1CEQA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
304
Chain Sequence
PKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
total genus 110
structure length 304
sequence length 314
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ceqA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ceqA02
3PEFA 5HTOA 5TSDA 1U4OA 1ENZA 3IQDB 2Q3EA 2I76A 3AY6A 4PFJA 1IB6A 4E12A 3TZ6A 4RVDA 5KJFA 2DBQA 3GGPA 4GLLA 4E32A 1MG0A 3MJSA 3JQGB 4CQLB 3PWSA 4JROA 1TB4A 1JVSA 3FPLA 1A7AA 2OUIA 1NTOA 2OMEA 3VTZA 1LX6A 1QYVA 2PY6A 3PHHA 5DCUA 1Y7TA 1KOLA 3PHJA 3U3XA 5CG2A 5DBFA 4CQMD 1HDXA 5F21A 3Q2IA 1QV6A 1YS4A 1I36A 3IS3A 3IUPA 2DKNA 1NBOA 2GN8A 2GSDA 3D64A 3NYWA 4CLRA 4Z6KA 3A9WA 1ZFNA 3W8DA 1JQBA 3BTSA 1EUDA 3GOHA 3JQBA 1E7WA 2BFAA 1EQUA 1GCOA 2B69A 2X9GA 3ANMA 2VHWA 3AOGA 4IS2A 1F12A 4CMCA 3GZ4A 2EKLA 2AQHA 4BQRA 1GZ4A 2O3UA 2Q1TA 3ICPA 3W6ZA 1LQTA 1MA0A 4CM3A 3KETA 4N7RA 1NX6A 3FI9A 3WTCA 1Z45A 2X5KO 1YVEI 3HSKA 2XXBA 4BNVA 3PXXA 1ISGA 2YQ4A 4YJGB 1BHSA 1DDOA 1C1DB 5K6AA 4G81A 2JCYA 2UVDA 3K92A 3MJVA 2YYYA 4OKIA 1X15A 1D3AA 2D5AA 2NQTA 3PLNA 2Q1WA 1ZXBA 3G79A 1U2DA 1U28A 1TEHA 2A35A 3K6JA 3KSDO 5IN5A 1PSDA 1KVSA 5EIOA 3ZNPA 2B5WA 4YXFA 1E1MA 3HN7A 1LQUA 5EPOA 4IXTA 1BDBA 3GMDA 1WPQA 4UEOA 3GZNB 1GV1A 4JQCA 2PGLA 1X13A 3BMQA 5DT9A 5AXAA 4J4TA 1E1LA 3JQ9C 1K2WA 3PGJA 4GGPA 3H2ZA 4P22A 3L4BA 3WGQA 4CM9D 1ZEMA 2NTVA 2C7GA 1W0CA 2YV1A 3DB2A 3JYLA 4PG6A 5A9TA 1V8BA 1TT7A 1ZJYA 3DZBA 4WLEA 1ONOA 3DTYA 3VZQA 1HWYA 1ML3A 4BO8A 3JD3A 1GUYA 5JC1A 3DZGA 2O3QA 4BQPA 4BNMA 1DIBA 3PHGA 5BSHA 1GD1O 3I5MA 3E9MA 4HV4A 3JQEA 4EI2A 4DIBA 3AY3A 5KCZA 4I5EA 4J2OA 3O4RA 5HA5A 2Q2VA 3FWZA 3PWZA 5JLAA 4RZHA 4BS9A 2DC1A 4FOSA 2Y1GA 4OKNA 5I7EA 3PP8A 1ZSYA 4RDIA 4XQGA 2WE8A 3INTA 3U9LA 4CMHA 1R4MB 4IGFA 4KUGA 2FPPA 2DPGA 1EE9A 1U8XX 3UXYA 4Z3KA 4ZJUA 5ILOA 4M49A 2JAPA 3H5RA 3JQ6A 4AVYA 4XRGA 3JYNA 2PGJA 2WYWA 4YJDA 1P77A 1PQWA 1T1RA 3MJTA 4IXWA 2FZWA 4N5LA 3TRIA 3H9UA 1N2SA 3F5SA 1N9GA 3IAHA 2QIOA 4NDNE 3DOOA 2PR2A 2AA3A 1T2DA 3NT2A 1EZ4A 1H6DA 3ZWBA 4DREA 3JD1A 3WSVA 2PH5A 1Q7CA 4J16A 3OA2A 5L7TA 1ZMOA 3OIFA 4IZHA 3JD4A 5JYDA 1NR7A 3TL2A 1NFRA 2BGLA 2D2IA 5IF3A 3L6DA 3NUGA 3DHYA 5BQFA 5DCYA 2WYUA 3B1KA 1Y8RA 2Q45A 2Q4BA 4LCJA 3LT1A 1HSOA 3GNQA 1XLTA 1LDNA 1ZZEA 4INAA 1T25A 2J5RA 1ISHA 4H15A 3L0DA 5I8ZA 4CV0A 4RF5A 1AHIA 5I9LA 3QVTA 4TSKA 5H83A 3WBFA 3ZWAA 4DBZA 1R4NA 2CY0A 1BMDA 1X1EA 3CSDA 2XPCA 3AY7A 3AUSA 5G4KA 1HE2A 1EBUA 4BNXA 3RBVA 3PRJA 3PTZA 4A27A 2BI8A 4L4SA 1NWCA 5JE8A 2GZ2A 4OXNA 1LDEA 1U3WA 1UXIA 4D3DA 1HZJA 1L7DA 3QWFA 3UN1A 3GHYA 1U3UA 4NIMA 3NDJA 1CQJA 3K2BA 3IUSA 2E48A 5L7YA 1T1SA 4CLDA 2X9VA 2A94A 5FI5A 4FGSA 2Q1SA 3DL2A 5TQVA 4EEZA 4PLCA 1EK6A 2X0NA 3PHLA 2F1KA 4LISA 3C1TA 3CMCO 4TRMA 3CH6A 3NX4A 4O6VA 3BAZA 1V3TA 3DC2A 2JJYA 4EW6A 3RCBA 2EV9A 1G1AA 3DR3A 4J90A 4PLTA 3K96A 4C7KA 1PIWA 1EFLA 1WW8A 3PYMA 2NVUB 1T2AA 2NU7A 1U1IA 4GX1A 4BVAA 4BNGA 2B37A 1DLIA 1KVUA 2I66A 3W4IA 4RVFA 3F3SA 4AJOA 1PJTA 5L3ZA 1E1NA 5HRUA 1YL7A 3E5MA 4LRTB 5THKA 4GX5A 1I2ZA 4GVXA 4NZ9A 3VTFA 4CMJA 1R66A 2R6JA 4KQWA 5L7WA 1SPXA 4E2XA 1SMKA 4L76A 4DTIA 2IRWA 2P4QA 3E03A 2UAGA 3DONA 3RBZA 2OXIA 2NM0A 3OSUA 1CERA 3WGHA 2IZZA 1XELA 5G0WA 1CWUA 2O3TA 1D4FA 4XYEA 3RFTA 1CYDA 2IEBA 4CMEA 4M54A 4RV9A 3E82A 3L77A 2FR0A 4BNFA 2AXQA 3RIHA 1FF9A 2QZZA 4E5KA 4L75A 4WE3A 4EBFA 1CDOA 3H5NA 2Y0EA 3UCEA 3A4VA 1WDMA 5COAA 4NG5A 5G4KB 1BVRA 3SJ7A 1JU9A 4PZDA 5BNTA 3QE3A 3SC6A 4DXHA 2YV3A 1DAPA 4AJ2A 2LDXA 3TL3A 2GLXA 3INRA 1NPTO 3IKTA 3P5SA 4A03A 5GZ1A 2DT5A 4Y9DA 3W8EA 2RIRA 2I6TA 3DQPA 1F06A 3PJDA 1Z6ZA 2DAPA 3H9QA 3KHUA 1ZUD1 4GMGA 3ZWOA 3BMCB 3OIDA 5KWEA 2VHYA 3ULKA 1QXSA 5HBRA 1DC3A 1WP4A 3IC5A 3KEOA 4R4JA 1R12A 2X0RA 4YAGA 1LSJA 3M2PA 4Z0HO 4E6PA 4ZD6A 1Z75A 3WGOA 1AN9A 3DAPA 4CM4B 4U6SA 4ALNA 1U3TA 1SEPA 1V0JA 2FPGA 1E3JA 4RZIA 4HBGA 2O7QA 1HEUA 3IKVA 4Z0PA 4YA6A 5EERA 1P33A 2NWQA 5CHEA 4M86A 1JWAB 2YFHA 1EUZA 2C2YA 2ZYGA 4IDAA 4R51A 1XG5A 4Y6PA 1DC6A 3ZU2A 4UUNA 4W7HA 4ESOA 3QIVA 1O8CA 5TJ9A 4RGBA 5G0VA 5LDGA 1J6UA 3AM4A 3JQAB 1DFHA 5IDWA 1H94A 2HO5A 3WMXA 4M89A 2B4TO 2Z5LA 2P5YA 3KOUA 1DJQA 3CXRA 4CV1A 1F17A 3HZZA 3RUIA 4NMHA 1ISMA 4BNWA 5MDHA 4PG4A 2RAFA 1IYZA 3WWZA 3ZHZA 1H9AA 9LDTA 4WCFB 4JK3A 1BXKA 5A06A 5J23A 2WSBA 4FFNA 4FJ0A 4G65A 2PGDA 3JQFA 2AG8A 3S2IA 3GVIA 2X4GA 1ZJZA 1HYEA 4P4LA 4ZHSA 4J1QA 5CDSA 1E6EA 4KTVE 3FTNA 4AG3A 4WCFA 1GYQA 2HJRA 4RLHA 4XIYA 3WLEA 2E82A 3NKLA 1A5ZA 1BGVA 4BO5A 3JCZA 1NPDA 4B7CA 2C07A 2CFCA 1HDRA 1YBVA 3T4XA 3MCVA 5T6BA 3U4HA 3JQFC 2OL4A 1SB8A 3KTDA 1NVMB 3H7AA 3SBOA 4FGWA 1I3MA 4PIVA 1PL7A 2IEDA 3JQAA 4MVJF 1SB9A 3DMYA 3RWBA 4F45A 3UUWA 3H3FA 3RC7A 1EVYA 1NQAO 1JAXA 1RM5A 4J9UE 4BMVA 4BNIA 5A02A 2Y68A 3O38A 3PIDA 4WNIA 5JPIA 2EJVA 1AE1A 1I8TA 1BSVA 4Q3CA 2X58A 1H2HA 4L8VA 5AVOA 3GN2A 2C5AA 3S2FA 1ULSA 3WJAA 1YDWA 2DM6A 3NTQA 4DQXA 3GC6A 4AJPA 2J8ZA 3H9GA 4URFA 1Y8RB 4HX5A 1EVIA 4J91A 2FZEA 3NDIA 5L53A 3QV1A 2BHLA 2PV7A 2YV2A 4GSKA 3M1LA 4YJFA 4LMPA 5B1YA 3NJ4A 5KKAA 4B79A 4YQZA 3UICA 3QSGA 2NSDA 3HHPA 7MDHA 2CVZA 3B70A 4B8ZA 3FHLA 5F1OA 1HXHA 3L9XA 3HWRA 3I9LA 4ZQEA 5IDYA 1P1KA 5TT1A 4CLRB 4EJ0A 3WOHA 1LDGA 2JFHA 4RLSA 3V2HA 3QRWA 3WFJA 5BR7A 3EAGA 3PQDA 2DTEA 3ICCA 4YAIA 3WDSA 1HZZA 2C29D 5KJ1A 5JMWA 1UZMA 2R2GA 5COBA 1Y8QA 2O3RA 3L6EA 2AE1A 3WLFA 1E3IA 4J43A 4HWKA 4BO0A 3KLMX 2I67A 1PJLA 1DSSG 1QYDA 2DVMA 2I5PO 1H6CA 1DPGA 1VL0A 3R3JA 1LU9A 4YPOA 5CDUA 5C7OO 2P68A 1VJ1A 2Z1MA 4J1NA 2EW2A 4OJNA 1PU2A 2HK8A 5JCXA 1CJCA 5JDIA 5CPFA 4DVJA 2VOEA 2P9GA 1PGQA 1U8FO 3HE3A 1UAGA 5KJEA 4IMRA 4ONEA 4QQRA 5I9MA 1BRMA 1TVEA 4BNZA 1A9ZA 4L9RA 1FK8A 5H82A 2NVBA 1YBMA 2PFGA 3CE6A 3IJPA 5B37A 4A26A 5CPBA 3ABIA 3PLRA 1ZEJA 4D0SA 1XU7A 4R3NA 4XDZA 3EDMA 4ALMA 1T26A 3PHIA 3KYDB 3T7EA 4JIGA 2UYYA 3F46A 3N7UA 1VJTA 3OICA 4BO6A 5TIIA 5CEFA 3D4OA 4FFRA 1Y1PA 2OORA 2EGGA 3CIFA 4PLPA 2Q4EA 4TRRA 1PJ2A 1KC1A 3OJOA 3QP9A 5I8WA 4II2A 1Q0HA 1PGOA 3GEGA 3ITDA 3ZV6A 4TRJA 4JJIA 5JAQA 4MVJD 2C82A 3V1YA 4GWKA 2Z1NA 4BNTA 3JQBC 1G0OA 4NBVA 1P1JA 4EITA 3VH1A 4IUYA 1MP0A 3ENNA 4ND1A 2ZYDA 3ROPA 2GN6A 1UP4A 3AOEC 1NAHA 1VKNA 3QQPA 4W99A 4PLGA 3RKRA 3QY9A 3RC1A 2ZTLA 3H8VA 4D43A 1I3LA 5EN4A 1P74A 4R3WA 3S2GA 3A14A 2WD7B 3BTVA 3L6OO 2EJWA 4IDEA 3ORFA 2FRDA 3ZHXA 4CLOA 1ZO8A 4FFOA 4AJEA 2J5QA 2XXJA 5L45A 3N74A 4IGEA 3AFMA 5KJ6A 5C37A 2IZ1A 1Y81A 1P1HA 3K31A 1AHHA 4EEXA 3DOCA 4FFPA 2J3KA 2ZB3A 3ZV3A 2H63A 5U1PA 5KVCA 1K6JA 4K28A 4CL8A 4NJMA 3R1IA 2Q1UA 1HLPA 3A1NA 3HADA 4WK6A 3RC9A 3LT2A 3NTRA 1QYCA 4L0QA 3HFSA 4R5HA 2PKQP 3LT4A 2GGSA 4O5OA 4PVDA 3FR8A 3WBBA 2R00A 1DB3A 2HUNA 4KUHA 5B12A 4B4OA 3TNLA 2EEZA 4DLAA 4GL4A 3FNHA 1S7CA 3G1TA 1KY5A 3UGKA 2UUOA 3UAGA 3K2EA 3EUWA 5DNAA 3TN7A 1C3VA 3RROA 2HSDA 2Q2QA 2OBYA 2PD4A 1M6HA 4YT2A 5JDCA 1V9LA 2QQ5A 2VYVA 4NFYA 4WOJA 2J6IA 4DIOA 5JFOA 1F8FA 1ZSVA 3H9JA 3G0OA 5TF4A 4KUEA 3GNSA 2E37A 5AQ1A 4E5NA 4L74A 3GGGA 3UH1A 4UVIA 3QLJA 3WB9A 4YTEA 4IJKA 1JAYA 3TFOA 4J7UA 2O4CA 2NADA 3VZPA 4Q3NA 3QW2A 4J4HA 3L4SO 3GAFA 5G4LA 3OECA 2VUSA 1GDHA 1S6YA 3RASA 5EINA 1WMAA 1PGNA 3FN4A 4CQMB 4AJJA 5KIAA 3RJ9A 1SC6A 1DFIA 4BUCA 1DOHA 2D4AA 4XRRA 1XDWA 4WUVA 4Y67A 3LC2O 1Y6JA 1LC0A 4QEDA 3QA9A 4N18A 4R1NA 1E3WB 1Q2XA 1YOVA 4E33A 3EY4A 3C7AA 5IXYA 3ZZNA 1IPFA 2O2YA 3WS7A 3DXFA 3Q1LA 1I3NA 5DF1A 3FRJA 3JSAA 3TOZA 3ZWNA 3M1AA 3GRPA 4WPGA 1SBYA 1WDLA 4B3HA 1PGJA 4KP7A 1B8PA 2H5LA 4R9RA 1ISFA 1WXDA 3GZNA 4U7WA 1N5DA 4B4UA 4TMFA 1HTBA 5G0TA 1OZAA 3E18A 3GLQA 4J7XA 4BKOA 2NTJA 2YW9A 3V5NA 3RAJA 1NQOA 1FXSA 4XIJA 2EP7A 1LRLA 3JQ7A 5AXBA 4LMRA 3M6IA 2WWRA 1O0SA 1TXGA 4ZQHA 4YCAA 5LCXA 4PG7A 3ZWPA 1UH5A 1ADBA 3FSRA 4E31A 1GZ6A 1DAOA 2WD7A 1P44A 1UP6A 3W4KA 1H5QA 3ZNQA 1V6AA 2JD2A 4CV3A 3GEDA 2YZ7A 2CDBA 3PK0A 3U4IA 4J3FA 1C0IA 1NQ5A 1DEHA 4GX0A 3AU8A 4ZQBA 3WGYA 5FFFA 5T8KA 1XU9A 2VNAA 4F46A 5T67A 3MZ0A 4XGNA 2X6TA 1ZNQO 3ST7A 2P2SA 4OXKA 4W9NA 1HYGA 3KV3O 3P2OA 4NU6A 4RORA 5BSFA 1FMCA 4BO2A 1PTJA 1LDMA 3WYEA 3SLKA 4P38A 3KLPX 1EVZA 4B7XA 4DQUA 3W1VA 3LU1A 2AEJA 3WYCA 1AXEA 3WGTA 3WJ7A 3WIDA 3WTBA 1PQUA 4ZN6A 4TVOA 1LLDA 3WR5A 1PWZA 4WCDA 1JDJA 4WASA 3U49A 4NFSA 4BB6A 4D46A 3ZV5A 1N7HA 2D59A 3WQRA 2GD1O 3TWOA 4JXKA 1QORA 2CDAA 2QX7A 4Q39A 2CD9A 1PJ3A 4WKGA 1WWKA 3O9ZA 3QVOA 2YFQA 3IL2A 2O48X 4Z9XA 3FNEA 3GVHA 1PL6A 4MP8A 4PLWA 4XEHA 4AJ4A 3ZV4A 3FR7A 4A2CA 4RJTA 4UVGA 1CRWG 5ICSA 3W4JA 5JYEA 2GO1A 2QZ9A 1OBFO 4QSMA 2AG5A 2D8AA 2NLOA 4KOAA 2CF5A 4RPJA 3DDNA 4WLOA 4YACA 2RHCA 3UVEA 3BHJA 4FBGA 3JYPA 5ENDA 1E7RA 1FDSA 1LSUA 4GQAA 4YT5A 2P9EA 3PWKA 4NQZA 8ADHA 1ZK2A 2FSSA 4XA8A 1O5IA 1NXQA 3OHSX 4BNJA 4YAEA 1WVGA 1UAYA 3KM0A 3LYLA 5IAAA 4O1MA 4UEKA 1BW9B 2H1SA 3I9OA 3WGIA 2HKIA 4JP3A 3DTTA 2A92A 3GRKA 4IDCA 1RM3A 3SJUA 1QYWA 1E7SA 1LLCA 3TDKA 3RBXA 2AW5A 5AXDA 4BNUA 3FTPA 3KVOA 3BMNA 3QJ5A 4TQGA 4E4YA 4KQXA 3V2UA 3ADOA 1K0UA 3UF0A 3JQAD 1LXCA 3DHNA 2CNBA 2IODA 1VL6A 5A5FA 3NJ8A 1ZSNA 4J9VA 4GKVA 1SCUA 4W6ZA 4FPXA 3DBHB 2I3AA 1RJWA 3I1JA 3SC4A 2GUGA 3Q3CA 3EMKA 5A9RA 2EIHA 5KOIA 2DPHA 1GQYA 3BMCA 4XR9A 4UAGA 5A5EA 2B4QA 2DBRA 5EL0A 3I6QA 2ZATA 1ZK4A 5A05A 4KDFA 1HL3A 5TC4A 2Q46A 1KYQA 3G17A 2UV8A 1E0DA 1ENPA 3IMFA 4ZVVA 3PDJA 1C0LA 1B2LA 1HDYA 3KYBA 2YDYA 1VKOA 4GMFA 3IOYA 3ZW8A 1X7HA 3VAZA 1KY4A 3F47A 2NU8A 3QWBA 1GPDG 3V1UA 1P0FA 4M87A 3T4EA 4BO4A 4CM4A 1YQGA 1N1GA 4F6CA 4XZ3A 4PLFA 4BO9A 1M2WA 1MXHA 2Y66A 2DBZA 3AWDA 4ITUA 5C5IA 1E77A 4E0BA 2B83A 4BOYA 4DYDA 3LK7A 2VCYA 1E7QA 4QO7A 3DO5A 4R69A 4JX8A 4D3SA 1IL0A 3GVCA 3W6UA 3C24A 5G2OA 2W2KB 4M1QA 4EDFA 4XWYA 2BELA 1B16A 3H4VA 1HDOA 3ADPA 1B0AA 2PZMA 5T64A 3WICA 4L73A 3E5RA 3OJEA 5CDTA 3ZWXA 4YJGA 1LSSA 2WJPA 1KIFA 5MGBA 4PLVA 5F1PA 1XWFA 1EK5A 1YQXA 3AFNA 3HUDA 4WEQA 4I5FA 4AICA 3I4CA 4PRKA 3KBOA 3VPHA 4JN6B 1JKIA 1VJ0A 2ZJ0A 3OEYA 4G5HA 5IDQA 2HDHA 5EJ2A 1XR3A 1U7HA 4FCCA 1E6UA 3DWFA 3N58A 2B4RO 3H2SA 3F5QA 4RQTA 2I9PA 3DBVO 4P8RA 1UUFA 1Z7EA 5T5QA 4NPCA 3ETGA 4OIMA 2EGHA 4P4NA 1N7GA 4RVHA 1Q0QA 4XB2A 4NFHA 1DRVA 2P4HX 1R16A 5DN9A 4DC0A 5HWSA 2ZIZA 1YGYA 3DBRB 9LDBA 3RC2A 3RFVA 1YWGO 4BNKA 2PZJA 2E6UX 2D1YA 2D3TA 4TRNA 2W2LA 2BKAA 1H93A 4HADA 4IQ0A 4PG8A 5L9AA 4K6CA 2YDXA 4GLOA 4YRDA 2GR9A 3TPCA 1N8KA 4MIOA 1DHRA 3HG7A 4ROSA 1YJQA 3PQEA 3AUAA 4QECA 4NBTA 5CEJA 3QWAA 3HB4X 1NVTA 5TLSA 2WYVA 2A9FA 4Q9NA 5ITWA 3CTMA 3RSHA 5H81A 1EFKA 1UJMA 3E1KA 1UXJA 4BGEA 1I3KA 2J3JA 3DBHA 3CUKA 3NT4A 4KWIA 1YJ8A 4TVBA 3C3XA 4U5QA 4H7PA 3UKOA 4F3YA 3FF4A 3OJFA 1SNYA 1NHGA 2PTGA 4N5NA 1OMOA 4RVUA 3EC7A 5KVQA 4CQLA 2PD3A 1RWBA 5JY6A 5JDIC 1KC3A 1XGKA 3PDUA 4J4BA 2C59A 3GPIA 4O59O 1KERA 3MWDB 1PS0A 3U5TA 1N9GB 4FR5A 2HU2A 3BA1A 4XYBA 3ROQA 3ZWVA 2CUKA 1EEHA 1GCUA 2DTDA 4QFDA 4IJUA 3RFXA 1N1EA 3F1LA 2Y0DA 1ENYA 1GQQA 2HK9A 4J2HA 4MVJM 4NI5A 1UDCA 5DDIP 3GEMA 4TWRA 4HXYA 2PA3A 3QVSA 4BGVA 1PZHA 3PGXA 4J0EA 3RUHA 1OI7A 4HNHA 5GZ6A 3I6IA 4B7UA 4Q3DA 4BL5A 1A72A 3C1AA 4LGVA 3ZGYA 2P9CA 3NRCA 4R1SA 3E9QA 2NACA 4DA9A 5JY1A 1MG5A 3KSUA 2VT3A 4GKBA 4ALLA 3I3OA 3JD0A 3PIIA 4GBJA 2FR1A 2NVUA 3ENKA 3KB6A 2HMTA 1ZKMA 2P5UA 3OJLA 8LDHA 2QYTA 2GZ3A 3VPSA 3AU9A 4RF4A 3ITKA 1O9BA 4XGIA 1QYXA 3ANNA 4FC6A 4TKMA 3I52A 5JO0A 2E4AA 2BD0A 4XDYA 2GDZA 4W82A 3PYXA 1U4SA 4YVFA 4AJKA 4RDHA 3VC7A 2Y99A 4RPKA 2VWQA 4PZCA 4QUKA 1FDVA 1QMGA 3AI3A 1QV7A 2RCYA 2JFGA 2W2KA 2X86A 3HDQA 3DHEA 3VDRA 1I30A 1NFQA 1DLJA 3JTMA 3OP4A 3I83A 3SX2A 3MEQA 3E8XA 2ILTA 3D5TA 1BXZA 4D44A 2JAHA 4PZEA 3R3SA 4ILKA 2E49A 1MUUA 2C5EA 3V2GA 3WFIA 1SOWA 1TI7A 1NVGA 2NVWA 3GN1A 2PZKA 3ZH2A 4AJNA 4AJ1A 3ZW9A 4R1TA 1IHXA 3CINA 4UVEA 1VI2A 2JHGA 1LTHR 1T2EA 4R41A 1NM5A 1IE3A 1HETA 4IINA 4FIZA 3IDSA 1O6ZA 1BVUA 4UULA 2G0TA 4D0RA 5CDGA 1GUFA 1HSZA 2CVOA 2YUTA 4U8GA 5KKCA 1D7OA 1GEGA 3X2FA 1MX3A 2G76A 2QRLA 4BO1A 1IZ9A 4BHTA 2AEMA 3F6YA 4CM5A 5LDHA 1U9JA 3FBGA 3INGA 3Q9NA 5CDYA 1SZJG 4MKZA 5EQFA 4WLUA 4H16A 3RUFA 2O3SA 2ZK7A 4DL9A 2ZB8A 4XCVA 4IDFA 1BWSA 3O8QA 2ZYAA 3ZCXA 4R54A 3PVZA 3D4PA 1PJQA 4LW8A 3FPCA 4XQCA 1DRWA 4OQZA 4XGKA 4JP2A 1QLHA 3FBTA 1ULUA 1EMDA 3EZLA 3H6KA 1KVTA 1GADO 4IDBA 4YRBA 1YE3A 2EP5A 5K0ZA 4YAJA 1DIRA 1OC4A 4CV2A 2HRZA 2Y1OA 3G3EA 3A28A 3ZNNA 2ZCUA 3GAZA 3GDFA 1MLDA 1W4ZA 3VVCA 3GR6A 1Z73A 4OM8A 2AHRA 4NK5A 5I9NA 1CETA 4PN3A 2NUAA 4OSPA 3AI1A 3I23A 5BSGA 4IM7A 4MPDA 5DBGA 1P3DA 1UXKA 4YB8A 2RH4A 4ND3A 4OQYA 3JD2A 4RCVA 3K30A 2VHZA 3JV7A 2RH8A 2UUPA 4ID9A 3ZHBA 3GT0A 2CF6A 4FW8A 1YB1A 2AQKA 5B4VA 3BYZA 2GZ1A 5IXSA 1YO6A 2AE2A 2GASA 3C85A 1V3VA 4JBIA 3EYWA 4MDHA 4KTTE 4LVUA 1UZNA 5L95A 2OHXA 2VTDA 5FF9A 1GUZA 3OIGA 2HQ1A 3ONEA 3D7LA 4ZU3A 3C7CB 2I3GA 4ZICA 3PZBA 1NAIA 3ONFA 3FD8A 1LC3A 3DZJA 1GR0A 2IYPA 5I7VA 2D5CA 3L4BC 4NJOA 3DAFA 1M76A 4XB1A 4YT8A 3BIOA 1QKIA 2B35A 4Y6SA 3WIEA 3QWHA 4M8SA 5ILGA 3MWEB 3WGGA 3DBLB 3GG9A 4XQEA 2VUUA 2OGUA 2UDPA 3F4BA 2VZ0A 4NBUA 1ZVMA 2VZ9A 2FMUA 2AQ8A 4DPKA 1M6WA 3FWNA 3LDHA 4EGFA 3NAQA 3HQ4O 1VM6A 4LSWA 1BTOA 3TF5A 4MP6A 3Q0EA 2ZB4A 4DYVA 2GRAA 2ZJ1A 4EJ6A 4WLFA 2BLLA 5DCWA 4HFNA 3LLVA 3WG9A 3CZRA 2C7VA 2O23A 3D0OA 4IZIA 7ADHA 4NHEA 4MKRA 2W98A 6ADHA 4BNLA 3IP3A 1Z82A 1TLTA 5JC8A 1ZH8A 2HJSA 2A4KA 4I9NA 5THQA 1A4IA 1E7MA 3RU7A 3F4LA 5ADHA 3OA0A 4I1IA 2Y1DA 3V8BA 4OMUA 1T4BA 2BH9A 1YQDA 4RO0A 4W9NC 4J49A 5HS4A 1GPJA 4R1UA 4RL6A 3PQFA 4DPMA 3LC7O 2J5KA 2V7PA 1I2CA 4MINA 1T4DA 1D1SA 1ISIA 3KSZO 2GN9A 3EW7A 4HY3A 4DRYA 2DQ4A 3NEPX 3TOXA 1EBFA 1U3VA 5TNXA 3EK2A 1EDZA 5ER9A 2V6BA 3BMQB 1CQIA 5GY7A 1CIVA 4Z0TA 2VUTA 3RUDA 1V3UA 1R4MA 3LLSA 1PZFA 4JJGA 3GY0A 3C7DB 3KYDA 2PLAA 3QWIA 4YJHA 1KEPA 2J3IA 2C0CA 3I9NA 1ADGA 4HP8A 1B14A 3E48A 2EKQA 2HMVA 4GSLA 1AUPA 2QYSA 3SXPA 1YOVB 1KEVA 2BFPA 3WX0A 4XKJA 4CUJA 4FD3A 5F5NA 3P2YA 5F5LA 4KWHA 4E2ZA 4Q3EA 2JD0A 1YDEA 1WLYA 4MVJP 4BMNA 4YEDA 3D4NA 2BGMA 2DUUA 4MO2A 2V6FA 3C8MA 1KVRA 4YWJA 3VPGA 1PX0A 1PZEA 3OFSA 3PJEA 2PZLA 3ZU5A 1HF3A 3AOEA 1Z74A 5B4TA 3ZWCA 4XJTA 4AJHA 2GNAA 5L4SA 5BT9A 4M55A 5T57A 2Q99A 5BSEA 3JQ8B 1B3RA 2VWHA 5TT0A 1HDGO 3TZCA 4QX6A 5CG1A 2NNLD 4FJ2A 2DTXA 1PEDA 1PR9A 4B3IA 5I7SA 4U6QA 3HDJA 1FJHA 1E3WA 1C14A 4U0JA 5BNFA 3TZQA 2PKQO 2B36A 1XQ6A 1Y5MA 4O63O 4EUHA 1DHTA 4FSHA 4PLHA 1XCBA 4PCVA 3V1TC 1PS9A 1MXFA 3DZKA 4NK4A 4CJXA 4YQYA 5JS6A 4XQ9A 1N92A 5DOZA 3E6AA 4F6LA 1H6BA 2YJZA 3Q9UA 3DZFA 4IDGA 3TFQA 4IBOA 3KUXA 5FWNA 4ZRNA 2QW8A 3VZRA 3HNPA 4AJIA 1DC5A 3BTOA 5JCJD 1WDKA 2VRBA 2VHXA 1YH3A 1K6XA 3VHRA 3ON5A 1B3BA 1Y5RA 1NQTA 1Q7BA 4IS3A 1D8AA 1RKXA 1SEVA 1B8VA 2VHVA 2RBEA 5C7LO 2X8LA 4DLLA 2HLPA 3H3JA 2AMFA 2R00C 4D79A 4NNJA 3D1LA 3U62A 4E13A 3H9EO 4BB5A 1GYRA 1JW9B 4NBRA 3PYLA 2J3HA 5K9ZA 1MGOA 3PJGA 3I4FA 3QVWA 5COQA 1VRWA 3AW9A 3SEFA 4CMIA 4EZBA 3JQ9A 2VT2A 3CZMA 1DJNA 3OQBA 2FY8A 4IJVA 1GTMA 2V6MA 3U4CA 1U2GA 5TS3A 4ND5A 1GY8A 1PS8A 2LDBA 1YB4A 3F9IA 3GUCA 4IPTA 1P31A 1OC2A 1X7DA 5AYVA 1IUKA 2W2LD 3WMWA 1T24A 5A9SB 3NV9A 1P1FA 4Q3AA 3GFGA 5A03A 4CUKA 3TQHA 1PQPA 1V35A 5IJZA 3GVXA 4DBVO 3T7CA 1M75A 2NV6A 4FJ1A 5A3JA 1A27A 1R0SA 2ZCVA 4B4VA 1IULA 4CM9A 1YRLA 3AUTA 3DMTA 4DQVA 3OQ6A 1OFGA 2ZQZA 4RVSA 1I2BA 1NR1A 2GCGA 1XSEA 3ETDA 5JBIA 1Q1NA 3H5AA 5AXCA 3VZSA 3RUCA 4A5OA 1K3TA 1E3EA 5FYDA 3IP1A 1RM4A 2C20A 2Y0CA 3GK3A 2EWMA 2X0JA 1GYPA 3AUUA 4CM8A 3WNQA 3R6DA 3GDGA 4IIVA 3JQCA 5FI3A 2AQIA 4PRLA 1WNTA 4R16A 3GGOA 5DULA 1DC4A 2YHIA 4X54A 3O03A 3AJRA 3RQSA 1B7GO 4MVJE 4MIEA 2H9IA 4C7JA 3CEAA 5IDXA 1C0PA 4FFMA 4I9UA 2P91A 4XR4A 5KVSA 2VRCA 1MC5A 2Q49A 3DFUA 3LZ6A 4XX0A 1GL3A 3GVPA 4GGOA 4ZRMA 3WQQA 1A7KA 4Q3BA 3L07A 4PLYA 4GPD1 1W8DA 2VYNA 5ICMA 2PK3A 2PH3A 3NGXA 4WCFC 1UR5A 4CUZA 5JNLA 5G0SA 3RU9A 1R6DA 4E30A 3AK4A 3LT0A 5K6AC 3OF2A 4LSMA 3K5PA 1B26A 1ZMTA 4G2NA 3GF4A 1MFPA 4MJLA 4DMLA 1UZLA 4I5DA 2Y93A 3OH8A 3ZN2A 4HFMA 1DIGA 4QTZA 5DP1A 2B0JA 3O26A 5ITVA 3E9NA 1LDBA 4TROA 4CQMA 3HFGA 5GZ3A 1VLLA 4CLOB 2IE0A 2PWZA 3WYBA 1ZXLA 4Y98A 4CLEA 1KEUA 4YDRA 3TJRA 3ZHYA 1ZK3A 1E3SA 2FPIA 2QG4A 3B1JA 3PPIA 4H3VA 1T2CA 1T2FA 2CVQA 2EHDA 2VN8A 3EZYA 1EQ2A 4K1LA 1SO8A 1HT0A 1L1FA 4GX2A 2POQX 5U4QA 1O95A 1O94A 1XQ1A 1ZBQA 4A73A 3KRTA 2DFDA 2PKRA 3RD5A 3JYQA 2OBNA 2IDZA 4BV8A 2OP0A 3ZU4A 1U5CA 1H2BA 4A0SA 5L4NA 1UXGA 4RPGA 1I33A 4HUJA 4B8WA 1G0NA 1X0XA 2BMAA 4UVHA 2IXBA 4LRSB 4B4WA 2WDZA 3SVTA 2O3JA 2O7SA 4DUPA 1JKJA 1TT5B 1I01A 2SCUA 4QXMA 4WOKA 4YJFB 1SAYA 4ND4A 1QG6A 4RQUA 3G1UA 3CMMA 4KZPA 3VPFA 3PI7A 4TKLA 2BF7A 5IZ4A 4HFRA 4RPHA 4YT4A 1R4NB 4XYMA 4J6FA 2HMSA 1GV0A 4D3FA 2QRKA 2Z95A 4JLWA 2XOXA 3JQ7B 5IG2A 2CSUA 5ES3A 1YONA 2PD6A 4PLZA 1YKFA 2QRJA 3D3WA 3MOIA 2B5VA 4WEOA 1ZIDA 2ZTMA 4JNKA 3P19A 1VSVA 1BXGA 4DPLA 2I65A 4TZTA 1ARZA 4YR9A 3D3EA 1MV8A 3EVTA 1MFZA 1PL8A 5EQDA 2VNSA 3HN2A 4CMKA 3Q11A 2X0IA 5U9CA 4MVJI 1FDWA 3PFFA 2V6GA 2FOIA 1EE2A 4MP3A 4Y6RA 3VDQA 2NTNA 1R0LA 2QHXA 3GA0A 3DFZA 4ALKA 4E3ZA 4KMSA 1ORRA 4IQ8A 3VKVA 1C1XB 1Z7BA 4C4OA 4R5MA 1C1DA 5HS6A 4EJMA 4FB5A 3KEQA 5HM8A 1B8UA 2GPTA 4OOFA 4WLNA 2JKVA 3W8FA 2NQ8A 1VE9A 4LK3A 1UXHA 1IHYA 5IFLA 4BGUA 4QFCA 1ADFA 1JA9A 1XKQA 3OM9A 2VWPA 5JO9A 2GYYA 4YYZA 5C3MA 1L7EA 3FNGA 2XF8A 1XHLA 2WD8A 4XYGA 4CMIB 4JGBA 3EGOA 2C54A 4K6FA 2VTEA 5ENVA 3UOGA 3KYCB 2EKPA 3WXBA 1P9LA 1PZGA 4BGIA 2I99A 5L40A 4GWGA 4ZQGA 3MOGA 2W4QA 3ASVA 4MOWA 1A4UA 3FNFA 3ZDFA 3K73O 4LN1A 5A9SA 5IZCC 1GAEO 4TZKA 3AM5A 1WZEA 1U7TA 3BZUA 2DLDA 4CR6A 2DUWA 1ID1A 1HKUA 2EW8A 5DZSA 3ANLA 3MTJA 4JBGA 3U09A 4MVJG 1FDTA 4I08A 2V65A 2FR8A 4QO8A 3GDOA 4OYRA 4Z9YA 3MJEA 4HNGA 1QR6A 1PGPA 1F8GA 4CLHA 3K8ZA 3LQFA 1P1IA 1RYEA 2JHFA 4J7CA 4S3MA 4UVDA 4NJMB 3D5QA 2X7HA 4II3A 4CODB 2X22A 4D42A 3ETEA 4A7PA 5L51A 4BKUA 4DIFA 1LI4A 1LLQA 1ENOA 2HK7A 3AM3A 1PWXA 2Y67A 1YL6A 4R9SA 4CLXA 1GZ3A 1M66A 3X2EA 1QLJA 2EG9A 5T8KC 1J0XO 1LEHA 2YHIB 3GQVA 3LVFO 3UFXA 4BV9A 3CKYA 4UEJA 1XIVA 4E2WA 1D1TA 4IY1A 2YQ5A 5TGDA 4CM8B 4EUEA 1JVBA 2WM3A 2CMDA 5A04A 1XEAA 1JTVA 1ZW1A 1W6UA 1NYTA 4GI2A 1NNUA 2JFFA 4IJWA 4RF2A 5I7FA 5IN4A 1E92A 1VPDA 4XJSA 3BHMA 1PJ4A 1ZK1A 4RVGA 1LSOA 5EMHA 4YRAA 5FEUA 5JW6A 3GUYA 1E3LA 5DOVA 4BNHA 1IY8A 3DBRA 1NFFA 5CFZA 4BO3A 2TMDA 1K5HA 4UUPA 5DBIA 1LDYA 3RI3A 2VYVD 3JQGA 2X1HA 3SLGA 1LRKA 4HFJA 3NGLA 4S1VA 3VH4A 1HDCA 1LRJA 2GN4A 5LC1A 2WTBA 3LC1O 1AGNA 2ZKLA 2ZQYA 4CMGA 3G49A 4UUOA 4MKXA 4GH5A 3ZU3A 1CEQA 3U4DA 4FC7A 1WAMA 3RJ5A 1LJ8A 5TX7A 4BNYA 1CF2O 4YBZA 4XYLA 4NBWA 2X5JO 4UREA 4PGFA 2X23A 1Y9EA 1DRUA 4QT0A 1MC4A 1Q7GA 5G0UA 1DIHA 5KJCA 3RKUA 3DAGA 1X14A 5A3VA 4ZGWA 3WSWA 4A10A 3NT5A 2XAAA 3BXXA 3TZHA 4FS3A 5BNIA 3PFWO 4BIIA 3BMOB 1Q0LA 3GMSA 3I9KA 1PR3A 3ZI0A 2O4UX 3HJAA 3HDHA 2CDCA 2EF1A 4OSOA 1QRRA 2VOJA 4ND2A 4CR7A 4HKTA 3UHAA 2AEFA 3VKUA 4BO7A 2ZTVA 4DLBA 4N5MA 2BGKA 1MB4A 1X1TA 4DGSA 1HRDA 4WLVA 1C1XA 3DOJA 3F1KA 5A1TA 2OP1A 1VC2A 4DWVA 1YBAA 1TT5A 4LCEA 4W4TA 4MVJH 2HAEA 4I8XA 1AXGA 1ONPA 5F3RA 3OQ1A 3FCOA 3RUAA 1K89A 1P45A 1ONNA 3HDYA 5IZCA 2JD1A 2WMDA 5KNLA 5AOVA 1NP3A 5JAIA 4WNCA 3OEWA 4R01A 5JMPA 1UDAA 3GNTA 1NWHA 4E21A 4YAKA 6LDHA 3MJCA 3OMLA 4OO3A 3STHA 2OOSA 1EUCA 1J5PA 2VRCD 4P4GA 4CM7A 3COSA 3DEYX 4NH4A 1DXYA 1HE4A 3D3WB 1DO8A 3VH3A 1E1KA 1SOVA 4OAQA 1LBEA 3GH3A 1EVJA 3ONDA 3ZWMA 1IOLA 3ASUA 1YL5A 3WGZA 5JAZA 1RYDA 1KEWA 1UP7A 2DU8A 1KS9A 3BMOA 3C1OA 4OGWA 2ET6A 3H65A 2GF2A 2HCTA 3HB5X 4CM6A 4CM1A 3L9WA 4WGGA 3B20A 1PJBA 1JLLA 1E7YA 4ZQFA 4JBHA 1OOEA 1GEEA 1A71A 3WQSB 1KETA 3RUEA 2X9NA 3GFBA 3ZWWA 1IZ0A 1VSUA 2OO5A 3B6ZA 3BMNB 4AL4A 1I24A 1TA4A 4D41A 1PJSA 3U0BA 5CP8A 4D7AA 3A06A 5GMOA 3OETA 3OBBA 3EHEA 3LSYA 3ZNOA 4ALJA 4KDEA 2Y1EA 4MIYA 2G5CA 2F00A 5JAMA 1YB5A 1DIAA 4ZA2A 4AJLA 1Y8QB 4W7IA 4IQGA 1ZCJA 4CL3A 2D0IA 1GQ2A 1H6AA 3PZRA 1GFSA 2EXXA 5ER6A 3KYCA 2IZ0A 1ADCA 1LA2A 3NDRA 1HLDA 3MJ4A 1NPYA 3VOSA 1WMBA 3TSCA 2TMGA 4L4RA 3BHIA 2BFOA 4L4XA 1HYHA 2NU6A 2Q2WA 4FDAA 4Z3DA 4J1SA 2X5OA 1JKFA 1QP8A 5TRTA 4MVJA 3JYOA 3NTOA 3UCFA 5JXWA 5A4DA 2W8ZA 1E6WA 3GG2A 4JJFA 3VPXA 1H0KA 4EYEA 1FDUA 1EDOA 2HMWA 5F1KA 3BTUA 4UUMA 1BG6A 2BFMA 1KVQA 4CMAA 2VZ8A 1HE3A 1YXMA 5L4LA 1R0KA 3VH2A 4CPDA 4B3JA 1E5LA 2YY7A 1UDBA 3LF2A 4J0FA 2DFVA 2H6EA 1ISJA 2ZB7A 3IIEA 3R0IA 5KTKA 2BRUA 3JQ8A 3IJRA 3CPSA 4YJHB 4IMPA 1G6KA 5CEEA 2JCVA 1Y9AA 4IIUA 4GVLA 5B4UA 2Q50A 1X7GA 4GAEA 1P1RA 4K26A 1RPNA 4I9HA 4BKQA 2Y1FA 5C7IO 1ZK0A 1LUAA 1BW9A 4Y8VA 2HRBA 3OJ0A 2O2SA 3B1FA 4FOOA 2CZCA 1NHWA 2BI7A 1J4AA 4FQ8A 1P0CA 1BDMA 1DBVO 3M2TA 2VWGA 2FWMX 4CMBA 1VL8A 2WEKA 3UW3A 1C0KA 3DBLA 3KZVA 3ROMA 4FFLA 2FSVA 1XA0A 1A9YA 2OZPA 4U0KA 3S1LA 2YHUA 1WZIA 3LF1A 2W90A 1RM0A 3KO8A 1M67A 4E5YA 3ZWYA 1B15A 2C2XA 4R68A 4BMSA 3K9QO 3AI2A 3ROKA 1O89A 4OL9A 1R15A 4OOEA 4RF3A 4NR0A 4ALIA 2FHSA 2G82A 1HDZA 3UCXA 1R37A 3EVNA 2HMUA 2G17A 1IPEA 4PG5A 1K6IA 1I0ZA 4XD2A 2FP4A 4Z9FA 3Q2KA 2ZTUA 4AFNA 1LNQA 4BKPA 3KXDA 2WE7A 5CAEA 1I10A 3GPDG 3VVBA 5DP2A 3P7MA 2FN7A 3DZHA 1OAAA 2RHRA 1JWBB 1JN0A 4I5GA 4DC1A 3Q6IA 3S8MA 2VYND 1I5RA 5KVVA 2Y05A 4E2YA 1XYGA 1PJCA 1X0VA 3TZKA 2G1UA 2VQ3A 1LLUA 4OH1A 4FN4A 3QVXA 1NASA 1HE5A 3S55A 1W73A 4NU5A 5EESA 3WWYA 2JCXA 3I9MA 3JQDA 4LVCA 4OXYA 3S2EA 4J1TA 5JCJA 2O50A 2EERA 3PJFA 4BNNA 4E5PA 4WJZA 4WECA 5TJHA 2OFPA 4O0LA 4N54A 1QSGA 2JL1A 4PVCA 4JCOA 5JDCC 2Y1CA 1BXGB 3QHAA 3DZIA 2IYOA 4EUFA 2GERA 2DBVO 3O8QB 1I32A 4RPLA 1F0YA 4CR8A 2PNFA 3I9JA 4BKRA 3RVDA 4IDDA 1U5AA 4D45A 4K9DA 3DMTC 1H9BA 2IXAA 3GHHA 1E5QA 1J49A 3MTGA 4CMEC 1GU7A 1KBZA 1DFGA 5JSFA 4OHUA 3WNVA 4E5MA 4DMMA 2NU9A 1F14A
chains in the Genus database with same CATH superfamily
3FPEA 2XNKA 4MRSA 1X86B 2PMBA 4H7HA 5HTOA 2XCOA 2GTPA 4D6XA 1V45E 1U4OA 5KTRA 4D3YA 5KPDA 3JXEA 3HHEA 1K8RA 3GB9A 4IJQA 1GGHA 4GFDA 5CM8B 1WUHS 3TZLA 5D84A 5ERGB 4Y6LA 3CXUA 3TZ6A 2JH9A 3OG9A 4Y6GB 4TS3A 3OY2A 3EMBA 1SXJA 1Q20A 4Q7QA 1IG0A 2XTAA 5HKLA 5K8VA 2WSYB 4BB9A 5FP0A 1A7AA 2OUIA 4OUDA 4KQ6A 2KX7A 5I5GA 3KSAC 2P79A 2ERXA 3DBOB 4Q9HA 2PY6A 1Q2UA 1Y7TA 1KOLA 3U3XA 3ZDZB 4CQMD 4JI7B 5JJIA 4CFZA 1XKXA 3GLGE 5CR9A 1N6LA 4MS3B 2ORYA 4OF4A 4ZIRB 3C3DA 4UDNA 1SD5A 5BR1A 4JT9A 2IZ6A 2PWAA 3HPRA 4CBVA 2DKNA 4G0OA 1EXNA 2B1RA 4U00A 4BLWA 2E7ZA 1OA1A 2GN8A 1HM5A 3F4KA 4OHZA 3ROEA 4AUKA 2HK6A 3A9WA 1BCSA 3AHHA 1JQBA 4D2IA 2HIAA 1XFAA 2BW0A 3GOHA 2QA5A 4FKZA 1E7WA 1Z4IA 2H07A 2VHWA 1P0MA 4KBYA 5TMEA 3TI7A 4O4IB 2BH2A 2QRUA 1KKUA 2W6QA 4M7OA 4XLTA 2AQHA 2XDYA 4BQRA 1GZ4A 5JSZB 5E8JA 4D3XA 5DI3B 1FRZA 3QXCA 1FJXA 1MO3A 3M4JA 3KETA 1E8DA 1Z45A 4GL2A 3LUGA 3L8MA 4L3WA 1NNSA 5SZIA 1XI2A 3TSAA 1YVEI 3HSKA 1WULS 1DJOA 1OREA 1IBMB 3OKCA 1NI3A 3U1BA 2YQ4A 4KR2A 2VCHA 5L3SA 3FCEA 5K6AA 1T36B 1C4WA 2O0MA 4G81A 2WYHA 1T43A 3ZGLA 3TUZC 4R98A 4Z49A 1T3TA 3K92A 3MJVA 4FZVA 1YF3A 1OLXB 1OF1A 1Z6AA 2PX8A 2EFEB 4M7PA 5E2BA 2Q1WA 1U28A 2A35A 2HIGA 3V3KA 3NW9A 4GOND 5H8WA 1IH8A 3T0FA 3DKPA 2JI8A 3ZNPA 4G5OA 1LVHA 2ZBVA 1E1MA 1FU7A 1ST2A 4UTZA 3Q7SA 4IXTA 2H29A 4HXFB 4DRXA 3KOXA 3TMKA 4JLOA 3GZNB 4JQCA 4UEOA 2PGLA 2X7XA 3BMQA 5AXAA 2IITA 2F3SA 4HN9A 1OAKA 1V9SA 3OJCA 1USVA 1TOAA 1OQAA 1XEFA 4P80A 5C46F 2C4KA 1I7PA 1WHTA 2C7GA 4XFDA 3FZGA 1F20A 3LUFA 3K0EA 3SX4A 3DB2A 2YVAA 2JZOA 3JYLA 2W9XA 4E03A 5K8UA 1TT7A 2KBEA 4FGJA 4YIHA 4RKEA 3AYXB 3T9FA 3TSYA 3DZBA 4UBKA 1CU1A 2F8LA 3QBEA 4YJ3F 2VHUA 3GJQA 2IW3A 3QHPA 5D3KA 3WO0A 3S7TA 3GT3A 3NEJA 4TLDA 4OQMA 4EB3A 2O6LA 5KNBD 3PKIA 5H7XA 2WK1A 1J0AA 3OZSA 4P4TA 2J9FA 2O3QA 2QRZA 5AVSA 1YI8A 1DIBA 3PHGA 5DT2A 2DT8A 1NXWA 3I5MA 4PNEA 3OWXA 4OK6A 1RMYA 5AIAA 4OCZA 5E1OA 4J2OA 2HFJA 4HD8A 2JFNA 3L7NA 3A6HA 3UT0A 4HBZA 1U80A 4J0JA 3OQNA 1H2EA 3ROXA 4FOSA 3S81A 2CDNA 5K0SA 1KQNA 1EFVB 2ZWMA 4B4KA 4E88A 3JATA 1UOPA 3BBLA 1TUBA 1SHJA 5EHQA 3Q8MA 3RABA 3PTAA 3U9LA 3W8RA 2YHSA 1GQFA 4L5CA 2FPPA 3QF4A 1E2UA 1H22A 1VKJA 4QPCA 5MF6A 4NOLA 2BDUA 2IK8A 2QX9A 3ZWQA 1MA3A 3KSMA 4M49A 3DE0X 3DM9B 4ZV4A 1LLFA 3CIOA 5GVSA 3JYNA 3A6LA 2A14A 4JAVC 2ZUBA 3WK7A 2WYWA 3THXA 1P77A 3G88A 5CCEA 4IXWA 4KPUB 5F73A 2FDRA 2FZLA 1FVXA 2G08A 3DKVA 4REOA 1KI7A 3TRIA 1N2SA 1N9GA 4NULA 1N3LA 3T7JA 4ZDJA 2P1RA 2XECA 4JC5A 4BPRA 3NT2A 1T2DA 3NI2A 1F48A 4LRQA 1U2SA 1CR0A 3EXHA 3VUFA 2ZQ5A 1ZMOA 1L5HA 1M2EA 2GZHA 3IB6A 4DV3B 4PRYA 1D9ZA 3WB0A 1NFRA 1VL1A 4BMDA 4ECAA 3DHYA 3DSRA 2BSXA 2HD4A 3B52X 3QUSA 2ROQA 3DO6A 4ACBA 3IO5A 4ETWA 3LT1A 1HSOA 4UUBA 1XLTA 1UBOS 3NHRA 1ZZEA 2OZLB 4UKDA 3CF4A 1T25A 1RI1A 4EB6A 1PYGA 3VAYA 4LF7B 2IHZA 5I8ZA 4MJ3A 2C42A 4CV0A 4DDWA 1GUAA 1WMFA 2IDJA 1ACLA 2GBLA 1UQTA 4LOJA 5TXGA 4WNAA 4HRYA 1W8IA 2VJLA 2Y2VA 5EP3A 5H83A 2Q2OA 5H3CA 2CY0A 3ZWAA 4DBZA 4Y18A 5AVXA 4PZ0A 4Z4EA 4DQKA 5AJZA 4OK3A 3GQBB 1YMUA 4Q21A 1RAEA 4J2TA 5AKXA 3RBVA 3NMUF 3BB1A 3EHDA 3PTZA 3SZLA 4L4SA 3IIIA 1E98A 4YCDA 2EKZA 3V4PB 1HZJA 4LDNA 4ZCPA 5K3DA 2ONJA 4W5NA 3HYNA 2V59A 3GHYA 1BQ3A 3LX8A 4B32A 4NIMA 1FLAA 4QYMA 4DCNA 2MSWA 4AP5A 2FGKA 3ZE9A 4YXWD 4K1XA 4AN0A 3L1IA 4H4EA 2X9VA 3P26A 4HZIA 4WUTA 3U48A 2A0KA 3BFXA 3KJIA 3WL5A 1EK6A 1S8FA 1UIMA 3GO4A 3M6WA 1MC8A 2OYSA 4D3ZA 4WJLA 3PHLA 2L69A 2I91A 4FYWA 4EG3A 1C9MA 5BUCA 4B6PA 1J39A 1P4AA 4WK2B 4LXUA 3T7RA 2JJYA 4XQ0A 4EIWA 3V00A 1N25A 3UAOA 1GAJA 2C3OA 2GAOA 3PFNA 3J7TA 3QVJA 1TFUA 2VBIA 1LK7A 5BOVA 1LS1A 1N3BA 2GJ4A 3N5CA 5HDQA 1EFLA 1ZPDA 4IEEA 1A9OA 1CUIA 1T2AA 4GD3Q 4IL5A 1KQFA 4I9GA 1U1IA 4GX1A 1KZHA 1K7XB 4CR7A 4DOMA 5BN1A 4P81A 4FS8A 1E3QA 1MBZA 1TMGE 2R96A 3F97A 1KVUA 5HKKD 4DIDA 1GVHA 3RSZA 3F96A 4JUBA 4M99A 4AJOA 3ZHVA 3UMCA 4K8OA 1H0RA 2AHOA 1G9TA 1I2ZA 2HQBA 4GX5A 1NMXA 3FCSB 1QKJA 3VTFA 1HG0A 4KQWA 5L7WA 3PSHA 3VNSA 2BE9A 5CUQA 2IU0A 2P4QA 1ZVJA 4XVUA 3MXOA 3OZTA 2E89A 1Q1BA 5FRDA 3S5UA 2OXIA 2NM0A 2APJA 3WGHA 1JT9A 4FGUA 3PHCA 3QY0A 1P5FA 4HF7A 2HREA 3COZA 1ECFA 4GPBA 4RK1A 4N3NA 1BVYF 1Z0JA 2JEOA 3E35A 1GPH1 4XGRA 3B3FA 3UJNA 2W58A 4D8UA 1RP7A 2P9FA 4M54A 4OGLA 3W34A 4DM4A 4DQDA 2X19A 2X9LA 1ZUHA 2AXQA 1QH9A 1FF9A 1QWOA 2IZ5A 1MIOA 2QZZA 1EFPA 2YYSA 1J8QA 4RABA 3KV1A 1BYUA 4RJ2A 4WE3A 2Y0EA 1QGUB 4K6HA 1WDMA 1XE3A 3FPGA 3H99A 3I92A 5COAA 5CIYA 3HWX1 4LKOA 2JLCA 3TH5A 2P1ZA 4UPEA 5IC6A 4W63A 4TSRA 2FEPA 2ZEJA 3SC6A 5IJAA 2PRKA 3PNBA 2QTNA 3T99A 2X5XA 2IUEA 3N0XA 3P2MA 2VUIB 2C3MA 4WJKB 3IKTA 4RZXA 4MNTA 5IAJA 3S7ZA 2QGFA 4YUXA 4Y9DA 3PCXA 5AJWA 4YV1A 2I6TA 4NVRA 1F06A 5LPNA 5BMVF 3PJDA 3BJIC 5EZQA 4RDCA 5I7UA 2FCRA 3H9QA 3KHUA 4MQ4A 1ZUD1 4GMGA 4W1SA 3W90A 2VF2A 2XOEA 4JJ6A 3IRUA 2QX8A 1DC3A 1WP4A 3DE3X 4R4JA 1K66A 4OP1A 1R12A 4YPFA 5HFNA 4Z0HO 4XUCA 4ZD6A 1Z75A 1ZRHA 4UPVA 1ZH0A 2TYSB 5JRDS 1AN9A 4KNYA 1RPTA 3C6KA 3FKSD 2F67A 1FNNA 1YZYA 4ALNA 4QFMA 3THOA 4B87A 1SEPA 5LXTA 3CR8A 1V0JA 2VAMA 4I36A 1JYFA 1JHYA 1HEUA 3MCTA 4WA7A 1G6Q1 1N34B 4Z0PA 4C0LA 5H5JA 2X0DA 2CUNA 3UMVA 3H1TA 2ZYGA 4R51A 3SDBA 4P34A 4KN9S 3T7IA 1S4QA 4GI1A 4CQNA 4P83A 1XQXA 5BWLA 4UUNA 4W7HA 2PKWA 3H4MA 4XUDA 1JKXA 5TJ9A 1LPOA 5LDGA 3JQAB 3AM4A 3RVBA 4RHUA 3TJMA 3QPWA 2WAXA 4C2TA 3I73A 4X84A 2QQ0A 1YQEA 2CHUA 1UZUA 1V8PA 3L7AA 3EVFA 5IDWA 1XCMA 1U2RA 2B4TO 4N82A 4EY8A 3F90A 2YXLA 4XZ3A 2F48A 1V5IA 1X9HA 3CZ4A 3M0EA 3NIBA 1E2FA 3HZZA 4JR1A 3ZTYA 3B3JA 4NMHA 2CVPA 4PQFA 5MDHA 1IYZA 1EGAA 1HY3A 4G0NA 3E9DA 3CNOA 3WWZA 1Q83A 4RGQA 3PD0A 1BXKA 4GI5A 2XMGA 2XDAA 4MW0A 4NZNA 4UFNA 5A06A 3IJEB 2I6XA 3PR1A 4FJ0A 5J23A 3I61A 1HA3A 3RFUA 4HUQA 1T8PA 2RKOA 1XD2A 2M6RA 3JQFA 4FFBB 4AQYB 5KPJA 2HMAA 1HYEA 2W2QA 1T9BA 3UMGA 4ZHQB 3LO5A 4J1QA 1J2EA 3F7NA 2GPYA 1I0IA 4EUNA 4Z2AA 3G9UA 5CFPA 1GYQA 4RE5A 5AVJA 4DCJA 1IDN1 4OQ4A 1JBEA 2C61A 3NKLA 4FP9A 5LP6A 1GR1A 1ZU5A 3H1BA 5AVWA 2FFAA 2NO4A 2C07A 3WBJA 1HDRA 1YBVA 3HP4A 3LUCA 2W8BB 1BE6A 3MCVA 4TV8B 2I2CA 2XNJA 3JQFC 3PC6A 4JI5B 1G21A 3E3NA 2AYXA 2XQKA 4C4TA 4X1IB 1NVMB 1NE2A 2FLWA 5HF9A 3SBOA 2CV2A 1I3MA 4KPFC 3U26A 1YR1A 2CNNA 4BQQA 3DMYA 2ZJ8A 3UUWA 3M83A 2HU5A 3KHSA 1GG8A 2XUAA 1FFEA 1RM5A 1ZCZA 4UE6A 5ALMA 1W1IA 4FW9A 3O38A 4WNIA 4CKYA 1SQSA 3K9LA 2EJVA 3V3TA 2ZFUA 1BSVA 4G4JA 4I0WB 4X8HA 1KZ6A 1IMOA 3ABQB 4L8VA 5AVOA 3T15A 1AD2A 1NF3A 4M22A 3I2IA 4XSGA 4MB6A 4YH1A 3S2FA 1G5HA 2DM6A 3GC6A 1FTNA 1GVNB 1X1DA 2RKWA 2J8ZA 3H9GA 4RW0A 3AEQA 3MUOA 1THMA 3VISA 3ADDA 2FZEA 5BRJA 3D54D 2PV7A 3B13B 2YV2A 4ZC1A 3T34A 4M46A 1IHOA 2PRIA 3VR3A 1U2GC 1BQ4A 4D4MA 5A2QA 2QRPA 2QOEA 3NJ4A 1DAHA 1Z0FA 4MPPA 5KKAA 3UMMA 3K71B 3DKRA 3RT1A 3C1UA 2CVZA 1LH0A 1H2RS 2XYQA 3BCSA 1NLFA 5HJEA 4CN9A 3L9XA 1E94E 1TPZA 4OI1A 1W5AA 2XRFA 2WAMA 3OFVA 1V37A 621PA 1I4TD 1XTKA 4GPEA 4NZZA 5IWAB 4KAXA 1N8NA 2H5IA 1LDGA 3EZ2A 1DKOA 3V2IA 3HKEB 4KWCA 1SC1A 1KZ1A 1VDMA 5HCIA 3FCUB 1NVUQ 3FPAA 4G86A 3V2HA 1MKYA 2JGDB 4Q4JB 2BFCA 2WPNA 3O8DA 5A5VA 3PQDA 1PWEA 4GZ3A 5AK0A 5KDLA 2FUG6 1XJQA 4TXHA 1ZGAA 2OE2A 3E3OA 3CCBA 1XLTC 3L82B 4MITA 3RK1A 3SZRA 4NCHA 4HVCA 3KZMA 1WXXA 2J85A 1ZBDA 3HVUA 3OIYA 5AESA 1I6MA 3HRKA 3SJAA 3C15C 1QHSA 1R6XA 1U8EA 3SCZA 4JWTA 1E3IA 2GN0A 4AMGA 1NI4B 4RACA 5KYXB 1XVAA 4M53A 4BO0A 3KLMX 2I67A 4IIGA 1NVEA 2ZSAA 1QYDA 2DVMA 4F71A 2PRZA 2R1UA 5DM70 1EJ0A 1P2GA 4LKRA 1VL0A 2CFSA 3R3JA 1PR2A 1NW9B 3FZEA 4ZT6A 4MGEA 3JRNA 3AKZA 3WB2A 4RSHA 1PU2A 3CBQA 3ESXA 3FGOA 4IFEA 4UJ3A 1GTL1 2ONYA 4DVJA 1CUBA 2P9GA 1PD1A 1KDYA 2WF6A 3A9VA 4ONEA 1CUHA 4QJ5A 1ZM4A 4US0R 2SECE 4BNZA 3KQVA 4NARA 2UXBB 4D4IA 1Z88A 2VQFB 2NVBA 5IEBA 2K5UA 1JF8A 3PLRA 4G0YA 2YXBA 5T4HA 1X42A 4JR0A 1P4JA 4D0SA 4H7KA 4R81A 2ZAMA 3ZX5A 2I2BA 2YH2A 3T9CA 3PHIA 5EIBD 4HLDA 5EMKA 3ZXIA 3VR5H 2XMCA 4HGQA 3N7UA 1UPUA 1VJTA 3OICA 3IP6A 3RVNA 1NW4A 4TWJA 4JENA 1PNTA 5FTNA 3D4OA 4QTXA 1T6BY 1V7PC 1MPTA 1H1LB 2OORA 4FKMA 3PLAE 1KI6A 3GEIA 2AOTB 2Q4EA 3LUKA 3DE4X 1EK1A 1U81A 1HT3A 2WSLA 3A4LA 3QP9A 4U5XA 5A5DA 1QC5B 2AZ4A 5JNVA 4N49A 4C7VA 5CB4F 1PGOA 4TUYF 4GR5A 1I1QB 1D0IA 3IPLA 4KODA 4R8VA 1WZUA 4W5HA 4D5EA 1E79A 5D1NA 1JRLA 3T1HB 4F5EA 1VYVA 2C82A 1A69A 3DEFA 3ZYZA 5F9MA 4IUBS 5ALJA 3BXPA 2H9YA 3CVWA 3ZXXA 1P1JA 2O8CA 3KWFA 2PGIA 3OTHA 3UAXA 4ND1A 2VUHB 4TYNA 3ROPA 3B5IA 4Q48A 3AOEC 4C2BA 1PBTA 5JTTA 1XCJA 4XLLA 1CCWA 2AX3A 3MERA 1TTPB 3RKRA 2W6ID 3P9NA 4UMVA 3I2GA 4HXEB 1GAWA 4LX0A 3RC1A 4D43A 2F8TA 4G9BA 1I3LA 3T5GA 4R0MA 2WD7B 3BTVA 3L6OO 2ZUEA 1EM6A 4CLOA 3ZHXA 3DLPX 4KXFB 2J5QA 2Q6OA 2P6OA 3L41A 3SM3A 5EZ5A 3N74A 4X20B 1I0LA 3U4MA 3AFMA 1B6GA 3WJ1A 5T4FA 2WMYA 3C6MA 2ESRA 4JQSA 5KVCA 2OCKA 5U1PA 4TV9B 2AYYA 4NJMA 3CBGA 2D74A 1XEWY 1AKEA 2NPIA 5CW1A 3UNXA 1Y3AA 5EOVA 5LQJA 1C2YA 1HLPA 3A1NA 3AEUB 4RM3A 4WK6A 5FWYB 4OB6A 5BW6B 1Y34E 3LT2A 3QH4A 4H3KB 5DIZA 1KWKA 4NNOA 2Z0MA 2ZRPA 4RU1A 1B42A 4D9EA 4JVLA 3OBIA 5LQUA 2P9BA 2C2MA 4Q1FA 3OOHA 2XVAA 4O5OA 2H85A 2QNIA 1N5OX 3EUAA 3QKIA 4U02A 4AURA 2FSIA 3FR8A 4K81B 3WBBA 1H23A 2R00A 1DB3A 5B12A 1M73E 3TNLA 2EEZA 3H97A 3SE0A 1GQRA 3LX5A 3U37A 1KY5A 5K3BA 3O2SB 1XXHA 3AL3A 3EUWA 2VF5X 3R5JA 4XVHA 1XNQB 1KK1A 2YV4A 5JNRA 2PD4A 1M6HA 3A11A 1FL9A 1KPIA 1ZRMA 2XYGA 3RT7A 4NFYA 2W7TA 4RKYA 3DPIA 4NONA 4WOJA 1F8FA 5AI9A 5AW0A 4ZOAA 3H9JA 3G0OA 4KUEA 3OTQA 2B82A 2H0QA 2E37A 2C88A 2UVPB 1Y0BA 4E5NA 2IH2A 4QGFA 3DDZX 2MT9A 3PPXA 1GG9A 4B3CA 1IHUA 2OR3A 4IJKA 1JAYA 1SBNE 1T9GS 4CEJB 2H2IA 3TFOA 1WJGA 2PZFA 2AG6A 2O4CA 1H69A 3LUDA 3H2HA 1XBTA 2NADA 2VA9A 4Q3NA 3GPLA 2QGNA 1G4UR 3AB7A 3B2QA 3V8RA 4PANA 3MNFA 1JHZA 3L2OB 3GUZA 5EQJB 4LE0A 2BM1A 1PEYA 4GVPA 2D4AA 5EIAA 4LXIA 3CF0A 4D9NA 4LDAA 5BWNA 1CS0B 1NW7A 1LC0A 4K3UA 3RFCA 3WWOA 4DMRA 1AOXA 2UZ1A 1E3WB 4XD7D 3FBWA 1K6MA 4LJ9A 1L1RA 4RZ2A 2ARKA 4MQFB 5DEIA 5IEJA 3ZZNA 3OZ7A 1IPFA 2H7YA 2WUFA 2H54A 3R44A 3ORHA 4P7GA 4Z4HA 1OYWA 2R6CA 3JSAA 1MTZA 2FEOA 4AZSA 3TYXA 3M1AA 1A4RA 3GRPA 4B33A 5CXQA 3A31A 4DILA 4WPGA 1SBYA 2NPOA 3GJ4A 5LA6B 5LZ5A 2TSYB 2W22A 3IBGA 3MXTA 1XMSA 1ZIOA 4I46A 2AG1A 2PVPA 2IS2A 2QZSA 4AF7A 4Z0NA 4TL6A 3DMHA 1TQ2A 4LXGA 5JSQA 5JQWA 2BHRA 3TRKA 1HTBA 2R8PA 1OZAA 3DO8A 5G0TA 1XZLA 1RWKA 4P98A 2RMKA 1E79D 2YW9A 1NJSA 1WP9A 3MTQA 2ZIXA 4CHTA 4HI0E 1NVWQ 2R47A 3QVMA 4XIFA 2IDKA 4YNBA 4N3GA 4O8ZA 5CJ2A 2EP7A 3JQ7A 3KQYA 3R3HA 4LMRA 3DOEA 1T8UA 4PAMA 1IM5A 2HA4A 3D31A 1QQTA 3RSOA 5DWDA 2H06A 2GAFA 2YJ3A 1D1QA 3C8UA 3LYUA 2QLBA 3EZ9A 4E31A 1OGIA 2WD7A 2H2WA 3B6EA 5C8YF 2NV2B 5A7GA 1UP6A 1KWGA 4MWCA 1CR1A 2H7VA 2HX1A 1JEDA 2WP8J 2XGGA 3E9EA 3ELUA 3ZNQA 3ZZ1A 3GEDA 2AUNA 2OT3B 4W6QA 5GOTA 2Z2YA 1SZDA 1LS6A 1Z38A 1C0IA 2JGIA 1NQ5A 1IY0A 3A9RA 4M0FA 4W1RA 3JU3A 4GX0A 5JZSA 1CR4A 3CN7A 1XU9A 1WEKA 4EB0A 3BJZA 3EH2A 5T67A 3ZUPA 1SKUA 4F46A 5K51A 2XITA 3VOBA 4QSHA 4ZEXA 2JFXA 4W9NA 2QRVB 1G20A 3EGEA 3P9IA 3ICVA 4R1PA 2XTMA 4EL0A 2ISQA 3A3PA 3SLKA 4P38A 1EVZA 4UEWA 4URZR 2Y6UA 3JR7A 4X6YA 2AS0A 1N0UA 2PXCA 3WJ7A 2EJCA 3WIDA 3OTIA 3UEOA 1PQUA 4EG0A 2CB0A 2XIJA 1OFTA 5JEDA 4IHKA 4WCDA 1JDJA 2ERCA 3U49A 4D46A 2ZYIA 3HSSA 1GN9A 4D9BA 5F9FA 5J1SB 2D59A 4DANA 2H8KA 2GO7A 4YECA 3TWOA 3VJRA 5BPHA 1QORA 2PUJA 4Q39A 4N0EA 1ZISA 2CD9A 3LOUA 4OU5A 2OXFA 3CKKA 3QE4A 3X1JA 4KRXA 4PU0A 2JKYA 5JYCA 1JU3A 2YFQA 4DDVA 4HRAA 5E9WA 2YKGA 1JDVA 2JBHA 5P21A 1MZVA 3GVHA 2FP3A 3IVMA 1NZDA 4HCJA 4XVQA 2RHOA 1Y37A 1RAIA 3FR7A 4PR3A 4Q03A 2JH8A 2K2QB 1QFZA 3PUKA 3MINA 4Q7JB 4RJTA 5LZ2A 3W4JA 3FCXA 1T6NA 4QSMA 4F3CA 2WSSA 4KOAA 4QXQA 3DZCA 3DVRX 2P3LA 2CF5A 2W83A 4PBRA 1CJUC 4WLOA 1TYCA 3GLFE 3UVEA 3BHJA 3OZGA 3ZE7A 1QNFA 2PANA 2QPAA 1E7RA 1FDSA 1LSUA 1DKMA 1GFWA 5FUYA 3PWKA 3QW4B 4FQ5A 1ZD3A 5EE3A 4NMLA 4WXRA 4RKQA 4I3HA 1ZS9A 3QU9A 4S04A 3QBTA 1SHTX 2YWBA 4YJ2B 1CS4C 1RQLA 4KO1S 4KIWA 3CQ9A 3PUHA 4A8JB 4IICA 5K8TA 4Y9TA 3LYLA 2FPUA 1XX6A 4M1ZA 4P3KA 1SKQA 4Y2VA 2C92A 3SJBA 1N2HA 1F1BA 3P9ZA 2B5OA 4KV7A 1Z5NA 3SZ3A 1W36C 3SYRA 3SQNA 2G83A 3GRKA 3I3SR 3EODA 1QGUA 3SJUA 3P4YA 1CUFA 2RG7A 2IZ7A 1H8EA 1LLCA 1QFSA 2Q0QA 4X0EA 4RETA 2AW5A 1GNPA 4YONB 5AXDA 3D0KA 2XKBA 3FTPA 3R9XB 3PNMA 3KVOA 2FPKA 3QJ5A 5GIPE 3TKAA 4MUMA 3QFFA 1FPMA 2YRWA 4HLNA 2MYTA 5SY9A 1SR8A 5DNDA 4EENA 3NBXX 4B3DA 1LXCA 3DHNA 2CNBA 1L5QA 3JZMA 4MR8B 1QAMA 5DFAA 1FTSA 5A5FA 3L1UA 4LNHA 3ET4A 5TMPA 2LIVA 5BW5A 1SCUA 1DOAA 1T4MA 1W6RA 1X19A 3DBHB 4FPXA 5JSYA 3V33A 4V2IA 3H11B 5AJHA 4EPTA 1KJNA 4GDMA 4PZ9A 3HV0A 2B3DA 1LKZA 3ZIUA 4BQSA 4OQPA 1ZK4A 4GI7A 5A05A 4Z2YA 4DUYB 3DEKA 1QG4A 3T5TA 1OV4A 3BWBA 4CIWA 1OE0A 2Q46A 2R1TA 3KVNA 1OZFA 4JZYA 4MTLA 4O4LF 5KWSA 3A04A 2UV8A 1ENPA 4V0MA 1W5SA 4JOBA 4RHTA 1N2JA 1B2LA 1OT3A 1Z4QA 3HXLA 1W4AA 1GPKA 2OEPA 2VEDA 4FILA 221PA 4GMFA 5EE5B 3BGSA 3F47A 721PA 5AD1A 1LBQA 3HU3A 3QWBA 1XDGA 1YS6A 4FZ3A 3I42A 3C3JA 4HQ0A 1P0FA 4M87A 4N1AA 5HHTA 3T4EA 4BO4A 1GTZA 3C39A 4CM4A 5EHZA 1CB0A 3G6WA 4XWAA 4EZEA 3AC0A 3JPYA 3QMVA 2QYOA 3LBHA 2R2AA 4YRNA 5C5IA 2DBZA 2KLBA 1E77A 4E0BA 1X70A 3OLYA 2ES4A 2OLJA 4JEIA 1BQEA 1G20B 1ZC4A 3U2QA 4MQUA 1GO2A 3DUWA 5EWMB 4HNQA 4DYDA 5LNK1 4I1YA 2VCYA 3VHXA 4QO7A 3MUEA 1QFXA 3DO5A 4D3SA 1WW3A 3B78A 1E2MA 5B6JA 1M1YE 3T6KA 1J8DA 1GKIA 2ZJBA 1IL0A 4C03A 3W6UA 2XYVA 5C1BA 2I7CA 1OA0A 2W2KB 4QRDA 5LQDA 3VR1A 4MUXA 2J9FB 4LV8B 1V96A 1TEXA 4FK8A 1B16A 1Q3HA 1MGPA 4FGKA 4C3ZA 4R6XA 2FA9A 3OE5A 3GW8A 4KFSA 1ZM7A 4H1UA 4X63A 3E5RA 3AJ8A 3NR2A 2WQZA 1LSSA 2PR7A 4TTTS 5KNDH 3KQLA 2R4TA 3BMXA 4ES6A 4CDMA 4CIBA 1A8HA 2C8JA 4PLVA 5EZSA 2ILVA 1UMBB 1YQXA 5KHLB 1WKVA 1G19A 1QCZA 4MAFA 1X7ZB 3P0JA 2Q0XA 3I4CA 2HU7A 4M0EA 2FUEA 2JIMA 4DY4A 2LR0A 2Q21A 3A4NA 1XF9A 1JKIA 4TT8A 1T9DA 1UBTS 2FW7A 3B5JA 4H6VA 1LPPA 4DE5A 5IDQA 5EJ2A 3VV3A 1OWLA 4EG1A 3H5OA 3KD2A 3DD1A 3HNRA 5H70A 4IIYA 1X1CA 1NJFA 1P19A 2CWWA 1DO0A 3LUAA 4PCUA 4ER7A 3HB0A 1U1EA 5HP4A 3HZHA 4FUTA 4OTZA 3C8DA 4FWIB 5KNCA 4P8RA 1Z7EA 4PC2A 5I9IA 4OIMA 4TYYA 4CF7A 1E9CA 3GEHA 4MRMA 4XB2A 1RXVA 4G5FA 4MO9A 1DRVA 3GJSA 4NFHA 5DN9A 3ZTTA 4DC0A 1YGYA 4AKHA 1KR2A 2CDRA 1Z35A 5ALRA 3RC2A 4BNKA 2CJXA 1ZGJA 1CRPA 2ZWVA 3TLAA 4KXQA 1I1HA 1MQAA 4TRNA 4OXRA 4HADA 1ABEA 4ZVMA 3RYFA 3I34X 3K1ZA 2BFEB 4K6CA 5L9AA 3OZRA 5BSWA 5IASA 4NYIQ 2R85A 1R0ZA 4OEHA 1O96B 2XGMA 1C7IA 1DHRA 4MIOA 2PMFA 5CHYA 3GIWA 3VTKA 4RS3A 1SCIA 4I50A 4RY2A 5FLEX 1E64A 3ZD7A 1YCFA 2QVCA 3PD1A 3CTMA 3FYTA 3E0XA 3O7WA 1UJMA 3E1KA 4BGEA 5LIRA 2J3JA 3EG9A 4O5AA 1OU0A 2ZIXB 3HDVA 3Q7IA 2NZJA 4OHPA 3RW9A 3NBAA 4DHEA 1QAQA 2KMLA 4MCJA 1U3DA 2ZSFA 3LCRA 1L4UA 3Q9SA 2IGBA 3TCXB 1XYYA 1T2UA 2OHJA 3FLMA 3T54A 1GUDA 3C3XA 3RAFC 3ND8A 2ORIA 2XB9A 3OJFA 5IYZF 1SNYA 1N0IA 3RYIA 2CFIA 1PYDA 3I64A 2R68A 5KVQA 3TD6A 4IOMA 1RWBA 3N75A 1A95A 1DAKA 2EYQA 4DJAA 4HQFA 3PBKA 5J2UF 5LDDC 1SU7A 4O59O 3LDGA 1KERA 1CK4A 4YRGA 4W5JA 3U5TA 3QXHA 3I8OA 3KDAA 4XX1A 3S3TA 3TLGB 1SPBS 5DBHX 1AQIA 5IVHA 3L5KA 4XYBA 1MU0A 2EQBA 3OU6A 2JGJA 2I7DA 1BS9A 4B3TB 3WLRA 1WBBA 2ZRJA 2HCJB 3E3LA 5CB0A 3BWVA 2DECA 1N8SA 3PHBE 1Y8ZA 4QFDA 2CBXA 1PE0A 3ES9A 2AR0A 4R83A 4RULA 2B94A 3OWOA 3D8HA 1GQQA 2HK9A 3THYB 1O95C 1UDCA 2YWXA 3KT6A 4QYIA 3K6SA 1Z33A 2Q5IA 4TWRA 2PA3A 3H04A 5HBGA 1W9HA 2FF7A 2Z57A 4BGVA 3SHOA 2EZUA 1PZHA 2ZVPX 1L7VC 1MVNA 2DKFA 3E9CA 5ALYA 2QT0A 5GZ6A 3EXG1 2QR5A 4Q3LA 4R2MA 4YJ2F 4P7KA 3QXGA 3GFPA 4B7UA 3LW7A 1FP2A 3EEBA 4Q4HB 5EKUA 4QLBA 1EX9A 5EWJA 5HIAA 1Q7RA 4IFTA 2GPWA 3NRCA 3A4YA 2C3PA 2XWJI 3IH5A 1YU9A 3BB4A 4YP6A 5JLAA 3KSUA 1F9EA 5CCXA 4BJ6A 4ALLA 2DR0A 1U7OA 4AQ7A 2UUCB 1CUEA 4HAVA 2FR1A 2NVUA 2XT0A 3KB6A 1UBLS 2NU6B 1DZIA 2VSXA 4KAJA 4ZV7A 1AKMA 2GZ3A 3K1AB 4D9KA 3AU9A 4ON9A 4XGIA 4KL8S 3HRIA 2RGXA 4IFIA 4XIIA 1CUSA 2PSFA 3NTXA 4C4SA 2YZNA 4R2JA 5CNKA 1HT2E 3I52A 3I53A 5I9BA 5JJ5A 3HGMA 2ODWA 3PQ5A 3MBOA 5HEKA 3ZK8A 5JHGB 4KR3A 2GDZA 2XHEA 3PYXA 1U4SA 3QEAZ 1W1UA 5BV2P 2YHAA 3T1VA 2P0YA 3FZNA 3LDFA 3BAFA 3VZDA 3KR1A 3V6MA 4RPKA 2CBGA 3X1DA 4GM4A 1RPAA 1ZD5A 4JBLA 1QV7A 2RCYA 4L2IA 4NENB 2P3SA 2IKSA 3H1FA 1L7BA 4RLFA 3S2ZA 2LBPA 3DHWC 3JTMA 1I5OA 3QUBA 4C7OB 1TU0A 1M0EA 1Z37A 3LXUX 3WNZA 3S4YA 4D44A 1FCJA 4W5WA 3U17A 1YK1A 3Q41A 1RJ9A 3RF7A 5IAOA 2DG2A 2MIIA 1L1EA 3WFIA 3ZDDA 1M1XB 1NVGA 2NVWA 3KFXA 4QU0A 1XDBA 2IXTA 2W8BA 4AJNA 4INZA 3U6KA 1Z08A 3KTAB 4G1UC 3MGKA 3ZLBA 1RWPA 4WDRA 2QN1A 4GQIA 1HETA 2O8EA 1GPMA 3FH0A 5AOAA 1FYDA 1RTTA 3EFEA 1JDBC 4UULA 3ORRA 2PX4A 3HJBA 1SY7A 1JR6A 1FE8A 2DRIA 4OGFA 3QMMA 2E4YA 4RC9A 1TKCA 1IONA 1QH0A 1TJ3A 2ZI5A 1IZ9A 4BO1A 1G8GA 2ZSKA 4X1KB 4WZ6A 1V11B 5KOJA 4M6WA 1KP9A 2H1CA 4RFSA 1M2VA 2XA2A 1AT1A 4ZPXA 3WLSA 1AJEA 1GU1A 3MELA 2YVQA 2I87A 3QX9A 5FWXA 5CDYA 5IH7A 4WZAA 2PZ8A 4KGXA 3RUFA 2O3SA 2KWIA 3G82C 3WLMA 4IDFA 4ZV9A 2VTBA 2V5UA 2ZYAA 1TLLA 4EW3A 4MV1A 5HIJA 3RK4A 3H17A 1PJQA 4KKXB 4LW8A 4XQCA 3PNSA 3QBVA 4ER6A 5CLIA 5AJYA 3IUNA 5IABA 3M4ZA 3LXRA 4OH7A 1POWA 4Q4HA 5KTSA 2HWXA 1KVTA 4ARZB 4IDBA 1FS5A 3OSZA 2PUAA 4YRBA 5K0ZA 3JQRA 2A7QA 2HRZA 2W4IA 3VAAA 3SZGA 1NSYA 2A1UB 3LM8A 3A28A 1EPUA 3AFHA 3CRRA 3KOMA 4WMLA 1M34B 1QTIA 4QYXA 3ZVLA 3G8DA 4OY3A 2VF7A 2V7EA 3VVCA 2FLVA 2XRMA 3KKOA 2BISA 3CUSA 3UHFA 1ATIA 3EZNA 4Q4JA 4JB8A 5AK4A 2FFHA 2NUAA 1AGYA 3NYIA 3FOEC 1ETHA 2ODQA 3CY6A 3LL7A 5DBGA 1P3DA 3SVZA 1U1FA 3WDMA 4B4DA 2RH4A 5KNDA 1X7XB 3JD2A 4RXTA 4PX5A 5AO9A 1ODJA 4JHXA 3KKQA 5ALEA 3TO5A 3N28A 1ZIYA 4CF4A 3OZVA 4X3CA 4PC6A 3M5DA 3ZHBA 4C1BA 2CXQA 3KFLA 2NYRA 2G9UA 3D0RA 3HGTA 1OI3A 4FOLA 4BJ5A 4CKZA 5B4VA 3BYZA 1P7YA 5IXSA 1D0VA 3KIPA 4BKMA 2GASA 1F6BA 4FHCA 4JBIA 5AI8A 3EYWA 2NO0A 3F3KA 4JJ7A 5ERXA 1EXMA 2EF0A 1RI4A 1WCWA 3OIGA 2O19A 3D7LA 4FSXA 2IOFA 5ESXA 1RZUA 2COKA 2W00A 4HDMB 5F12A 4Y1RA 3NP7A 3THSA 4TLAA 3OHPA 4B73A 1P5HA 2BYTA 5C8ZA 1LC3A 1K27A 1NI4A 1XC7A 1AU9A 2ZLBA 3DZJA 1SA0A 2AC4A 2IYPA 4MUYA 4P54A 3L4BC 5JNUA 4F56A 4DR2B 3NBUA 3DAFA 3DXZA 3E1SA 5KTYA 2NN3C 2CB9A 4YAFA 1M76A 1DIOB 4G0UA 4YT8A 4BMZA 1CY1A 2R62A 4Y6SA 5T41A 4HEJA 3QWHA 5FBRB 1R0BA 1UADA 3GJTA 3NCHA 4MW2A 3DBLB 4XQEA 4ZOBA 4DCTA 2HGSA 2OY0A 2Q3HA 3KBBA 2HCFA 2OGUA 2UDPA 3FVQA 3LPAA 3UMSA 3VU1A 4G5GA 1B4DA 3K0HA 3K0AB 4BEWA 2HF9A 5EI5A 2G88A 4JNCA 4ZOLB 4IVQA 1ZVMA 3HK2A 1G42A 1XCLA 2FMUA 1M1YA 3MVEA 4QWMA 4EGFA 3NAQA 4S12A 1G3QA 1RKVA 3ANYB 1Q15A 3AJAA 1BTOA 2VHEA 4MP6A 2ZB4A 1J21A 5L3SB 1PG5A 1ZY2A 5BMOA 2BOVA 2UU9B 2GRAA 4KLRA 1R50A 2CV1A 5FOQA 1Z4OA 4ZZ1A 2C7VA 2ZWPA 1NJGA 3D0OA 1RADA 5TV2A 2NUAB 5BQ5A 2EQAA 2NZXA 5F2NA 4HQ6A 1FBNA 1XZBA 2QL7A 2O57A 1IAQA 2W98A 4GPAA 1VHTA 3LKDA 4RA9B 3UWDA 4BNLA 2VP3A 3L18A 1U0RA 2Q1YA 3LUHA 1A4IA 1T4GA 2IHVA 4G1FA 4BDTA 2IY7A 3F4LA 4D4JA 4F91B 4F3KA 5JI2E 4O33A 2BH9A 4MROA 2XEDA 3GFSA 4W9RA 3DCNA 3L05A 1XQYA 3IVRA 2OVBA 1IHPA 1NLMA 3LC7O 2V7PA 3P32A 1V1RB 1BWPA 5DU2A 3D4IA 2Q8QA 4F8EA 4QTYA 5KUTA 3L7KA 1ISIA 2WHPA 1S3IA 4X00A 1C7JA 3MF4A 2ZPTX 2VPQA 3NEPX 4FOPA 2QDKA 2Z3WA 3FZYA 4NABA 4TQAA 5JNSA 1U02A 2HTFA 1EDZA 1OFUA 3G0IA 5KOHB 2FJPA 4Y7DA 5CB4B 2YMMA 1CQIA 1OBCA 3D3NA 3R3ZA 3C7TA 1PQYA 4Z0TA 1OLUA 4MQ5A 5J4KA 2WU1A 1INLA 4UOEA 4WD3A 2O0LA 1Q0UA 5JZ9A 2AFIB 2QUHA 4B3MB 4FYMA 1ND5A 5FA5A 3DJYA 5IJ9A 1DGQA 5IMBA 4Y2HA 1RYNA 3GY0A 1B2RA 1J1UA 1W4LA 3A3YA 4RAOA 4FLEA 3ABZA 1UJCA 1YRQA 3KYDA 1D03A 5G3YA 2OA0A 3T95A 3UQZA 4MUHA 4CFSA 3LSTA 3ZGNA 1L1QA 4DDUA 1HQYE 3H7IA 4OUKX 2C84A 1B14A 2JFOA 3E48A 3LBYA 5AICA 5JEEA 1PT9A 1ZHOA 4U9UA 3ESDA 3TVTA 4EB8A 2J5BA 4M83A 1NQUA 2QYSA 1N5JA 4B47A 4FEGA 3SXPA 2LCQA 1KEVA 1U0OC 3W8NA 4DY6A 1L5MA 3I1FA 2X13A 1RBQA