1CETA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
305
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRLDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 305
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cetA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1cetA02
3GAFA 2DKNA 1KY5A 4GWKA 1J4AA 1NQTA 5TSDA 1Y9AA 1NQOA 1U5CA 4ND3A 4DBZA 2DTXA 3Q11A 1HEUA 3ITDA 2C5EA 1XLTA 5A03A 3M1AA 5JO0A 3WYBA 1K2WA 3QVTA 4A0SA 4CJXA 1EBUA 3OA0A 2DBQA 1L7EA 3W4JA 1HWYA 4FGWA 3U4DA 1LTHR 1OC2A 4D43A 3Q0EA 4RORA 5JY6A 4B3IA 2W4QA 4DL9A 3BMOB 3BMQB 1UDAA 4KOAA 4P8RA 4OAQA 1DFHA 2I3GA 3T7EA 4RLHA 4NBRA 2ZYAA 1H6BA 4R9SA 1U1IA 3NRCA 5DNAA 1DAOA 3DTTA 4BNTA 2EF1A 1TLTA 2YDXA 1K6IA 2J3HA 3PIDA 4U0JA 4UUNA 4RVSA 4WPGA 1N2SA 2P2SA 1H2BA 2VHYA 1H9AA 3E18A 3GHHA 1NHWA 3PP8A 4KUEA 5LDGA 3RASA 1C1DB 1PTJA 2OL4A 4RQTA 5KVCA 5KJ1A 4QEDA 3D4OA 4QT0A 2FY8A 5KJFA 1JLLA 2IYPA 3FPCA 2J5KA 3ZV3A 1Z7EA 4TRNA 1PWZA 4WJZA 4QX6A 4XR4A 5FI5A 4WLEA 3LC7O 1DC5A 2OMEA 3F4LA 4IDCA 5LCXA 1PWXA 3QE3A 4AVYA 4W4TA 4AJNA 2I99A 3B1KA 4IS3A 5MDHA 4K6FA 5ENVA 3PYMA 1A71A 4IUYA 2XXBA 2NU8A 5BT9A 3AOEA 5L7YA 1M6WA 4FDAA 1O8CA 3L4BA 4DQUA 4YT2A 1HT0A 3ONEA 2ZKLA 1ZO8A 2IZ1A 4BV8A 2EKQA 2FOIA 1GEEA 3DQPA 1Z6ZA 4MP3A 5A06A 3VH2A 4MVJM 4RV9A 1ZEMA 1VE9A 4CLOB 2EHDA 4DYDA 1Q0QA 5TJHA 1OZAA 3CUKA 4B8ZA 1T1RA 4U6SA 4R54A 1EDZA 5JDCA 1I24A 1MP0A 1OI7A 4IZHA 2A9FA 5DP2A 1PIWA 2ZCUA 1AXGA 2JAPA 4RF2A 3U3XA 1PGQA 4IXWA 4PLHA 4H16A 4GX0A 1R0KA 4M54A 3DL2A 2CVOA 2CD9A 4GGPA 3K6JA 3Q2KA 5KKCA 1KC1A 4DC0A 2BFOA 1GQ2A 1GZ3A 2IXBA 3TNLA 3WGOA 3WSVA 5KIAA 4GVXA 4II3A 5FYDA 2GASA 3V1TC 3O8QA 4CV1A 1Z82A 1A7AA 4NIMA 3WBBA 3WGTA 4PLYA 5A05A 5TIIA 3E9MA 4RF3A 4K6CA 3UXYA 4BO1A 1DHRA 3M2PA 2DAPA 3V1YA 2X9GA 4EEZA 2LDXA 4FOSA 5DBFA 1B15A 1SZJG 2YFQA 4HP8A 1R66A 3WYCA 5ADHA 3PQFA 1BRMA 1NPDA 4CM5A 5THKA 1K5HA 1EUCA 4AJ1A 4BIIA 1GYRA 5FI3A 2VWHA 2GO1A 3Q3CA 4GLOA 4INAA 1UP4A 3RBVA 4ZRNA 5T67A 1PQUA 4WLVA 4E2ZA 2EW2A 3BMQA 4YWJA 4M55A 2DBZA 2JD0A 5F5NA 4FFOA 1LXCA 4UREA 2Y1DA 3OH8A 3RC2A 2BI7A 4RPKA 3D0OA 2YFHA 3JD3A 3PGJA 2HMUA 2D0IA 2NQ8A 3UF0A 2W2KB 3AJRA 1C1DA 1O95A 3EW7A 3WQQA 4RPLA 3L6DA 3ONFA 2HK7A 1E6UA 3QW2A 4UEOA 2VHWA 2BHLA 4R1SA 3WLFA 4U0KA 4KWHA 4OXYA 3IS3A 4CR8A 3R1IA 1E3IA 4PIVA 1YH3A 3JQEA 1LC0A 3PFFA 1H0KA 1KY4A 4GLLA 2VOEA 4I1IA 4R9RA 4B8WA 4EITA 1GQYA 1U9JA 4FOOA 3RC1A 5EN4A 3H9GA 3DAFA 4I9UA 3INGA 3RUAA 3SJUA 5KWEA 3K2EA 2GNAA 4DPMA 4IDDA 4Y67A 3HUDA 2QYSA 2Q2QA 1D8AA 2AQIA 3LT0A 3TSCA 3I4FA 4CQMB 3TDKA 5I7EA 2VHXA 2AE1A 2O50A 2ZTMA 5JBIA 1ZSNA 3MJEA 3SVTA 4E2YA 3D1LA 3MJSA 4EI2A 1IHYA 1NHGA 3JYOA 4Q9NA 4RVFA 4A26A 1Y8QB 1EFLA 4IIUA 3IIEA 2I6TA 2VRBA 5JYEA 2BI8A 2NV6A 2RAFA 2ZTUA 1ZSVA 3Q9UA 4XQCA 3LSYA 4Y98A 5T64A 3RU9A 1E6WA 2UUPA 2AEJA 4CLOA 1JAXA 1LJ8A 1R16A 3VAZA 3PJFA 4JBGA 5IF3A 1WWKA 4BHTA 1Y1PA 3BA1A 2DPHA 4WLFA 1W6UA 3W8DA 4M89A 2EP7A 3FI9A 3MWDB 2PKQP 2DM6A 5HA5A 1BXZA 4IBOA 3SEFA 2A92A 1TB4A 3GGGA 3FHLA 1ML3A 1N1GA 2X86A 4Q3CA 3HDJA 4W99A 4LVCA 5JS6A 3I9MA 4EEXA 5IZCA 1TXGA 3TWOA 3PVZA 1EVIA 3ROPA 3C7CB 4BNNA 2D8AA 3KETA 5ITWA 2YYYA 2B37A 2P4HX 1Q7CA 1E3LA 3NTOA 3CMMA 4KQWA 2DTEA 3GGPA 5KJ6A 2GERA 3D64A 1V8BA 4UVIA 5EQDA 4PLTA 3U09A 5A9TA 3M6IA 3PJGA 1WP4A 1IY8A 4CQLB 5TF4A 2WYWA 4PG5A 2WD7A 3VPXA 3ABIA 3VKVA 3UUWA 3K31A 5JMWA 4TMFA 4CV0A 3ZH2A 2UAGA 1HE3A 2V6MA 3H6KA 4IDGA 4B7XA 3S2IA 2GN6A 3TJRA 4ALIA 1ID1A 3E5RA 4M87A 4QUKA 1BG6A 1HLPA 2PWZA 3RFXA 4I9HA 2EKPA 4YT5A 4ZJUA 3C1AA 5AVOA 1WMAA 1AGNA 1QXSA 1T26A 5A04A 1FK8A 2W2KA 3PZRA 1ENOA 1R12A 2PZKA 3O26A 4NBWA 2IZ0A 1UJMA 5DCWA 3OETA 2HUNA 3RJ9A 4EGFA 3MJTA 4OHUA 5L7WA 2IODA 1YL6A 2WE7A 4JIGA 4IDAA 3WB9A 2X1HA 1PR9A 4BOYA 4MVJE 3PRJA 1NYTA 4JP3A 1U28A 3DBRB 4RCVA 4OMUA 3DOCA 4MVJG 4OJNA 4XQEA 1WXDA 5TS3A 2X9NA 3PWKA 3WLEA 3EMKA 2CUKA 5JCXA 4CM9D 4U6QA 3C1TA 1VL0A 4AJPA 4CQMA 4ZQBA 3MJVA 5I9LA 1P74A 1NX6A 4GI2A 2FR0A 3FBGA 5IDWA 1Y8QA 2YHIB 3JQGB 2AQHA 3ROMA 4R1UA 5BSGA 4RZHA 4U7WA 4DLLA 3ZV5A 4JBIA 3W8FA 2NSDA 2O3SA 3PTZA 1PJ2A 4IZIA 2JJYA 1T2DA 4J6FA 4PG7A 4BNHA 4Z3KA 2O7QA 4ND5A 4DQXA 5KVSA 1LRJA 2NTNA 1KYQA 2B5VA 3TZCA 4J16A 1ISHA 1MV8A 5CP8A 1KVTA 2PZMA 4CLRA 3KEQA 4YAJA 4EJMA 1PX0A 4PZEA 4R01A 3MWEB 3INTA 2EIHA 5K9ZA 1YWGO 4YAIA 7ADHA 5JCJA 4BB5A 5B1YA 4DYVA 1UAGA 4PLCA 1Y9EA 4WLOA 3RI3A 3QWAA 1JAYA 1UZNA 4MIEA 1HRDA 1ZFNA 2IE0A 4LRTB 4ZQFA 3RC7A 1PJ3A 4NZ9A 3TL2A 4N5MA 4IM7A 1LDYA 1DC6A 3DAPA 3AFMA 2FZWA 3H9EO 4B7CA 4CQLA 3INRA 4R5HA 1AHHA 2PGDA 2PNFA 1A7KA 3PHJA 4JP2A 4BGIA 4E3ZA 3EC7A 3FF4A 1ZKMA 1K6XA 4XYMA 1I36A 1WDKA 3E48A 3P19A 3S55A 4UUOA 1U2GA 4R68A 4IGFA 2E6UX 4YRDA 3DHYA 1Z74A 4NG5A 3ROKA 3AUAA 5C7OO 3JQAD 4GL4A 4B3JA 4M1QA 1XKQA 2ET6A 3OIDA 1KEUA 2VYND 3QQPA 1A27A 5U4QA 2YW9A 4GMGA 3OECA 4MVJI 4OXKA 4AJJA 4FW8A 5IXSA 4BO2A 1NASA 2OP1A 3KYCB 5A9SB 2J5QA 1XG5A 3LF2A 4OGWA 3GZNB 5CPFA 3SX2A 2O7SA 4XIYA 2O23A 3I9OA 5K6AC 5JAIA 3QJ5A 2AMFA 1LI4A 2AA3A 1LDMA 4DLBA 3OIFA 1R0LA 4H7PA 4D46A 3RROA 2GCGA 2PKRA 3QWHA 1Y5RA 5IZ4A 2WMDA 4TROA 3DBRA 4K26A 3ZV4A 3CZRA 5A5EA 1YQXA 2GZ2A 3BXXA 3ZHZA 2BGKA 3GDOA 3OBBA 4YJFB 5AQ1A 2VNSA 1E77A 1YB5A 4J2OA 1SCUA 1U3TA 3IUPA 4CMAA 2FWMX 3SXPA 5CPBA 3U0BA 4D3SA 1DHTA 3PHGA 1HL3A 2BFPA 2CMDA 4IGEA 2C59A 2JD2A 2O3UA 4MVJA 4LRSB 1ZNQO 2DPGA 3BHIA 2XPCA 3GUCA 2AW5A 4NJMA 3RUCA 4JNKA 4D42A 5ER9A 3PLRA 4XGIA 3JQ9A 4W82A 1PZEA 2YHIA 2JD1A 3CE6A 3JQGA 2D1YA 3JYNA 3VDQA 1VSVA 2VTEA 4WEOA 4CUJA 4ND2A 4BQPA 1JDJA 3HG7A 4E2XA 1JWBB 4BNVA 3W6ZA 2OFPA 2FHSA 3JQCA 1BW9A 4PVDA 3KV3O 4BNLA 4ZICA 2WJPA 4FFMA 1DIAA 1YBAA 1A9ZA 4OO3A 1BWSA 2O4UX 4MVJH 1KOLA 2PH5A 2O3RA 3JV7A 2NVWA 3HDYA 5A3VA 4YXFA 3HHPA 5JMPA 1IB6A 1P44A 2VWQA 2OUIA 2G0TA 2HO5A 4YJGA 3QY9A 3WGHA 4BNXA 3VC7A 3I83A 5G4LA 2Q4BA 2W98A 4Z0PA 3TL3A 2RBEA 1ISMA 4J2HA 4ZGWA 1QYCA 4OQZA 4O1MA 4PLWA 3V2HA 3DBLB 2FR1A 1P1KA 3GK3A 4FSHA 2YY7A 1PS0A 1E92A 1Q1NA 1QORA 2WSBA 4GX1A 1PJLA 2FR8A 2W2LA 2GN9A 1ENYA 3C1OA 4QO7A 5JNLA 5I7SA 2TMGA 3LT1A 3OEYA 5GZ3A 2LDBA 1D1TA 2QZZA 3LT4A 4C7JA 2H9IA 2FPIA 2O4CA 4DREA 3TPCA 4YJHB 1CQJA 1UZMA 3AU9A 3JD0A 5DCYA 2J3IA 1QR6A 3UHAA 3C85A 2GYYA 4Q3AA 3IDSA 5ILGA 4AJ4A 4OH1A 5ICMA 1JQBA 2BGLA 2E48A 5THQA 4CMBA 5TT0A 1AN9A 3B20A 1J0XO 3KYCA 2D5CA 3GFGA 2B4QA 3H9UA 4IPTA 3UVEA 3WQSB 1WZIA 1FJHA 1ZJZA 3GZNA 3M1LA 1ZMOA 3TZ6A 2P9EA 1V6AA 2ZB3A 3EVTA 3Q2IA 4J4BA 4YJDA 5G0TA 3DOOA 2O3JA 1EZ4A 2EJVA 2X9VA 3C3XA 5AYVA 3ULKA 3JCZA 1PEDA 4JLWA 4WKGA 3WNVA 4D44A 1I2BA 2JCVA 2J8ZA 4AJEA 3W8EA 4YJFA 3GZ4A 2DU8A 1H6DA 3KOUA 4JQCA 1V35A 5JO9A 5IAAA 1HE4A 3G1TA 2EKLA 3LZ6A 3ZNQA 1EEHA 4II2A 3AI1A 4CR6A 3GNQA 1CEQA 3HB4X 1P33A 1PS9A 3H5RA 1KBZA 4AICA 4FFRA 4CMCA 3KZVA 3ZWCA 5JXWA 1EE9A 1MUUA 5COQA 3OF2A 4WCFB 1I33A 1DRWA 1PSDA 2B35A 1NR1A 4J0FA 5IDQA 5B12A 2BH9A 4ZRMA 4NPCA 6ADHA 2Y93A 3KM0A 2NUAA 1PR3A 4FFNA 1FDSA 3HFSA 4HUJA 5T57A 2IZZA 3OM9A 3FR8A 3WMXA 2JCXA 4N5LA 4NBUA 2V65A 2DVMA 4RVDA 5AOVA 4BL5A 4DIOA 3MOIA 4J1NA 1CJCA 2WD8A 4N18A 1O5IA 4UEJA 1E3JA 1H9BA 3DHNA 1EE2A 4CLEA 3HSKA 3BZUA 2EXXA 4PRLA 3WWYA 1GZ6A 3CMCO 3E8XA 3DR3A 4CV2A 4IDFA 4X54A 5FEUA 1DRUA 2EGGA 1CRWG 3OP4A 3QLJA 4JJFA 5JAZA 3V5NA 3TZKA 2HK9A 3I4CA 3IJPA 2QG4A 4MVJP 4N5NA 2TMDA 3ZWBA 2X4GA 4QO8A 3WBFA 4CLHA 3DZKA 3LT2A 4LSWA 3DBLA 4XYGA 4HFMA 1UZLA 3NJ8A 4RL6A 4PVCA 3S2EA 3JQAB 2I76A 4ID9A 1Q0LA 2A94A 1IYZA 1UDCA 3RKRA 4J7XA 4AG3A 1UP7A 4DTIA 1J5PA 3M2TA 1RWBA 3H3FA 1V3VA 5LDHA 3GPDG 3GVHA 4RF4A 1GUZA 1EVJA 4BKOA 4EDFA 3PK0A 1K3TA 1HETA 4L4XA 4HFJA 1I2ZA 1DBVO 3HN7A 3OQ1A 2Y0DA 3COSA 4HNHA 3QSGA 4YB8A 2GR9A 3MZ0A 2VUTA 3UW3A 4E32A 2PR2A 3DZIA 1U3VA 3NKLA 5BSHA 3AFNA 2AQKA 2JL1A 1CETA 1ZIDA 1P45A 4QQRA 4W7HA 1WPQA 4AJ2A 5JYDA 3UCXA 5KTKA 4BNKA 1P3DA 5EINA 2AEFA 3OEWA 4TWRA 3RUFA 5L4LA 4RPJA 3GDFA 1YDWA 3DONA 1C1XB 5G0UA 3H65A 1ONOA 1HYHA 2IEDA 2PV7A 4URFA 4AJLA 5ITVA 3WSWA 3QVXA 3PHHA 5DOVA 3FNHA 5EPOA 5I7VA 1VKOA 1C0KA 1PZGA 5EQFA 4GX5A 1GZ4A 4XIJA 1DO8A 1CF2O 1VJTA 4YQYA 1MGOA 4OL9A 3AM3A 5BQFA 5C3MA 1MLDA 1GV0A 5FFFA 1NVTA 2PKQO 2Z5LA 3Q6IA 1PS8A 5CG2A 5HM8A 2O2SA 3SLKA 3EHEA 3SBOA 2QHXA 4XDZA 1YB1A 3NJ4A 4KQXA 4CMIB 4YEDA 5TX7A 4F46A 1AUPA 3JD4A 4XJSA 4RDHA 4M8SA 1EFKA 1ZXBA 3DZJA 3FPLA 3U62A 2GRAA 1DB3A 4H15A 4OOFA 1FDVA 5DBGA 4JBHA 2DBRA 1P1JA 2VNAA 2VWPA 3K2BA 4W6ZA 1FDUA 5BNTA 1B3RA 2YV3A 3MEQA 4NH4A 3GGOA 5H81A 2OORA 4Y9DA 4BNYA 3PEFA 2Y1GA 3EAGA 2I3AA 3VVCA 2SCUA 3KLMX 3GUYA 3PPIA 5G0VA 4PLVA 4BVAA 4KTVE 4J90A 4L76A 2WTBA 5DCUA 2WDZA 1GU7A 2P68A 4IJKA 4MP6A 1V3TA 3EZYA 2BD0A 3WOHA 4PG8A 4CMEC 2XAAA 3ENKA 1RM3A 1O6ZA 4UULA 3G17A 2QZ9A 2XOXA 4DPKA 1HLDA 4S1VA 2JKVA 1DJNA 5AXBA 3CKYA 1LDGA 4HFNA 4NNJA 3S2FA 4A03A 3HDQA 4CV3A 1NFQA 3P7MA 4RVHA 1QYXA 1E5QA 5K6AA 3EDMA 3AM4A 3JQ9C 1E3EA 1XDWA 3F6YA 3SLGA 2HMSA 4A2CA 4YBZA 4IJVA 4L75A 4Y6PA 2H5LA 2Q49A 3D5QA 3NYWA 4JK3A 1EQ2A 1HDCA 2BKAA 2NU9A 1ARZA 3QHAA 4BNIA 2VT2A 3OHSX 4S3MA 3OIGA 1W4ZA 4NBVA 4BKPA 3ADOA 2BLLA 3GNTA 2Q3EA 4CMGA 4O63O 4F6CA 5TC4A 2VRCA 3X2FA 2NTJA 1DSSG 1WW8A 3BMOA 4LMRA 4O59O 3JYQA 3RCBA 3TZQA 3VH4A 1C3VA 1JN0A 1BXGB 2OBNA 4UVGA 1XSEA 4BO6A 3BTUA 2F00A 3GY0A 1EVYA 5CEJA 3WGIA 5IN5A 4J9UE 5IDYA 3F4BA 2VHVA 3GH3A 2E82A 3NAQA 4KDEA 1X7GA 3AY6A 3VTZA 1KEVA 4W7IA 4EW6A 5JC1A 1IHXA 1GYQA 3GQVA 1YKFA 1GPJA 3NV9A 1HDXA 3FCOA 4HNGA 4FN4A 3RUHA 2PZJA 2A4KA 2ZCVA 4K28A 1GCOA 1F17A 2HK8A 4XRRA 1UXIA 3PJDA 5DZSA 3ITKA 1D7OA 4DUPA 1AE1A 2V6FA 1QKIA 3H9JA 1G0NA 2HMTA 4XYEA 3C8MA 1GD1O 1F14A 2Y05A 4LCEA 4ESOA 4CM6A 3E6AA 3CZMA 4P4GA 3D5TA 2Q50A 1YOVB 3WIEA 2CVZA 2QRLA 3EK2A 1O94A 3NTQA 1XA0A 1NQ5A 4R1TA 1XWFA 1WVGA 3KO8A 3LLVA 3UH1A 4CMIA 4LISA 2FPGA 2X5OA 1PJTA 3VZPA 2NACA 2UDPA 5A02A 1XR3A 3FTNA 1UXGA 2NWQA 1S7CA 4OSOA 4FFPA 1XGKA 1Y8RB 4CLDA 1ZUD1 4AJIA 3C7AA 3VPGA 3I3OA 1T2FA 1U3WA 3GRPA 4WEQA 4GWGA 4E5PA 1ZK2A 4J7CA 3WJAA 4CR7A 2IYOA 5JPIA 5TLSA 1UXHA 1NTOA 1Y7TA 4FQ8A 1ZZEA 3RUIA 4XEHA 2PD4A 2E49A 1ZCJA 3GDGA 1D3AA 3AUTA 4XQ9A 5H83A 1ORRA 1E7WA 1DOHA 1N7GA 4RPGA 3EY4A 4A5OA 1E6EA 2EGHA 5IN4A 5DOZA 4WNIA 2IXAA 2HMVA 2PA3A 3GG2A 3Q1LA 3IMFA 3L07A 4BO5A 3UFXA 5TJ9A 4XGNA 1PGOA 4WCDA 2VYVD 2OZPA 1SOVA 3E82A 1N92A 4IQ8A 3A4VA 3VH3A 3TN7A 5L40A 3LC1O 1C0LA 3E5MA 3PWZA 3UGKA 3H5AA 1T2CA 1U7TA 1YB4A 3R3SA 1C0PA 1M66A 2O3QA 3RQSA 4RJTA 4P38A 2J6IA 3NTRA 4J0EA 5DULA 2C2XA 3V1UA 4R41A 3L6EA 1G0OA 1ZVMA 3ZU5A 5BSEA 2CDCA 1XELA 2GZ3A 3ZZNA 2O2YA 1Y6JA 5H82A 5CFZA 3SC6A 5JFOA 4P22A 5L45A 3LU1A 2VQ3A 3F5SA 4KP7A 1DC3A 4H3VA 3AI3A 1MA0A 1MFZA 1ULUA 2GUGA 3E1KA 1TT5B 1XQ6A 4YPOA 1R4MB 1KERA 4M49A 2Y1EA 1ADGA 3I9KA 1LLDA 5G2OA 4UUPA 1GPDG 5JC8A 1BXGA 2QYTA 5T8KA 4YT4A 3ZNOA 2DC1A 4R51A 5CEEA 3FWNA 1LBEA 3ICPA 5KOIA 3DMYA 1YO6A 2Y67A 3OSUA 1XHLA 2YV1A 2GLXA 2AG8A 3DWFA 3KSDO 4DPLA 2GF2A 2ZYGA 4Z3DA 3N7UA 4DVJA 4J49A 4GGOA 4GVLA 3QA9A 2B5WA 3IJRA 4QXMA 4N7RA 3A9WA 5FWNA 1I3LA 4XA8A 1UP6A 2CSUA 5B4TA 1EK6A 4JJGA 5L95A 1HXHA 2Y1CA 2X0NA 4B4OA 3KTDA 3I6IA 2YQ4A 1LDNA 3BHJA 3K92A 4UAGA 2Z95A 2Y66A 4QTZA 1JWAB 3RIHA 3I9NA 3S8MA 4J3FA 2WYVA 3RWBA 3WTCA 2YHUA 1BXKA 3HZZA 1ZK0A 4BNGA 3P5SA 3A28A 4MP8A 4RVUA 1W8DA 4NHEA 1LRKA 2FMUA 4FC6A 3U49A 4GPD1 4E5NA 4TRMA 4A10A 1NM5A 2GGSA 1SO8A 3TOXA 4LN1A 5C5IA 2JFFA 1EUDA 5GMOA 4XYLA 5G0WA 4MKXA 4CMJA 3ZWVA 4NDNE 3TQHA 2OGUA 1U8XX 4E12A 4BMVA 5CEFA 2EV9A 3NGLA 4B7UA 1Y8RA 3VOSA 3B1FA 1U2DA 3T4EA 4JROA 4YA6A 3AY7A 3LVFO 4A7PA 4XRGA 1M67A 4HKTA 4OSPA 1UH5A 3O38A 1HSOA 4BO3A 5B4VA 1YONA 3QWIA 3JD2A 4WLNA 4MVJF 4XKJA 1SMKA 3W1VA 1R15A 3PZBA 4MKZA 1B7GO 3ZNPA 5G0SA 4J43A 2BGMA 1YQGA 4WOKA 1E3WB 4BO9A 7MDHA 4YR9A 3ZU4A 2OBYA 2V6GA 5DF1A 1E0DA 1A72A 5HWSA 3WTBA 3VPSA 1PU2A 2C54A 2HRZA 1IE3A 1QLJA 1KS9A 4WCFC 4DBVO 3H2ZA 5DN9A 3ZNNA 1PZHA 2X23A 3KYDB 1T24A 3WFJA 1IUKA 1LEHA 1KEPA 3KEOA 1E1KA 4WNCA 3G79A 4LMPA 1LSOA 3D7LA 2UV8A 2ZTLA 3DFUA 5G4KB 1U5AA 3WS7A 1VC2A 2RH8A 3ANLA 2RH4A 3GR6A 4YDRA 3RFTA 1EVZA 3N58A 3GN2A 3IKTA 4Y8VA 4ZQHA 1B8PA 2E37A 4KMSA 5BNFA 1TT5A 5F21A 1R4MA 1V9LA 4RPHA 4LSMA 4MINA 3GG9A 2VZ9A 5HTOA 1HYGA 2VWGA 1MC5A 1OC4A 1X15A 3GMDA 1GCUA 3VHRA 2QRJA 3HWRA 3ZWNA 1N8KA 1B8UA 4TVBA 3ZWMA 3PDUA 2X6TA 2C5AA 4ITUA 4R5MA 1LSJA 1FMCA 3UN1A 1DIHA 1ZH8A 3FBTA 3NGXA 1LLCA 4I5DA 4BO4A 5JDIC 3VZQA 2R2GA 5ILOA 2BF7A 4YVFA 4DXHA 4Y6SA 5I8WA 4WOJA 4EZBA 5L53A 5GZ1A 4EUFA 3KSZO 2JHFA 3STHA 3V8BA 4BNJA 4E0BA 1GAEO 4LW8A 3KHUA 4D45A 2PTGA 4HXYA 1PJCA 4OKIA 4AJHA 1DRVA 4IINA 4CMEA 3JQFC 3LLSA 2DBVO 1Q7GA 2Q1UA 1ENPA 3JQBC 4RF5A 5AXCA 1YRLA 3IAHA 2VHZA 4CM3A 5BNIA 4OOEA 2DTDA 2VCYA 3ANNA 5A1TA 2YZ7A 3CINA 4WASA 2E4AA 1HSZA 4EUEA 3F5QA 2C20A 1H2HA 3O9ZA 3GC6A 3KLPX 3JQ8B 3MTGA 4JN6B 3L6OO 3AW9A 1ISIA 1X1EA 4Z9YA 3ZCXA 1X13A 1WDMA 5EESA 1SEVA 1PJSA 1PQPA 1RYDA 3A1NA 5I7FA 2BRUA 1H94A 1SBYA 2PD3A 3FWZA 3JTMA 2NU7A 5KJEA 4J1QA 3VH1A 5J23A 2EERA 2DFVA 3JYPA 3VZSA 4LK3A 3TFOA 3PDJA 4GMFA 1PJ4A 1DFIA 4HBGA 5JY1A 8ADHA 1CIVA 3F46A 1NBOA 4XJTA 4BUCA 4BKRA 5IDXA 2Y0EA 2JAHA 1KETA 1E3WA 3G0OA 1U4SA 1MG0A 3WGGA 3WR5A 3PYXA 5T6BA 1LU9A 2HU2A 1CWUA 3I23A 1QV7A 3JQ6A 1P1IA 1JKIA 3CH6A 1I5RA 1F12A 1ZMTA 3EYWA 3NT2A 3HFGA 4FJ2A 6LDHA 3GEDA 1NPYA 2C7VA 4BGUA 1KEWA 3KYDA 1ENZA 3OICA 4EJ0A 4FGSA 3V2GA 2QIOA 1E1LA 1E1NA 4I8XA 3B6ZA 3I6QA 4E6PA 4U8GA 1I3KA 1BSVA 2VUSA 1F0YA 3GAZA 3HDHA 1EUZA 1NVGA 5JW6A 3H3JA 1LLQA 1YL7A 1R0SA 3IP3A 4XR9A 3W4KA 3PJEA 1KIFA 3MOGA 2PY6A 2VN8A 2DT5A 4YTEA 5EMHA 2IDZA 3AM5A 3MTJA 5AXDA 1KVUA 4R3NA 3WDSA 4JX8A 4F45A 4FJ1A 2DUWA 1Y5MA 2FZEA 4MOWA 5F3RA 3AWDA 3U4HA 1LQTA 4UVDA 5A9SA 5IJZA 1YBVA 2C0CA 2G76A 4FJ0A 4IS2A 4DC1A 3RFVA 1EDOA 5C37A 2J5RA 2PZLA 3GLQA 3PI7A 1D1SA 2GPTA 1DFGA 1HDGO 3PIIA 4Q3NA 2BFAA 5F5LA 3NDJA 5A3JA 2Z1NA 2WE8A 4KUGA 4WE3A 3H5NA 3SC4A 1YXMA 4D3FA 5F1OA 5L3ZA 4XCVA 1ZSYA 2B83A 4XB2A 4K1LA 1MB4A 1U3UA 3DO5A 3ZN2A 3TOZA 1VLLA 2DLDA 1GFSA 1X0XA 4DMLA 4WECA 4CM1A 1LDEA 2ILTA 5T8KC 4BO8A 4JXKA 4DQVA 2PGJA 4L73A 5COAA 3QVWA 4CUKA 4C7KA 1JKJA 2GZ1A 3QP9A 3TZHA 1E1MA 4YAEA 4TZKA 3EGOA 4EUHA 1MC4A 2Y0CA 5C7LO 3R6DA 4O6VA 4J4TA 2HKIA 2G1UA 3D3WB 5EL0A 4YACA 3ZU3A 5TQVA 1QG6A 4QFCA 3O03A 1TA4A 1Q7BA 1DLJA 3HB5X 3U4CA 2ZB8A 4NFSA 1Y81A 3OMLA 5CDTA 4OQYA 1CERA 3DBHB 3ON5A 3G49A 4PZDA 1XU7A 2CZCA 4B4VA 4IXTA 3GVPA 2AQ8A 3BYZA 1TVEA 3GVIA 3CPSA 1GQQA 3D3EA 1TEHA 4AL4A 1NPTO 4P4LA 2J3KA 1LSUA 1P1RA 1W73A 3DHEA 4E5YA 3ASUA 4R69A 4LGVA 5AXAA 1T2AA 2AHRA 2JHGA 4L8VA 4HFRA 5L4SA 4K9DA 4B4WA 5A9RA 3JSAA 4FBGA 4GSLA 3BHMA 4I5FA 1ADCA 1XIVA 4YCAA 4EJ6A 3GT0A 3ZDFA 4IQGA 1KC3A 3QWFA 1L1FA 1I8TA 4Q39A 3UICA 3T7CA 4D0SA 4JCOA 1LX6A 2X8LA 3GF4A 4R4JA 4L9RA 4PG4A 2X7HA 3RBZA 4D79A 1HE2A 1HZJA 3O8QB 1H6AA 1NWHA 4YJHA 3ADPA 5TNXA 4CL3A 1PZFA 3U5TA 3KRTA 4OYRA 1MXHA 2QW8A 1ZW1A 1M6HA 2FSVA 2Q1TA 3RBXA 3GPIA 1BHSA 2GN4A 4GKVA 3LC2O 1Z73A 1OOEA 1RM4A 4KTTE 3U9LA 3QVOA 5GY7A 4CMHA 3ETEA 1I3NA 5DBIA 4FFLA 5JCJD 1A9YA 5F1KA 3GEGA 5KVVA 2C07A 1YE3A 4J4HA 4CM9A 3MJCA 4TSKA 1DPGA 1QYDA 1SB8A 2R00C 4BNMA 2P9CA 3WICA 3EZLA 4FPXA 1NAIA 1UXKA 1JU9A 4G5HA 1VJ0A 3OA2A 3TFQA 1T4DA 4DMMA 4G65A 3RC9A 1T2EA 1EQUA 1HYEA 1NNUA 1B0AA 5C7IO 4HX5A 4BO7A 5MGBA 1B14A 2AE2A 3OJ0A 1E7SA 4WK6A 5BSFA 1WMBA 3ZWOA 2W8ZA 2R6JA 3RAJA 9LDTA 3UOGA 2H6EA 1LQUA 3NUGA 1AXEA 1B16A 3TF5A 1I0ZA 2Y1FA 1D4FA 1LDBA 4R3WA 4NR0A 4WCFA 4XDYA 5LC1A 5T5QA 5I9NA 3ZWXA 4DWVA 1Q2XA 1A5ZA 4J91A 2P91A 1JVBA 1XU9A 1X1TA 4FCCA 1PL8A 5EERA 2NTVA 3NDRA 1ZXLA 2AG5A 3VVBA 3H4VA 3W6UA 3B70A 2WYUA 1PL6A 1IPEA 1SB9A 4ALNA 1RM0A 2DUUA 1I01A 3CTMA 3LK7A 4MJLA 3D3WA 3AK4A 4ZN6A 3DZBA 4FC7A 1HDYA 1EK5A 1EMDA 4JJIA 3ST7A 5KJCA 2QX7A 4GSKA 2PH3A 4BGEA 5JE8A 1FXSA 5L9AA 4FR5A 3DBHA 3D4NA 4XX0A 1MG5A 4LCJA 2EP5A 3JD1A 5ES3A 1QP8A 4J7UA 1B2LA 1V3UA 1ZK3A 3VPFA 4AJKA 1NR7A 4MVJD 3ICCA 1JW9B 4PZCA 1K0UA 2D4AA 3WYEA 1PGNA 4L0QA 3PGXA 1XYGA 4KWIA 3ANMA 3WJ7A 4BV9A 3ZW8A 4NBTA 1SEPA 4AJOA 4ALJA 2C7GA 5JDIA 1M2WA 1VM6A 3ONDA 4DIFA 2Y68A 4ZQEA 2P5UA 1GL3A 4ONEA 4CM8B 3I9LA 3JQAA 1YBMA 2NU6A 4WLUA 2VYNA 2ZYDA 2EG9A 3HJAA 3Q9NA 3GVXA 4E13A 4OIMA 1UDBA 3R3JA 1PJQA 1PQWA 4HV4A 5B37A 1YVEI 1UXJA 3AUSA 3P2OA 3IL2A 3JYLA 1WAMA 1KVSA 3JQFA 1ZJYA 4HADA 5CDYA 1RKXA 5DP1A 3BTVA 3JQBA 3VDRA 4E4YA 1QYVA 4D0RA 2YDYA 1J6UA 3DAGA 1E7YA 4G2NA 4XZ3A 1E5LA 3KUXA 3TRIA 4IMRA 1UR5A 3WFIA 4M86A 1IOLA 3N74A 4RO0A 1RPNA 3FRJA 3RD5A 3ZGYA 5B4UA 3PWSA 2WD7B 4GAEA 3K73O 4CMKA 4I5EA 3HE3A 1QV6A 3T4XA 1U7HA 4QECA 3WMWA 1Z75A 5HS4A 1T1SA 3AUUA 4I9NA 1YJQA 3L9XA 3WGZA 1E7RA 1C1XA 3I1JA 1VL6A 2W2LD 3F9IA 3GN1A 3OJEA 4R16A 1SNYA 4D41A 5A4DA 4FB5A 3OJFA 4E33A 1ZK4A 2B4TO 2AEMA 1IL0A 3GRKA 1YJ8A 4QSMA 3OQ6A 5KCZA 5JAMA 4CODB 1OMOA 4ZVVA 4CM4B 3VKUA 2CDBA 1BMDA 1IULA 4MDHA 3GOHA 4PLPA 3L77A 2CVQA 3K9QO 5TT1A 3WQRA 3JQ7B 2ZATA 1CYDA 1PJBA 4MKRA 1HTBA 4Z6KA 1I30A 3E03A 4HY3A 5IG2A 1ZK1A 4Z9FA 4ZA2A 4NU5A 4B79A 4B4UA 3MJ4A 2HLPA 5BR7A 3X2EA 4J1TA 2Q1WA 4DA9A 2ZIZA 1HF3A 3PHIA 1H6CA 4DIBA 3DOJA 5CDGA 4YRAA 2HCTA 1HZZA 1NAHA 1NWCA 2O3TA 1SAYA 3EUWA 3A06A 4ALKA 2B36A 3WX0A 1O0SA 4YQZA 4KUHA 3ZI0A 5CHEA 1OBFO 1VJ1A 4TKMA 2D3TA 3LF1A 1HKUA 4W9NC 4WUVA 4RQUA 5GZ6A 4BNUA 5HS6A 5EJ2A 3GMSA 3WIDA 4D7AA 3BAZA 2J3JA 3L9WA 4GQAA 2X5JO 2V6BA 3VPHA 3K30A 1L7DA 4BB6A 1P77A 3KSUA 4CM8A 1HE5A 2EWMA 1I10A 2I67A 4CLRB 1MFPA 2BFMA 1XQ1A 1GR0A 4NI5A 2ZTVA 3IOYA 3KXDA 2POQX 3RUEA 2XXJA 4YT8A 1LLUA 1ADFA 3S1LA 5L51A 2ZJ0A 1V0JA 4E5MA 4UUMA 3UCFA 3DTYA 4ZHSA 1ISJA 3I52A 4A27A 4F3YA 3RU7A 3GEMA 2Y99A 2D5AA 1S6YA 2IEBA 4JGBA 1DC4A 3AY3A 4UEKA 3GNSA 3ZHXA 4BNFA 4TRJA 1R4NB 2UVDA 1RJWA 5JLAA 1BVRA 3WGYA 3ZWWA 2O48X 1R6DA 4NJOA 1O9BA 4PG6A 2VZ8A 3DMTC 1GY8A 1CDOA 1N5DA 4PLFA 2D2IA 2EEZA 1X7HA 2P9GA 1R37A 4KDFA 3VTFA 4IIVA 3ZWYA 1NFRA 2NVUB 1T4BA 1DIGA 3B1JA 4GKBA 4PCVA 1A4UA 2A35A 3AOGA 1DEHA 2QQ5A 2UUOA 3DFZA 3QIVA 4Q3EA 2ZB4A 2HDHA 4A73A 4BS9A 1F06A 2B4RO 4UVHA 2FSSA 1IPFA 4MPDA 1K6JA 4Y6RA 1LSSA 5CDSA 2HQ1A 4GH5A 2DFDA 2JFGA 4BGVA 1J49A 4CM4A 1BVUA 1YOVA 5JSFA 1U8FO 2HJRA 4QFDA 1JTVA 3SJ7A 3UKOA 4E30A 5KNLA 1Q0HA 3PXXA 2PK3A 2PFGA 4YRBA 4XD2A 4XGKA 3PYLA 3DZGA 3G1UA 4TKLA 1QSGA 1P1HA 3JQ7A 1P31A 1PGPA 2FP4A 2YQ5A 1N1EA 1OAAA 3HNPA 3OQBA 3F1LA 2YUTA 1WLYA 1BDBA 2Y1OA 2G5CA 4OXNA 3FTPA 1YL5A 3WNQA 1IZ0A 2I66A 1C14A 4NU6A 4WGGA 1BGVA 2I9PA 3AI2A 2BELA 5L7TA 2EJWA 4NJMB 3ZU2A 1C0IA 2NLOA 5K0ZA 4ALLA 3K5PA 2C29D 3FN4A 2RHCA 4XWYA 2IRWA 3K96A 4YAKA 1I3MA 3NX4A 1VSUA 2JCYA 1B3BA 1F8GA 3OFSA 3ZHBA 3H2SA 1M76A 1DIBA 1BW9B 3AU8A 4P4NA 4CLXA 1VRWA 2OHXA 1P9LA 5I9MA 2H1SA 4AFNA 4CL8A 4ROSA 2R00A 4DRYA 2Q2WA 2UYYA 2Q46A 3BMNB 3JQDA 2I65A 4BNZA 3MCVA 2HRBA 4Q3DA 1VPDA 3C7DB 2ZQYA 3K8ZA 4MIOA 4EBFA 4RZIA 1B26A 4ND1A 4YJGB 3RJ5A 5ENDA 3RKUA 4D3DA 1IZ9A 3AOEC 1RM5A 3L4BC 1Z7BA 2HJSA 1GADO 3KBOA 3ENNA 2CNBA 2NQTA 2YV2A 3BTSA 4RDIA 4ALMA 1GV1A 3ZW9A 3FNGA 2FN7A 3GHYA 3OJLA 4RLSA 3KVOA 1ULSA 1FF9A 3O4RA 1R4NA 1FDTA 2CF6A 2P4QA 3IP1A 1DXYA 3LYLA 4HWKA 4TQGA 8LDHA 5IFLA 3UCEA 4NK5A 4UVEA 2Q2VA 4BMSA 2PD6A 3F47A 5JDCC 2JFHA 2ZQZA 1GUFA 4PN3A 3HADA 2CY0A 3WG9A 1DLIA 3CXRA 1X0VA 5A5FA 2NVUA 4Q3BA 1N7HA 3DBVO 1B8VA 2X0JA 3DDNA 2H63A 1WNTA 2Z1MA 3F1KA 2GSDA 2WWRA 3GA0A 3HN2A 2Q99A 1P0FA 1FDWA 3IC5A 4I08A 1Z45A 1UAYA 3WWZA 2VOJA 4O5OA 2RIRA 2VRCD 3QVSA 3BMCB 3FNEA 4NFYA 3ZWPA 5U1PA 3C24A 2Q1SA 1MX3A 3GFBA 1EBFA 3S2GA 1VKNA 5F1PA 4E2WA 1GYPA 1P1FA 4E31A 1LC3A 3ZV6A 3GVCA 2HAEA 3BIOA 3E9QA 4Z0TA 1SOWA 3PQEA 3QRWA 1SC6A 4CM7A 1I2CA 5ICSA 4IMPA 1LA2A 3I5MA 1X14A 4IQ0A 1W0CA 1DDOA 2PLAA 3FSRA 1H5QA 1F8FA 3LDHA 1H93A 2DQ4A 4TVOA 1GEGA 3ETGA 2HSDA 2W90A 1VI2A 2X0RA 3NDIA 4IDBA 2G82A 1A4IA 3E9NA 3H9QA 4KZPA 1K89A 3KB6A 3FNFA 4C4OA 5IXYA 1NFFA 3DXFA 4XYBA 5JAQA 1HDZA 1O89A 3W4IA 4BO0A 4DGSA 1CQIA 4L74A 4PRKA 2OP0A 1E7QA 1YGYA 2D59A 4I5GA 3ZWAA 4J1SA 4L4SA 2VTDA 4RVGA 1N9GB 1DIRA 1I32A 3FR7A 2NVBA 4TRRA 3V2UA 4FIZA 4CPDA 3BMNA 3CIFA 1YDEA 5COBA 4YAGA 2VZ0A 3IKVA 3CSDA 1KVQA 2WEKA 3NT4A 2ZB7A 3PHLA 1XCBA 2VUUA 5EIOA 3ROQA 5G4KA 2PGLA 4G81A 2QRKA 5CG1A 3QWBA 4ZU3A 1AHIA 3ASVA 4NK4A 2XF8A 1QRRA 4LVUA 3L4SO 1ONNA 4PLGA 1YS4A 4NMHA 2GN8A 4GX2A 2C82A 1GUYA 3ORFA 1BDMA 4ZD6A 1WDLA 1M75A 3H8VA 3ZHYA 4BMNA 3RUDA 4Z9XA 1QLHA 2Q4EA 5CDUA 2F1KA 2WM3A 5U9CA 3I9JA 4ND4A 1GTMA 2NNLD 1NP3A 2ZK7A 1ADBA 4F6LA 3NEPX 3PFWO 4L4RA 4OM8A 3U4IA 9LDBA 5HRUA 2FPPA 3DZHA 4NQZA 4Z0HO 1TI7A 1QMGA 1G6KA 2OO5A 3BTOA 4E21A 4PFJA 4BQRA 3KYBA 1PL7A 3PQDA 4J9VA 1ZEJA 3VZRA 3DZFA 4O0LA 4XB1A 2I5PO 2X0IA 4RGBA 2P5YA 2X58A 3R0IA 3HQ4O 3A14A 4IDEA 5ER6A 5FF9A 4PGFA 3OJOA 3EVNA 4MO2A 1U4OA 2OOSA 3IQDB 3L0DA 4IJUA 5I8ZA 1ISFA 4IJWA 4PLZA 5IZCC 1VL8A 2BMAA 4BKQA 4IY1A 2NM0A 4E5KA 3PLNA 2GDZA 2VT3A 3BMCA 3NT5A 3RSHA 1JVSA 3DB2A 1RYEA 4U5QA 4W9NA 2X5KO 3ETDA 3FD8A 1MXFA 1DJQA 1SPXA 1LNQA 3F3SA 1XEAA 3D4PA 1NQAO 4XQGA 3H7AA 3UAGA 1JKFA 4MIYA 1E3SA 1LRLA 5L4NA 4ZQGA 3WGQA 3JQ8A 4FS3A 1TT7A 2CDAA 4YYZA 1NVMB 3P2YA 2Q45A 2HMWA 2X22A 4FD3A 2C2YA 4OKNA 3G3EA 1HDRA 2VYVA 2RHRA 2FRDA 4BNWA 1LUAA 4ILKA 1UUFA 1YQDA 1GDHA 3DC2A 1BTOA 5DDIP 5HBRA 2V7PA 4N54A 4BKUA 1E7MA 5TGDA 1JA9A 5CAEA 1KVRA 2NADA 2EW8A 3IUSA 3QV1A 4CQMD 3DEYX 1ISGA 2ZJ1A 2YJZA 2CF5A 5KKAA 1P0CA 3RVDA 2B0JA 1ONPA 3DMTA 3WXBA 1PGJA 1N9GA 1OFGA 1DAPA 2CFCA 5KVQA 1G1AA 2B69A 1HDOA 2AXQA 2RCYA 2G17A 4R1NA 5DT9A 4B3HA 4CUZA 3CEAA 1T25A 1WZEA 4TZTA 4DLAA 2GD1O 1ZBQA 4EYEA 1X7DA 3LQFA 5TRTA 1NXQA 4NFHA 4GBJA 2OXIA 1QYWA
chains in the Genus database with same CATH superfamily
3HJNA 1D2RA 2ZI6A 3Q8KA 4GPIB 1N0HA 2CCKA 3EG5A 3BHNA 1KY5A 1VSQA 2O2ZA 3USZA 5TSDA 4EMSA 1U5CA 1K66A 2CL6X 1D07A 4LXQA 4DBZA 1HEUA 1Z5GA 3F6SA 5A03A 3TM5A 3WYBA 2AZXA 5E6UB 1QKKA 5JNSA 4B43A 4MS4B 2PXAA 3SYNA 2PFSA 2BDTA 3ILYA 4EELA 1NLMA 1E9DA 1L7EA 4R7TA 3GW8A 5CNKA 4ARSA 5CLQA 3U4DA 5KS2A 1OC2A 3R6TA 5B1IA 2WYOA 3GUZA 5JY6A 2H7XA 4B3IA 5EUQB 1WZ2A 2PKCA 4MA4A 3D6UA 1XJQA 3OAAA 4KLRA 3F0TA 3EZ2A 3G9XA 4DMFA 3BVPA 3VGPA 2IUTA 1EXVA 3WZMA 1PX2A 2I3GA 4LWQA 4RLHA 4R9SA 4K9PA 1W96A 2GEKA 1U1IA 1G8JA 4NMMA 3FMGA 3GP5A 3MD9A 2Y2UA 4ZP1A 3RS8A 2HEIA 5EJ6A 2FUEA 4Q05A 4AWBA 2R96A 4LHEA 1EVKA 3P26A 5IYZB 1K6IA 4RVSA 1N2SA 1H2BA 2VHYA 1MJHA 3C16C 5BUCA 3PP8A 5M7EA 3E53A 1C1DB 1JDUA 3HEBA 5TF0A 4MSUA 1P0PA 3T4UA 3F73A 1DKLA 1NLZA 3IUMA 2QRZA 1J9GA 2GK7A 3D4OA 3GB9A 4DCSA 2C97A 2FZGA 2C1ZA 4DLPA 1VPLA 2IYPA 3L01A 1N3LA 3T1NA 3L4EA 2EQBA 2H48A 3I72A 4WJZA 2HFKA 2J0QA 4WLEA 1GSIA 1E9RA 2OMEA 2EQAA 1VLMA 3F4LA 5LCXA 1VPVA 1L5VA 3TM4A 4KW7A 3V2IA 5G1NA 3B1KA 2I9KA 4Q12A 4BU0A 1XTTA 3PYMA 2HDWA 4QU0A 1A71A 5B6IA 2HPHA 3HBMA 4IUYA 1MAAA 2XXBA 3CVUA 4HTAA 5BT9A 2I6XA 3AOEA 5CFLA 3PDHA 4XX1A 1CUEA 4FDAA 3L4BA 4ED9A 2YXPX 3I5YA 2OV1A 3L8EA 2YIVX 1TA0A 1ZO8A 4J8PA 1DKMA 2EKQA 2FOIA 1L5QA 3OFJA 3GLIA 1EH5A 4DV3B 1NJ1A 1YACA 4MP3A 2LCIA 2QPAA 4MW6A 4REOA 1XQVA 5JI2E 1QGYA 2O52A 3KD3A 4MVJM 1E8MA 2ACEA 1Z6QA 2BR3A 3OZUA 4GZ6A 4D74A 5JJKA 4TS1A 2J9XB 3O4JA 4DYDA 3VXKA 3AR7A 1QH1A 1A9QA 4MV6A 1CEEA 1T1RA 4NLLA 2J41A 3JU3A 4R54A 4BYGA 5JDCA 1I24A 13PKA 3EBOA 1GITA 3RNOA 1KTIA 2DQYA 4WVLA 4IZHA 2VCHA 5BPFA 4A8JC 4X71A 3BD9A 5INTA 5E6RB 2J7KA 2JAPA 4RF2A 4EQZA 4WERA 2OUKA 2H2IA 1FSFA 1WDWB 3H4TA 3HU3A 4GOOD 2FE1A 4G9GA 4I1SA 3CY6A 3DL2A 3K6JA 2ZWAA 3E9YA 4YLEA 4DC0A 5C3UA 5BQ5A 1Y5LA 2IXBA 1KIMA 3TNLA 4TS4A 5KIAA 4RIHA 1QVAA 2CNKA 2IGTA 2GTIA 1OYYA 1W5AA 1JXMA 2GJ4A 4FYWA 4B6GA 5CVUA 4G0UA 4NIMA 1ZJ4A 4LX8A 1VKJA 5ESXA 2LKDA 5TQJA 3WC4A 1OTXA 4YN3A 3T9FA 1UJ2A 1M2OB 4B17A 3E15A 3HXOA 3X44A 5A4IS 2GB4A 2IDMA 3OOYA 2IYTA 2I4OA 1Z63A 1SWVA 3ET4A 4URXR 3SBXA 4QUBA 2WUDA 4R8LA 5E6UA 1SZJG 2YFQA 4HWOA 3UC5A 1R66A 4MS4A 4DNXA 5LQRA 2NZWA 1EPUA 2PS0A 3TRJA 3REQB 4CM5A 4TXMA 3RS9A 1EUCA 4US0R 1S2MA 2ZPAA 2QRGA 3WGVA 2I1VB 3CCBA 5FI3A 3R4VA 1TW2A 2EF0A 3Q3CA 2WAOA 4GLOA 5EP3A 1UP4A 3OHPA 4K2AA 4CKCB 4NONA 2ZP1A 4WLVA 4E2ZA 2OV6A 5LQAA 5F7OA 4Z4QA 1UOPA 2VPIA 4KNVA 1DARA 2IPOA 5KX5F 5F5NA 2IEGA 5CB4A 1LXCA 1FRNA 1Q1GA 2BMFA 2BP7B 3VBEA 4EHJA 1A88A 3K8YA 4N47A 3AR8A 3A4TA 4OMCA 4MKGA 2FG7C 4BCCA 2R6AA 3D0OA 2YRXA 2E3JA 4ZCPA 1DVRA 3K16A 2HPAA 5AJYA 2QUHA 1G6OA 3MB5A 4IAOA 2J9RA 3ROGA 2HTEA 4MQ6A 5AH0A 1JHZA 1E6KA 3SXJA 2H1RA 3UF0A 2Z04A 3AJRA 4H7KA 1C1DA 2OXFA 4PPFA 1Q15A 4UEOA 4NYIR 2FCAA 5LBUA 3U13A 4CW7A 3IS3A 3TRFA 1L4KA 1EVQA 1T3SA 3QH4A 5E7JA 3JQEA 3KBBA 4DWWA 2FDCA 4LF5B 5I4IA 1H0KA 1IAVA 2YY5A 4J7AA 2Q3JA 1VGRA 1U9JA 4FOOA 2IPLA 4I66A 5EN4A 4CDRA 3H9GA 1MQSA 5JMOA 3INGA 1TPZA 3IR5A 1E61A 1ONBA 4DPMA 4IDDA 1X38A 4Y67A 1PO7A 2Q5QA 2QE7D 2Q2QA 3HUDA 5JARA 3HYCA 1WQ4A 3GRUA 3LT0A 1T8RA 3PUIA 4PNHA 3TSCA 4CQMB 2ZRAA 1N2ZA 4YP6A 2VHXA 5JBIA 1FXUA 5D01A 1ZSNA 4CDMA 4V2IA 1SKBA 3MJEA 4S1WA 5IMSA 3MJSA 1IK6A 4G07A 2JGNA 1NHGA 4Q9NA 4V0NA 1SXJA 1EUDB 4A26A 5HYVA 3SQDA 3ZEIA 3U37A 2PQMA 2ECPA 2I6TA 3SK0A 5T4FA 5L3QA 2RAFA 2NPOA 3AFOA 2PLWA 3HSYA 3Q9UA 4F5WA 2GHIA 1YKGA 3KSBC 2AEJA 5BN4B 1LJ8A 2ONCA 4W5NA 4BFSA 3U7RA 3BS4A 4M0EA 4JBGA 1Z4OA 4UFPA 5IF3A 1ZIOA 3NQ41 1VBMA 2P90A 3OU2A 4JU9A 4LRQA 4P7BA 1O0BA 1LTKA 1SIOA 3BKWA 5CFRA 1RHKA 4WLFA 3ZKAA 4D96A 5CDFE 1PT7A 2EP7A 4AM8A 4Q16A 4QUEA 3MWDB 4IILA 2PKQP 3GRFA 5AW4A 3HCBA 1L3IA 1PQ4A 2MYNA 3PTLA 4WIAA 4FBMA 1Z35A 2GYUA 4OTZA 5JJCA 4QBIA 1JQJC 1A98A 4BMXA 3E22B 4W99A 2BCJQ 3HDJA 2H52A 3IILA 3H1TA 4GOMD 3TSYA 3I9MA 4AMUA 3M6FA 4EEXA 2VF8A 2WZQA 4EW2A 1TXGA 4JOQA 3PVZA 4H27A 3ROPA 4L22A 3C7CB 4ZGBA 4PXSA 5F12A 1QG2A 5ITWA 4V0MA 3H5LA 2Q3BA 2H1VA 4RYDA 8GPBA 1U4NA 3HNRA 4GMDA 2P4HX 5KWIA 5F4BA 3VC3A 1Z2PX 9ABPA 5KYGA 3NU1A 2DTEA 2BFEA 4I4TB 2P9TA 2GERA 2PDAA 1JIIA 1YQWA 5EQDA 5FP0A 3O93A 4DQDA 2ZI9A 5B58T 1QUFA 3U09A 4G67A 3ZDCA 3BE5A 3WY9A 2EAUA 5AW3A 4MPTA 4DNPA 4EOGA 5TF4A 3REQA 2BMEA 5JZBA 1OH5A 1FL9A 3ABIA 4G26A 1TZCA 1J70A 2QRUA 3K31A 4HL6A 1AKRA 5JMWA 2PM8A 4DCGA 4A8PA 2ZVPX 4CV0A 4XUGB 1QNLA 4MWTA 1C41A 2E4UA 3H6KA 3RV3A 2A58A 2QTMA 3NHPA 4FCVA 4IDGA 2GN6A 2FW0A 3CT4A 3U1VA 4BFVA 3DPIA 1G2QA 2ODTX 1XCJA 3UQZA 2DH5A 5KNBD 1BG6A 3RRYA 3FROA 4GBGA 5SZJA 2YICA 2IXFA 4YT5A 1D1QA 5J2TB 3QPAA 3EEOA 4HGNA 5A04A 4LOAA 4G5GA 3VR6H 4W5RA 3EXEA 3TNFA 1R12A 4LTMA 5G1OA 4QOHA 5K0CA 1UJMA 1IJKA 3OETA 2HUNA 3A4NA 4JJ8A 1CW2B 1C9DB 1GAJA 1TVKB 2E1PA 1IN7A 2IODA 1YL6A 3DT6A 3MJTA 4RK6A 4YP1A 1Z8NA 3EDCA 3QBEA 3MYRA 3KALA 4IDAA 2X1HA 3K0SA 1PR9A 3V6MA 3MUFA 1M8PA 2Q4OA 2HBRA 1IDN1 2EGUA 5F78A 2JFOA 3HY6A 2B25A 4OJNA 4XQEA 3U0VA 5LP1A 4LNUB 5TS3A 1YS2X 3JZAA 1UJBA 3PWKA 1NA5A 4BFXA 3UJ7A 1U8UA 3EMKA 3IOCA 4MWOA 1B4DA 3E23A 4AECA 2CN1A 1U8CB 2I1LA 1VL0A 4CQMA 4DVGA 4A5SA 2E0IA 3O82A 4A15A 2J1LA 2JVJA 1WKCA 2FXVA 1COWA 3QUCA 4LQLA 3VKGA 4RK7A 3PC3A 1E6LA 1SVWA 3VU3A 2BMWA 3W9BA 3E2MA 4JKOA 2X8BA 3MWJA 5ALRA 1R8SA 4R2KA 4QQFA 4FT2A 2YHIB 4QARA 2XWQA 3UPUA 2V3CC 3CGGA 3V4RA 1XXLA 2BVNA 1EX7A 4RZHA 4U7WA 4DLLA 4Y2RA 2HIAA 3AUYA 3ZV5A 3O9VA 2IBTA 4F4FA 3C3AA 5BN4A 1LJUA 2O3SA 1GGMA 5A71A 4Q9DA 3CKKA 1T2DA 1RJDA 5DM2A 2IYSA 2O7QA 3R3HA 4ZWNA 5BOSB 3RC3A 5KVSA 4PFSA 5TEVA 3HHEA 4B6OA 2ZTHA 3DCJA 1ISHA 1JSXA 2PX6A 3IHTA 3KU1A 4JQOA 4DSUA 2FMXA 1MOSA 5KTSA 3IESA 3FGZA 3KJEA 2YASA 4CLRA 4YAJA 4MV5A 2C7RA 5CLHA 4OMDA 1KIAA 3E22A 1POWA 3HB1A 4ML3A 1L4NA 1L4FA 2RGEA 1SR8A 2FMKA 1TLFA 2CBGA 2VRNA 3PQ4A 1I2MA 2ZEJA 2FRXA 1WTCA 3ILVA 5FT9A 1UAGA 5K3CA 4B3DA 4B6EA 3L02A 4C3VA 1KQGA 4KXVA 1LBHA 1ES9A 1WX1A 3QWAA 1HNZB 3N2YA 1FYDA 1P6UA 4FYPA 3FUVA 3LXUX 5EZ5A 3K70B 1PJ3A 2OCIA 4IM7A 5JBNA 3E7FA 4XM1A 2JAQA 5A1JA 2XZOA 3JARB 2IV7A 3DAPA 2WZCA 2ZJ7A 3AFMA 2WJ6A 3H9EO 3AUFA 4MQMA 5K0LA 4ENRA 3RTCA 4ZEMA 2RHGB 2SECE 3INRA 3G0HA 2G6BA 3ZK8A 2O0KA 1K7XB 2VQSA 5DNCA 2GAAA 4DILA 1LF5A 2HJWA 3V48A 2AZMA 5JTTA 4L9SA 4L78A 3FF4A 4CDNA 4FE4A 5ALHA 5K20A 5E1BA 1K7EB 4AZSA 3P19A 3A26A 1JFLA 1G8PA 3HM2A 1LD3A 5AP9A 4PBSA 5K3DA 1GAWA 2B4YA 2EKDA 2NVOA 3DHYA 3ROKA 4N41A 4PYKA 1VCOA 4BWVA 1PQYA 4ZZ0A 4JLPA 1NXSA 3SJCA 3LX5A 4PGAA 2OXTA 1NJ2A 1TK3A 1UBKS 3I5UA 1HDEA 2H92A 3OECA 4HRAA 2ZBUA 3VR3A 2IXTA 4B46A 3KYCB 4U63A 1R9JA 3ZCQA 5CPFA 3W90A 4IRUB 3HL0A 3I9OA 4MV8A 4HLQB 1EIWA 1TVKA 5JAIA 4EHLA 1LI4A 3RK0A 5JJIA 4BN4A 3T7JA 3OIFA 1QFZA 1TD9A 4H7PA 4D46A 3ODGA 2GCGA 1O0CA 1U2SA 4NENB 5CVVA 5DNWA 2FSPA 2WMDA 3BILA 4K26A 3VO2A 1M1NA 2DCUA 3HKDA 4DR1B 3RT7A 2CLIB 5FBZA 1T3LA 2HNBA 1YQXA 3FYHA 4DC9A 3TGLA 1TA9A 2AFIE 1OT5A 5AQ1A 4MUFA 3IQHX 1CY4A 1SCUA 5CPBA 4KQHA 3B3JA 3FNRA 4CYMA 4AXXA 3BCHA 3BF8A 1CFZA 1EYZA 3BA6A 5HK8A 2CMDA 4MVJA 5CT8A 2JD2A 3LTNC 2QLBA 3HVHA 3CKMA 2ZYVX 1Q7TA 1W75A 1ZNQO 5EXPA 3FOFC 1AGPA 5IVPA 3WGNA 4RTQA 1ULTA 3U31A 1YI1A 4NJMA 1MVNA 3RUCA 1B6GA 4MCIA 4ZFNA 4JNKA 4ZZ1A 5ER9A 4DY4A 1YV9A 3DEFA 2YC4C 2YHIA 4CQNA 4WSOA 3TB6A 3NWOA 4U7PB 3QMMA 4ZT4A 1IWBB 1DP4A 3VDQA 2VTEA 1U2TA 4KVAA 4CUJA 4ND2A 1AZLA 4G1MB 1P7WA 1PT6A 1T1IA 3HG7A 4KE6A 5ALXA 4BQPA 5AVUA 1CLUA 4V0LA 3KXKA 4WK0B 4OB7A 5AJVB 1LY1A 3FKSA 2OFPA 4WXPA 3ZLTA 4G5XA 2FHSA 3JQCA 3R5XA 3DFIA 1GGJA 4EX6A 5AKIA 3G5UA 1Y8ZA 4F11A 1DIAA 5DGXA 1BWSA 1L3BA 1RTTA 4Q66C 2O4UX 4WTOA 2A9KA 5CA0F 1KOLA 4KYTA 1WUHS 4FYJA 3ZU6A 5FQOA 1Y4ZA 1L5WA 2XW6A 4WINA 2PZ8A 2V7BA 3C6MA 1JQKA 3LUJA 2Q9BA 4FDTA 4C22A 2GEFA 2R0QC 2A0UA 5JMPA 4DRZA 3UJ3X 1P44A 3R9XB 2FFQA 2FX5A 2HO5A 2I55A 1FU4A 3L0PA 5GONA 1KEKA 2A6PA 3WGHA 5M2QA 2ZKIA 3MS4A 4Y7DA 4EY3A 1OLOA 3ZCVA 3QMWA 2Q4BA 2RBEA 4NABA 3GPBA 2VHCA 1QYCA 1E2JA 3WMGA 4D9CA 1MZPA 2IHVA 2NUBA 2RC6A 2WG2A 3AINA 3GAMA 4DDUA 2WKQA 1YZNA 5AKJA 3GK3A 5JZVA 1PS0A 3SHTA 1E92A 2O05A 4JVOA 3TBHA 1TJ3A 1RACA 1H3FA 5KU7A 1H0HA 4Q1VA 3OOHA 4QC2A 1V16B 3OLWA 2C9CA 4C3UA 2PUJA 2G28A 1DBRA 3EQ2A 1FX1A 3HUUA 2H9IA 1XKLA 3QBTA 4Z2AA 4QOSA 4LC1A 1NW3A 1NV8A 1V11B 4UU8A 2IS4A 4OI4A 1NVKA 1YA4A 2WPDA 2O1EA 3RE1A 4F38A 1CUAA 3UHAA 1XVUA 4EVQA 3C85A 2GYYA 5DSZA 1KH1A 1L5NA 3VX4A 4Q3AA 4P5PA 4AJ4A 3CF0A 5ICMA 2VTVA 3AJEA 2E48A 3B48A 2BFBA 2XTJA 2C83A 5DTRA 5F2EA 2D7CA 2Q4TA 3EIOA 4I9FA 2V3VA 1LQ2A 5JRZA 5TT0A 1B1AA 4UTXA 3KYCA 4GG1A 1EP2B 2C4MA 3AC0A 3L1IA 2B4QA 3H9UA 4IPTA 2XUDA 3T1VA 5DU2A 2IP4A 5IN4A 5JVDB 3S70A 2BFDB 2PVCA 1JBKA 3TZ6A 1XKXA 2I3DA 3JRNA 2P9EA 4W5HA 4J4BA 2UZAA 4F9EA 1ISPA 1V8ZA 2GXQA 2W6MA 4UASA 1J8DA 1JR2A 4J0IA 1ZH0A 3WL5A 3ULKA 2I87A 3C3XA 1Q95A 4M0DA 2JDID 4NEQA 3W5DA 4CIWA 4D44A 1I2BA 3P27A 5DBHX 4C0LA 1NF3A 3ORSA 1PFQA 1ZN8A 1LWNA 1V35A 1QP0A 2OCKA 1HE4A 1RRCA 2ZIGA 3LZ6A 7ABPA 3PS9A 5AI4A 1EEHA 4II2A 1ISRA 2OCPA 4CR6A 3MJFA 1FA9A 4UXIA 2KLBA 3TGWA 1CEQA 2QWXA 4N3BA 5BUZA 1P33A 5K05A 1ZNWA 1PUXA 2ZUDA 2YMLA 3I1YA 2XUGA 1OAOC 3IIIA 3W78A 1KMQA 2PUVA 5EIAA 3CLSC 1Y6ZA 4EYGA 1D6JA 3K0BA 3FMIA 1ABEA 1CNFA 3NHYA 3AO0B 4NV3A 5CMLA 5SY4A 3O8CA 3DJYA 3Q9LA 1QB7A 4LE1A 4LXUA 1Y6RA 4XEUA 4Y6OA 5JG7A 1P19A 1XD2A 1EQAA 1RKQA 1DUIA 1SUEA 2I33A 3IMGA 2Z9BA 4OXQA 2P2ZA 2R6CA 4Q93A 5B12A 1TUBB 1CG6A 3N2ZB 4I3GA 4HMOA 4JFAA 3LBNA 4Y2YA 1JG6A 1CCWA 4K9NA 3TGPA 3OTOB 3FOEC 2AFHB 2IZZA 3D0RA 2R8RA 3FR8A 4NBUA 4D9BA 2OHHA 4ARUA 5JIBA 2I8CA 1AO0A 1P5HA 4RVDA 4ZDJA 3URKA 4BL5A 3WKEA 4KLNA 3F98A 1YC5A 3B8HA 4BMZA 2G5TA 3JQRA 4X3PA 2WTNA 1XTUA 1H9BA 1NUTA 2BIFA 5BVHA 5SZKB 2DLNA 3VR5D 3BT7A 3ZLVA 4CLEA 3HSKA 2PT5A 3MGAA 3LPLA 5ES4B 3UXMA 3FGPA 4HYYA 3T3MB 3OCUA 3PCRB 1DAIA 2PRZA 4UBMA 1V26A 2R8OA 2PJRA 1ZRMA 4MW4A 4WRRA 5BR8B 2JFXA 1IM8A 1XMQB 1XN1A 3EQ7A 4P7FA 1Q1QA 1CUZA 3QLJA 2YRWA 3ZR4B 4FOPA 1KQ3A 1ZW6A 4IKPA 2QJOA 1WD7A 1Y3AA 4GRIA 3I4CA 2QTRA 3IJPA 1YQQA 2P0YA 4H2DA 3A1SA 4IV8A 5I7AA 4H0FA 1PK9A 5A4MS 3ZWBA 2X4GA 4EFNA 1R6BX 4DDTA 1XCPA 3DZKA 4RZXA 3LT2A 4CLHA 5B3JC 5JS8A 1UKEA 4RHYA 1J42A 1N57A 1YTLA 1DEAA 1WA5A 4F12A 3EGDB 2LIVA 1Z3IX 4CN9A 4GW3A 4ID9A 3ZBUA 2A94A 1GPLA 3F7NA 1UDCA 2GKOA 4UCFA 3RKRA 2H4YA 3EWSA 3T06B 4DMLA 1J2RA 1V16A 3D31A 3V1NA 4ATNA 2C00A 1H8ED 1QOQB 4Y9TA 1W9HA 3BDIA 1OF1A 2HMYB 4JEHA 4P86A 4U9IS 2AG6A 4DTIA 2Y1LA 1RQGA 5LDHA 1V11A 2HLDD 4HNTA 3GPDG 3GVHA 1P2GA 1GUZA 4EDFA 1E79D 5B6JA 4WY8A 5AUQA 4AAYA 4L4XA 4N1AA 3WSTA 2A59A 4YB8A 3CBGA 3BFVA 3OMXA 4KRXA 1KH3A 1SBNE 4E32A 2J31A 3DZIA 4H9GA 5CM9C 1U3VA 4ENWA 1V7PC 3KYIB 2JL1A 4UTZA 1CETA 5LD2C 2YIJA 4O02B 5CA1B 1ZIDA 4KIUA 2UYQA 4NP6A 2JG3A 2FG6C 4RSGA 5AICA 2AV6A 1JHXA 3EBPA 3N6VA 5HIJA 3VSDA 5JD5A 5JVDA 2EC5A 4HCJA 1XKTA 2BFDA 5JYDA 2IK8A 4CRWB 5AI8A 3OEWA 5D7BA 1OIVA 5FOVA 1P9RA 4K9LA 4YYEA 4H08A 3IMEA 2B3DA 5L4LA 2HPZA 3GDFA 4TPKA 1YDWA 2XB6A 2EZ8A 4MUNA 1QIKA 5FULA 1Z2OX 4LJ7A 4NX2A 3TE7A 3ICQB 2WMNB 2PV7A 1HYHA 1VG1A 3P0HA 5KQMA 3TLZA 4JUCA 2O19A 3FNHA 4IO0A 3M4XA 3KHSA 4JYBA 2PYZA 1PZGA 3B13B 5CT4A 2ADMA 3L2OB 4BVBA 1DO8A 1XLUA 1CF2O 4R9NA 5EKUA 4OAPA 3X0DA 1MGOA 1VPEA 3PG5A 5C3MA 2R7KA 4TTTS 1QV9A 1L7XA 2H9AA 3I2HA 4POAA 3Q6IA 4HF7A 4PINA 3ZQJA 3FI0A 5EJAA 1E0SA 4IXMA 4KYUA 3SLKA 5HM8A 1GL7A 3EXFB 3N3AC 3D8HA 4U00A 5I4CA 1XRMA 3SQOA 2QVYX 5T41A 4XDZA 1YB1A 4F2DA 3KZOA 2GZMA 1MOZA 4MQFA 4CMIB 1JYFA 2R84A 4M8SA 1U0LA 3U62A 1WUYA 3U39A 4E09A 4V0QA 1N36B 2GBLA 1KHHA 4RL4A 1V3QE 2EIXA 3O4FA 4OOFA 4J0QA 1BC5A 2AFHA 2XT9A 1Q5PA 4MYDA 4NOMA 4QGFA 1QK5A 1YQ9A 2BKEA 2Y6UA 3F6PA 3LYAA 4OP1A 2COEA 4BATA 4EKEA 1Y63A 3GGOA 2ST1A 4MQ4A 4BNYA 4BJ6A 2NYAA 3OBIA 3PEFA 2VS1A 2I3AA 4IXDA 1NV9A 4K40A 2V98A 3KLMX 5C32A 5G0VA 1YCFA 3W1WA 3N39C 3CRZA 4I4IA 5JFGA 1CDEA 3FDXA 3PICA 3OQNA 1GU7A 2P68A 3DLCA 4IJKA 1Z4KA 1C3JA 2C5HA 2FN9A 2NO1A 3KU4A 2V74B 1FQWA 2VL7A 4S1TA 1QZXA 4U7FA 2Q5LA 3F3YA 4F84A 1I2DA 2YWHA 3UBTA 3B5EA 1Q91A 4S1VA 5HRAA 3CKYA 4NNJA 4JWKA 1EFAA 5BMOA 2AN3A 4L0MA 2P2DA 3LK6A 2FPRA 2PLRA 2WP0A 2Z8YA 1CIJA 1KS2A 3EDMA 3JQ9C 1U5BB 4IWYA 2CDRA 3SLGA 2DF8A 4A2CA 1QQ6A 2V8BA 1PFYA 1JMYA 4QEKA 2Q49A 3NYWA 1SQFA 4MVCA 4XFKA 1ECLA 1HDCA 5IKOA 4F86A 4XWOA 3DFKA 2VXCA 4BNIA 5A4KA 4WKPA 2ZVDA 1M0WA 3OHSX 1U99A 3WHLA 4DEVA 5CLLA 4ENTA 9ATCA 5BORA 2PT9A 1DRKA 5ESWA 1JG3A 4Y0AA 3E9EA 4HWGA 2PH7A 2YOGA 3CZ4A 3ZX4A 4AWAA 5FOQA 3FVRA 3WYGA 1CJTC 3CE9A 2JGAA 2DRIA 4O63O 3TCKA 5TC4A 2VRCA 4YUZA 2J87A 1IY1A 1DSSG 1NF8A 2C8VA 3BMOA 4O59O 2QX8A 2F90A 1E89A 1XRPA 2X77A 2X40A 3EF1A 3PQ7A 2CJFA 3CNEA 1KI3A 1ANKA 1BXGB 4UVGA 4AQYB 2ACVA 3HZHA 2CV1A 4KXXA 1OLXB 1V9CA 2CLEB 5CEJA 2O8VA 4M8NE 3WGIA 3FHTA 4G0NA 3A6DA 5IN5A 2KWIA 1KK0A 2B0CA 3SEQA 1L4BA 5CA1A 2QZSA 2FK7A 1I0LA 2XEDA 2YVLA 3USES 1MJGM 2IVFA 3BICA 4RY2A 3AY6A 1J5XA 4LHXA 4C3OB 2QSYA 1KPHA 1IHXA 3FRHA 5J59A 3IAUA 3THRA 1U9YA 2XNDA 3EASA 3ENQA 4KPEC 3NV9A 1QHXA 4MYUA 1F0PA 3RUHA 2Q0SA 2BEUB 1DS6A 3D7MA 2B8NA 2FR8C 4GI5A 2IV2X 4HLCA 4IJ6A 4K28A 3V8QA 4BCDA 4DCTA 1UXIA 3TLBA 8ATCA 3ITKA 4ME6A 4XWKA 1G0NA 2HMTA 2OK8A 3OKFA 2MWMA 1V8FA 1X19A 2Y05A 3BH7A 2W6JD 3BJIC 4ESOA 1T8SA 3PQCA 1EX1A 1N75A 1M1YB 2Z6VA 5JJ5A 5LM3A 2JAOA 4RTMA 3KJIA 1KMMA 2Q50A 1H2ZA 2F3RA 1WJGA 1XA0A 4D1YA 1G5TA 1LFAA 4CMIA 1VHTA 1XP8A 1WV0A 3R3VA 4R0MA 1Q57A 4IOJA 2FUKA 1DBIA 4DA6A 1RZRD 2CLKB 3RVLA 4ZAZA 2BFCB 1UXGA 4I4CA 3VJLA 2JB9A 1N78A 1K5DA 5KNCH 1QIJA 3ZE6A 1X1BA 2JKZA 3D6VA 5AVZA 3M1YA 3K0AB 4L16A 5ED4A 3KHTA 1ZUD1 1W59A 4WZAE 4DTCA 3VPGA 2IU6A 3LBAA 3IP7A 3I3OA 5JISA 1T2FA 4IDHA 4IIHA 1U3WA 2Y4OA 4E5PA 4FMDB 4ZCRA 5C80A 1ZK2A 3PWTA 2ZUUA 3UHPA 2HXGA 4GIBA 5BN5B 2B1RA 1DX4A 1TO2E 3O1HB 4NZNA 4R1LA 1NTOA 4RMNA 5C1OA 1ZZEA 3ZWDA 3OOSA 3RUIA 2E49A 5H83A 3PNPA 2QG6A 3OIYA 1IIRA 1DOHA 1N7GA 3NFRA 3EY4A 4FYHA 4DAEA 1Y5IA 4P3KA 5C4IA 5IUJC 2A9RA 2W6QA 4LWZA 2EGHA 1RABA 4PZ0A 4ZVSA 5PNTA 3MTQA 1Y37A 2IXAA 2MSWA 2I7XA 3A9CA 2CL7X 2PA3A 3I37X 4PSUA 5KJCA 3IB6A 3MBIA 2C4VA 3IMFA 1LBQA 3L07A 1FZQA 3AHEA 3OZFA 2YXLA 4XGNA 2OZPA 3E82A 4JWTA 4GHWA 1N92A 1UMCB 3MTBA 1CE8B 3VH3A 1GU0A 4KQGA 4S1PA 3E4DA 3U1TA 1T4GA 1GNRA 1T2CA 2CXUA 1U5BA 3B36A 2JAWA 2QM0A 2XUJA 4KPFC 3ETLA 3SSNA 1PHRA 4GEGA 5CLFA 2GK4A 4GD3Q 4RJTA 1KYXA 4TV9F 2CXOA 5H7XA 2CFOA 3RC8A 4AP6A 5M04A 4UHJA 4HVCA 5BSEA 3FTDA 4HWSA 3NORA 3ZZNA 1T8YA 2O2YA 3AHJA 3H2BA 4LRWA 5BMVB 1M83A 3SC6A 1QTQA 3IV6A 3LU1A 5C4MA 5K0JA 3F5SA 3ADBA 1UAAA 1DC3A 4H3VA 3E0XA 1FY2A 3GA5A 3WRWA 5HZMA 1KZ7B 3EFOA 3KQSA 1TT5B 3QEMB 3T1YB 3X1ZA 4YPOA 1ZRHA 3AEYA 2H7YA 4M49A 1TQ2A 2Y1EA 3I9KA 1JALA 4L9AA 3S2ZA 3UMRA 3B89A 1W88A 4UUPA 3I4LA 4BZQA 2O6LA 1BXGA 5DHTA 1SVNA 2Y9MB 5T8KA 1YHZA 3C0KA 1IG0A 2NO0A 2H1FA 3S1AA 5D00A 2FVXA 3HVKA 4GOXA 1P0IA 1JMVA 2J7PA 4J94A 4CNQA 5CEEA 2IHTA 5KOIA 2WAMA 2H08A 3DMYA 3O8OA 1SZCA 4IV0A 4NAHA 5HBGA 1I13A 1SC9A 1W47A 2A9QA 4FSDA 1O97C 2GLXA 2WT9A 1R6XA 1VLZA 1TFRA 3D7RA 4PZZA 3V4PB 2ZYGA 3N0RA 4YJ3B 4DVJA 5HR5A 2ZWVA 4GVLA 2IYZA 2YZKA 4OFBA 4ZOLB 4NAVA 3WLRA 5EJFA 1KPGA 5ADWA 2NMVA 3VJMA 5C9ZA 2BEUA 1EK6A 4ZT2A 1TAHA 3T99A 4CBVA 4LDQA 1WBBA 3KTDA 3NC4A 2WWHA 4UAGA 4YP9A 1JQLB 3G2NA 4J2TA 5CYGA 1JAHA 4H6XA 4QJ4A 3I9NA 3HCRA 4NICA 4EO4A 5LUAA 4TT3D 1U6IA 2YHUA 2YY6A 1BXKA 3HZZA 5AHWA 3P9IA 1R8JA 2ATIA 1ZK0A 3MPOA 4BNGA 1H9CA 4P3NA 5J63A 1M1YA 4IEEA 4NHEA 1SCNE 2V58A 3E58A 3LL7A 1S89A 1XAHA 5ADVA 4AF8A 1E2PA 5LMZA 4OGKA 1GNQA 1PRYA 2A3RA 4A10A 1GP2A 2FSVC 4C30A 1B74A 1SO8A 4YGXB 3TOXA 5C5IA 5ICGA 2JFFA 3AIIA 5FWAA 2CMKA 1MO5A 5IM4A 4LVOA 2EZUA 3PHCA 4DXDA 4NDNE 4DR4B 2OGUA 2VSOA 2BFCA 3G7UA 2F17A 3LQYA 4TWBA 4IIJB 4PX2A 4D02A 3ER9A 3D6JA 4PPQA 3IRVA 4ZOAA 4B7UA 3SHWA 3K0AA 1Q84A 1UANA 2DPYA 3FXAA 4YAUA 4NCJA 3VAAA 3SOZA 1U2DA 3T4EA 2QAJA 4A36A 1WR8A 4O0MA 1KMNA 4QPCA 1UH5A 4KO3S 4WAUA 4ER5A 5BN5A 3MAJA 2AJBA 4BO3A 1JU4A 1UKVY 4XI9A 5KYTA 1M7GA 1R15A 1CD5A 1QC5B 3UJ8A 1NF2A 5F52A 5C52B 1XDGA 4MAFA 4KQMA 6REQA 2P4SA 4WUTA 4MEAA 1E3WB 1WCWA 7MDHA 2ECKA 4DMKA 1DT3A 2OBYA 3PD0A 2PXHA 5F1YA 1JQAA 1H8EA 2N9UA 4AW9A 1EJ2A 4LKRA 1UMCA 2C2GA 1CE8A 1KS9A 4WCFC 4DBVO 2ANBA 5DN9A 2P0AA 4QBGB 2MSLA 5A3RA 3J81A 1B6RA 1IUKA 4KL8S 4HLUC 3ER8A 1QRTA 1KEPA 4A16A 3Q4GA 4QICA 5BSTA 3TB4A 1M1UA 2QN7A 3G79A 2RKBA 3V32A 1V1JA 2Z58A 3KSAC 5JJBA 1GZVA 1D2HA 3D7LA 1C4WA 4G84A 1OGIA 1XF9A 1O8BA 1DE0A 3GYGA 4OUKX 4WACA 4BV2A 3EOAI 1N2CB 1SXQA 5FUMA 2ZJ6A 3RFTA 1X7YB 2CE2X 2OQRA 3CVJA 3T3IA 4QUIA 5TGTA 5LKRA 1HYQA 1ZM4A 3JVIA 3GBPA 4RFLA 4GGMX 3WWDA 4KMSA 4QAJA 5ALDA 1TT5A 2P2YA 3QEMA 5AJWA 3RH0A 5IKXA 1V9LA 4KQ2A 1P4GA 4LSMA 3GG9A 3HR8A 5LQKA 4QG7A 5HTOA 1HYGA 1YRYE 2JGDB 1RBMA 3VHRA 5GADl 2P4UA 5HKBA 4DLYA 5JAZA 3C3JA 3P0EA 1NKVA 4XARA 4XLZA 5HPYB 1ZMXA 4JB8A 1T5TA 4MYRA 1B8UA 3ZWMA 4ENUA 1P8AA 4W63A 2IYWA 1BCSB 4MQEB 1XPOA 1N0UA 2OLEA 4PRZA 3KQLA 3ZGLA 4ITUA 3IPAA 4JENA 4BZPA 1U0FA 4EJ2A 2HREA 1PLJA 2FJ0A 3BL8A 3K20A 4YJ3A 2FPPB 3FBTA 3NGXA 1LLCA 2JLSA 221PA 2IPNA 3OTWA 4CG1A 5ILOA 5JPDA 1A1SA 1OQAA 1W0KA 4H4EA 2BF7A 3BGSA 4MKIA 1ZM3A 3T1OA 1E1RA 1N6NA 1Z25A 3I32A 3ZHRA 4G5OA 3ZI4A 3M5DA 3KVVA 3LWDA 4E70A 4EZBA 1NDHA 3ZQ6A 5AKZA 4Z7QB 2VKTA 3OZVA 3WA6A 1LW6E 2VAXA 4L5BA 3STHA 3V8BA 3JZMA 4BNJA 1GAEO 2YW2A 2VJYA 3KHUA 4LW8A 4NVRA 1NMEA 4HAVA 2VJKA 3L0YA 4HJRA 3OC6A 3JQFC 4N6NA 1OBOA 3TR5A 2DBVO 5HX7A 2F3PA 4Q03A 1QLWA 1E3DA 2G36A 1M6VB 2UYOA 7REQA 4DEXA 4LGMA 2I2DA 1NY6A 3DEZA 2EHJA 3FGOA 2VQ6A 4KGDA 4QM7A 2ZJAA 2VHZA 1IY9A 4MTLA 4CM3A 3KZNA 1CC1S 4MPJA 2W58A 3LIPA 3ITNA 2VCYA 4B09A 3PQ8A 1N8NA 3IEUA 3KVNA 5A7HA 2BTEA 3IX7A 3T1QA 4O4LB 2GESA 3SJZA 1EFPB 3E9RA 3CWCA 3BIJA 3MTGA 4ALLA 3THWB 1O95D 4MZDA 3AW9A 3T94A 5CA0B 3PEUA 4LQ4A 5F7JA 1X13A 2R25B 4ZOQI 4Y2UA 4L95C 2DB3A 5KOHB 3PQ3A 1SEVA 1PJSA 3UKDA 2GPNA 3IP5A 4WFIA 4RFSB 4A8TA 1VL1A 1SBYA 2C7QA 2PD3A 3JTMA 5I8PA 3W8RA 2JJ1A 4K2HA 3K8QA 3P0JA 3JYPA 3F2IA 1IPHA 1OH7A 5B53A 2AKEA 1E2IA 1IHDA 3PDJA 3VMMA 1QC5A 5B1EA 3H5OA 3UAWA 1JIQA 4WL0A 4C6RA 4BUCA 4ZV7A 1SCQA 4TYPA 3B60A 1TYDE 4UKDA 3BBPA 2ZJBA 1E3WA 1LPBB 1MG0A 1U4SA 1X7WB 1CUHA 2E5FA 2QVGA 3DDZX 4UARA 5CH8A 3V4FA 3I23A 4LZLA 3JQ6A 3SJBA 4MHTA 4IQ4A 2F1IA 3VSCA 3M5PA 1I5RA 2GZAA 4RSRA 3FM9A 4XGRA 1HO3A 1SHKA 4FGZA 1JHPA 1GGFA 1Y7HA 2YINC 4BGUA 3FCCA 1QGDA 2XXAB 3OZBA 1F4VA 3DDHA 2YNMC 5BW4A 1DBQA 2I22A 1FTGA 3U6BA 3A70A 1GG9A 3EQZA 1G38A 2VBCA 1E1LA 3ICOA 2OTCA 2Q6OA 5C4GB 4I8XA 4KXUA 5EXEA 3U60B 2C4HA 2VAVA 1N2CA 2R7MA 1NF9A 1LK7A 4KR7A 1EAYA 1FS6A 1X7YA 4M1MA 2RJNA 4NYMR 1LLQA 1YL7A 4ZTBA 4DR2B 2B98A 4XR9A 3LV8A 1H5NA 1MJGA 1S2NA 2H5JA 5EPEA 3V7UA 2VN8A 4H6VA 2J0SA 2MSNA 1D6MA 1XQYA 4YTEA 1PV2A 3AM5A 1X1CA 2LPMA 1KVUA 2PPLA 2JGDA 4V03A 3WDSA 1QNFA 2WWWA 3NBFA 3OIUA 4FJ1A 2XEXA 3WLNA 4B2LA 4P0PB 1EIZA 4MDFA 2BEVB 4C7OB 3KPYA 3P9KA 1YBVA 5AKYA 5F35A 4DXAA 2Q0XA 1R6VA 3C48A 5A9SA 3I64A 1RPZA 3GLGB 4DC1A 3RFVA 4HYEA 2J5RA 1OX6A 1MMFB 4BMDA 3VR2D 2V0NA 4KXFB 1HDGO 1D8TA 3C3WA 4N8DA 3SHQA 4AQDA 1ZMRA 3R7SA 5F5LA 5BWBA 4H59A 1ZH6A 1LZKA 1EWTA 2WE8A 1YRHA 3V7YA 4WE3A 2A1UA 4ZVMA 4DA8A 2F48A 2N1MA 1H8HD 1YXMA 5FJJA 1AGRA 4KX3A 4JJAA 5L3ZA 4HH1A 4L3VA 4CNBA 4E51A 1ZSYA 1HOTA 1JWLA 1SZDA 3VYUB 3DO5A 3ANXA 1J90A 3MCWA 1L5OA 2JFQA 3NEYA 4XDGA 1T1JA 1XK7A 4HB0A 5K8TA 1EA7A 1M6VA 4CCSA 4L5AA 4MW1A 4TTAA 3WGUA 2I91A 4UOQA 2AFHE 1TF2A 1XJ5A 2H31A 2XD9A 3IIJA 1K8RA 3LJKA 3MW8A 4FGUA 3DOFA 1R4AA 3FBWA 3L6CA 5AM1A 5J9FA 4XCXA 5K09A 1Q1ZA 1IJFA 1ZI8A 3PXUA 1II8B 4GI7A 4JLNA 1W4LA 2PGJA 3FCSB 4L73A 4M6WB 4ZZ3A 5BNZA 2REOA 3ZCSA