1LI4A 5AOVA 1MGOA 4XIJA 1R37A 1LSSA 5JCXA 3DBLA 4PN3A 3PDUA 3FCOA 3O38A 4J2HA 5IZ4A 4BKQA 5IN4A 5ENDA 4MVJF 1XDWA 1GYRA 2QZ9A 3GVHA 5CG1A 3SX2A 5BNIA 5F5LA 3NT2A 4TKMA 1NYTA 4AJLA 2GNAA 4JBHA 4IJVA 4E4YA 4IY1A 3GC6A 3OICA 2YQ5A 5AXBA 1ENPA 3GHHA 4PG4A 4YAIA 2Y1CA 1Q7BA 4IPTA 3DAPA 3OFSA 3A4VA 3S2IA 4PG7A 1T2CA 1M76A 2JAPA 3AWDA 4YWJA 3VZRA 4B7UA 1CETA 5G4KA 4AJJA 3INRA 3OJLA 2W2LD 3L07A 1SC6A 1YDEA 4OH1A 5B4UA 3WBFA 1E6WA 1FF9A 3DZKA 2V65A 3EDMA 5KVQA 3RFTA 2DU8A 1V3UA 2OBNA 2E49A 3P5SA 3W4KA 4EJ0A 2B4RO 2PFGA 3RFXA 5IDXA 3DFZA 1NQOA 1VJ1A 2Q1UA 3WYEA 3UKOA 4BNUA 1YB1A 3HDYA 1TXGA 1T4BA 3F5QA 3COSA 3NJ4A 3MJCA 4E5NA 1ZKMA 1ADGA 1UP6A 4WOKA 4R5MA 1HDCA 5KOIA 4LMPA 2OZPA 1KC3A 2BFAA 4KTTE 3W4JA 1E1LA 4CMIA 3VPHA 1E6EA 4JNKA 4A10A 1I10A 5AXDA 4LCJA 1BXZA 3DR3A 1ZSYA 2NLOA 2OGUA 2PD3A 3JYQA 4K28A 3PLRA 3ROMA 1ISMA 5TRTA 4BMVA 1LSOA 2C5AA 1CQIA 3HDHA 3U0BA 1DRUA 4J1TA 1V0JA 1NWHA 3L6DA 1YBVA 1E3WB 1ENOA 4D43A 1I2CA 1GYPA 4OMUA 3IL2A 1XQ6A 1YS4A 1GQ2A 3HNPA 1E77A 1LX6A 1E7QA 2VNAA 4YAGA 1PS0A 1AE1A 2VUUA 3EYWA 3ZU4A 3ON5A 4GWKA 1D3AA 2CVZA 4M8SA 3MOGA 4QSMA 4AJNA 1H6DA 2DFDA 3WGZA 2GYYA 1UDCA 1QV7A 2GUGA 5GMOA 2A4KA 4URFA 1EVIA 2UV8A 3DO5A 3M2PA 3ZZNA 2GASA 2HKIA 3R6DA 3EUWA 1XLTA 2BKAA 3GZ4A 3TRIA 4D41A 3L6EA 5KKAA 2WWRA 3I9JA 1V35A 1U28A 2VN8A 4QT0A 2FSSA 4J43A 4CMBA 3AM5A 3WWZA 3LT1A 4BNFA 2Q4EA 3WXBA 3O9ZA 3K5PA 1AN9A 4QO8A 3EY4A 1I5RA 3O4RA 2NSDA 5I7EA 1TT5B 4ZVVA 4OIMA 4XX0A 3BIOA 5FWNA 1QYVA 5I7FA 3DZIA 4MO2A 4PLZA 3RROA 4W9NA 1QKIA 3JQGB 2Q49A 4IXWA 4MPDA 3JQAD 3TZQA 5AXAA 4BQRA 4E5MA 1GCUA 1O95A 2O7SA 2D4AA 2PLAA 1PJLA 1JA9A 5KVVA 3K2BA 2C07A 4WASA 2VWHA 3B20A 1FDSA 5C37A 5TJ9A 2R00A 4Y67A 5I9NA 1U3VA 5K6AA 1P0CA 4I9UA 3INGA 5TSDA 4R1UA 5KJFA 4RVDA 2DTEA 2VUSA 3ZWYA 2JAHA 1LEHA 1M6HA 3F47A 1ENZA 1GCOA 2HJSA 2VCYA 3ADPA 5CDSA 4Y6SA 3U4CA 1UH5A 2NVUA 4RGBA 5G0TA 4BV8A 4DL9A 2C82A 4J49A 4LRSB 1BDMA 3FPLA 3IJPA 2Q45A 1MB4A 1DFHA 2I99A 3QWIA 3RIHA 1HE4A 3KLMX 1NHGA 4K26A 3LT4A 1LDGA 2F00A 3JD1A 4FGSA 3W8FA 3UH1A 3BYZA 4E32A 4PIVA 3VPFA 4EJ6A 4AICA 2WM3A 1R4NA 5DNAA 4UEKA 5KJ6A 5B4TA 4OXNA 5JBIA 1I8TA 5CEJA 2ZTMA 1UAYA 1PGQA 3GN2A 3E03A 4BKRA 4XQEA 4TSKA 3PWKA 4Z9XA 4BKUA 4E12A 2GN8A 4R54A 2DPGA 1IHYA 1PGNA 4CUJA 1B15A 4E2XA 1LDMA 2HK9A 4BGIA 3W6ZA 3JD3A 1ISHA 4JCOA 4M89A 1NASA 2GZ3A 4E30A 4EUHA 9LDTA 2E4AA 1LLCA 3LDHA 4R51A 4BNTA 4CMKA 2NACA 1KBZA 3ZHYA 4NFYA 3PVZA 2Q99A 1YO6A 2FPGA 2QG4A 4OKNA 5CAEA 2FHSA 4I08A 3H8VA 1CDOA 4LSWA 3SXPA 5TGDA 5T64A 3JQCA 4CM7A 1MV8A 3FTNA 3PYXA 4BO7A 5L51A 2QYTA 4P4GA 1DLIA 4Z6KA 3DBLB 5EL0A 2WMDA 4YJHA 4CL8A 2HAEA 3A1NA 2IXAA 4IXTA 4OKIA 4YJFA 3IJRA 4NBUA 1XWFA 5A4DA 4AJIA 2GF2A 2P5UA 4ZGWA 4BUCA 4GGOA 5DOVA 1ZZEA 3HZZA 3PJEA 2FPIA 2IRWA 5GZ3A 1R0LA 2AHRA 1XU7A 4QUKA 1Q0HA 5HRUA 4HP8A 2NVUB 4ALMA 1HLDA 1AXGA 3PP8A 4K1LA 5G0WA 5JO9A 1E7YA 2JHGA 4BMSA 4B8WA 6ADHA 3FPCA 1BDBA 4J4TA 2G17A 2V6GA 4HBGA 2J3IA 2WE8A 4WJZA 6LDHA 5JYDA 3B1JA 1H5QA 4MVJE 3A14A 4M1QA 1ZCJA 3CMCO 1J0XO 5EPOA 1WNTA 5EQFA 1NWCA 1JKIA 2NADA 2YFHA 2ZATA 3WTCA 2CD9A 2O3JA 2RH4A 4XYBA 4E6PA 1E7SA 1N9GB 4OHUA 4ESOA 8LDHA 1DHTA 4K6FA 1H9AA 1T1RA 4C7KA 2WD8A 2BLLA 4NJOA 2Y0CA 3OECA 2A92A 4Q9NA 1NQ5A 3Q11A 3WLFA 4CQLA 2DVMA 5KWEA 3ANLA 3JQ9C 1W8DA 4YRBA 1IL0A 4XGKA 1KETA 3E18A 3H2SA 4OYRA 3C1AA 1Y5MA 3CSDA 3IMFA 1R6DA 2YQ4A 3FNEA 4I9NA 3CIFA 4BB6A 3GNQA 4WCDA 3K92A 2RCYA 4NBTA 1U3WA 3WG9A 1SB8A 3WYCA 1SBYA 1YJQA 4J4BA 4XCVA 2FZEA 1BW9B 1DRWA 2NU7A 4D79A 1WDKA 4AJKA 5A9SB 1M75A 4B3IA 4WLFA 4ILKA 1E5QA 3PQFA 3PJGA 4L75A 3S2FA 4B79A 1VRWA 1ADBA 1TT7A 1D7OA 2ZCUA 3ZWMA 4FJ1A 3KV3O 3C85A 3RC7A 1W4ZA 3ZNNA 5BSFA 2J5RA 1BXGA 1NAIA 1VL0A 4PLWA 4UAGA 3ITDA 3FBTA 4R1TA 3LYLA 5L45A 1R4MA 3IAHA 3PGXA 1GV0A 3ZWNA 3HN7A 1EFLA 1DJNA 2ZTUA 1T1SA 4AVYA 4ZHSA 3L0DA 3PYMA 3RKUA 1DC5A 2EWMA 1XQ1A 3HWRA 2QX7A 1YQXA 1UUFA 2OHXA 3OH8A 4F6LA 4KZPA 3TNLA 1EUZA 3I83A 2FP4A 5A3VA 2XXBA 4RORA 4WCFA 1QYWA 4F45A 4E2WA 1LDEA 3I1JA 1P1FA 2QHXA 4DGSA 2GN4A 4D7AA 1T24A 3WGYA 5ADHA 3N58A 1E3LA 2BI7A 3DBHA 3V1TC 3DONA 4B3JA 4YT4A 1GD1O 4EYEA 5A9RA 5EN4A 2WEKA 3T7EA 2NU6A 3KYDB 3PLNA 3VH2A 4YT8A 2IXBA 4W6ZA 2SCUA 4BNXA 1K6IA 2PNFA 4U6QA 1M66A 4BHTA 3RQSA 4NG5A 2VTEA 3N74A 3G1UA 1VL8A 3PZRA 3KO8A 4DIOA 1CERA 4XDYA 2B35A 1I24A 1SOVA 3L4BA 3PZBA 3DBVO 1P74A 3OBBA 4R3NA 3K73O 3I6QA 5CHEA 4EGFA 1JVBA 2HRZA 1RM5A 2HLPA 1DFGA 1DC3A 1BVUA 1XGKA 2AEMA 3K30A 4HY3A 3AOGA 4NJMA 1A7KA 3JQAA 3H9UA 3VOSA 1SEPA 1E3EA 4CLRB 1WPQA 3AFMA 1RJWA 1E1KA 4L8VA 1XHLA 2VYNA 3Q3CA 2EF1A 2GZ1A 2PH5A 2WYUA 3D3EA 5DBFA 3RJ5A 3P7MA 4NR0A 5BNTA 3NEPX 3WIDA 2D2IA 1C3VA 3KSUA 3OIDA 5AVOA 1DO8A 1PJQA 2B4TO 2J8ZA 4Q3BA 4WLEA 4FR5A 3EK2A 5JMPA 1YRLA 1X13A 1MC5A 4FDAA 1UJMA 3GRKA 2WSBA 4YJGA 3RC1A 3EAGA 1NVTA 4IBOA 3FHLA 3AY7A 3FTPA 5TT0A 1P9LA 2E82A 4GVLA 5COBA 4FJ0A 1GADO 2X9NA 4KP7A 5BNFA 5GZ1A 1XEAA 4A27A 4J9VA 5IF3A 3RUCA 3IDSA 1E0DA 2VNSA 4W4TA 4RDIA 4B3HA 1X14A 5AQ1A 3JSAA 3L9XA 2AQKA 1N9GA 3MJEA 4WPGA 3RASA 4CM1A 4CUKA 3EZLA 2AMFA 4J3FA 2NVBA 4H7PA 1K5HA 1YQDA 1L1FA 1AHHA 5DZSA 1SZJG 4AJPA 5DCYA 3PFFA 4PG6A 2VQ3A 1C0KA 1QV6A 2HO5A 3WFIA 3Q2IA 1U3TA 2JFHA 2PV7A 4TRRA 2J3KA 4BMNA 1I3MA 3TFOA 2I5PO 2OO5A 3WX0A 3RJ9A 2Y99A 3GY0A 5G4LA 1C1XA 3R0IA 4D0SA 4N7RA 3AI2A 3PWSA 1T25A 2ZB8A 2YY7A 1VKNA 1J49A 1EVZA 3JV7A 2JL1A 4XYMA 4YXFA 1D8AA 3KETA 3ITKA 4XYGA 4U6SA 4E2YA 5IFLA 2V6BA 2CDAA 3M2TA 1LC3A 1NFRA 4BKOA 5FFFA 3BMCA 5ENVA 2FR1A 2P2SA 2RIRA 2XOXA 1ARZA 3GAFA 3V5NA 1GZ4A 3GRPA 5I8ZA 4R41A 2X9VA 4CLDA 4E2ZA 5B12A 1IYZA 4IJKA 2TMGA 1A27A 2P5YA 3K8ZA 4GX5A 1OC4A 3CZMA 4CUZA 1SOWA 2EP7A 1BG6A 3LLVA 3GG9A 3P19A 4NJMB 1GU7A 4OQYA 1SEVA 3GDFA 2VHXA 4NHEA 4ALIA 3ADOA 3BHIA 1YB5A 3JQAB 2I3GA 3TOXA 4ZICA 1N7HA 3VZQA 2HK7A 4WE3A 5IN5A 1WZIA 4LK3A 3S2EA 2NTNA 3PEFA 3CINA 3QWBA 4GH5A 1OZAA 5JDCA 4EEZA 1BMDA 3QRWA 3SC4A 2EW2A 2O7QA 3OSUA 3D4PA 2AQIA 4U0JA 4UEOA 4WEOA 3AOEC 3C1OA 4FIZA 1A9YA 2RHRA 4NBRA 5IG2A 2JHFA 4L0QA 4CM4A 3L6OO 1R16A 2GSDA 1MX3A 4ND5A 4HX5A 3D7LA 3E6AA 4IMRA 3H9JA 1ID1A 3H9GA 3I4FA 3ANMA 3T7CA 2P4QA 2UDPA 4TVBA 3ZWAA 1QP8A 1F0YA 1QLHA 1PL7A 3QY9A 3CZRA 3ETGA 3ZGYA 4FFRA 2PGDA 4XEHA 3RKRA 2ZQZA 2BGLA 3BTSA 4XA8A 3WB9A 4BQPA 1E92A 3LK7A 5TF4A 1P44A 3UN1A 1H6BA 5C7IO 2EGHA 5DP1A 4QQRA 2NUAA 3JQ6A 3GMDA 4RF5A 2D5CA 4OOFA 3VVBA 5JY6A 4FJ2A 4MP3A 2FR8A 5L53A 3KHUA 4RPHA 2W90A 1DDOA 2BFOA 3TOZA 4YJDA 1ZSVA 4GSKA 5CDTA 1M6WA 1IB6A 1PIWA 3HUDA 3F1KA 1U4SA 2DAPA 5I9LA 1SAYA 3H2ZA 1ZJYA 1IOLA 3RWBA 4JJGA 4RPJA 2HCTA 1EE9A 4EZBA 2IZ1A 3ZNPA 1K2WA 1NVGA 3G3EA 4EUEA 3D4OA 1OBFO 4Z3DA 3GLQA 3UCXA 2AQHA 2XF8A 2C2YA 3OM9A 4H15A 1N1GA 3NAQA 3O26A 5MGBA 2HU2A 1L7DA 1P1KA 3FF4A 4BO2A 4RQTA 4X54A 1HDOA 4CV1A 3VDQA 4CLOA 1JKJA 4AL4A 3MEQA 4NPCA 4ALNA 4RLSA 7ADHA 2PR2A 3DZHA 3NT5A 1G6KA 2X6TA 5L4SA 4ALLA 4D42A 4BNNA 1GQQA 4INAA 4GGPA 2OP0A 4R1SA 5A1TA 2JD0A 1NPTO 3ONFA 3L4SO 1SB9A 4MINA 1Y5RA 1M67A 4HNGA 4O0LA 1O9BA 2CZCA 1ZW1A 3DXFA 3OJOA 4IM7A 1OOEA 2YV2A 3NYWA 4XKJA 3CKYA 4R9SA 2P4HX 3OP4A 1N8KA 2GPTA 3DEYX 2EKQA 4BNZA 3R3SA 5A05A 3HB5X 4OXYA 1QYDA 4FCCA 3QVTA 4KWHA 1BRMA 2XPCA 5DCUA 3OHSX 1ZFNA 4CLXA 3DTYA 2D1YA 1E7WA 1PS9A 3IC5A 3PHLA 3FD8A 1LTHR 4JGBA 2YFQA 1ADFA 1CEQA 5TX7A 4GMFA 1P1JA 2J5KA 3VH3A 4JLWA 1DC4A 1I33A 4W99A 5H83A 4UREA 1GZ3A 1Q7CA 4TRNA 5BSEA 1NQTA 1E1NA 2B5VA 3GDOA 3IP3A 3KM0A 4IINA 4PVDA 4DMLA 4FOSA 1AUPA 2O3QA 1Z7BA 3BMOA 4CLEA 2D5AA 1B2LA 3EGOA 4BO8A 4CMGA 3BTUA 2HQ1A 4CPDA 4NK4A 5T67A 3ULKA 5L4NA 4WLVA 4ZU3A 2ET6A 3VKVA 4EI2A 5L95A 2O50A 3UOGA 3I5MA 2EKLA 3KBOA 1HYGA 1BXKA 2E6UX 2H63A 3K6JA 2EEZA 3JYPA 4MVJP 5A03A 3IKVA 2VT2A 4F3YA 5I9MA 1U5CA 3JQ8A 4HFMA 3V8BA 2VWQA 3WWYA 3LC2O 3K2EA 1SMKA 2W2KA 2YZ7A 4J90A 4M55A 3WBBA 5U4QA 4BNKA 4GI2A 1GV1A 3TN7A 3E48A 5JCJA 2VT3A 3NGXA 3JQ8B 4CJXA 4Y6RA 5TLSA 3O8QA 4PG8A 2DBRA 3QWAA 1JQBA 4U5QA 1D1SA 3ZV4A 1FDVA 2C29D 2GD1O 1U9JA 4O5OA 2JJYA 4YQZA 1HDZA 4OM8A 1DHRA 1JWAB 3IP1A 3MOIA 2AEFA 1KVRA 1LNQA 1GFSA 1X1TA 3CMMA 2FRDA 3TPCA 4JP2A 2FN7A 2G82A 4YACA 4BO5A 3MWEB 3D3WA 4WLOA 3B1FA 4GPD1 3PHGA 1YVEI 2Q1SA 4CLRA 3UAGA 4P38A 1QMGA 3AW9A 2WYWA 4IDFA 3A9WA 3H6KA 4ALJA 3KYDA 1PZGA 2PKQO 5FYDA 3FR8A 4MKRA 3BMQA 5DF1A 2G1UA 1XIVA 4DYVA 4PLPA 1EVJA 4RF3A 7MDHA 4BNGA 3AI3A 3JQDA 1A4IA 2X4GA 1RYEA 1HYEA 2PH3A 4B4VA 2A94A 4ND4A 4HNHA 2O48X 2W4QA 4OGWA 1O89A 1GUFA 2PWZA 1VI2A 2CFCA 1E3WA 2EP5A 5IZCA 1HF3A 1P3DA 1QRRA 1H0KA 1FJHA 1UP7A 2DUUA 2HMWA 2Q46A 3AK4A 3MJSA 3DC2A 2Y1EA 1WP4A 1RYDA 4NQZA 4QECA 3ZWXA 4LVUA 1KYQA 4B4UA 3BTOA 3V2UA 4LVCA 3UUWA 4E5PA 1YJ8A 2FMUA 3RC2A 1R0SA 4UVIA 4CMAA 1F8GA 4JIGA 2NV6A 1NFFA 1E5LA 1R66A 3SLGA 5DULA 5THQA 1U5AA 2GLXA 3PXXA 5KTKA 4RPLA 5CEEA 5CPBA 5JO0A 1NP3A 2Y93A 1K6JA 1BSVA 1HT0A 5G2OA 4Z9FA 3ZN2A 5U1PA 4IZIA 1ONOA 1HSOA 3F9IA 4E0BA 5JDCC 4LCEA 2W8ZA 3WYBA 4ZQEA 2LDXA 2IYOA 2VWPA 3PYLA 4EDFA 4FD3A 1DIRA 4RO0A 5AYVA 4IIUA 4AJEA 4F46A 5B1YA 1QR6A 5CP8A 2Q3EA 1HDYA 2G5CA 2IYPA 1ZK2A 2B4QA 3UXYA 1PEDA 5KVCA 3GEGA 3DMYA 1KEPA 1ZK3A 3I23A 1DBVO 1FK8A 4IS2A 2O3SA 1I3NA 5JAMA 2UAGA 1HTBA 3PHIA 2HDHA 4MIEA 4ZRNA 1WW8A 2JD1A 1I30A 2POQX 1C0IA 2D0IA 2HMUA 1DB3A 1UDAA 1BVRA 3DOOA 2Y67A 2OORA 3QQPA 1ULUA 1VPDA 4FFPA 4IJUA 1CWUA 1IE3A 3JQ7A 4J9UE 1S6YA 3HADA 1FMCA 2C7GA 1DRVA 3KLPX 3GF4A 5G0SA 3V2HA 4XRGA 3LC7O 3PHHA 3BTVA 4WEQA 1N92A 1X0VA 4DREA 3I6IA 4KQWA 3UW3A 1YH3A 3RUHA 1UAGA 4UUOA 1NVMB 3NUGA 5DT9A 3DB2A 1J6UA 2OFPA 3D3WB 4K9DA 5DN9A 1TA4A 3DAGA 4J16A 1B26A 2WJPA 3NT4A 3QJ5A 4R01A 5F21A 4HUJA 3GA0A 3JYOA 3V1UA 2Y0DA 4YVFA 3BHMA 2CDCA 4AJ2A 3RC9A 3I9NA 3ONEA 5MDHA 3RUEA 4E21A 2DKNA 2ZYDA 4FC7A 1I01A 4S1VA 4DLAA 3G49A 4CMHA 1B3RA 1YXMA 5C3MA 3HB4X 2QQ5A 4FSHA 1YGYA 3G0OA 3VZSA 4E31A 4I8XA 2PKRA 3OJFA 3GGPA 2GN9A 2PY6A 3FN4A 1NHWA 1N5DA 1Z45A 3H9EO 2VYND 4FN4A 3QWFA 4QEDA 1Z7EA 2NU8A 1H93A 4UUPA 1HETA 4N5LA 4BNVA 4D44A 1EQUA 1EEHA 1TVEA 2HMVA 4W9NC 4XB2A 5CG2A 4Z0PA 3AFNA 3K96A 2V6MA 5JY1A 2BFPA 4OQZA 1G1AA 3S2GA 3TQHA 2NU9A 1RM0A 2EJWA 1EUCA 2PK3A 1PWXA 2NTVA 3C8MA 5JC1A 4YT2A 1I3KA 1NXQA 1FDUA 2DM6A 2R2GA 1MFZA 1H94A 3DHYA 1IUKA 3HSKA 2RHCA 4PGFA 4R4JA 4NK5A 2Y1GA 1EK6A 4J6FA 1P33A 5EIOA 5HTOA 1FDWA 3DDNA 3G1TA 3QW2A 3SLKA 2VYVD 2ZB7A 3GUCA 4W7IA 2UYYA 3ABIA 1DEHA 3IOYA 3H3JA 2PZKA 5IJZA 3PIIA 4WGGA 1Q1NA 1U8XX 4N5MA 2GN6A 1U2GA 4UUNA 1D4FA 3KYBA 4DMMA 4IDDA 1IZ9A 3HQ4O 4O1MA 3PK0A 1LRKA 4PCVA 3ZWWA 3EHEA 5AXCA 5JS6A 3WTBA 3L9WA 1YE3A 2CNBA 1NR1A 4XJTA 1ISJA 3U3XA 4YJGB 3PQDA 1TI7A 3JYLA 2HMTA 4D3SA 1DIHA 1ONPA 3WGGA 4CV3A 1DIAA 2HUNA 2C59A 1PJCA 2X5KO 4B4OA 4QTZA 4ID9A 4IUYA 3AUTA 3KB6A 2VTDA 4WECA 2VZ8A 4EW6A 3GFBA 1QORA 1HEUA 3OIFA 3JQBC 2VRBA 3P2YA 1JVSA 3ZU3A 5JAQA 1CF2O 1GL3A 3I9LA 2O2SA 5EINA 1ZJZA 2DTDA 2H9IA 1S7CA 3FNHA 2A35A 4BO6A 3STHA 3UCFA 3QIVA 4JK3A 1Z82A 4L4XA 4EEXA 5BQFA 2CF5A 1U2DA 2J3HA 2UUPA 1CIVA 1DSSG 4PG5A 1RKXA 3GH3A 3GMSA 5A02A 5L7TA 3IQDB 3LVFO 4E5KA 2X0IA 4I5GA 2RBEA 1X15A 3INTA 4IJWA 5I8WA 4CLOB 2DFVA 4MIYA 1GR0A 4J7CA 2DLDA 2ZYGA 2FOIA 2OUIA 2Q2QA 4P4NA 4C7JA 2V6FA 4U0KA 2AG8A 1XU9A 3I3OA 4DBZA 4I1IA 1GEGA 1ULSA 2YHIB 2IODA 1LSUA 1O8CA 1Q0LA 2ZCVA 4CV2A 5TIIA 3TL3A 3AU9A 2WE7A 1PU2A 2CSUA 4ZRMA 3MZ0A 4DRYA 2R6JA 4WOJA 1F8FA 1R12A 4FFNA 4XZ3A 1R15A 4RVUA 3D64A 4O63O 2QIOA 3GZNA 3W8DA 4OL9A 3C1TA 1LJ8A 5DBGA 3OQBA 1PGOA 1Y8QA 3OEWA 4B7CA 4J1SA 3QWHA 2Q2VA 3JQ9A 5HWSA 4FFLA 5KKCA 4E3ZA 2VUTA 4YAKA 3VPXA 2VHWA 4BNHA 3E9NA 1ZSNA 4XR4A 1UXIA 3TFQA 1KVQA 4JN6B 3GT0A 3IUPA 1J5PA 4UULA 3ZHBA 3R3JA 4CMIB 3TL2A 2YW9A 4QX6A 3GPDG 1B7GO 2QRJA 1JW9B 4BVAA
chains in the Genus database with same CATH superfamily
1NJGA 1JQJC 1X1RA 3MTJA 1EUQA 1Z06A 1NJSA 1SM4A 1VC2A 5CYOA 4DMHA 5JQWA 3O4IA 5BSTA 4EEKA 4LJ7A 3AERB 1CSEE 1U0TA 4F3RA 4KXFB 3IMGA 4BNJA 3E05A 4KBYA 4QJIA 1KU0A 1V16A 2XD4A 1HZZA 2P9CA 2YUTA 1U8TA 3WGOA 1QIMA 3AH8A 3C3DA 3CH6A 3KT6A 4NS4A 3TAUA 3A9UA 1TQDA 1N5LA 3EZNA 2DKOA 3WRYC 2OT3B 3RC8A 3BH6A 3P0EA 1WZNA 1JYSA 3TOSA 3KQYA 5DNYB 1ZG3A 5MFPA 2G06A 3D2BA 4DV1B 4LHVA 2DHDA 2ATCA 1RYFA 1RHQA 2CL6X 3N7TA 2JI8A 4GVPA 4LNAA 2ZP1A 1JEOA 4M36A 4U7WA 3A4MA 4K3VA 1LDYA 3W5UA 4HV4A 4DSUA 2FF7A 1K66A 1KEVA 1EDZA 3BHJA 3DZFA 1O5IA 3X1ZA 4GBGA 3H2BA 2J0UB 2DECA 1WVGA 2OZVA 3MTAA 4EMTA 5BV1A 1A4RA 2ZI6A 3G79A 3CUWA 3KVOA 2DFLA 3M9LA 4Z8XA 5EMNA 3DLPX 5E2AA 1NZFA 1NI4B 5IBRA 1N3LA 1THMA 1X8LA 3IODA 1NP6A 2OBYA 5FF9A 3TUJC 1SNYA 4QJ3A 1YS2X 1E3SA 3L77A 3O03A 1W5BA 1ZI8A 3HUUA 4GMGA 4TQGA 5SYAA 3ZW9A 5CA1B 2HIHA 4I4NA 2FUG6 2IF2A 1JDZA 2ZTLA 3LC1O 4FOOA 4CM9A 1UWLA 1GY8A 3N07A 4OXRA 2BR5A 2OORC 3RYIA 1AKEA 3KPWA 3PC8A 2FVYA 3IJEB 3VI4B 5D6OA 4C9BA 1ML3A 2OAGA 4NAVA 4WCFC 4C29A 4D6PA 1OKKD 2GZ2A 2EXXA 3H87A 1QQ7A 2F1IA 1XRNA 2H1SA 4QPZA 1SXJA 2XXJA 2ZRCA 4ZI7F 2BH9A 4RJKA 3LLCA 3WO0A 1SUEA 3VR1A 3AW8A 4ZTZB 1K2VN 2FWNA 1Z73A 3U7HB 1FW8A 2X9GA 4G63A 3LKDA 4YT5A 5IASA 3A27A 5LKAA 3NKFA 5EXSA 3UFXB 1P1IA 1WKCA 4P22A 3V33A 1QGDA 3G6WA 1YVDA 2ZJ2A 4AJHA 1Y6GA 3FDXA 2ODBA 1UK9A 4O02B 4M0KA 5CLQA 2V7TA 4JJIA 3HNRA 4EGJA 3RE1A 1SIUA 2C4HA 3DT9A 4YN3A 2BGKA 3T9BA 3BAFA 3KJIA 3MIIA 4US0R 1I6KA 3EE6A 1SFRA 4OSPA 5LBIA 1V8BA 3A3PA 3I2JA 3LBIA 3UA4A 5T8KC 3AVWA 4KDEA 3P2IA 5KZMB 2I0FA 3GBPA 1K0UA 1CFZA 4MMYB 5HCUA 3HO6A 2HBRA 4UCWA 3HY6A 1ECFA 3H1AA 4CIVA 3DVRX 4AXXA 4QDKA 3NM5A 1YL7A 3V1MA 3I58A 4Q3NA 3V2GA 3KVYA 2EARA 2R1ZA 1GNLA 1A72A 1LW7A 3W9YA 4QYSA 5KU7A 4FBLA 2AR9A 2I2AA 1W4LA 2AYXA 2WTUA 2C57A 1TU0A 2QY9A 2GM3A 5EUCA 3W8RA 1CLEA 1WMEA 1T26A 1WZ2A 2D59A 3E1SA 4EIWA 2PUCA 2J67A 4M6WA 2H1OA 1O9HA 4FFWA 4PQYA 2AG6A 5JYEA 2W58A 3F2VA 2WRZA 2ZS9A 4GE0A 1KTIA 5CTJA 5FBHA 4QODA 4CM8B 1M5RA 3GOHA 4FC6A 1WZEA 5C80A 3UG6A 1I4DD 2O5EA 3PC4A 4M1MA 4Y6OA 2HA3A 2KW5A 4UOQA 5IT5A 5ITWA 4XD2A 1A3CA 1EUDB 2FZGA 3D31A 3QEMB 4BGVA 2P9BA 9ATCA 1N9KA 2YRFA 2P3OA 3HPQA 4DANA 1FTNA 1OAOC 2MIIA 3DHVA 4WUVA 4M0CA 3WQBA 1RXWA 4PRYA 5E1OA 3HVRA 1I36A 1YI8A 1J7JA 4FYHA 2I3DA 1BGVA 4F9GA 3T3NA 3TDNA 3H3FA 5ES3A 1Y7LA 3VX4A 2PA3A 1H1LB 4B6GA 4DLWA 4DUYB 1E1RA 1GEEA 2H7VA 1G42A 2IY7A 3B6ZA 1L5OA 3RFVA 4RTJA 2GAIA 4PYKA 4OJKA 2JJ1A 4NATA 2G80A 3LQKA 4N0PA 1NMSA 3RYIB 3ILXA 3SZLA 2Q50A 1HO3A 5KYWB 2AN9A 5AR1A 1Z68A 3FB4A 1O57A 3I6MA 1BWPA 2EIHA 3ZLTA 1JHOA 2XZLA 1IN1A 1FSPA 3KL2A 4ER0A 1U3GA 3TJZA 1QNFA 4C7JA 3PTAA 1E7RA 4NH4A 3LP6A 3U5TA 3V00A 1P31A 4QOIA 5IVIA 2CXQA 4HB2A 5FLEX 5FYQA 4A2WA 4E1VA 5ICGA 1CW2B 2OD9A 1V4VA 1PI3A 4MQFB 5LWHA 1EFRD 2ST1A 1L7VC 1G5RA 3A6LA 4H3HB 2OV3A 3QSGA 1LBEA 4ZU6X 3TZ6A 3UCEA 2WTBA 3FCEA 1P0MA 3M49A 4PICA 3GW8A 5A7GA 5C0OE 3ILHA 1ZA2A 1ZJJA 1HE1C 2MSCB 2ZYAA 1Z38A 3FH0A 4GWLA 4MJ7A 4WWHA 4YRFA 1UBRS 5M7EA 4IMJB 1XG5A 2Y3IA 3NBUA 1XZJA 4PGHA 2OD7A 2QMEA 2Y68A 3LUGA 2H4JA 3LO5A 4H1UA 1GQOA 1NVVQ 3AR6A 4RDHA 5DW3A 3WLTA 5KYYA 4MHSA 1KSGA 1V95A 2WP8J 1MG5A 3IUEA 1YR3A 1RQRA 3THWB 1SKBA 1I7SB 4QUEA 3MTBA 1D9XA 1VKOA 2FY8A 2RGWA 2D6FA 4WFIA 1DX4A 2AI2A 2HRDA 3UXEA 5FNVF 1A76A 3WR5A 1E20A 3PDCA 2Q9BA 4GQIA 5BWCA 3Q3IA 5DGTA 2IHVA 3VTFA 1U7XA 2CGEA 1R4AA 2P65A 1OR8A 2B83A 2Y0EA 3LZDA 4HHEA 4UBMA 1SGWA 2O20A 2XBLA 3JWGA 2BLNA 3QKSB 4G36A 3ECAA 3LY9A 4C4OA 3AHDA 4K88A 2J87A 1B00A 1KBOA 5C53B 1W73A 2FEPA 3COVA 4HXFB 5LOVA 4C6TB 3L46A 2F90A 4R7TA 4C0WA 2PIDA 2ZVPX 3D6MA 4DSZA 5ERXA 1E2QA 1K6EA 4CI0B 2ID8A 2GJAA 4LG1A 3TKAA 4FYVA 2P9GA 3DMRA 1JA1A 4JJ4A 2UZ0A 1Y8QB 3U1VA 4WRRA 3M9WA 3V46A 1PQPA 3L7YA 4KO1S 3N2KB 1H2ZA 2Y27A 1HMPA 3KT8A 1RWMA 4JR0A 2MOKA 1RTTA 1N6IA 1R9GA 3E4DA 2NUAB 4UATA 2QLBA 3T15A 3T3HA 4MVJD 2RHTA 3PWZA 1HSZA 5AJYA 4WZBE 2Z3ZA 3ACCA 1QYCA 3FFBA 5KYGA 3FHOA 3LTNC 2X1VA 1XXHE 3ESAA 3KVNA 3AY3A 4YV1A 1JTVA 1BCSB 3UMRA 4JJKA 5E38A 5KOJB 3TGPA 5CGQB 5FADA 4WK6A 2PANA 3JXEA 3UHAA 3EIXA 4RHXA 3ZY2A 5DK6A 1PX0A 4BAUA 3JQEA 2OOSA 3PEWA 1REQA 4X3CA 1LBHA 3ZE6A 1EAYA 1XYGA 2XMPA 5FUQA 4MQFA 1C7QA 3TX2A 5KC9A 1JHPA 1HZZC 1ZA1A 1P6QA 1Z2NX 3OCXA 2GJ8A 5CVDA 3F97A 3VNBA 1HNWB 3P2MA 2J9XB 2JLCA 2J07A 2B5OA 1CIPA 3MCUA 5AM3A 2AZXA 1OASA 2Q6OA 4BKPA 2X0JA 4LY9A 1CRPA 5FUXA 2OMEA 2PT6A 5HDQA 4FFOA 4OI1A 4ROSA 4N4AA 5CIQA 4CF7A 1LLDA 2IUSA 2WF8A 4OKSA 1JI3A 2M1ZA 2C8JA 3CIOA 6REQA 5TGTA 4D56A 4DT1A 3VYUB 3N0RA 1ZD2P 1DRKA 3Q88A 4GX0A 2XIJA 3NX4A 2HIMA 3O8QB 4HXYA 4MS1B 3WADA 4J0KA 3PI7A 4MQ4A 3WFZA 4KUHA 1F1BA 1U0FA 1QIDA 3VVMA 2FFAA 1YDMA 3CG0A 3ZBQA 1RQLA 1DAMA 1GG2A 2PZMA 2XA1A 1OC2A 1U94A 3AFHA 3Q1LA 1VLZA 4EYOA 1QXSA 3GIDA 1EVKA 1YB4A 3T8YA 2SKEA 4KN8A 4BVLA 1H2XA 4WD3A 3URMA 2H4HA 3VR6D 3ZE0B 1A04A 2CUZA 1CS0B 3SYLA 1JT9A 1KSHA 4P83A 4XIGS 2XAAA 3MQ2A 1PJ3A 5BWBA 1TX4B 4OLHA 4CM3A 3EIOA 3SBOA 3R0QA 5T4FA 2NMVA 3DKVA 3FYCA 2WUGA 3LY8A 3B78A 3P9KA 4UARA 3MTIA 3VZPA 2JDID 2AOTA 4C05A 1K6XA 2FB9A 1Z16A 5KJCA 2FEOA 3VPAA 4NAUA 2YBDA 4WK0B 4Q01A 2Q2NA 2C2ZA 4TGLA 1YBMA 1XYVA 4ANFA 4R9VA 5FH9A 3WE7A 5L7WA 4IW3B 4RX1A 3TEJA 3SS8A 1U7WA 2LKCA 2PX5A 3EVFA 2CNWD 3DWIA 2EG9A 4OFZA 4B09A 5JSZA 2ZT6A 4B4WA 2I76A 1U11A 2PYDA 4L8FA 3ZWPA 3CUTA 4F2PA 2XDWA 5F7XA 3DA8A 1BFUA 2C2MA 3PL5A 1JQDA 1X7WA 1XAJA 4X1YA 2YHSA 2YWXA 1TVKB 1T3TA 1JAXA 5A9TA 3LYAA 1ZIOA 3NEYA 4JXJA 4N54A 5FTNA 3T4UA 3C74A 5KJ1A 4DA4A 1L2TA 2P3QA 4I50B 2GBIA 1QYXA 4FXPA 4HSGA 4QYIA 1Z6XA 1XHFA 1TAQA 4RH3A 1Y4AE 1CLUA 4QUAA 5KTRA 2JCXA 1GPDG 4V0ME 5IJ9B 5GINE 3L6CA 1MF7A 4R6WA 2AE2A 3NFRA 4H2DA 4M86A 4RVGA 3LT5A 5BN5B 4BBJA 5ARBA 3WA7A 4X90A 3R9XB 4PS1A 3GZJA 3P9XA 3TXXA 4CQNA 2RI0A 4K9MA 4MGIR 3RNLA 3JQBA 2HF9A 4DDVA 5ES4B 5HJ7A 4H3SA 2GM9A 4AP6A 2PL9A 2R1VB 4AQYB 4RPCA 2O5CA 2HIAA 1AGRA 2H4WA 1CQPA 3CHYA 1GQRA 1H69A 2QK4A 3CH7A 3IKMB 2B1GA 2IU0A 3PUJA 4HFRA 5A4IS 1ZR2A 3OC6A 4N3NA 4Q1DA 1XZMA 2W8BB 4WY8A 1JU4A 1JDUA 1X7ZB 2V4MA 3QE3A 3Q7IA 3QH4A 5FOXA 5LSAA 2PZJA 1QO7A 4MWBA 2R8ZA 2ZBGA 5C32A 4DNQA 4LZAA 4CTOA 4OLAA 4IP0A 1KJ9A 2QZZA 4OI4A 3RVSA 5EXPA 1Q7GA 2GAJA 3O4JA 2ZW9A 2IF0A 3OEEA 1IZYA 4KSYA 4PZCA 4TLCA 4GR5A 4QSHA 3AUJB 2FMTA 1GNVA 1YC5A 1J25A 3CEJA 4RTKA 4PO9A 2OAQ1 2C0QA 4ZTBA 2FUG1 2XY4A 4RWZA 1JMYA 3UWKA 5EP1A 5KNBA 4JT2A 4GDMA 4DIEA 3F6YA 4DMKA 5KTTA 3T9DA 2C7VA 4JLKA 1PQUA 1OXVA 2RH8A 1UC8A 2QJFA 4II2A 5CPFA 1BE6A 5K4GA 3JCZA 4G24A 1JLRA 3OA0A 1NBIA 2WTNA 4AZSA 2DBZA 3GOQA 4R1QA 3ZH2A 4OH7A 2RDMA 4Q6WA 4CODB 2QPTA 3E9CA 3F3SA 2JH9A 4AYTA 3K4PA 3K1YA 4ONEA 1M34B 4MS4B 2IHBA 3G88A 4Y2TA 5TQ2A 1YA4A 2XWQA 4JY7A 3UWSA 1Y80A 1I3OA 4R1PA 3DYVA 5HGXA 3EXAA 3ZE1B 2DUWA 4WJKB 1SZCA 1G2QA 3E9ZA 1SVKA 4I8DA 3NC1C 3LQRA 1ZVVA 2RH5A 4FYKA 4U7JA 1T4DA 5GOTA 3HZHA 3GLFE 3HCDA 5LD2B 5F9HA 4ARUA 1YSCA 4EENA 1O5TA 1PL8A 2C4TA 4C3OB 4KWTA 1GGMA 1ZGZA 5D5QA 1T8WA 4OBWA 1RTKA 2WJWA 4V03A 1VLLA 1HYBA 2ZRGA 1FYVA 1HT2E 1W4AA 3DMPA 1G8AA 3LVQE 4P5EA 4ZEVA 4L1KA 1M7GA 3KPVA 3KKPA 4QLAA 2CF6A 4YB8A 1PJBA 2J85A 2QM8A 4ITUA 4QTXA 4EY5A 1IPFA 1R7RA 1VL5A 1RHUA 5C51B 5KSOA 4I9HA 5D01A 4ZCMA 2O4UX 1N6RA 4Q16A 4RAOA 2R8YA 1WXWA 3K53A 4GAEA 1C1DA 1WABA 1YV9A 3EJWA 2EFEB 1IQ0A 1UWVA 2HEIA 2J08A 2VJNA 3JATB 4WCFB 4YCAA 3X1YA 1D04A 1T6BY 1Z3CA 2G88A 2OC4A 2JCBA 4Y2JA 2HLDD 3DMTC 2HSDA 4EA7A 5BRJA 3CX3A 2JLXA 2J0VA 4FHCA 1J2RA 1XZDA 2GPAA 2VK1A 3EGWA 4ES6A 4B3GA 3I5XA 3ANNA 3ISVA 4LV6A 3MG9A 1H4SA 1BD4A 3RLFA 4RD2A 3R3YA 4OXIA 4G1CA 1ZMXA 2O8BA 3F49S 2DFNA 1XZBA 4QRHA 2WBLC 3FI0A 2IIVA 3LA6A 4PGAA 3C6QA 1UDWA 1QHFA 3EPHA 4KWIA 2BMFA 2IEDA 1JF8A 2QMQA 3B6MA 4M7WA 4TVKA 2IPAB 4YRKA 2Q1TA 4D8TA 4Q82A 4FILA 2F48A 4KTVE 3V3KA 3WNBA 3FGZA 3PT9A 2UVPA 2Z4TA 2FW8A 1DIGA 2Q07A 1PSWA 4KUEA 2JLSA 4M0MA 2I80A 3II6X 1TD1A 2DPHA 4O2AB 4IEIA 1TB4A 3UFBA 4L57A 3OKFA 3L01A 3PUZA 3FETA 1JIJA 3VVCA 3I09A 5J59A 4LTDA 4XSGA 3ABRB 3PJRA 2X41A 3V55A 2VHQA 3B3GA 2UUOA 1T6XA 2VOEA 4M7OA 5TY0A 2FR0A 4A8JC 1VDZA 3T41A 1EWTA 1RXSA 3JD4A 1QRUA 3EZYA 5SY9A 3MGKA 5GJWC 5AW7A 5U9CA 2QQGA 3MCVA 2CLEB 4XSHA 3ZNOA 2JJ2A 4MEBA 1G5TA 4YUVA 3QVMA 4J7UA 3R5SA 3EQ8A 2EU8A 1MLDA 1ZINA 2XOKA 1FDOA 1NRIA 4K9SA 3LGXA 1P1RA 4HCJA 1T5IA 1U1FA 3F67A 4KXWA 1DAHA 3Q5EA 4BX3A 3KDPA 3Q85A 2EW1A 3FAZA 2NPIA 5IPFA 1C30B 3AR4A 2BGTA 2PQ2A 2XZDA 4II3A 1K8QA 3ZLBA 2F1HA 3CTMA 4NY1A 1YONA 4GXTA 1QTNA 3LUAA 1H4VB 4DR5B 4Q1AA 1EDEA 1M6YA 2CFRA 3GJTA 3KBBA 1OIXA 4NNJA 3CZ9A 1JDJA 3W2TA 1GZ7A 1U0GA 3WDKA 2DR3A 3EGXB 5GONF 2QQFA 1MJHA 5H68A 3SX4A 1JLMA 5H16A 2NOAA 2I9KA 1YQGA 3C7CB 2RHDA 5JD3A 3UJNA 2DSNA 4W7HA 3PHJA 3U31A 4JL6A 1NR7A 1T9CA 3TB6A 1MB0A 2HK8A 3HXLA 4DC1A 3BJRA 2B0JA 1EXMA 3MJTA 3A6JA 1W6UA 1G41A 2A5GA 2WWWA 1SBQA 2ZIFA 1Z6ZA 2ZSAA 5HF9A 2JEZA 1XVUA 3ROEA 1JHYA 2NVWA 5LU8A 3CN9A 3Q8MA 1KRXA 1NUAA 1N2BA 1XJ5A 1OUMA 1PDWA 3IELA 4OBEA 2X76A 2BR4A 3E4CA 3ENKA 3CUSA 4IMPA 2PUDA 4ZOQI 3FPKA 5JAZA 2ZXFA 4I3HA 3EG9B 2QLMA 4A6PA 1YDWA 1OSNA 5CVVA 3ZHXA 4E09A 3PDWA 3QEMA 1IK4A 2RAFA 4FOPA 4QOFA 2VCEA 4HDAA 2G1KA 1SG6A 2I03A 1AU9A 3H9QA 5JADA 1PBNA 1CBUA 1JKXA 2HMAA 2Q28A 3DL2A 4KV7A 1KO4A 5F1KA 3U4IA 4R2MA 1P4HA 3STWA 3KEGA 3U9SA 1PR3A 1HLGA 1DJMA 1GT6A 2GI4A 4MULA 3WKAA 4RAQA 3LX8A 2FZCA 3E82A 4U3JA 3OTWA 2G28A 4V0SA 4Y2HA 2NGRA 5DMXA 5FI3A 3S81A 5DLYA 2FWRA 1U28C 1FYXA 2JFGA 2PIAA 4RYDA 3SOPA 1DBQA 4C1NA 1IQPA 1PEYA 2FOLA 3FWKA 3NHRA 4G01B 5B4VA 1MV5A 1Q1QA 2JLYA 3KXDA 4G0QA 4ON9A 3UIEA 2DT5A 1EBUA 1C9JA 1ZKDA 2YWRA 1NP7A 3A37A 4KJXA 2BFEB 4C7VA 5AUPB 5G0UA 5JC8A 5JNVA 3DOEA 1SKUA 3GNTA 4IWNA 1Y1SA 3WLEA 1WUJS 1GTSA 1WM1A 4PU0A 4MW2A 1Z36A 3EISA 3F7TA 4OMDA 4Y6PA 3TZLA 5JAIA 1WE2A 4TLEA 2J5QA 4QDTA 2JIZA 1KY4A 2OUKA 3EXIB 4R1MA 3ZLJA 4GM0A 1VCMA 3FYUB 4QFCA 4EB3A 1C3OA 2B8WA 1F2VA 3CNNA 1KC1A 2ERXA 2JJQA 4IDAA 4IILA 4MKFA 4PX3A 1NW6A 1QHYA 1QH9A 4JLNA 8ATCA 3RS2A 4ROTA 3QZUA 3O31A 4WBXC 3W5BA 3NH6A 3U9LA 1D6SA 4BASA 4WKCA 3ZDZB 2D7CA 3FPBA 1DL5A 1XRRA 3ECCA 1K68A 3VPSA 1R88A 2B94A 3EMKA 3MINB 3U7GA 2V7PA 1JQ3A 1ZVMA 2H06A 2PD6A 2XODA 5CK4A 4M53A 3MB5A 2HW8A 4RIIA 1DOAA 4KO8A 2I7CA 4F6RA 2YCBA 3JYHA 4IS3A 4NMWA 3RR2A 3TPFA 5CBPA 5LM3A 1H6CA 5HUQA 1MAHA 2W7TA 2YXBA 4GM1A 2WF7A 5LD2C 1X7DA 1QHGA 4DJTA 4J91A 1KH2A 3NYIA 3VMFA 2YJ5A 3T1QA 1R6AA 4WDQA 5K0ZA 2WM2A 3FPGA 4BNLA 4D1YA 1KI8A 1TM4E 2HM7A 3BQMB 3C8UA 2HWWA 3HG7A 2P40A 3ZBTA 1PZNA 5CA1A 1PNRA 2ZZNA 3OEED 1DAGA 3BRWD 4RZHA 1AKUA 2XTNA 3QQ5A 1M8FA 1QGAA 1MHPA 1P5RA 2I34A 3ICPA 3T7AA 1UC5B 1PZXA 1T2EA 2P6RA 3OD1A 2VSXA 4P3PA 5K01A 3A6GA 4GT1A 3FTEA 4CE6A 1SXJB 1OHHA 2JD2A 1R0KA 1JQAA 4OHKA 1Q0PA 2WYVA 3G5MA 4R69A 4XQ9A 3PT5A 1LXCA 2CMFA 2VNIA 5HBRA 3KLBA 1AZTA 2QSZA 3BWCA 4IGAA 2O8EB 4KVAA 1F0KA 2PX4A 5DNWA 3CFYA 1DC6A 1PZEA 2GWHA 1DT3A 3EVTA 4HN9A 4XGIA 4CM4B 2OOKA 1AV7A 5HIJA 2HEGA 3VKUA 5AVZA 2OXIA 1NKSA 2AWNA 1LVHA 2J30A 2WJ6A 4M7PA 4AWXA 4EO4A 5A5EA 3O2NA 4NBVA 2PKQP 3P9NA 3HRHA 1T2FA 2BZ1A 2XQVA 2OILA 4GU5A 4BN5A 1HV8A 3FKSD 3RYCB 1Y1RA 1YBAA 1KO7A 4EK9A 1U6KA 2DBQA 1UT5A 5JWHA 5DEIA 1Z4OA 1WCV1 1FYFA 3OSZA 5M29A 4NCHA 2B7LA 1SVLA 2Y1KA 2YDXA 4E33A 3K9WA 3GARA 4TMYA 1WUHS 4LISA 4B6QA 3RARA 3WKDA 5BWNA 4CR8A 2AZTA 1HTWA 5KMGA 3HE3A 4RKQA 5JVDB 3KKLA 1BS2A 2CB0A 5EPUA 1TJ3A 4P33A 2D1RA 2A0YA 1YZFA 4Q4AB 3X2FA 1SUFA 1NUPA 2ZI4A 4MWGA 2QRVB 1M2EA 1TO1E 3NZEA 3F6CA 4JASB 3GD5A 2DH5A 2ZB3A 3BFJA 3C48A 4QJ5A 5AIAA 5HSGA 4PFQA 2VYVA 3NHMA 4TS1A 5IKOA 1Q6ZA 3B5IA 2C7QA 1T0HB 2H2DA 1TYEB 4PR0A 3UV7A 5ER6A 2AFHA 3SF8A 3GV0A 1UKYA 1Q12A 1LLQA 4XPZA 3EPKA 2G76A 3RVDA 5KNBH 1AMUA 1BYIA 3HVHA 3WKBA 2PZBA 4D8XA 1EVYA 4OAQA 5HZMA 3BULA 5TQVA 3LX6A 1RP1A 3B12A 2HA0A 1Y37A 3A4LA 4ZK2A 1ZN2A 1BS1A 5KVSA 4HMQA 4P4TA 3AR8A 3RIGA 3AT1A 3HNOA 1R0BA 2ZPTX 4UD2A 3D6FA 3ROPA 1UZMA 2WJZB 2BCJQ 1TFRA 2IE8A 2Z1NA 2WIKA 5BURA 3V8QA 5IU6A 2D8AA 4I9GA 3PGKA 5AOBA 3I52A 2BFCB 2FPPA 4X6YA 2QN8A 3ZE8A 1W0CA 3F5SA 4Q4DA 2O7NA 4MWEA 1LF5A 4A73A 1KQOA 4ZU1X 3QG1A 4YFYA 2FEXA 3M82A 4LZZA 4W5RA 4BVEA 1FUYB 1JHRA 4W5WA 3ACDA 4YRAA 1L5MA 3DFUA 5DHAA 3IXLA 4C5BA 2GCOA 1MH1A 2FDXA 2YJTD 2BMJA 3DD5A 4G1BA 2IW3A 4JV5B 1S01A 1U8AA 4FNGA 2JIOA 4N18A 1W4RA 4F84A 1QM5A 4REQA 2XCSB 5DCWA 4PRLA 4F6RB 3A9VA 2C31A 3DOJA 3KWLA 4RVFA 1I7NA 2BEUB 5BW6B 1E98A 3ZU5A 2Z2JA 4OK6A 5E8JA 2ZKIA 5KYXA 2FZVA 1VHWA 4MCJA 1QONA 3B51X 1S9DA 1YRBA 4LHEA 4XIYA 4UM9D 1XD8A 4A2CA 4RQUA 3HBAA 3OPVA 2Z3WA 3JD0A 5JAOA 1CRQA 4LOHA 3P9IA 2YVKA 7YASA 5E6UA 4YGXB 3KOYA 3TXYA 4JLBA 5AKHA 3IAAA 1Z8NA 2OQ2A 3MLEA 4FKMA 1SK8A 1LZLA 4FT2A 5SYNA 4MLZA 4N03A 4D9IA 2XB9A 2MINB 3LLSA 4IEEA 1SXPA 3I32A 5ILGA 3STVA 2PLNA 1SHKA 1UIRA 3CISA 1KVUA 1QPZA 1O03A 4OGLA 4ZYZA 2FPOA 2IYAA 5EMMA 3A0RB 4N82A 4JP5A 1JR3E 2X1LA 1CJCA 3G8BA 4Q4HB 3EIQA 4UNQA 1H3FA 4YP5A 4ZC1A 4BIIA 1TEHA 5K0JA 4QQFA 3M1YA 3AM4A 3TAHA 2NYAA 4H7KA 4XRRA 4TMKA 3GZTB 2FWIA 3TUZC 3IPYA 2CLDX 3X2SA 1LI5A 1QAMA 4F3CA 4RZQA 4IDBA 4RLHA 1TCCA 2AXEA 4TT8A 1KK2A 2V7BA 3FIUA 2QL7A 3D5QA 1NRXA 3EGCA 1M7BA 1OFHA 4EVSA 3MUFA 1ECJA 2ZJ1A 3M6AA 4RHEA 4KQ6A 4BEBA 3ELYA 1LRJA 1E9SA 1NQVA 1CE8B 3DEHA 2PJDA 2IXTA 4OYLA 5EQTA 5JDIC 4HYQA 2HT1A 3IOEA 1C9YA 4P2GA 3GAAA 5CR9A 2W2PA 3RU2A 1U7HA 4B6JA 4HEA6 3GBVA 1M33A 2IXGA 4I1OA 3BMCB 3DBIA 1YKFA 1A8PA 2J7PA 1U4NA 2R4QA 3QEAZ 2KS6A 5ECWA 1Z12A 4UDXX 5HFNA 1PQWA 1X9HA 2QX6A 2XZPA 4IIVA 4MA4A 4NFHA 4OJYA 5JAUA 1SVUA 4G37A 4C22A 4F3TA 1ZHHA 1SPXA 2C1EA 1Y0BA 1ZMTA 3FLBA 4RS3A 5GJVC 3S28A 3DULA 1ZGHA 3ZXIA 2QBYB 2PZLA 4Q3CA 1A8HA 2DHCA 5CLFA 3DPUA 1ZLXA 3LSYA 4ZOBA 5C2JB 1SCUB 13PKA 2X4LA 3RS8A 1JILA 4KHPB 3F7MA 2FKAA 2P4SA 2I2DA 1XK7A 5CH3A 5JSYA 4F60A 4ASUD 5AOVA 3SBXA 1MGOA 2EBUA 2RGRA 4UZSA 2QTHA 1E2DA 3FCOA 2OA0A 2WTEA 2IYYA 1QIEA 4QGAA 4MVJF 3JWHA 1GYRA 4K87A 5ULLA 3BL6A 1ZH4A 1VMAA 1DKLA 1NN3A 4IDOA 5F5LA 5M2QA 4MUXA 4BFXA 2BTQB 1XZ8A 2GNAA 1L5KA 4R0VA 2J3EA 4W1QA 3JVVA 4ARBA 4Y7DA 2HXYA 4IY1A 5ALIA 1VIDA 4FW9A 4YV0A 2MSLA 4K7JA 4C0HA 1OB2A 4BMXA 4C5AA 3LBYA 1MIOA 2XRMA 4BXOB 3A6PC 4RANA 1Q77A 2IOHA 3FGPA 1AN0A 1YI1A 3DAPA 4YMSA 5BN1A 3E35A 3S2IA 2Z43A 3ELUA 3DDZX 2EZ8A 2JAPA 3AWDA 4B7UA 1A9OA 3DO8A 3M4JA 1CETA 2OBXA 4UAUA 1DAEA 3GGDA 3TSAA 1Q3KA 3VYRB 4QDXA 3L07A 1XTJA 1W5EA 2VPXA 4ZI7A 5DN6D 2H4ZA 3EDMA 1G21E 1QGUA 3TUIC 2A8YA 1UPAA 4OQ4A 5DJ5A 2CLHB 2D2VA 2GJ9A 3SQDA 1B2RA 4KKVA 3GLSA 1BH2A 1EJ2A 2C99A 2GJKA 4JOCA 3RFXA 3S7ZA 5IDXA 1W93A 3QBDA 3FPHA 4RFSA 1M1YE 1MOZA 3LFUA 1N3BA 3QVJA 4LZOA 1YB1A 3UKOA 4BNUA 5F2OA 1T4BA 2V3WA 3COSA 1QRAA 5CT5A 1CUSA 5K0EA 1PG5A 4HQNA 2QL5A 1MX9A 3LDFA 1L5GB 2Q1XA 7MHTA 5DIFA 1ZKMA 5HKKD 1UP6A 1HDCA 2BEUA 3HP4A 4MVWA 3GL9A 2BFAA 4X8LA 2RCNA 1YCGA 1XLUA 1UKBA 3BL5A 4LCJA 1FBNA 2IBMA 1UBOS 3DR3A 4GSYA 5DYNA 2PD3A 4BQQA 2BGRA 4LXXA 1WZUA 4GNKA 5AIBA 5IEJA 2HRQA 1V47A 1Z6AA 4A1OA 5ALKA 5TRTA 1V11B 3U0BA 2AOUB 1E2GA 2X42A 3G8AA 3PVCA 3PFBA 1AH2A 5ILQA 3L6DA 4D9GA 1DP4A 1ENOA 1UCFA 4D43A 1I2CA 1NURA 3IE1A 3E0QA 1W59A 4YDQA 3A1TA 3AWIA 3ADKA 3DTVD 4LRQA 2OCXA 1E4VA 2QMOA 1LX6A 1KZ7B 4KK4A 4RETA 4X8MA 1R0CA 2HHLA 2VNAA 4ATNA 5I7UA 2HYIC 3A1WA 2AV6A 2RJOA 2E89A 3ON5A 2GK6A 4K0KB 1SBCA 5C52B 2D13A 2XIQA 3F0TA 2DFDA 3WGZA 1TM2A 5EHNA 5G3YA 4CBVA 2JGMA 2A4KA 3NOXA 4LV8B 1KYWA 3EIWA 4RK6A 4L78A 3RS7A 1JHUA 1NU6A 1ZRMA 2I2XB 4C7MA 2P7HA 2XYQA 4LWPA 2HKIA 4DJFC 2R4UA 3ZHCA 4REOA 1H22A 2C61A 1DI0A 1K3UB 2ZWVA 2PXAA 1OQAA 3GZ4A 4ME6A 4U2FA 4URHA 1IIBA 2D74A 2HPHA 5CVUA 3I9JA 1V35A 3U13A 5KWVA 4DCCA 4GKKB 3AF5A 4K0RA 5BPHA 1GN9A 2QR5A 3O90A 1W35A 2H7XA 3T94A 4ER6A 4Z7JA 5CDFE 2XKJE 4ZI7B 1C7EA 5JS2A 2VDUE 4IRUB 1WB5A 2YMLA 4AP5A 4F2DA 1KIAA 1I5RA 2XUFA 1OXMA 1G3RA 2NSDA 2QVBA 1RU3A 5H70A 5I7EA 2YWDA 1TT5B 3ESDA 4MWOA 3AONB 4OIMA 4W8OA 3ADCA 1Z63A 5FWNA 1GTJ1 4HH1A 2WUDA 2PPVA 3QEOA 1FSGA 4I50F 4ZMSA 4XUEA 1GUBA 5I7FA 4KU4A 1ILEA 3OIUA 4US1R 4L5YA 2J48A 4JSTA 4J0CA 1QKIA 2R68A 1Z3IX 2Q49A 3JQGB 1KDTA 1HT1E 3JQAD 4N39A 1J06A 3CUYA 4TMVA 4XJVA 4E5MA 2QROA 2D4AA 4TYMA 2VIIA 3DVAB 3OLCX 1PJLA 2ZYUX 1AQ6A 4RM3A 3HS3A 4WBNA 3VM6A 4WASA 3S2UA 4GPAA 4K9OA 4PINA 3HP7A 4KI7A 1U2QA 3FTQA 4ENUA 5CB4A 5C37A 5TJ9A 1KJWA 2C9CA 3AEKA 1II9A 3AG6A 1A8IA 2JZNA 2R4TA 1LPNA 1SXGA 3TR6A 2ZJ4A 3EPPA 3AB7A 2WIGA 4LS3A 4NCBA 3ADPA 1C9EA 1EX7A 5HKBA 3CF2A 4Y6SA 3AHGA 5FOQA 1H3NA 3K09C 2OHHA 5KQMA 2IYLD 1Y7PA 4DL9A 4M0EA 4F12A 3FNBA 2O5VA 2O2CA 3B2EA 4ZHQA 2CKDA 4XUGB 2YL2A 1MVLA 3ZKAA 1OXKB 1MB4A 5JSZB 2OHJA 1YD7A 4L4ZA 3EZXA 2XDQA 3RRBA 1ZIPA 2FEMA 1QQ5A 1NHGA 3AV3A 2EL9A 2XGOA 3B7PA 1ZUNA 5DTJA 3EWNA 1LDGA 1Z7GA 3JD1A 2A1UA 4QGHA 4YHHB 3BYZA 3ZUPA 3C3BA 2DWOA 4RM2A 3LOPA 3HJUA 1KBQA 5C81A 5CFLA 2ORVA 2MYNA 3BWBA 4OEHA 4UEKA 3L7LA 4MV8A 2ALJA 1S8AA 4ZO6A 4LYDA 4OXNA 3A31A 3QE0A 4FFDA 5CEJA 2EYUA 5HG0A 4HQOA 4CFSA 2R0QC 2EKBA 1UOPA 4P32A 4MUEA 1SC4A 3W3ZB 2P1DA 3PWKA 3WOVA 4CKEB 1A7JA 3V9PA 1ZP6A 2GN8A 3BE5A 3ZHVA 1RR6A 4JMPA 3AR2A 2JI7A 4ZWNA 5LPNA 3UC5A 2FPRA 2RGUA 3PL1A 2HK9A 4OL0A 4F4UA 5IK2D 2CFSA 1M3SA 3AETA 4JCOA 2GZ3A 4M89A 3REQA 4EUHA 3UTCA 2ZSFA 1K9VF 3H7IA 5GTDA 1YFJA 4WXRA 5FWDA 2HFKA 2G0AA 3CNEA 5EY5B 5FUVA 3ZHYA 2WF5A 4DEXA 4OKNA 2BTOA 5KSPA 4E70A 2X3UA 4MMXB 3T5MA 4NSNA 5CAEA 4F06A 4M1EA 1GL9B 4AQ7A 3IV9A 3H8VA 2FZ4A 4I4TB 3I01M 4TN1A 5JOQA 1GXSB 1QZZA 3WSWA 5KSZA 5DYYA 2H9AA 3U3ZA 1MV8A 4BO7A 2QG6A 2WIAA 5E6UB 3IDOA 5AVQA 1BX1A 2P2NA 3EZ7A 5L51A 3RSGA 3L05A 3DBLB 3C8DA 3P27A 2WMDA 1GLVA 2EZUA 2DFTA 2BUBA 4KVZA 3WL6A 3L0SA 1KJYA 2BEJA 1ZGAA 2E4YA 3CCBA 4CU2A 1MO4A 5A4DA 1NNSA 4ZGWA 4YI3A 1KEZA 3FOZA 1FU8A 2FPIA 2IRWA 3LUKA 3PJEA 4KPGA 2RC6A 4QUKA 4WAUA 3UJPA 4B75A 4ERXA 1Q0HA 1ZZGA 1K1EA 1L5QA 1Y3IA 3T9AA 1D6JA 1DG9A 4LY0A 1HLDA 3PP8A 5K3DA 3UHFA 1FFSA 4HGYA 2XW6A 5JO9A 3HXPA 5HMLA 5KBYA 3QTBA 2IPNA 4D0GA 3R5KA 3AEKB 1CEEA 1IPHA 2IHTA 4AS1A 3DZDA 2G17A 4J4TA 2H16A 4MV9A 2XA9A 3KEMA 4HATA 2WE8A 4ZGBA 4WJZA 5JYDA 1GRCA 2QDXA 3D7KA 4MVJE 4WN9A 3CMCO 2A1UB 1OZGA 2NADA 2OHIA 3A32A 4MRAA 5CH8A 3LYUA 2K7FA 5AVSA 4CT4B 2CD9A 1RADA 1L9XA 2ZBDA 4EP1A 4ZI3A 4D8YA 1BVHA 5EHIA 1E7SA 1I14A 3FBWA 4HNSA 3FHCB 4K6FA 1U1DA 1BA3A 3FMVA 1OZ0A 2VF5X 2OKCA 2WD8A 1A9SA 1R74A 3L04A 3OECA 1A8UA 1J23A 2WIBA 4F04A 2DVMA 1D5CA 4OYRA 1CX9B 1S02A 3H2SA 4XWKA 4H4DA 1UBUS 3CSDA 2E21A 4N7BA 2TSYB 5K3FA 4CCYA 5AFSA 5HZKA 1DX6A 4Z1MD 1L7OA 4BB6A 4WCDA 2A9KA 3K92A 4QEZA 2RCYA 4NBTA 1U3WA 1RD4A 5FA6A 3WYCA 4EPXA 3SVLA 3K70D 1E6CA 1MRSA 1SBYA 1WPXA 2FZEA 4J4BA 3SHVA 4BZPA 4BFWA 3K4HA 5FBVB 4DSNA 1WDKA 1QFZA 2FSPA 2Z8ZA 3GWZA 3K1TA 4O4JA 5IUNC 1VFPA 2MR5A 2QP9X 2XGMA 3NAMA 2BM8A 3TNJA 5NULA 3CUUA 3EAFA 1E5QA 1FLNA 3PQFA 4L75A 3S2FA 1X2EA 1J90A 1VRWA 3HI4A 5ESXA 4DVGA 4HLUC 4TV8F 2OWDA 4KBGA 3RREA 3ZWMA 4XASA 2VTKA 3KV3O 3IR6A 3C85A 4C0XA 3KQLA 3S1AA 5BSFA 2WG0A 1JJAA 3HRIA 1Y9ZA 4P0PB 1V8FA 3ITDA 2C4KA 3STYA 5F7JA 3HA2A 4R1TA 5DBHX 3UT0A 4D9BA 3KHSA 2WJGA 3R0XA 4PRZA 5ESWA 3USCS 4BBAA 4CG3A 5IX8A 2BJHA 3D5EA 5EIBC 3NVMB 3HN7A 4MUYA 4RQBA 4KQEA 1PFYA 1ODSA 4RWEA 1OX4B 4URVR 3QF4A 1N6KA 1U7ZA 1GVHA 1PJ8A 3HWRA 1U98A 4KO2S 4U7GA 3OH8A 4YAFA 4N76A 4M99A 5BQOA 1M73E 3TTUA 1PLLA 3ZWDA 4MHOA 1T2NA 4LBYA 4YRZA 4ZJPA 3PRHA 3SZMA 2F9FA 3TNLA 1N7JA 2FP4A 4JWTA 4DV5B 5A3VA 4BCCA 1X74A 4M46A 2E3JA 2XXBA 4OSEA 3TINA 1KYZA 4F45A 3UTDA 2C78A 3WI7A 1YR8A 2AL7A 5BO5A 1ZM7A 3B6IA 1VKJA 3MJRA 1LK0A 2P2YA 4E2WA 3ELDA 4DGSA 5JWRA 4X93A 4KPYA 3HBFA 5TS2A 3WGYA 5ADHA 5B36A 4RC9A 4NCKA 3OWOA