1CEQA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
304
Chain Sequence
b'PKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 110
structure length 304
sequence length 314
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ceqA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ceqA02
3W8EA 2J5QA 4MJLA 4DBVO 1I2CA 5TJHA 4MVJP 5L9AA 4HNHA 4DXHA 1YOVA 5T6BA 3HFGA 5G4KB 2YW9A 3JV7A 5CEFA 3WWZA 2OHXA 3ICCA 4FC6A 3ZW9A 5IDXA 5ITWA 5KJCA 4D3FA 3PIDA 4QX6A 2Q1SA 2X58A 3LC7O 3B1FA 4D0RA 5I7EA 3S2FA 1EE2A 3ZHXA 3NUGA 4HX5A 1PQUA 1H6BA 4BGVA 5KWEA 4AJHA 3AWDA 5A3JA 3E03A 4NNJA 1JKFA 3RC1A 3EZLA 3KB6A 5A9SA 4IJUA 4BB6A 3DTTA 3LLVA 5L7TA 1I01A 2XF8A 3QIVA 5CPBA 4J6FA 1XELA 2D59A 1WXDA 3UCXA 3JD2A 4J4BA 4YXFA 1EEHA 3ADOA 1UR5A 2YFQA 1Q2XA 4JK3A 5KJEA 5KVCA 3JYLA 1W4ZA 4RJTA 1YO6A 1TT5B 2NM0A 3FWNA 3ZDFA 3I1JA 3KTDA 1M75A 4YEDA 5LC1A 2GN6A 4D7AA 4H16A 2NACA 1DC4A 3H7AA 1SZJG 2BI7A 4WJZA 3DZHA 1HZZA 4Z6KA 3EAGA 1Y8QA 2OUIA 4I5EA 1DFHA 4CM8B 4CMCA 1E6UA 1NX6A 3GEGA 3BHMA 4RQTA 4RPHA 2YQ4A 3C7CB 3F6YA 1GPJA 1DIHA 1Z74A 4QT0A 1NVGA 3L4BA 3RJ5A 1PZEA 1O89A 1VC2A 3AOEC 1LRLA 5F21A 5L4NA 7MDHA 1RM5A 1ZSYA 3CIFA 5L53A 1DSSG 3AUUA 3PZRA 2QZ9A 2X5KO 3AW9A 4NK5A 1LQUA 2VRCD 4ZQEA 1LSSA 4QFCA 2VT3A 1G1AA 2C5EA 2UUPA 4RO0A 4B8WA 3BXXA 1BW9B 3C1TA 4WLEA 4INAA 1R66A 1SNYA 2HLPA 3RROA 1OI7A 4B4UA 5EERA 4WKGA 2O7SA 3WSWA 1P1IA 1M66A 3D3EA 4BMSA 4KOAA 3U0BA 1SEPA 3GRKA 3O8QA 2VRCA 1KERA 3CZMA 1IPFA 2AEFA 3EMKA 2GN9A 1XA0A 1WAMA 4OAQA 1W6UA 3VOSA 1FMCA 4CMIB 1EQUA 1FDSA 4DIOA 3N7UA 2JFHA 4MP3A 5ADHA 3H9GA 1J6UA 1VI2A 3RUIA 1C14A 4J0FA 3UICA 3ZI0A 2J3IA 2EKPA 4K6CA 1LX6A 4KTTE 3RFTA 3AY7A 4FFNA 3PI7A 1KS9A 3A06A 2FR1A 3BTOA 4MVJM 1UZNA 3ICPA 1Y8RB 4OHUA 4RGBA 2DM6A 1R4NA 5DN9A 5A9TA 3KLPX 3UOGA 3KV3O 4UEKA 4PLZA 3RU7A 1VKNA 3ABIA 2UDPA 3BIOA 4FR5A 3G3EA 4EUEA 1EUCA 4E30A 1GR0A 4CMKA 4FFLA 2OORA 4WLOA 2GR9A 4BNIA 3PVZA 2ZB3A 2P9EA 2DAPA 3JQGB 4HFNA 1TEHA 5KKCA 4D3DA 2VUUA 3PJGA 1DAOA 1EE9A 5A9RA 1KEUA 2GN8A 3G1UA 2ZTVA 2X5JO 4GSKA 2AQHA 3VZQA 3C24A 5JNLA 2AHRA 3MOGA 3WGHA 4YJGA 4W82A 3UCFA 5L7WA 1D3AA 1V0JA 3M2PA 4W9NA 1H6DA 3K9QO 2HJSA 2UV8A 1LTHR 4DLLA 1NYTA 1X7HA 4Z9FA 3O38A 4J90A 1NHWA 1SB8A 4W7IA 4NDNE 4XB1A 5A05A 3QY9A 2UYYA 3GG2A 3JQ8A 1BTOA 2B0JA 3X2EA 1K3TA 2Q2WA 3L4BC 2X0RA 1B16A 3HJAA 3QLJA 5JO9A 3LQFA 3L6DA 4FFOA 4IM7A 1P77A 1XDWA 1ZJZA 3FPLA 2V6FA 3L0DA 1H9AA 2V6GA 4BO4A 5J23A 3BAZA 2O2YA 1E7WA 3SEFA 3WLEA 1YWGO 1VRWA 1HZJA 2D1YA 1JVSA 1LLUA 3ONFA 3UVEA 1YDWA 4FPXA 4J7XA 3M1LA 2GO1A 4X54A 1VJTA 1HTBA 3RWBA 3WGZA 3GVHA 3VVCA 4BO5A 3GNTA 4PLTA 1GV1A 3RC9A 1P74A 4J91A 5JBIA 3ROPA 4DLBA 1GFSA 1TA4A 1GV0A 3IIEA 3BTVA 3JYOA 2DFVA 2QG4A 4PLHA 3JQAD 2OBNA 4R4JA 4J1NA 3ONDA 1UH5A 4GGPA 4RF3A 3VH3A 1JA9A 4A2CA 1ZK1A 2VUSA 3ZV3A 3KSZO 3D3WA 2VCYA 4H7PA 3D4PA 2BGKA 2DPGA 3OETA 3WXBA 2CSUA 2AQKA 3GAZA 3UXYA 4Y9DA 1UXHA 3GZ4A 4MKZA 1JU9A 3UN1A 5HWSA 1LI4A 3KOUA 5HM8A 3NJ8A 3U5TA 1KC1A 5EIOA 3D64A 2C29D 4OOFA 3JQAA 1E7MA 1OBFO 4ND5A 4PLVA 1PGQA 5LDHA 1UUFA 4LVUA 2IDZA 5CFZA 5BSEA 4EYEA 3DAPA 2XXJA 3COSA 1EUZA 5DBGA 2YDYA 4YVFA 1A71A 1LDEA 2B37A 5I9MA 3K2EA 4EDFA 4UAGA 5MDHA 2XAAA 3KBOA 4JJIA 3VH4A 2PD6A 1EBUA 4CM3A 1IOLA 1Q0QA 3BHIA 1U3TA 3HDQA 4CLXA 1YBAA 5EQDA 5CPFA 2DVMA 4DC0A 2ZJ0A 1MFPA 4XRGA 3ZHBA 1LLDA 2I67A 4GX1A 4RDIA 1QORA 1ZH8A 3UHAA 3S2IA 3TFQA 1KVRA 3LF1A 4ND4A 3AU8A 1GCOA 1YE3A 3HN7A 4BKPA 1FDWA 1QSGA 1QMGA 2QYTA 3ENNA 3KLMX 5A5EA 1ADCA 1PS8A 3GUYA 4QSMA 4W9NC 3WIEA 4C7JA 3BMQA 4WOJA 1FDVA 3JD4A 1BXKA 2VOEA 1U2GA 1PL7A 2IODA 3AM3A 4OXNA 4RVSA 3SLKA 4EEZA 2QW8A 2GERA 3DTYA 5IFLA 1IHYA 4BGEA 3RUEA 4Y6RA 1SB9A 2O4UX 5C7IO 4GQAA 4P4NA 3VAZA 1BMDA 3GK3A 2AQIA 4GGOA 4Q3DA 5DULA 2DBVO 1MXFA 1Y5MA 3KZVA 2O50A 5EESA 1P31A 3W8FA 4YAEA 5FI3A 1PJ4A 1XQ1A 3GA0A 2C59A 5L4SA 4O1MA 4FJ0A 4E2WA 5JYEA 4XGKA 3LF2A 1ULSA 1J4AA 4EUHA 3I9NA 2WSBA 4N5NA 3ZU4A 1XCBA 4BIIA 2Q4BA 2Y1DA 3DBHB 3HNPA 1E5LA 3LK7A 4NK4A 2FP4A 4YACA 5ER9A 1DFIA 2W4QA 2X86A 4UUOA 3ULKA 2ZQYA 4YDRA 4JBIA 3FR7A 1PJ3A 3L9WA 2PZKA 3NTQA 2GZ1A 4HBGA 4J16A 3EVTA 3FF4A 2R6JA 2GF2A 5DOVA 3PPIA 1E7SA 2FSSA 3CTMA 1K89A 1PQPA 4IGEA 2PY6A 4E6PA 4TVBA 4ILKA 5DNAA 4KDEA 3FBTA 3E6AA 2E48A 3AUTA 2RH4A 1LNQA 5A03A 1NFFA 2GASA 2DPHA 4CQLB 1GUYA 5G0SA 1I3LA 2YQ5A 1HKUA 5GMOA 3M6IA 5K0ZA 1LDNA 2YUTA 5CDSA 3PK0A 4KUEA 1RPNA 4MVJF 3VKUA 3WTCA 5KOIA 1UDAA 2DUUA 2WD8A 3QVSA 1S6YA 2OZPA 2G0TA 5DF1A 4RQUA 1T4DA 3OECA 1E5QA 4NG5A 4UEOA 3DONA 2AG5A 1SCUA 2PFGA 3GEDA 3FPCA 3SLGA 5G0VA 3ZCXA 1WP4A 3WFJA 1PJTA 2YV2A 3B20A 4ZD6A 3AFMA 5ER6A 3AI1A 1UZMA 3ZHZA 1BSVA 3RQSA 1I10A 1X7DA 4XA8A 4C7KA 4IDBA 1KOLA 2RAFA 4D46A 1E1MA 1J49A 4U7WA 3IDSA 1F06A 5A1TA 3QSGA 3AUSA 4NJMB 4N5LA 5ENDA 4IJVA 5L51A 4CLRA 5L7YA 1X14A 2X5OA 5DBFA 1HE3A 2HJRA 1SEVA 3H2ZA 2WD7A 2LDBA 3H5RA 3WGQA 4XEHA 1LBEA 4K1LA 4B79A 4B7XA 1Y7TA 2BMAA 2QRLA 2Y66A 1ZMTA 2A92A 4E13A 3PJDA 2AA3A 1JQBA 4FFPA 4XQ9A 3ZNOA 3QHAA 3GMDA 4DIFA 2Y93A 4RVGA 1HDYA 3C7AA 4TQGA 2NWQA 3TPCA 1Q7GA 1DIRA 4AJ1A 2GD1O 1G0OA 1OZAA 3BMNB 4MINA 1DJQA 2WYWA 3QW2A 5AXDA 4H3VA 4ZN6A 5BSFA 2DTEA 4NZ9A 2POQX 4HWKA 3IMFA 4R69A 1IUKA 2JCYA 1U28A 1XQ6A 2W8ZA 3FWZA 4PG6A 3T4XA 4E2YA 4XR9A 1XIVA 3RUFA 4OQZA 4UVHA 1I3MA 3MJEA 4WCFA 3EHEA 3HQ4O 1LJ8A 3E9MA 3A4VA 4Y6SA 5EMHA 2CNBA 3PHHA 4MKXA 4IXTA 5DZSA 2R2GA 3F1LA 3GDOA 5ITVA 3DC2A 2ZCVA 3RBXA 4DMMA 1PEDA 3ZU3A 2DC1A 2C2XA 3TRIA 4CLOA 3PLNA 4UULA 5KKAA 1GUFA 1VM6A 2CY0A 2O3JA 3FNGA 5L95A 3VH1A 2UUOA 1H0KA 1C0LA 1WMAA 2A4KA 2BLLA 2B5WA 3WGGA 4MVJE 1I2ZA 1K0UA 5F1KA 3VZSA 3R0IA 1L7DA 1Z45A 2TMGA 1V35A 1Z75A 1Q7BA 3FBGA 4QFDA 2Q2QA 5KTKA 4J9UE 2JAHA 1P33A 1J0XO 4GAEA 3V2HA 4PG7A 4O0LA 3R6DA 1UAYA 2QIOA 1P1RA 2NVUA 2VWPA 3PJFA 1HYGA 2Q1UA 4L8VA 3RC7A 5C37A 1O5IA 1Y9EA 4BGIA 2P2SA 3P2OA 1N92A 5IN5A 1PS0A 4NPCA 1HLDA 3WWYA 1KBZA 2VTEA 4ALJA 1U7TA 4ZJUA 2HUNA 3KXDA 4NI5A 3ZWOA 1GQ2A 5IDQA 3EVNA 2O3UA 4HFMA 4MPDA 4P4GA 4I5DA 5KJ6A 3DFZA 4DQVA 3V2GA 3WGTA 2EW8A 3PIIA 4J0EA 4YWJA 4BO9A 1LDMA 5JCJD 1D4FA 1NQTA 4XYGA 3LVFO 3QV1A 3FD8A 2EP5A 2O7QA 3LSYA 4IDCA 4FN4A 4E3ZA 4P22A 1XHLA 1NHGA 3GGGA 5IDWA 1LLCA 2B69A 4PG8A 3IP1A 1OC2A 5CHEA 2PZLA 4YT8A 5C7OO 1NNUA 1ZK4A 4FGWA 4WLUA 4BMNA 3HB5X 1HF3A 5JCJA 5B4VA 1N9GA 4ONEA 5CEJA 8ADHA 2X22A 5CG1A 4IQGA 5TS3A 3DHYA 4MOWA 2Z95A 1LEHA 3TWOA 4BQRA 4GMFA 1L1FA 1Q1NA 2Y0DA 4BNTA 2FR8A 4BKRA 5I9LA 3HZZA 2IXBA 4I9NA 4PGFA 2B4TO 1U3WA 2V6BA 4U0JA 1QYVA 3GVIA 3EUWA 5JDIA 1EMDA 2I76A 5T57A 2DT5A 3L07A 4W7HA 1YQDA 2GZ3A 1LSOA 4B3HA 4J43A 1QV7A 1CF2O 3VDQA 1JKJA 2X0JA 4WCFC 2HU2A 5BQFA 3KVOA 3OA0A 3WQRA 1Q0HA 2E82A 3SXPA 1K6JA 1N1GA 2Q4EA 4D43A 1O0SA 2A9FA 3OFSA 4IUYA 3PRJA 2P5UA 2C07A 3K30A 1MC4A 1PGPA 4L4SA 4XZ3A 3B70A 2J3HA 1PR9A 2Y1FA 4Z3KA 3RKUA 2PGDA 1VE9A 2X23A 4WECA 3GDGA 1A4IA 3FCOA 1NAIA 1IE3A 3MTGA 3KM0A 3ST7A 4EEXA 1K2WA 1YL7A 4OO3A 3ZNQA 4J7CA 4RPKA 2CFCA 2E4AA 1OAAA 3PTZA 3W8DA 2ZB8A 2EGGA 1VKOA 2ZKLA 5TQVA 2JKVA 3H5AA 4DYDA 1E7RA 2A35A 2FHSA 4U5QA 2J8ZA 4YRDA 2FPPA 4ZU3A 1UXGA 2W2KA 1G0NA 4Q3CA 4FB5A 2G82A 2O3SA 3GF4A 5HS6A 5CDGA 3PJEA 3D4OA 1RYEA 1DOHA 3ZN2A 4CV2A 3V1UA 4RVDA 3F4BA 1X0VA 1LU9A 3GZNB 4WE3A 1ZMOA 3DR3A 3HWRA 3QVXA 4ALMA 4BNZA 2JD2A 2JCXA 1DHRA 3VH2A 4NU6A 4CV0A 4E5KA 5HS4A 4LMPA 2P4QA 3MJVA 4HY3A 2R00C 4A0SA 3DHNA 4JJFA 3EZYA 2RHCA 4KWIA 1VL6A 4O5OA 2ET6A 3OICA 5KVQA 1DPGA 1JLLA 2CDCA 3NYWA 4B7UA 2VUTA 2DBQA 1EK5A 1AUPA 2GGSA 3DOJA 2OGUA 2GLXA 3F5SA 4E32A 4ND2A 3DZJA 1BXGB 1E3WA 3ZNPA 3DFUA 2HRBA 2Q1TA 3BTUA 3ZNNA 2ZYAA 3QWBA 1B7GO 2FZEA 1SBYA 4BNMA 4D44A 4YB8A 3JYPA 3TZCA 1XU9A 4CUKA 1O6ZA 3ETDA 4IS3A 3HUDA 4BVAA 4D3SA 3FHLA 4FOOA 1DBVO 1D7OA 3RI3A 3R1IA 3ANMA 3WYEA 3UCEA 3G17A 9LDTA 4DUPA 5IZCA 1F17A 1DRUA 2RIRA 2IE0A 4WPGA 1WPQA 1B2LA 4CMHA 3RVDA 3IC5A 3QWFA 1JKIA 4MP8A 1B15A 3WTBA 3O26A 4XIYA 5JDIC 3BMQB 1N1EA 5EL0A 5KCZA 3VKVA 1GD1O 1B3BA 2DLDA 4R9RA 2FOIA 4BQPA 1FF9A 4PG5A 3ZU5A 3RUDA 3ROQA 1MXHA 2IZZA 3PYXA 3QJ5A 3C1AA 5IG2A 3M2TA 3H4VA 1Y81A 1EQ2A 1LC3A 3OIDA 2HSDA 5AXAA 5TGDA 1E6WA 3ZU2A 2O2SA 4S1VA 5GZ1A 4FBGA 1I2BA 4BNWA 4OM8A 4XIJA 2D8AA 5TT1A 1HE2A 1DRVA 1P45A 2CVZA 1HLPA 3MOIA 2HRZA 4R3WA 4RCVA 4EJ0A 1JAYA 3MCVA 3MTJA 4WGGA 3K96A 5L4LA 1DIGA 4GLLA 1P44A 3QVWA 3IJRA 1B26A 4OXKA 2NU8A 3SX2A 4FGSA 3VPXA 3AUAA 4CM4A 2EV9A 3LU1A 4O63O 4DGSA 3IJPA 4CLDA 3KUXA 1LSJA 4MP6A 4MVJH 4UUNA 3SJ7A 4BOYA 4GVLA 1AN9A 3AM5A 3PEFA 4BNVA 2PK3A 1KEPA 2HKIA 2JFFA 3C85A 1A7AA 3PZBA 4S3MA 1A4UA 2O4CA 4YQYA 3KSUA 1Q0LA 4PG4A 4UUMA 3ZGYA 1HSOA 1YVEI 3GHYA 1H2HA 1DIBA 1PZHA 2J5KA 1K6XA 1NWHA 4TROA 4J9VA 4LCJA 3GEMA 1PJCA 1GL3A 5THKA 4CUZA 1W73A 2OMEA 4GKVA 2X0IA 2Y1CA 3U3XA 1NBOA 2DTDA 2FMUA 1HDOA 4Q3EA 1HT0A 3L9XA 4RORA 1NASA 3GPIA 3JD1A 5IXSA 4HFJA 3BMOA 2D2IA 3UKOA 4DWVA 2C0CA 3ADPA 4OJNA 2GZ2A 2ZQZA 2RCYA 3GPDG 2G17A 4CMEA 2YHIB 2BFAA 1I24A 3IAHA 4CQMD 3P5SA 3NEPX 3LLSA 3B6ZA 1SOVA 1Q7CA 2PV7A 3GDFA 1IY8A 5C5IA 3GR6A 4IXWA 2D5CA 3WYBA 5IZCC 2B4QA 1U8XX 2D3TA 1E0DA 4IDGA 4O59O 5JAQA 3ZWWA 4E5YA 4AJEA 3U09A 5FFFA 1H94A 4L73A 4WK6A 1DB3A 4BNJA 4OSOA 3MJ4A 1MA0A 4DTIA 1M76A 1GTMA 2X9GA 2VHXA 2AG8A 4RL6A 2GCGA 4A27A 1QG6A 2PKQP 4EBFA 3JQBA 4OOEA 1T2CA 4IMRA 5CDTA 2SCUA 2WD7B 2I3AA 1PWZA 3WGYA 3E18A 2OP0A 1C1XA 1GZ3A 2GN4A 2VNAA 1R6DA 3STHA 3OJEA 4XYBA 2O3RA 1YB5A 3ENKA 4FCCA 2HCTA 2J5RA 3C3XA 3OJLA 8LDHA 2FZWA 4A03A 3KEOA 2PA3A 3LZ6A 1HE4A 3C7DB 2VOJA 2VWQA 4PLPA 4LRSB 1KYQA 1EK6A 2AEMA 3P2YA 2GNAA 2BI8A 3HE3A 4EJ6A 1UZLA 4AVYA 3DBLB 3KYCA 1GUZA 1KVSA 1C1DB 1WDLA 3QQPA 5I9NA 3AY3A 4EUFA 4RZIA 4WCFB 4Z0PA 2Q1WA 3JQEA 2JFGA 4R5MA 4R1SA 5AVOA 1MG5A 3AFNA 1FK8A 2X4GA 3ASVA 2Y1EA 3GH3A 3JQ7B 2VQ3A 1AGNA 2C5AA 2GUGA 3DZBA 4BGUA 5ICMA 3UH1A 1HDXA 5T5QA 2BGLA 3VTZA 1U5CA 4GPD1 4OMUA 4PZEA 2H5LA 1KY5A 3TOXA 5HRUA 2HDHA 1ZEMA 3GNSA 1A7KA 3CMMA 4XB2A 4D45A 4HFRA 1LC0A 3N58A 3ZW8A 1A9ZA 4IS2A 3AY6A 1DEHA 4ESOA 3FI9A 2PD3A 1XEAA 3JQCA 2FWMX 2YZ7A 1NAHA 4YJFA 1TXGA 3IS3A 3L6OO 3LDHA 4ZGWA 3RD5A 3I23A 4KZPA 4F3YA 1R4MA 1YJ8A 2H6EA 1ZK0A 1PJSA 4N5MA 4BS9A 4CMEC 3FR8A 1XU7A 3OIFA 3DZIA 4J7UA 1HE5A 4A73A 1XYGA 1XKQA 4IBOA 4XYLA 3ROKA 1DHTA 1YONA 4RPLA 4FDAA 1E6EA 4I9HA 2HK7A 2Q99A 1LQTA 2FRDA 3TNLA 2QRKA 4GLOA 3DL2A 3MWEB 3NRCA 3DMTC 4L9RA 1ZXLA 5B12A 4G65A 3VZRA 1N7GA 1QR6A 3AJRA 3F3SA 3PDJA 4XWYA 1BVUA 3CEAA 4M8SA 4FSHA 5GZ3A 1V9LA 3B1KA 2EKQA 3W4IA 3JQBC 5L45A 3FTNA 3PHGA 5G4KA 2Z1NA 4IIVA 3U4CA 5BNTA 3GG9A 2HQ1A 2Y05A 3TOZA 2EGHA 3DMYA 4YJHB 2OBYA 4LN1A 1A27A 5AYVA 2D4AA 4DQUA 4ND3A 2WYVA 4BNKA 3V2UA 3NJ4A 2DBZA 4ZQBA 3DAGA 4NFYA 4BB5A 1V6AA 2D5AA 3Q2IA 4OYRA 3BZUA 2Q46A 4XQCA 4P38A 1E1LA 1RYDA 3GRPA 4E2ZA 4KUGA 2G1UA 1E7QA 4J1SA 4L4XA 5COQA 2I5PO 1HYEA 1W0CA 1N2SA 3NT2A 4XYMA 4Y67A 2EJVA 1MX3A 3NDRA 3WJ7A 1NXQA 4YT5A 1TT5A 3LT1A 1ISJA 1JAXA 4TRMA 5EINA 4R1TA 4AJIA 3PHJA 4URFA 4ZHSA 4B7CA 2VHYA 4I5FA 2WWRA 1OFGA 2C7VA 2HAEA 4CM8A 5ICSA 3WMWA 2IRWA 4MDHA 1L7EA 3B1JA 5MGBA 3DDNA 4PZDA 2OOSA 3Q6IA 5CEEA 5H81A 4TRJA 3F9IA 3KHUA 4MIEA 4EJMA 2PGJA 4CR6A 1MG0A 5EQFA 3G79A 2H1SA 3I9KA 1PTJA 2E6UX 4M87A 5KNLA 4AJKA 3ZZNA 1HEUA 1TB4A 1NFQA 1X1EA 3L6EA 3VC7A 4BNLA 3JD3A 1Z7EA 1UXIA 4CJXA 1GQQA 1ZFNA 3I52A 3T7CA 1JDJA 4D0SA 1WNTA 4A7PA 3DZKA 4NFHA 2BGMA 5BR7A 4XGNA 1PQWA 3GHHA 1BW9A 3DEYX 1YBMA 3PWSA 4QECA 1MV8A 1HDCA 2I3GA 1DFGA 1GAEO 3TZ6A 6LDHA 3WBBA 1N7HA 3H9UA 4WOKA 5JE8A 1E92A 3CSDA 3DWFA 3PHLA 3KSDO 4CUJA 2B35A 1YL6A 4MIYA 4IDDA 3OQ1A 1N8KA 3O03A 3W6UA 4CM7A 2Q50A 3V1TC 4U6QA 2EKLA 3FNHA 5B4TA 2C7GA 1YGYA 4CMBA 5JC8A 1KETA 4J49A 4CMIA 1O9BA 1WZEA 1PJBA 1PU2A 2YFHA 3DHEA 2G5CA 4LVCA 2ZIZA 2YHUA 2QRJA 1IL0A 1WW8A 1YOVB 4GWKA 2OXIA 3U9LA 2FY8A 4AJ4A 2Q2VA 3K2BA 1EFLA 1ZIDA 1Y8RA 1LLQA 4KQWA 2F1KA 4JQCA 1LXCA 2CVQA 2FPGA 5KVSA 1T24A 1I32A 3D0OA 4CM6A 4FJ1A 2A94A 5A9SB 2NQTA 1E3SA 4FD3A 4Q3NA 5EJ2A 4B3JA 5TLSA 4ND1A 2LDXA 5ES3A 3JQGA 2VHVA 1GU7A 3CUKA 1K5HA 4NBUA 1LRJA 5I7FA 4DQXA 4NH4A 1XWFA 3GVCA 4WASA 2CF6A 3PWKA 5TSDA 4A5OA 4XKJA 2B5VA 4OSPA 3GVXA 1VJ1A 1ENZA 1U3VA 3WFIA 1YQXA 2DUWA 4L4RA 1ZKMA 2YDXA 3WGIA 3E9NA 4B4OA 3GN2A 5B37A 3RSHA 3CINA 4ALNA 1Y8QB 2AXQA 5FEUA 3NTRA 2CD9A 1YB4A 2VHZA 2AE1A 4O6VA 4JROA 1X0XA 4PLCA 4Q9NA 3P19A 1DC6A 1KEWA 5JAIA 5FWNA 1JWBB 3U4IA 1C0KA 5GZ6A 2J3KA 4OGWA 5JW6A 2WE8A 4PVCA 1Y6JA 3RBZA 1F12A 3H9JA 3Q0EA 3SVTA 4RLSA 3DZFA 1LUAA 4UUPA 1CQJA 2X7HA 1P1KA 1UP6A 3K31A 1SMKA 2FSVA 2NUAA 3GY0A 3JYNA 4RV9A 4BO3A 4F46A 5COAA 2VHWA 1LDYA 2D0IA 4CR8A 2C82A 1ISGA 5JMPA 5KJ1A 2VT2A 1O8CA 1IZ9A 3CE6A 1WLYA 2YY7A 2VRBA 1FJHA 1J5PA 2BELA 3MZ0A 1T2EA 4DPMA 3WMXA 4P8RA 1DRWA 2RBEA 5JSFA 4NU5A 1BVRA 1PJQA 2AW5A 3JSAA 1G6KA 3O8QB 2GPTA 1V3TA 5GY7A 1U3UA 3ZWAA 1I30A 2PKRA 2VWHA 4M1QA 2P91A 3ANLA 1DIAA 3PQEA 1ZVMA 3NDJA 5G0WA 3WICA 3W4JA 5HTOA 4LGVA 3WNVA 4D79A 3HHPA 3WS7A 3S55A 1CEQA 2R00A 3Q9NA 3WB9A 4ALIA 4Z9YA 3NGLA 3ITKA 4DVJA 2B83A 5KJFA 3I83A 3JQFC 4YAKA 4R3NA 3G0OA 4TRNA 2CVOA 1R4NB 1DC5A 1EDZA 2AEJA 4MVJI 4PLWA 4GI2A 4YRAA 1PX0A 3T4EA 5BNFA 2EW2A 4R68A 4R51A 4W4TA 3LYLA 2PH3A 3G49A 1I3KA 1PL8A 1Y5RA 2JCVA 1I3NA 3AM4A 3H6KA 3DBVO 4CLEA 1NVMB 1ZW1A 2W2LD 4J3FA 3INRA 2JJYA 1K6IA 4GL4A 2DKNA 4XYEA 5ILGA 1QYXA 3ZWXA 4XGIA 4PLYA 4PN3A 4R16A 4K9DA 2BD0A 3HADA 4YTEA 1ULUA 3DQPA 2HMTA 5IDYA 1P9LA 4YJGB 4YJDA 3A14A 3JTMA 4CMAA 2ZYDA 3AK4A 3TZHA 2H63A 3F4LA 3I9LA 2X1HA 4IPTA 1GY8A 3JCZA 2W2LA 4MKRA 3GMSA 4NQZA 4BNYA 1RWBA 1ZBQA 3VPGA 3D7LA 2IZ0A 4BMVA 1T1RA 1VL8A 2ZB4A 4GMGA 4BNUA 1QV6A 3JQ8B 3K8ZA 3QVTA 4LK3A 1PJ2A 1ORRA 3GGOA 4NJOA 1Y1PA 5EN4A 1E77A 1PGJA 3ONEA 4OKIA 3S2EA 5A04A 1YXMA 4BO7A 3E5MA 1YH3A 2JL1A 3LC1O 1YDEA 3OQ6A 1PSDA 4GBJA 3ZWPA 1YL5A 1T1SA 1BXZA 4E5NA 1E1NA 1X7GA 1ZCJA 4K26A 3T7EA 5A02A 2DBRA 4KDFA 2J3JA 3AU9A 5ILOA 4JXKA 3NT4A 2PNFA 4PCVA 4HV4A 1YB1A 4Z0TA 3WJAA 3U4HA 1SOWA 5TJ9A 1ML3A 4J2OA 4YPOA 2Z1MA 1DLIA 1YRLA 4BKOA 4BV8A 1QYWA 4FOSA 1DO8A 3RKRA 3RFVA 4B8ZA 1NQ5A 3I4CA 3K73O 3UGKA 3O9ZA 4EW6A 4DREA 4IJKA 5JAZA 1E7YA 1EVIA 3CXRA 3D3WB 3FSRA 3JQ6A 4PIVA 4FQ8A 1IPEA 1WZIA 4PRLA 5BT9A 2UAGA 5F5NA 2GYYA 2X9NA 4F45A 4XCVA 3Q3CA 3VDRA 5TC4A 2ZYGA 1Y9AA 2ZTUA 2B4RO 3DOCA 3JQAB 1WMBA 5DT9A 1WDKA 1VLLA 1GQYA 2QX7A 3LT2A 1GZ6A 3WIDA 4Z0HO 5F1PA 1QRRA 2PZJA 4LSWA 3RUCA 5U1PA 4UVEA 5H82A 5JAMA 1U2DA 4AJJA 1AHHA 1ZUD1 1O94A 4IZIA 5U9CA 1CRWG 2UVDA 3TF5A 4Q3BA 1U4SA 5G0TA 2W90A 1ZK2A 2Y1GA 3F5QA 3WLFA 4DMLA 4OL9A 1ISHA 1GEEA 3OIGA 2CZCA 2C54A 2HK9A 4F6LA 4JIGA 1ID1A 2RHRA 3K92A 1ZXBA 1H6AA 2CMDA 3NT5A 2EP7A 2VZ9A 3QWHA 2ZB7A 4RF5A 2Y67A 4ROSA 2ILTA 1KC3A 3OSUA 4E33A 1BDMA 4YRBA 4NJMA 3TJRA 2FR0A 5I7SA 3ITDA 2AQ8A 4W6ZA 4PLFA 1A72A 2P5YA 1KY4A 4QUKA 5FI5A 1YKFA 4DBZA 2HO5A 4RVUA 3UW3A 1EBFA 4PFJA 3VVBA 3OP4A 4LISA 3PHIA 4XDYA 3ZWNA 3SJUA 3GFGA 5DP2A 5AXCA 3ZWMA 7ADHA 5B1YA 2WYUA 4G81A 2PR2A 2H9IA 3H3JA 3IL2A 4UVGA 2CDAA 2DFDA 4N54A 4NFSA 4D41A 4LSMA 2GRAA 5I8WA 1BDBA 3CZRA 4ZQHA 3EYWA 1VSVA 1R0LA 3BMNA 4KQXA 4DC1A 1ENPA 1I5RA 4U8GA 1YBVA 4LW8A 4CM1A 5CG2A 1ZJYA 3ZHYA 3OJOA 3GAFA 4L75A 3H5NA 5AQ1A 3PLRA 2NV6A 1ZO8A 5CDYA 5DP1A 1BG6A 5KIAA 4IDEA 4YR9A 4DA9A 1YQGA 1W8DA 5JCXA 4BL5A 3I5MA 1NWCA 1Z6ZA 3H65A 3AOGA 4NR0A 4BNNA 3IP3A 3OJ0A 1NM5A 5JXWA 2BF7A 2PWZA 3I6QA 1MP0A 1U4OA 4M55A 4JBHA 4KMSA 3KYDA 1AHIA 1LRKA 2X8LA 5BSGA 3ZWYA 4BV9A 4GWGA 1CETA 5JMWA 1QLHA 3EDMA 3WYCA 4BNGA 4PLGA 1GADO 9LDBA 2EIHA 1XGKA 1D1SA 2EEZA 2IXAA 1IB6A 3BMCA 5K6AA 3NDIA 2ZJ1A 5H83A 3RBVA 1E3IA 1EFKA 4E0BA 3PDUA 1CDOA 2Q3EA 1GEGA 1WDMA 2ZATA 3DOOA 1UP4A 4M49A 4BO8A 4NMHA 4ZICA 3DAFA 2EJWA 4FC7A 1GYPA 4N7RA 1EUDA 4I5GA 1Z73A 4Q39A 1GCUA 5T8KC 5BSHA 1ZNQO 2IZ1A 4JP3A 2NLOA 5DCYA 3KRTA 4U6SA 1NTOA 1ZK3A 1E3LA 5L3ZA 1R12A 2IEDA 3GQVA 1PIWA 1SO8A 3HDJA 1LDGA 3DMTA 3Q9UA 2WE7A 1AE1A 1NPYA 4I08A 3I9JA 4NBRA 4XR4A 2HMWA 3ZH2A 5KVVA 4JX8A 2NU7A 3TZQA 1T2DA 3A1NA 5IJZA 4CQMA 4CLRB 1UAGA 1NR1A 3MJSA 4BNHA 1M2WA 3CKYA 5I8ZA 3GOHA 1I8TA 2XOXA 3PYMA 1QYDA 1PWXA 2TMDA 4ZRNA 3UFXA 1P0FA 1B3RA 3SC6A 4AG3A 4CM9D 2YV3A 1CQIA 4OQYA 1WVGA 4N18A 1ENYA 4XDZA 1AXGA 1QXSA 3NKLA 1CERA 1NR7A 2ZTLA 3EY4A 4MVJG 1H9BA 2BFMA 2OL4A 2PLAA 4I8XA 1CJCA 2P4HX 3E8XA 4RF2A 4YCAA 1DC3A 1GYQA 1V8BA 4IMPA 4H15A 3G1TA 1F8GA 3OH8A 5LDGA 3D4NA 5JYDA 2C2YA 4CM9A 4FS3A 4YAJA 4AJNA 3GVPA 1GPDG 1R0KA 3WSVA 1E3JA 1RM3A 2WDZA 3W1VA 1PZFA 3ROMA 5B4UA 2NNLD 3WOHA 2O3QA 4TMFA 3EK2A 1H6CA 3BA1A 3S8MA 2Q45A 4HXYA 1F0YA 2E49A 5F3RA 4CLOB 2V7PA 1P0CA 2WTBA 5TIIA 1C0IA 5JDCA 5TX7A 4DYVA 3K5PA 3DBRA 2BH9A 1U8FO 4JLWA 3JQ9A 4Q3AA 4AL4A 2YYYA 5HA5A 1XG5A 3ORFA 5I7VA 1TVEA 3OJFA 1QP8A 1BHSA 2Y68A 4TSKA 1B8VA 1HDZA 1IULA 1KVUA 1KVTA 1M6HA 1XLTA 3NX4A 4LCEA 4CV3A 5JY1A 3P7MA 3A9WA 4CL3A 3QWAA 1JWAB 3ZWVA 2O48X 3CH6A 4TKMA 5K6AC 5FYDA 3X2FA 4FJ2A 4AICA 1E1KA 4FIZA 4L74A 2NVUB 4ALKA 1BRMA 2XXBA 3IKVA 4YAGA 2AMFA 2BRUA 4CMGA 2C20A 2O3TA 4R1NA 3SC4A 1MGOA 1HSZA 4CLHA 5JPIA 1EVZA 1VL0A 4IIUA 3MJTA 2ZK7A 3Q1LA 4QO7A 4A10A 3GZNA 3E82A 3H8VA 3QRWA 1SC6A 3RUHA 4GX2A 2JHFA 3S1LA 4YBZA 4YT4A 3JQDA 5F5LA 1NP3A 4HNGA 4NBTA 1DLJA 4K28A 2EXXA 1CYDA 3HDYA 4UVIA 1IYZA 3V8BA 1TI7A 3TL3A 2RH8A 1EVYA 1I33A 2PTGA 2IYPA 4QEDA 4DRYA 1TT7A 3PWZA 3LC2O 3OEYA 4M86A 5T64A 4DLAA 3EC7A 1BXGA 3FTPA 1GYRA 5IXYA 2NSDA 4R5HA 1X1TA 3FNFA 5K9ZA 1O95A 3NTOA 3LT0A 3TSCA 3UUWA 4J1QA 1ONOA 2PH5A 1R0SA 4QTZA 3U62A 4DPKA 1N9GB 4TVOA 1I0ZA 4WNCA 3KEQA 1DJNA 2NVBA 3OBBA 5JO0A 2FN7A 4JNKA 3WG9A 4IQ8A 1F8FA 1LA2A 3DO5A 5DBIA 4KP7A 3ASUA 2FPIA 2ZCUA 2P68A 4PRKA 1UDBA 2O23A 3ZV4A 1D1TA 5L40A 1JW9B 3DB2A 1QKIA 4GKBA 4TWRA 2I65A 1PGNA 2CUKA 4J1TA 3UAGA 2XPCA 3RIHA 4E31A 3Q11A 3VPFA 3H3FA 5DCWA 4L0QA 4AJOA 4J4HA 4E2XA 3WBFA 2HK8A 1B8PA 4CPDA 1EVJA 1NPTO 1UXKA 4JCOA 3QP9A 1V3VA 3W6ZA 4L76A 2X9VA 5COBA 1HWYA 2PKQO 4JN6B 3INGA 4MIOA 4TKLA 4BNXA 5TF4A 5TNXA 4AFNA 1T25A 5BNIA 1M6WA 1U7HA 1A9YA 3UF0A 4UVDA 2DQ4A 1C3VA 1Z82A 1LDBA 2W98A 1QYCA 5JDCC 1DXYA 4HUJA 4IZHA 3F46A 2VWGA 3JQ9C 3ETGA 3ON5A 4CMJA 3PXXA 3GLQA 4WCDA 4XQGA 3FN4A 1ZEJA 3GNQA 3INTA 1IHXA 1N5DA 1H5QA 1T2FA 2NU9A 4EITA 1ONNA 3E5RA 4TZTA 1LSUA 2W2KB 3IUPA 4W99A 5C7LO 1MB4A 5A3VA 3IKTA 4ZQGA 4GVXA 5JY6A 1JTVA 4IDFA 2NQ8A 1YS4A 5DOZA 2EHDA 1JVBA 1T2AA 4EI2A 2Y1OA 4GX0A 1BGVA 2AE2A 4XD2A 3I6IA 4NIMA 2CF5A 4OIMA 1C0PA 4M54A 1SAYA 2NVWA 1PL6A 2JAPA 3L77A 3C1OA 3H9EO 4LMRA 3FNEA 4E4YA 3OM9A 2I99A 5DCUA 3VZPA 5CDUA 2X0NA 2NTNA 2OP1A 3HDHA 4HKTA 3DXFA 1PS9A 1FXSA 2X6TA 1EZ4A 3K6JA 1NQOA 4CODB 2GSDA 4ZQFA 1FDTA 3IQDB 1BWSA 1E3WB 1T4BA 3PP8A 1UXJA 3JQFA 4E5MA 4RVFA 4RLHA 3KETA 2WMDA 3OMLA 4LRTB 4R01A 2JHGA 4JJGA 2BFOA 2YHIA 4Y98A 3ANNA 1B0AA 4RPJA 1RM4A 1HXHA 1V3UA 4PZCA 4RZHA 5EPOA 4YQZA 1ADFA 4K6FA 3H2SA 1KEVA 3RASA 4C4OA 4IJWA 1RJWA 1UDCA 1U1IA 3PQFA 4XQEA 4RDHA 4XJSA 1R37A 4FFRA 5A06A 3OQBA 4IQ0A 3WNQA 3IOYA 4UREA 1DAPA 5A4DA 4R9SA 2PZMA 4G2NA 4YAIA 3NAQA 1ZSNA 4WEOA 2V65A 3TFOA 5TT0A 4Z9XA 1X13A 4A26A 2CDBA 4BNFA 1ISIA 3ZV5A 2DU8A 3ETEA 5CP8A 4CM5A 2G76A 4FFMA 3F47A 3RC2A 3GC6A 4BO6A 2BHLA 4JGBA 3HN2A 4G5HA 5JLAA 3O4RA 3IUSA 3I9MA 1XR3A 4Y8VA 4HADA 3OEWA 5G0UA 3PYLA 4BKUA 5ENVA 1GDHA 4WEQA 1HL3A 4B4WA 3TZKA 4R1UA 4KWHA 2IYOA 4BHTA 1PR3A 4JP2A 2HMVA 3MJCA 2J6IA 4CR7A 2EG9A 3N74A 1R16A 4CM4B 4D42A 1IZ0A 3U49A 2VYND 3DBLA 1C1DA 5G4LA 4YA6A 4DL9A 4JBGA 4QQRA 5JS6A 3I3OA 1ISFA 2WM3A 4GH5A 5HBRA 4GSLA 1RKXA 2ZTMA 1JN0A 3OHSX 4FW8A 4WLVA 1ENOA 1HETA 3JQ7A 5IAAA 3HFSA 2V6MA 3BYZA 2HMUA 2NTVA 3BHJA 4IINA 3AI3A 3FRJA 2YJZA 3GT0A 3BTSA 1H93A 2P9CA 2VYNA 3R3JA 1ARZA 4I9UA 3KYDB 1DDOA 4ZRMA 4CL8A 2OFPA 5G2OA 2HMSA 1ZSVA 3PGXA 4QO8A 3OA2A 2I66A 1NQAO 4CV1A 2P9GA 3GGPA 2VZ0A 5C3MA 1HDRA 1RM0A 3Q2KA 3WQSB 3BMCB 1HRDA 3QVOA 3PFFA 4OKNA 3AI2A 2I6TA 1QLJA 3BMOB 4QXMA 1D8AA 1OOEA 4BO2A 3HSKA 2EWMA 1M67A 4YYZA 3VPSA 4WUVA 3D5TA 3SBOA 4YT2A 4TRRA 3TDKA 4OH1A 2OO5A 2VYVD 4R54A 3L4SO 3NGXA 1PZGA 2WEKA 4E5PA 3TQHA 3ZV6A 3JYQA 5A5FA 3MEQA 4IGFA 4BKQA 1S7CA 3GN1A 3WGOA 1OMOA 1MC5A 4WNIA 3KO8A 5JFOA 2JD0A 2QQ5A 5THQA 1TLTA 4KTVE 3C8MA 4IDAA 1R15A 4II3A 1ZZEA 1NPDA 2NU6A 3A28A 1I36A 2Z5LA 2VYVA 4CQMB 2VN8A 4TZKA 1A5ZA 2Q49A 3ZWBA 4BO0A 4GX5A 1VJ0A 5T67A 1MUUA 3E9QA 2WJPA 4BUCA 3S2GA 3VPHA 2QHXA 2VNSA 3TL2A 2Y0CA 4KUHA 1C1XB 1Z7BA 2EF1A 5DDIP 4ZVVA 1CIVA 2I9PA 3I9OA 3ZWCA 1F14A 4XRRA 4J2HA 3E1KA 4YJHA 3HG7A 5AOVA 1KVQA 2Y99A 4B4VA 1ADGA 3QE3A 3RCBA 4Y6PA 4OXYA 4E12A 4AJ2A 2B36A 2VZ8A 4F6CA 4M89A 3F1KA 3H9QA 4E21A 2JD1A 1VPDA 4MO2A 1OC4A 4B3IA 1VSUA 1MFZA 5IN4A 2QYSA 4XX0A 1P1JA 3DZGA 3MWDB 1T26A 3CMCO 3PFWO 5F1OA 3W4KA 3KYCB 4II2A 4ZA2A 4EGFA 3TN7A 2BFPA 3WDSA 2F00A 1P1HA 4AJLA 4EZBA 4AJPA 5LCXA 2NTJA 1P3DA 3GUCA 3OF2A 1ONPA 4RF4A 4HP8A 4NBVA 3NV9A 3LT4A 2IEBA 1ADBA 3WX0A 3D1LA 3RU9A 4DIBA 3RJ9A 3JD0A 3V1YA 1ISMA 4IY1A 4DPLA 4PVDA 1H2BA 3DBHA 3WQQA 4WLFA 3RUAA 4BO1A 4R41A 3M1AA 1YJQA 2Y0EA 2PD4A 5IF3A 2QZZA 1P1FA 3CPSA 6ADHA 3DBRB 3AOEA 4UEJA 3V5NA 2NADA 3R3SA 4RPGA 4U0KA 3HB4X 4J4TA 3WR5A 1U5AA 1AXEA 1NVTA 1UJMA 4I1IA 5IZ4A 3D5QA 4P4LA 2YV1A 5AXBA 1CWUA 2EERA 3VTFA 3QA9A 3QWIA 5FF9A 2DTXA 1X15A 4NHEA 4ALLA 2GDZA 4YJFB 3PGJA 5JC1A 4XJTA 4NBWA 4MVJD 1MLDA 1SPXA 3I4FA 1NFRA 3PQDA 3VHRA 5CAEA 3RFXA 2VTDA 1R4MB 2E37A 1EDOA 1PJLA 4ID9A 1GZ4A 4CQLA 1UP7A 4Z3DA 4WLNA 1KIFA 3EGOA 5TRTA 1HDGO 4ITUA 3U4DA 3RAJA 2PGLA 5U4QA 1PGOA 1XSEA 4RVHA 1E3EA 4MVJA 1U9JA 1FDUA 1B14A 1B8UA 3GFBA 3EW7A 3KYBA 1HYHA 5T8KA 1WWKA 2BKAA 3E48A
chains in the Genus database with same CATH superfamily
1QRUA 3W8EA 3LTNC 1FNBA 4OB8A 4D99A 5BVHB 4L85A 1I2CA 3HMKA 4BTEA 4HNHA 4DXHA 4UXHA 2ASVA 5B3JA 1AS2A 4OG2A 4UJ3A 4RHUA 1H3NA 3WWZA 4ZU1X 5IM4A 3ICCA 3KU4A 3K94A 4A6PA 2ZUSA 5ITWA 4FE4A 2DFNA 3FLMA 2Q1SA 2X58A 2SKDA 4D0RA 1EE2A 2QTFA 2QR5A 4Q1AA 1IPHA 1GPUA 3NEYA 4HNAA 4Q5IA 1V43A 2QTVB 2I22A 3QXXA 4EA6A 5KWEA 2AB0A 3JY6A 5HE8A 3WJ1A 2JGJA 2WG2A 3HACA 4QRHA 2GN0A 3O8OA 4OLAA 4L51A 5A9SA 1XRMA 3LLVA 3UAYA 2QRHA 1I01A 3QIVA 3W9SA 5EJ5A 2JBAB 2D59A 2K2QB 3PXGA 1X86B 4OD0A 3DOUA 4MR8B 4MS4A 1EDDA 1RCUA 4YXFA 2XJ9A 3ADOA 3ASYA 3LG2A 1F0NA 1K2VN 1VG1A 5J5CA 3ZHRA 5BR1A 1C4OA 5KVCA 2YVAA 3OJXA 3WHPA 1WUHS 2A30A 5B1EA 5DNUA 3NB0A 3FWNA 2CNDA 3H8WA 3KTDA 2GN6A 4J0QA 1F3OA 2NACA 2EAUA 2DZDA 4WJZA 4LWPA 4Z6KA 3DVAB 3I4LA 2IUUA 4R9VA 1Y8QA 1Q77A 1L5RA 2OUIA 4XSVA 3FMPB 4MIKA 2DMRA 3T0GA 2OBMA 4C3ZA 2NO6A 4CM8B 4EQZA 1OB5A 1PRYA 3K5HA 4RQTA 3H1GA 1GPNA 3L2OB 2YQ4A 4EYOA 4YYEA 2QF7A 4D0NA 3O8DA 3U56A 4LE1A 1CRZA 2Y76A 1AZTA 2MSCB 2Q1XA 2AFRA 2IWRA 1PUXA 3D8TA 1AX9A 2FXIA 3ONNA 2O2DA 3RJ5A 3VR2A 3VVMA 4KFTA 2O1WA 5EJ6A 2Z2XA 4X1IA 5L4NA 2ZE6A 1ZSYA 1N1MA 1U81A 2RBKA 2XBLA 5L53A 3AUUA 4LG1A 1EP9A 4NBLA 1BFKA 2KLHA 2YX1A 3AW9A 4NK5A 3CONA 1ZDMA 1CLUA 2D5IA 2O2IA 3CEMA 2BR3A 4E46A 5FWDA 2NU9B 1AF7A 1UJ5A 4HHEA 2VT3A 1VHLA 4XPIB 3EGWA 5KQMA 3RIEA 2C5EA 2WZCA 4RO0A 3BSSA 2JFZA 4HWPA 1BW9B 1SVLA 2D1RA 3E1SA 1KORA 1Z5OA 3DNFA 1RADA 2D2XA 4HRAA 3Q72A 4R0VA 2H3EA 4WA7A 5AI9A 2OZLB 3O8RA 2JIZA 2QI9F 4JXZA 3P26A 3T0FA 1CDZA 1CUZA 2X76A 5FKJA 1TQDA 4M6WB 621PA 1P1IA 1X92A 1VLQA 1ZH6A 4HNSA 4YLGA 5J4VA 4G0VA 1IN4A 3AV0B 1WY5A 4KOAA 1KSGA 1SEPA 1UMKA 3V4OA 3R9WA 2P6UA 5H70A 1IPFA 1LS1A 4IGIA 1XJQA 5CBPA 1W6UA 4EFMA 5IEBA 4EFDA 3D8RA 1FDSA 1QGDA 1B1CA 2BEUA 1Q0RA 1ZGAA 2AJBA 2FUCA 2PIDA 2ZRQA 1ICEA 3I0NA 3OFND 4KSYA 2BUCA 1GDTA 5CVEA 5HKKD 1VZ2A 2UKDA 3QX8A 4JB2A 3CNEA 4X20B 5AH0A 5C1DA 2QE7A 3T9DA 1KDPA 2E1RA 1AD2A 4EK9A 1IAVA 2YY6A 3RFTA 5ED4A 3PXEA 1DJMA 3MWJA 4TOIA 3PI7A 1KS9A 3A06A 2FR1A 3BTOA 4NXNB 1GNQA 4CKWB 3D7MA 2H11A 1V1RA 1YZGA 2DM6A 1YUMA 4RMJA 5IASA 1HK7A 1QUFA 2SKCA 3QXCA 4KPGA 3WZMA 4F4IA 4O2BB 3MTEA 3SZMA 4AX4A 2FPGB 1EKXA 1L4UA 2ZS7A 1DQSA 4FR5A 4BWFB 4GEGA 1A8IA 2VP3A 4BVHA 4FFLA 2OORA 4LJ6A 4BNIA 3KX2A 3PVZA 2C83A 1IWBB 1TEHA 4NC9A 4D3DA 4ENTA 1FA9A 1B73A 2CDNA 2F3UA 3MC1A 2F8SA 4D6PA 4GPAA 1VCOA 1EE9A 4QYIB 5AO9A 5A9RA 1KEUA 3HU3A 3M1YA 4RV5A 4WOCA 1SPBS 3KFLA 3D81A 4UD2A 5NLLA 1K8XB 3WLRA 1QONA 4GSKA 2H29A 2J6CA 2XB2A 2AQHA 4ZOCA 5F76A 2HHJA 4JFAA 4ZPJA 3O4VA 3K9CA 5FX2A 1TZJA 4UNQA 1E89A 3WNBA 1E4EA 2A0KA 4W82A 4YP7A 3TUZC 1VMKA 1Z7WA 3UCFA 2VJMB 3J81k 4QGAA 1HZZC 2BP7B 4Y0AA 1JEYB 2VJAA 1AK9A 1C1YA 2OD2A 1D2NA 3A05A 3K9QO 4L6CA 2WV9A 2WKRA 4W9NA 4LZZA 5BMVF 2HIAA 2ISQA 4B3BA 2IGTA 4TMKA 3VNSA 1EINA 2O57A 4M9QA 3DCJA 1JLHA 4IL5A 3LKZA 3IDFA 2CFOA 2G04A 2UYYA 4RFLA 3M1IA 1K3TA 3EF3A 1OWOA 2Q2WA 3L4BC 1FX1A 1PWHA 3DW3X 4LYHA 3LQ2A 3QLJA 2WKWA 2ODWA 4IM7A 1KZGB 1N78A 2O8BB 2MYNA 2V6FA 3L0DA 4AXBA 3MMXA 2Q4OA 3MSCA 3HLKA 4BO4A 4HK4A 5PGMA 2QP4A 1KEEB 2XOKA 4HEHA 1KO1A 4D8YA 3SEFA 3K05A 3WV4A 2XRZA 1QQAA 2EHJA 2D1YA 4R7ZA 4YGYA 1LLUA 5F2NA 5J1SB 3SYLA 5BV1A 4UQLA 2X42A 1GPMA 3AF3A 3P0RA 4GYKA 4J7XA 3OLQA 1NATA 2E5LB 1JHRA 3AFGA 3S5JA 3KHSA 1JIIA 3U1VA 2H4ZA 1QAQA 2BHRA 3C15C 3HVHA 3SZOA 1DAKA 3RWBA 3GVHA 3VVCA 2YXBA 1XKTA 3GNTA 4P34A 1AUQA 2ERYA 2X4DA 1GV1A 2LCIA 4J0GA 4M76B 1FDOA 3RC9A 2R96A 1Z17A 3KQVA 1F51E 2P7IA 3ZDXB 1EK0A 2VDNB 4FQ5A 4DLBA 4ERNA 3A6EA 3N6VA 5EIBD 3AONB 2H1FA 3H1EA 3EDYA 1UOQA 4WINA 3I45A 2WF8A 2PUBA 1KPGA 3FKJA 5LXTF 5JD6A 4GGPA 4RF3A 3RABA 2QG6A 4LMBA 3R4VA 4A2CA 4YUAA 3VR5H 2C4MA 2A1UB 1SWWA 1XTBA 1QV9A 2VCYA 3KUKA 1Z0KA 3D4PA 5JEEA 4MW7A 3EZNA 2ODTX 2F3TA 2AQKA 2QYHA 3RRBA 3G7UA 2YMQA 1OVGA 2HCJB 4IHJF 3UN1A 5HWSA 1E9DA 1RZRA 4MQ4A 1JHDA 2PGNA 4P86A 4PFQA 2BKLA 1JLKA 3D64A 4OOFA 3JQAA 1E7MA 2A9JA 4PLVA 1N4AA 4DDVA 2GVZC 1GFIA 4OHKA 4RTMA 3AHCA 2UZ3A 3K0AA 4WA8A 3SPXA 5BSEA 1DBPA 3DAPA 3JSXA 2G25A 2WLSA 2XXJA 3COSA 1TPZA 4RKRA 1JEOA 2YDYA 4YVFA 5K5EA 1MCZA 1GU0A 1A71A 4YMTA 2LCQA 5KBYA 3OE1A 2XKJE 4UE3S 1AKRA 2FFBA 4JJIA 3EOZA 3IA2A 3H5OA 3KBOA 1EBUA 5J4HA 3ZEIA 1U3TA 4PCUA 2UZ0A 1ZC4A 3CZCA 2VEDA 2QY6A 1I51A 2DVMA 3H6GA 3UATA 4DC0A 1CNFA 2ADFA 4KR3A 4XCQA 4QPDA 2IS6A 3I3SR 2QVBA 4H1VA 5HCIA 1EB9A 3FPAA 4RABA 3DT9A 3CNOA 1KVRA 1ID8A 2I4OA 1N2EA 3SCZA 1NKTA 3DGFC 4MROA 2JCSA 1LBTA 1SG9A 4PRYA 1E64A 2PNJA 3VAAA 4BKPA 4U63A 1ORHA 3D2LA 1J9GA 1ADCA 1JXAA 1U3FA 5EFOA 1PS8A 1VIMA 3GUYA 1AURA 4TL6A 5JNTA 4UHEA 1U3DA 1VI5A 2OYCA 4KPFC 4PGGA 1KDVA 3BMQA 1DUIA 1UJ6A 5K20A 1G5RA 3K6KA 4WOJA 1FDVA 3JD4A 1JEQB 5EJIA 4YJ2F 3U61B 4Z9AA 1ADYA 1PL7A 3AM3A 1TK2A 3ESCA 4IIDA 3B89A 2GHTA 5J4KA 1VQ1A 5HOQA 3MG9A 1PHRA 2B98A 1SB9A 4EG0A 3DCYA 3QEOA 5C7IO 5KPJA 2PHZA 1S9HA 1MO3A 1R9MA 1Z6TA 2Z4TA 1G7TA 3IQEA 4P4NA 3VAZA 1BMDA 1R0YA 1U3GA 5B6JA 2C7PA 4KR7A 3ITNA 2YHSA 2JC3A 1CE8A 1MXFA 1WW2A 3FIJA 3KZVA 4KV9A 5DSTA 1SC1A 1UBFA 5EESA 2ZOSA 1P31A 1QG4A 1ZWKA 2FFAA 1ZOOA 3A6DA 4YAEA 4B6OA 1COWA 1K97A 3TQFA 1Y7HA 2C59A 5L4SA 4P3NA 4OXRA 4L72A 4E2WA 1FNCA 2I7TA 3TTUA 4LQCA 4QTXA 1KE2A 3HVUA 1P4JA 1E63A 2PL9A 1LZLA 3NU1A 5I8PA 3PICA 3ZU4A 2XF2A 4BC1A 2HBZA 1ORWA 3E53A 5EJ4A 3A9VA 1H3EA 3K35A 2AZXA 2P65A 1PDWA 3M34A 3VZDA 3KJHA 1J8YF 1Q1GA 1U8AA 2OKCA 4DBLC 2F90A 1K08A 5K8LA 1YDHA 1U8EA 3FYHA 3LCRA 4DCGA 2OCXA 3OPQA 2ZQYA 4RDCA 2B8EA 3BCSA 1R6AA 1E9VA 4YDRA 5CB4B 4UARA 4QPJC 4RACA 1PJ3A 4TT3A 5CIQA 5FCDA 4BJ6A 3HNOA 3PGKA 4J16A 4ZVUA 2HUPA 2O1EA 1UBTS 2AVNA 2P41A 5EXDA 1L4MA 2JLQA 2FSSA 5JHGB 2GEFA 2C7BA 2FN9A 3A2MA 3K0SA 2ZI3A 3BB1A 4IGEA 4DCJA 5KINB 2PY6A 4E6PA 2WF6A 3UFBA 3A11A 3FBTA 2XYHA 5TQ2B 3AUTA 1GTL1 2RH4A 3WMRA 1FP4B 2GASA 2JGKA 4H3HB 3D9QX 4GZLA 1E1RA 3H16A 1HKUA 4G07A 3KQMA 4MWOA 5ENZA 2X2PA 3M6IA 3WNCA 1R64A 2YUTA 2HIMA 4KUEA 3CLTD 4RSRA 4DCNA 1OR8A 4J29A 4RD1A 4LAFA 3RVRA 2WUEA 4RQUA 4G0YA 1YS6A 3VR6H 1IZYA 5FAXA 1ZUHA 5BRNA 2QTTA 1VP3A 4TSRA 3VAYA 5MN6A 5LD2B 3B85A 3A9UA 5CNKA 4IZOA 4UEOA 3ZC3A 2AG5A 1MOPA 3N2KB 3FPCA 4WESA 2QZPA 4PZAA 3ZXUB 5A4FS 5IM4F 2HFJA 2WSYB 4GC9A 4GU5A 4D9BA 2B92A 3BIFA 3NPMA 4C20A 1CIPA 5KYWA 1C3LA 3DE5X 3PFCA 1MIOB 3AI1A 1QF7A 1UZMA 4FE3A 5P8WA 2JGAA 3LUPA 4UASA 3DNMA 3DV0A 4JJ8A 1GRNA 2RAFA 4WBSA 3ROTA 2PXCA 2ZAOA 3RGGA 4TWZA 1J49A 4BECA 1XJWA 3BL5A 1F06A 4JVNA 4DZTA 1EE1A 1YIOA 2GD0A 2YMLA 1P7VA 4KBFA 4N5LA 5DNVA 5ENDA 4YPFA 3O5AA 2A5YB 5REQB 2I4IA 1X14A 3CJTA 5DBFA 2W93A 3ZCVA 1SEVA 2M6KA 3DFMA 4HQRA 3JVEA 3H2ZA 3ZCRA 3HY3A 2LDBA 3HB7A 4X90A 2WPNA 1QTQA 5CXUA 2ZFUA 3OCYA 2WJWA 3BXFA 4AZVA 4EAAA 2YWJA 3RGWS 3TS1A 3TD2A 1S8OA 1Y7TA 3RS2A 2QRLA 4BMDA 3RQIA 3ZZMA 4QM6A 3O3NB 1IIBA 1XTJA 3GFRA 1SR8A 1SQ0A 1OBOA 2G0NA 1REQB 3LL4A 4FFPA 4MUFA 3GMDA 4XQ9A 4ASUA 2IX9A 4RVGA 2NWQA 1TKRA 2F62A 3CNLA 2H7VA 2PWBA 2HV9A 3RHSA 3UY4A 1OZAA 5AXDA 2ONJA 1H4SA 2PRKA 3QW2A 4BYGA 4DWJA 4ZN6A 3TECE 3NHFA 1WX1A 2VJDA 2POQX 4AC9A 4COKA 1ECFA 1K7EB 4P4TA 2DUJA 4I3GA 2R8YA 1WCIA 3IMFA 2FLWA 4QQ8A 1BRTA 4P2GA 2RGUA 1P4SA 3T4XA 1U28A 1XQ6A 4CTMA 1NOKA 2C42A 3GU3A 5JT1A 1QP7A 4XR9A 3ZQ4A 5CLQA 4DF3A 4Q6BA 3RUFA 5CLJA 1JJ7A 2AN3A 2XAUA 4FMDB 3QEAZ 3GJRA 2AI3A 3CRMA 4LDPA 2FG7C 1KL7A 4RTJA 4M8IA 3T95A 4RIHA 3A4VA 4Y6SA 3E7FA 3SP1A 3SYKA 3PHHA 4D9EA 1GR1A 4JZKA 3NH6A 3SAJA 4IXTA 2IOQA 1Y8AA 2R2GA 3H1BA 1T1GA 2EDCA 2ZCVA 3MVEA 1W88B 3RBXA 4R2HA 2PWAA 4QD3A 3D8NA 1XZMA 1P75A 3PDIB 3TRIA 5K45A 4ZJPA 2DHRA 5KYNA 1N5OX 1GUFA 2ZI6A 4M9XA 4HGYA 3Q6NA 5L95A 2ZM6B 1H0KA 4ZMBA 1C0LA 3RW9A 4UM5A 4B7ZA 3IJ5A 1I2ZA 4JDUA 4CIXA 3G89A 3JWPA 5DBOA 3R0IA 4POAA 1GTZA 3TL6A 4BDTA 2XWQA 1Q7BA 2AC7A 4QFDA 2OFXA 1YS9A 2Q2QA 3A1CA 3R0QA 4J9UE 1SCJA 1D5CA 3FKSA 3CVOA 1P33A 3PNYA 2CT8A 1J0XO 4BAUA 4D97A 4EA7A 4NY1A 4RAOA 5JHHB 4L9AA 4R6XA 4R71A 3R5SA 1P1RA 5C51B 1MH9A 3FMGA 1E1QD 3AR8A 1K6MA 1O5IA 3FCXA 4HB3A 1MX1A 4HPXB 3E84A 5IN5A 1UFQA 2C4KA 4NPCA 2PA0A 1HLDA 3AKYA 3H99A 1DIOB 3SZUA 4ZJUA 3PFBA 3CSSA 2K7FA 4YDQA 1YIDA 3EVNA 2OAQ1 2HEGA 1KEZA 4HDQB 2QZJA 1E2BA 3QXSA 1M2JA 5KJ6A 5KSWB 3D54D 1O77A 4DQVA 3R5XA 1U9IA 3ICQB 1R2QA 2RKWA 3NWPA 4LYYA 4BO9A 1LDMA 2HWUA 1Z25A 4OK6A 4XYGA 2QVCA 1RKQA 1IZZA 1ECLA 1SXPA 4H7FA 4HH0A 2O7QA 1PDOA 1WXWA 2P1DA 1L1QA 3E0XA 3KHTA 4FN4A 4IDCA 4MUIA 2G67A 4P22A 2AXPA 1EDBA 4ZCQA 3SJAA 4DEVA 4E3ZA 3GLIB 2QIPA 4NVRA 3GGGA 3NANA 2QN8A 4RQBA 3B5JA 1TJ3A 4PPFA 3C3WA 3QHQA 3M5PA 2HSGA 2MR5A 3G02A 1OC2A 3I6BA 1OUMA 4L95C 2ZWOA 5CHEA 4YT8A 1V6SA 2W0MA 3OPXA 1JQDA 4Z4IA 1NNUA 4PYKA 4Q34A 4C89A 2R60A 4I3FA 5I3ZA 3T3MB 1RVV1 2Y27A 3PR2B 1G16A 1KYYA 3VO1A 4U4AA 1NXSA 4PHCA 5JCJA 3ZXIA 8ADHA 4I1YA 2X22A 1QGZA 3IRUA 4HDRA 4RFVA 1ML4A 3DOEA 2FN4A 1YE5A 4FFBA 1JA0A 3AFIA 1LEHA 3AEYA 1L1FA 1IBMB 1QCZA 3PEUA 2Y0DA 4YMSA 4HJRA 3RJTA 1CDDA 5BPFA 4GYYA 5ABPA 2PZFA 3IBYA 1QQ5A 4WNYA 4ZKDA 5E1BA 2IYQA 1PJ8A 5DX8A 2B4TO 1U3WA 2F43A 4HDCA 4X62B 2OO7A 1MQ9A 4HN9A 2FEOA 2RC5A 2VYCA 5EJ9A 4ABTA 1NMZA 1EMDA 3OZ7A 5JDIA 4G0OA 1F2TB 4EMUA 2FZ4A 5T57A 3C98A 3RAEC 5DLDA 4DZZA 2N1BA 2FDXA 1YQDA 3EXHA 1HFKA 3OZBA 5JVDA 2GZ3A 1LSOA 4XAQA 4POOA 2NUTB 2VCEA 3P0JA 4XQ0A 3K1ZA 4J43A 4AF6A 3IMEA 2NO0A 2W48A 2QXYA 4WCFC 1A9QA 5BQFA 3CX4A 3M82A 4QPNA 4E6EA 4L07A 4MV7A 1YVDA 4UZEA 3AR2A 3G5UA 1V8ZA 2VPQA 3SXPA 2Q4EA 1WMSA 2Z6UA 2BM1A 4IUYA 4MCJA 4YDHB 1PLLA 2L19A 2EF0A 4OMFG 2EIXA 2Y1FA 2ZVQX 1GAQA 1VE9A 2PGDA 2ZPAA 3GDGA 4WECA 4B3DA 3PEYA 3BWVA 4ODIA 1NAIA 1RAFA 2CMKA 1A7JA 2QTAA 2Y0PA 3N0XA 1MB0A 3V1NA 5KSOA 1KRWA 4OXQA 3KM0A 4N49A 4ON9A 3ST7A 1GKIA 1YULA 1Z0FA 4FNOA 1U2QA 3FH0A 5CW2A 1AS3A 2ZVJA 4OI2A 2E4AA 2GAAA 4UCWA 4YECA 2ZSHA 3PTZA 1EGAA 1Y1LA 3W8DA 3NM5A 3LK6A 3HTXA 5TQVA 1P1BA 2JKVA 3H5AA 1E7RA 2FHSA 1AOXA 3AR4A 1V1MB 4U5QA 1CEXA 2PSJA 1TUBB 2P6NA 3QW4B 3GLFE 2ZE7A 3QFRA 4BB0A 4Q3CA 1P0IA 2KQUA 4B2LA 1TVCA 3GF4A 1UK9A 2PFKA 2EX4A 1GLGA 3D4OA 1DOHA 4RTQA 5EYPB 1O4VA 5BOSB 2FDCA 1UEXC 1ZMOA 3SMQA 4R7TA 4EY3A 4BNZA 5FWAA 1DHRA 4IIEA 3WFJA 1H0HA 5SZIA 1FSFA 2ZI4A 3DHNA 4JJFA 2RHCA 3K4HA 5ERGB 3UG7A 2A5FA 4MB2A 4O5OA 1BCSA 1N57A 3I12A 4KJXA 3R7LA 4ARAA 2JGFA 5IT5A 5JBNA 4TKZA 3QU9A 1PT7A 2H07A 5ALPA 4OJTA 4CL2A 1U8YA 2VUTA 1YZNA 2CCJA 2DBQA 1UQUA 4QDZA 5HW0A 5B36A 4PHGA 1J09A 3K0CC 2OGUA 2W2VA 1HTWA 5AM0A 7GPBA 3F5SA 3ZE9A 4U7TB 3TGWA 3AESA 3O8LA 5IK2A 2C4VA 1IVSA 3CUVA 3DZJA 13PKA 1BXGB 1OFIA 1ORTA 1LPNA 5AM1A 2CLMB 3SQOA 3WLSA 4I9FA 1J7KA 2ODEA 4G3XA 2ZYAA 4DCMA 3P9SA 4CG1A 1Y8CA 3EZ9A 4IVRA 4K05A 4BEBA 1OH5A 4JOSA 2Q6KA 2QRQA 4DRXB 1GG9A 1EUQA 1XU9A 3WWOA 4CUKA 1O6ZA 5AW7A 4PS1A 1E79D 4TLDA 3ET4A 1B42A 1SU8A 1F8YA 4IS3A 5ALEA 3RI3A 3EJ6A 3SZGA 3ZK9A 4NULA 3ANMA 5K8TA 3AQ4A 3VRHA 3NIGB 4PQFA 4GKAA 2XGOA 3E9ZA 4X66B 5IZCA 1RHUA 2CMFA 1TQHA 4NBSA 1F17A 1RU3A 5FOUA 3B6EA 2IE0A 1B2LA 1UBEA 3JWGA 4CMHA 4QRDA 3H5VA 5E7MA 4LDNA 1PE0A 2FRXA 4MP8A 2GK3A 2AGVA 4G5FA 1EWRA 3P0IA 2VDOB 3VKVA 1FTYA 1LW6E 1AMOA 1B3BA 3W6PA 3L6BA 3GJ0A 2AOWA 2VH2A 2WMYA 3N75A 3NYRA 4G67A 4OA5A 4WDRA 1E5VA 3ZU5A 4R2XA 3TMYA 4I66A 4S1NA 5DTMA 3UMGA 4DANA 3PYXA 3VMMA 4X9XA 3T52A 3CO5A 3FLEA 1E6WA 3IESA 1OBCA 3DC7A 3L46A 5JFTA 2QXUA 2I87A 1EYZA 2GMWA 2PMCA 2ETVA 5TPWB 1YC5A 3C7TA 3L5KA 5BV2P 4Y6LA 1DX9A 2CVZA 2JIPA 1JAIA 2B7LA 3DSRA 1AQIA 1QIJA 5C34B 1H2EA 1HA3A 2QJTA 3PL5A 4EJ0A 2ID7A 3IMCA 3NWJA 4N03A 1CKEA 1I4DD 3K96A 5L4LA 4MRRA 2XTNA 3USZA 1RLMA 1NONA 2NU8A 4TYPA 3SX2A 4FGSA 4PY2A 4HQ0A 1X9HA 4JUDX 4LNUA 3IIIA 3ZCUA 3SQDA 1TFRA 4UBNA 1ISSA 2PDAA 3URMA 2QMUA 5KQGA 4FGZA 4QU8A 4XM0A 4CLDA 2YR0A 3RLIA 4H6VA 4HB4A 1ZGHA 1D6MA 2D0PB 2Z08A 4X1KB 5KYXB 1AMUA 1UBGA 3ABOB 4OQMA 2A0FA 1IU9A 3SJ7A 3JWHA 4RM2A 5J59A 4NEHB 3RFCA 1H2YA 4ZI2A 3OIVA 4BNVA 4C2AA 3ESXA 5F7XA 4RD6A 1KEPA 3IAM1 4FWTA 1II8A 2NW6A 3ENQA 2R8BA 4JI2B 4MR9B 4YQYA 4Q0MA 4MGYR 3KSUA 4PG4A 3IPLA 3ZGYA 3KELA 3E0QA 1YVEI 3GHYA 4QOFA 1TM7E 3O31A 1H2HA 2UVPA 1QCDA 1PQ4A 2GSWA 4HDKA 4I36A 5LNK1 1A9XA 4GO1A 4URWR 1W7AA 4J9VA 1G64A 4COOA 1NUUA 1EI9A 3PUIA 5J1TB 2R2AA 2Z2ZA 1ITZA 4K88A 2O5VA 2Y1CA 1LLFA 5LUBA 3U3XA 1T4CB 1NBOA 2DTDA 2HWYA 5EKDA 2GD2A 4Q3EA 5AW6A 5HGXA 1HT0A 3O84A 3L9XA 1ZHFA 3GPIA 4AMZA 2ZCJA 4YFVA 2I3DA 2CLDX 3C41J 2JFQA 4PCLA 2B1IA 3TVYA 1U2DC 1X87A 5D6NA 1JU4A 5ALSA 4CCWA 3FOFC 3ANTA 3RYHA 3ZIDA 3GPDG 5EJAA 4DV0B 2VA8A 2FQQA 4AZ3B 3WLLA 5K4HA 1IJKA 1E0JA 3IAUA 2G17A 3NEAA 2YHIB 3RRMA 4C5AA 1I24A 5C9ZA 1K6EA 3QVLA 3MW8A 1QPGA 1PHPA 1Z83A 2FPLA 3RV3A 4MH0R 1SOVA 2ZJ5A 2QORA 4RTLA 1IY8A 3EIQA 1ZCAA 4TWBA 1C7ZA 5K2OA 1ZUNB 3NYQA 5B6IA 1TTHA 4OBEA 4QDKA 1RQ7A 5LLSA 2IY9A 4X6LA 3WYBA 4TN5A 2W7TA 2GBLC 4MMZB 1E0DA 2LKCA 1NUTA 1N2IA 4EHIA 2RIPA 4ME6A 3F4KA 3GLHB 4MGEA 1GTJ1 4OUDB 3MQ2A 4I8DA 4U2EA 3WFZA 5KOHB 1OCEA 4DA6A 3QTTA 4RL6A 4KQ6A 1QG6A 3D4LA 4GXTA 5HZHA 2XUGA 4Y9TA 1CK4A 3G8DA 3ZE0B 3JQBA 4F92B 5KNDA 4Z2AA 1VBNA 4IMRA 5CX1B 3M49A 2A14A 2YN4A 1N6NA 2I3AA 2AJLI 1KZHA 3WGYA 4WHMA 2E18A 3QEJA 5B3AA 1FW6A 2BCJQ 5KCMA 5FTWA 1MJHA 1IUPA 1FPMA 1RXUA 3KJGA 4QUIA 1V2HE 2GCEA 1JL3A 3STVA 2VNAA 4P1ZA 3EH1A 3OJEA 1O58A 3PRKE 2O0HA 3S81A 3QFTA 2G4VA 4YP0A 1GFZA 2C31A 2O3RA 5LQUA 1Q0UA 5KDOA 2WT4A 3D3JA 3IPRA 2J5RA 4FCCA 4M60A 3ACDA 1JKMA 1U98A 2I6SA 2RK3A 8LDHA 2XD4A 4A03A 2HA7A 3NKVA 1RXIA 1B0UA 3WYAA 1HE4A 3C7DB 3GJ6A 4UHFA 5I9TA 1WD7A 1Z26A 2XUIA 3S1AB 2WJIA 5JZVA 3P2YA 3D8HA 3LYHA 4HS9A 4RGQA 4AKTA 2VBFA 3PKIA 4MKFA 4AVYA 3W5SA 1DJPA 1C3JA 3K0HA 1KVSA 1G18A 3QQPA 4I4LA 3LLMA 2DRIA 3AY3A 3RYCA 5MN4A 4EUFA 2O8VA 1WD5A 1XEXA 2WKQA 1C7JA 3DDHA 2GPYA 3PEVA 5LB4A 4QGSA 3JQEA 4JI6B 4DM3A 5BN5A 2E21A 3A1VA 3BWDD 2C9BA 4JENA 4MK4A 4QBIA 4R1SA 2DUMA 2W6NA 2W6ID 2OFWA 2Q5QA 1B43A 1WQ4A 3GH3A 4D9JA 4YLYA 1K8QA 2GUGA 3DZBA 4BGUA 3HKCB 1USUA 1WQ3A 1NL3A 4BLOA 2HW8A 5E3JA 4HB0A 1Q84A 4I1VA 4JWKA 1FXWA 1GG2A 1HYBA 4GE0A 4TMVA 5H16A 3UIEA 4LFBB 3NUQA 4KXWA 2A5JA 1U5CA 1ZW6A 5T4EA 4PZEA 1L4NA 1T9GS 1KY5A 2MMCA 1S01A 1OH6A 4QL3A 5HRUA 3PDHA 3CZ5A 3FPBA 2F59A 4V0MA 3PXDA 1M7HA 1GU1A 5K4AA 1FYWA 4UC0A 4RFSA 5F52A 1DXQA 1LC0A 3TTSA 1O6GA 4HAXA 1DEHA 2PD3A 3L1JA 5TARA 2FWMX 4C4AA 3UAVA 1W0JD 3MB8A 3CURA 4GR5A 4X71A 2XDYA 3VPCA 2J0EA 4EHDA 2PUDA 3S8EA 5B64A 2X14A 3IS3A 3KPYA 3L6OO 3RD5A 3TZEA 3RT1A 3TXAA 1AGPA 5DLEA 4KZPA 4F3YA 4F60A 1R4MA 3D0KA 4DR4B 1VJGA 2H6EA 3ENVA 1EB8A 2JGRA 5GOTA 4BS9A 2CFIA 1J8VA 3G2NA 4FP9A 1XU7A 3OIFA 4K9LA 3P4UA 4DTIA 5DISB 2W43A 1HE5A 2J9FB 4WXRA 5B7GA 2FW8A 3THYA 5LYJA 4IJQA 4J3JA 2CKMA 3UAZA 4QQFA 3OQNA 2QL9A 3COPA 4C7KA 4I9HA 5L6LB 1CUVA 2NQ2C 2ZSUA 1YCFA 3O94A 4Q16A 2QRKA 3W3AD 5CVCA 5DX1A 3STXA 2XMBA 3CR8A 4TTAA 3RVJA 2NAPA 4KXLA 3NRCA 2IV3A 3COJA 1JEDA 2HEIA 4BB9A 5B12A 5LZ9A 4G65A 2E4YA 3F3SA 2IYEA 4M8SA 2W2PA 4MS3A 5SZKB 4X00A 5LQMA 3B1KA 1VHTA 2X4LA 2CHFA 3GJXC 3FTNA 3JZAA 4BUZA 5CVTA 2FOLA 5JS8A 2YV4A 1Y4ZA 3TGLA 1VHWA 4G8BA 4MGZR 4TMZA 3T3OA 3GG9A 3VDMA 3TSAA 5KTRA 4KI7A 4IMJB 1STOA 1NW7A 3DFIA 4OHFA 4YJHB 4P7FA 4KITB 2EL7A 3EIEA 1L7RA 5BYJA 2P5SA 1TUEA 2EU8A 1SU7A 3DAGA 1Z2PX 1H8HA 2I62A 4CL0A 4OYRA 4KRYA 2GOYA 1A3CA 1GNRA 1BEEA 1OU4A 1E1LA 4E2ZA 2Q27A 3W5IA 4KUGA 4S2UA 2G1UA 4LBYA 2Q62A 1KHHA 3BQ9A 3KZKA 5JVDF 1J5EB 1JDUA 1P5FA 2HGSA 2AXEA 1K7YA 2FUNB 2MOKA 4HDNB 4YI5A 3VR6A 3ZWBA 2CV0A 3FY4A 3NT2A 4JNCA 1ZN8A 2C9MA 4XUDA 1I9GA 2FQYA 5C1BA 1EG2A 3KOOA 3NDRA 1U0OC 2HWWA 1CSEE 4UBOA 3IXLA 1KDOA 1TT5A 5CU7A 1ZAKA 1OLXB 1ISJA 1SBZA 3QUBA 3EEOA 5G02A 4MYDA 5D1HA 4WIAA 3W0LB 3TD9A 4K86A 5HMMA 3EGVA 5ICSA 1F4PA 2IRWA 1ISPA 1VPEA 3G85A 4FNAA 3S2EA 3B1JA 3PL1A 5A5GA 5BXQC 4PZDA 2OOSA 1E2UA 1WHSB 3UJDA 1WU8A 3THWA 5H81A 4MIEA 1D6NA 1FB5A 3UUFA 2PVSA 4CR6A 4CIBA 1MG0A 3HYLA 1Y42X 1ZD4A 1X1CA 2B1GA 3ELWA 3JZMA 2H1SA 3Q40A 5EQFA 3S2SA 1PTJA 3G7SA 1CS4C 4XIIA 3VUFA 4N9WA 2Q7OE 4AYXA 3ETHA 4M87A 2MYPA 5EWLB 1S4MA 1W48A 2CJXA 3JVUA 3GL9A 5AI0A 3RC3A 1X1EA 1CEYA 1PG2A 2GWHA 3GJ3A 3JD3A 3Q8KA 1GG5A 1Q19A 2PPVA 1JXOA 3KQTA 1VRVA 2IEGA 2I34A 3VHXA 2GWRA 4TXJA 3DZKA 5KYUA 2RH9B 3B48A 1PQWA 4Z4GA 3GEIA 3GHHA 3DEYX 4OFZA 2CSXA 2FKAA 3RVQA 3W6OA 3CSDA 3DWFA 2Y6UA 6AT1A 1G60A 4U1RA 2DGDA 4EY5A 2B35A 1TCUA 3TSYA 1J1UA 2REQA 2Z9CA 4FLFA 4F21A 5GOZA 5ED0A 4B35A 4F8JA 2R66A 1N8KA 2DJ5A 5DASA 2NUBA 2Q50A 3V1TC 1L0BA 4AYWA 3DEAA 3FNHA 4GS5A 1X38A 3TMKA 4OJMX 5E6RB 1DGQA 1HURA 4HSEA 3SXUB 4OQ4A 2VHCA 3BILA 4XDHA 1O9BA 3LGXA 1PJBA 3MTDA 3V9PA 1PU2A 3TLXA 1S2DA 3ZJYA 4LVCA 2YHUA 2AOTA 3OE5A 4XLZA 5E4JA 2O2XA 3HFRA 3U9LA 3I1YA 3SDZA 2AFHE 3BEDA 1Q57A 3IUEA 1B6TA 1N6OA 4P3PA 2F9MA 3K2BA 3TIXB 3L43A 5J2UB 1ECCA 1EAYA 4UU7A 1K7CA 2OVFA 5M7EA 1GKUB 4MQUA 1W35A 1LXCA 4DKJA 2ZWPA 3HCRA 3O8BA 3QPWA 3G23A 1T24A 3EVGA 1I32A 4CM6A 4ZZ1A 2NO7A 1N0HA 3K0KA 1BGWA 1YJBA 4X3PA 2J4CA 5AOAA 5F77A 1OXVA 4ZI7A 1LKZA 4ND1A 2LDXA 1WSDA 4FMCB 1R0WA 3DB1A 1CS0A 2B4KA 3N2ZB 2G9RA 5ALKA 5I7FA 2Z0MA 2J4FA 1CUJA 4R6WA 3GVCA 1JZQA 3ICVA 3VBEA 5TSDA 4J1TC 4XKJA 5JNUA 1ST3A 2B5VA 3SE0A 1Y9DA 2VPWA 1E0AA 1NTRA 1QJ4A 2ZR0A 3LUDA 2DUWA 3WFIA 4EARA 4EHFA 1UPTA 1N0WA 2FWAA 2QD4A 3CX3A 4WKCA 3EUEA 5CTJA 5G1PA 2HSEA 4Y2SA 1YRBA 2CD9A 1YB4A 3KUUA 2ZB2A 2VHZA 2W5UA 1XA4A 4O6VA 5HTKA 2IV2X 3A2KA 1DKNA 2X8JB 1VYHA 3P19A 4Q9NA 5EI5A 4B7AA 5JAIA 1PR1A 2O2ZA 1M6NA 3KDSE 4WFKA 3TOVA 5JI3E 2J3KA 1UQTA 3UH0A 2YMPA 5JROA 4IXMA 3ILSA 3CPJB 2Z83A 4JL6A 3Q0EA 2VJNA 3QYFA 4RLSA 1I80A 2D2VA 1LUAA 4Z4EA 1P6QA 2QTMA 4MDEA 1YS2X 1RD4A 3GY0A 5DTEA 3USCS 5ALGA 4BO3A 5I4BA 2O2CA 4F46A 4EP1A 2Q4RA 3EVAA 3MXTA 1AU9A 1P2SA 2EJUA 2PUJA 2NZUG 3PD0A 2IDJA 4FOTA 1ILWA 4OLHA 5DI3A 2WFLA 2Y6VA 4D1YA 1H8EA 3F8TA 3IP8A 2VT2A 1O8CA 4Q9DA 1NI4A 1UFRA 1WLYA 3MS4A 2F1JA 1SCBA 1H4QA 1A7UA 2VXBA 2VRBA 2HSJA 1Z4NA 1FJHA 1J5PA 1OHHD 2PJUA 1T2EA 2C78A 3FYSA 3THSA 3L40A 1Q7TA 3WMXA 1D2CA 5JOQA 2FFQA 2JHCA 1DRWA 2RBEA 2QSYA 3C5HA 3D1VA 1NGSA 1PJQA 3LE8A 4OHCA 5HFNA 2XLCA 3FDXA 4NU0A 5F7JA 1QQ7A 3KVVA 2AJ8A 4ER0A 3R5TA 2A1TR 3DLTA 3LT5A 2VF4X 1L5LA 2CYBA 3QNMA 3IUNA 4AB1A 4ZTZB 5LQDA 1Q20A 3TRHA 1ULTA 1JYSA 1I13A 5KHLB 4A0FA 1OWLA 2VWHA 2Y0BA 1T6YA 2QVGA 3OQJA 4M1QA 2HREA 2PR7A 3PQEA 2C99A 1D5WA 3RS9A 5ELXA 1AKVA 1Q1QA 2TECE 1SGWA 5CJPA 4ZYXA 4EHJA 4KK4A 5THXA 4B76A 1N5MA 3WS7A 3TNFA 5BSUA 2YOGA 5F9HA 3WB9A 3LS2A 4EG4A 4Z9YA 4OXIA 3VX4A 2YKGA 3NGLA 4H4EA 4ZZ3A 3ITKA 3GLFB 2B83A 3I83A 4MEBA 4R3NA 1CU1A 2V8BA 2OQ2A 2QJFA 3V1MA 3UQYS 2MT9A 2XTZA 1DC5A 4LKRA 4MVJI 4PLWA 4WH0A 4GI2A 4Z8XA 3T35A 5J47A 2HHHB 1RI3A 5F9MA 5BNFA 1IRIA 1L5ZA 2XZTA 3FVVA 1ODCA 3O95A 1RLIA 2XIQA 3IKLA 4B6GA 2OBBA 1TADA 2PH3A 1PL8A 3DLAA 1NOJA 4MW1A 3GJ5A 4REQB 5AWFC 2IY8A 5HG0A 1BFDA 2J9YB 4GOMD 4CLEA 1NVMB 4W5HA 5JAUA 4GI3A 3EPKA 2ZXUA 3V00A 5DPMA 1PEYA 3CE9A 1DCKA 1GGMA 1QH8A 3AWIA 3DLPX 3OZEA 2BD0A 2WKSA 4FW9A 4K9DA 4YTEA 2FPMA 5F12A 2X8WA 3D7RA 4X64B 4KSBA 1NRWA 3L7OA 3IP5A 4OJKA 1U6IA 1W0KD 1ZUWA 2ENUA 3AHHA 4YCJA 3A14A 3JTMA 3AK4A 4N6GA 3KAPA 3S7TA 2PQ6A 4IPTA 3FB1A 5FBHA 3QQ5A 5K0SA 4OX9Y 4F71A 2XCRB 4QBGB 2IH2A 1MDFA 4BNYA 1RWBA 1N4DA 1ZBQA 2GPNA 4TQ9A 4GW3A 1W29A 3WWEA 2PUHA 3DQZA 2JIOA 2I4RA 4NS1A 2ZB4A 4UUBA 2C61A 1RYHA 1QV6A 1W5BA 1K06A 1RHQA 3BKXA 3JQ8B 3K8ZA 2RB5A 4BNUA 4C06A 5L6MB 4NBKA 1KKLA 3H1PA 4LK3A 1PJ2A 1DDGA 3NH9A 4CF6A 4O3MA 3AB7A 5EN4A 2PT7A 5LOVA 2W11A 5IW8A 1P8JA 4Y9UA 5A04A 3V8PA 5I45A 3PNVA 3GPBA 2JL1A 2XCTB 1WVIA 1FRFS 4Y6OA 5EXSA 4PX3A 5CXXA 3PF8A 3G9TA 3WMFA 4CN9A 4GXQA 2IT1A 5C80A 2VDUE 3ZWPA 4M1TA 4JFRA 2OTCA 4DJ5X 3SQWA 1IN5A 4DG8A 3HDVA 1X7GA 5DNCA