1CETA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
305
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRLDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
total genus 114
structure length 305
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cetA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1cetA02
3GDFA 4CR6A 4CQMA 4TQGA 4UUPA 1NQ5A 2C5EA 2QQ5A 1Z73A 5TQVA 4J1QA 2FPPA 1LBEA 1I24A 2WYWA 1LDMA 3PJEA 4B8ZA 1E1NA 3K2BA 1MLDA 3EW7A 1MX3A 1ISMA 1GCOA 4FN4A 5DBFA 5F21A 1YQXA 3X2EA 3C7AA 3LT2A 2ZYAA 1CDOA 2JAPA 3DHEA 3ZZNA 1OOEA 5A04A 2PY6A 2ZCUA 4LMPA 4OKIA 4TRMA 5JYDA 1YS4A 1JKJA 1GYQA 5TGDA 1ZUD1 3HWRA 1H0KA 2Z1MA 5DCWA 4KZPA 3TSCA 4F45A 3KYBA 3ONEA 4J16A 4ND1A 5JC1A 1K3TA 1GEEA 1GYPA 3GGOA 4OSPA 2RHRA 3JQFA 3GRKA 2IODA 4RQUA 4MIEA 2FWMX 1K0UA 4UEJA 4ZA2A 5DZSA 3V8BA 3GUCA 1O94A 4XJTA 3PLRA 3A9WA 3GR6A 3PHHA 4URFA 3RFTA 5IG2A 3AOEC 4H15A 4PG4A 1NQAO 1O95A 3D5TA 1ULUA 4AJ4A 5G0UA 3ZW8A 4O5OA 4BO6A 2ZJ0A 4XIJA 1SAYA 1F14A 2JCYA 1ADGA 4AFNA 3BXXA 4EYEA 4DBVO 3KUXA 3DFUA 3MJSA 1FDVA 4XKJA 3E9MA 1WVGA 2FY8A 1TT5A 4J4HA 5TC4A 4ZQBA 3I23A 5IN4A 4IDFA 4CUJA 4YJFB 3ZH2A 3ASVA 3ZU4A 3WWYA 1HYHA 1XQ6A 5TJ9A 4R1SA 1GD1O 1O8CA 4ZJUA 4PN3A 4W9NC 1W73A 1JW9B 4YJGB 3ZWBA 4I8XA 1DAOA 1KVSA 1PSDA 4GBJA 3CKYA 4MVJH 5COBA 3LT0A 4YA6A 2PKQP 2CNBA 3ZNOA 4R1UA 4JIGA 4D41A 2AW5A 1BSVA 4JLWA 1HL3A 1ZSNA 2FP4A 2HMTA 1ZKMA 3KLPX 4XIYA 4BIIA 4PLZA 4E5NA 4OM8A 3GVIA 4NHEA 1YH3A 3OF2A 4OXNA 1LDBA 2BI7A 1T2AA 2AG5A 4K1LA 4YAJA 3TOXA 1X0XA 3EUWA 1I3LA 1MFPA 1ZMTA 2BHLA 3ENNA 3PYXA 1LTHR 1ZXLA 2WD7A 1U9JA 3JYLA 1ID1A 4I5GA 3FBGA 4QECA 2PKRA 4R01A 1XQ1A 2H5LA 5A9TA 5TT1A 3AW9A 4CV3A 3P2OA 2X23A 3R0IA 3QVWA 1VJTA 3KB6A 3FSRA 1B8UA 5EQFA 3BMNA 5BNIA 1B8PA 2JCVA 4PLVA 4MP6A 3SC6A 1YJQA 2OBYA 1YB5A 3ZNPA 1RWBA 3HDJA 4A5OA 2HRBA 5KKAA 3Q3CA 4Y67A 3BMOA 3WGHA 3TZCA 4KTVE 3INRA 4NU5A 2YUTA 3ZV6A 4CLRA 3ZNNA 2ZKLA 4LRSB 4HFJA 2NV6A 1XU7A 2IXBA 3GAFA 4WKGA 4X54A 3NGXA 4R4JA 2VWPA 1RM3A 1T24A 1I2CA 1MG0A 2B4TO 4JP2A 3WXBA 4I5EA 4QT0A 3KSZO 4Z3KA 3WIDA 4NNJA 2FPIA 2NU6A 3PGXA 4YCAA 3G3EA 2CDAA 2VYVD 5L95A 1U7TA 3KBOA 3EGOA 1IB6A 3PJGA 4RGBA 3KYCB 2WE7A 1E3IA 3I9KA 3UKOA 3ZWYA 1K5HA 2Y1GA 5KJEA 1RM5A 1WMAA 5B4TA 1OBFO 5CDSA 3RBVA 3IKVA 4J2HA 5KTKA 2EKPA 5C5IA 3I1JA 3CMCO 1NFFA 2ZB4A 2QYTA 4E5YA 4NBRA 5AQ1A 4OYRA 2DFVA 5HS4A 1KVUA 3U4IA 1GV0A 5IJZA 3Q6IA 1NWHA 4JCOA 5B4VA 2FN7A 1A71A 3K6JA 4BKPA 5A3JA 3GQVA 1I0ZA 3S2FA 2Y93A 1HWYA 4YRAA 1O0SA 5CEEA 5JAZA 4NZ9A 3GPIA 2QX7A 5JS6A 3ZHYA 5JMWA 5A05A 1YKFA 3C3XA 3VH3A 3JQDA 3GOHA 2CFCA 3INGA 2O3RA 1YXMA 3E1KA 5BSHA 1LRJA 3L9WA 2IZZA 1D8AA 1O5IA 4CM3A 4DA9A 3LK7A 1P1FA 3DR3A 1UDAA 4E4YA 1IPFA 1P0FA 2VHVA 4BGVA 4XYEA 1QYWA 1IL0A 4OQYA 5LDGA 2FPGA 5JE8A 3O9ZA 4RJTA 5GZ6A 2C5AA 1H6AA 4IXTA 3ZU3A 1DOHA 5JDCA 1TT5B 5L4NA 1PTJA 2W98A 1BXGA 1L7EA 3TZHA 3FPCA 2G76A 3C24A 4IDEA 3RFVA 4YRBA 1ZVMA 3LZ6A 4W99A 4CLDA 2Y0DA 3DBLB 2AQKA 2VZ9A 1QG6A 5JCJD 3VKVA 1XWFA 3IJPA 3R1IA 4OL9A 2V7PA 4ROSA 4IGEA 3JTMA 4EJ6A 3BMCA 4I5FA 5KVVA 2V65A 4UUOA 2I9PA 1U3VA 4ZQGA 4DC1A 4G5HA 1LLUA 1Q7GA 2B35A 3ANNA 5U4QA 3QLJA 3ZV5A 1S7CA 3QWIA 2BGKA 4YAIA 4FD3A 1UAGA 4MINA 4YT4A 4MP3A 4E2WA 3L6EA 2OMEA 5JY1A 2DVMA 4A03A 4AJNA 5CFZA 7MDHA 2A94A 2EF1A 5C7IO 2NTVA 4E5KA 3LLVA 3AY3A 2AA3A 4P8RA 4XGIA 2Q46A 3K9QO 1ARZA 3VZRA 4WLVA 2X58A 1V3TA 2V6FA 3C1OA 3D5QA 3OIDA 4A10A 2BFMA 4H16A 3ZU2A 4MDHA 4BGUA 3ANMA 1W8DA 2QRLA 3RFXA 3AWDA 3F6YA 2AE1A 3CTMA 4CLXA 1PU2A 4B3JA 3BIOA 2NACA 3VKUA 3RC7A 4J90A 1LRLA 2Y0EA 3RBXA 1RPNA 1NQTA 3LU1A 2VQ3A 4J6FA 3N7UA 4Q9NA 3AI2A 4IZHA 4WCDA 3V2HA 3WGYA 3Q0EA 5A5EA 3HFSA 4GX5A 3TPCA 5JAIA 3L4BC 1J4AA 1LEHA 4CMCA 4CMIA 2Y1CA 3ETGA 2EGGA 3RSHA 3ST7A 4MIOA 2VHWA 5EMHA 5F1KA 1I3KA 5IN5A 3G0OA 3KV3O 4XRRA 1NAIA 1AGNA 3MJEA 3WTCA 4GWGA 4LN1A 3C7CB 1IE3A 1WNTA 3GFGA 3E18A 4BNTA 3O8QA 4KQXA 1QMGA 4TROA 4JNKA 4PVCA 5JW6A 4R3NA 3ZDFA 1U3UA 4MVJF 3FRJA 4XGNA 5L9AA 2P9EA 4BGIA 2GGSA 1KC1A 1HDOA 4MVJP 4E5MA 2J6IA 3VPXA 2YDXA 3EVNA 3MTGA 3PRJA 1D4FA 4NR0A 5L3ZA 1BGVA 1B15A 3CEAA 3MOGA 2P9CA 3MJ4A 2Q1UA 3Q1LA 4YPOA 2FZWA 3IUSA 1HSOA 2GCGA 3RU7A 5KCZA 3D4OA 3TJRA 1KEPA 4DQVA 1A7KA 1LSSA 1SMKA 4I08A 1RJWA 2X7HA 4MJLA 2HSDA 1M67A 2J5RA 3EY4A 4QFDA 4RF3A 1B0AA 5BNTA 3EZYA 1AN9A 1T2CA 3WG9A 4EDFA 1X1TA 1TB4A 3WX0A 3SJUA 1VKNA 1X15A 2XAAA 3PWKA 4CLOA 4BOYA 3JSAA 1UDCA 5CDTA 1HETA 3O8QB 1E5QA 5AYVA 4FGSA 1QYDA 1VL0A 3F46A 1ORRA 4L4RA 2P4QA 4Q3AA 4N54A 1B3RA 3OJOA 3HHPA 4Z0TA 2C07A 5A1TA 3QV1A 2Q2WA 3F1LA 3FNHA 3KETA 2WE8A 3Q11A 3HDQA 4LSWA 5L53A 5IZCC 1VLLA 3KEQA 4Z0PA 4RPLA 3DZGA 4IIVA 5DNAA 4GX2A 1PGOA 4BUCA 2CDCA 4ZQEA 3IUPA 1PIWA 1WP4A 2GNAA 3V1YA 4HADA 2ZB3A 3H9JA 4EJ0A 2W2LA 1P31A 4KQWA 4O59O 4UVGA 3E8XA 1PS9A 4HBGA 1NQOA 3PFWO 4WECA 4Z0HO 4ALKA 4TRRA 2B37A 4WLOA 5T57A 2I65A 4OGWA 1DFIA 2E37A 4IDAA 2FR0A 5F1OA 1LLQA 3KO8A 3DB2A 3FNFA 5I9NA 5KKCA 4BGEA 1I3MA 2WWRA 5DP1A 1YL7A 4K26A 1DRVA 2I99A 3RKRA 1ONNA 3RC2A 2GO1A 4YVFA 3I4FA 2AHRA 4XR9A 3DZBA 2HAEA 5HBRA 3I4CA 5IFLA 3H7AA 3TFOA 2ZATA 1JA9A 2C29D 2HCTA 3D1LA 2PH3A 1DC3A 2X22A 3OQ6A 2HO5A 1MP0A 3I9NA 3HQ4O 3PYLA 5G2OA 1T4DA 4OO3A 3STHA 1V3VA 3WNQA 3DZIA 4CM6A 3AOEA 1E6WA 4EEZA 1JKFA 3DAPA 4E12A 4MP8A 1CRWG 4N7RA 3EHEA 4Z9YA 4MKXA 5ICSA 4J1TA 1YL5A 4GI2A 4HY3A 1MB4A 4R1TA 2LDBA 2OUIA 1BG6A 2OGUA 4CR7A 1T1SA 1UXGA 2Q99A 3Q2IA 3VZSA 1PR9A 5FYDA 4IJKA 1GAEO 3JD2A 5CEFA 4IZIA 1HDRA 4C7KA 1DIAA 2B83A 5L51A 3DHYA 1FDUA 1VPDA 3ZWAA 5TSDA 3CZRA 4H3VA 1F8FA 3W6UA 5C7LO 1H6BA 5H82A 3D4NA 4CLEA 2E82A 3CIFA 4M49A 3BTUA 2O50A 1KBZA 1XDWA 3W8DA 3DMTA 3HADA 4HP8A 1PX0A 2VNSA 4IGFA 4QEDA 3KYCA 3ROQA 3MJTA 1BXGB 3ORFA 3RVDA 5AXBA 2YHIA 4U0JA 2ZTMA 2PR2A 3JYNA 2ZJ1A 3W4JA 3OETA 5FWNA 2BFAA 1EE2A 4R69A 1EVZA 3HUDA 3KLMX 1N7GA 3UHAA 1SEPA 2DKNA 2NVBA 1T1RA 3DXFA 5EIOA 1FK8A 3ZWVA 4E32A 3DOJA 4IM7A 3RIHA 4IIUA 3R3SA 3RUHA 1Y1PA 5AVOA 1PQPA 5L7WA 5EJ2A 3OQ1A 4RDIA 4TRNA 4ALMA 1E1KA 3KYDA 3QIVA 1CQJA 1KETA 4Y6PA 5IDQA 3D3WB 4RORA 4UUMA 2SCUA 3ZHZA 1P1KA 5TJHA 3JYPA 1UZLA 5J23A 3I6IA 3OEYA 4IY1A 1HDCA 2EKLA 1N92A 2RAFA 2YZ7A 2ZCVA 3BMQB 3WGIA 4BMSA 1O9BA 3RJ9A 4JBIA 1KVTA 4LISA 4GVLA 4HFMA 2X9NA 1ENYA 2Q45A 3DEYX 1SNYA 1XSEA 3NJ4A 3ICCA 4UVHA 3GC6A 4CJXA 2DBZA 1UXKA 4P22A 1KIFA 4OIMA 2IYPA 4XX0A 1FXSA 4QFCA 3PK0A 1A7AA 3JQFC 4K28A 3RJ5A 4HV4A 1ZJZA 5JPIA 5ICMA 2DT5A 3CINA 1Q0HA 2D1YA 1AHHA 2NQTA 4J1NA 5DOVA 1PJBA 5G4KA 3ZWOA 4KWHA 2X5KO 3ZV3A 2HU2A 1U8FO 4AJHA 3COSA 3DOCA 2CY0A 1A9YA 3D0OA 5A9SA 3ZWPA 2NQ8A 1TVEA 1QLJA 1D1TA 4B7XA 2JAHA 4D45A 3DOOA 2DBRA 4HNHA 4Q3CA 5LDHA 3Q9UA 1SPXA 4QSMA 5TNXA 1MXHA 1Y5MA 3RU9A 1F12A 3A14A 2VUUA 4BMVA 1PGJA 3K96A 2PD6A 3KSDO 1DBVO 3L4BA 4A27A 3RUIA 4ND5A 4D46A 2VCYA 4K6CA 4AJIA 4WJZA 2PZMA 3DZKA 2QZ9A 4BO3A 2JD1A 4YT8A 5I9LA 4N5LA 5G0TA 5CG1A 4XYMA 4ALJA 2DUWA 3FTPA 1QR6A 5DP2A 4BS9A 3KVOA 2EHDA 2PGLA 2Q3EA 4YACA 3DONA 3FF4A 2ZIZA 4O0LA 4WLNA 1YDWA 3VPHA 3E82A 4ALLA 3SJ7A 1P33A 4DMMA 3H2ZA 3L77A 5DF1A 3FI9A 1J0XO 4NFSA 3FWNA 1YE3A 1R16A 2FMUA 1FDSA 2DTEA 3DDNA 4CLOB 3G49A 1GUYA 3WIEA 5JFOA 1SB9A 3GRPA 2AE2A 4GGPA 1SC6A 3H5NA 3QRWA 4XQGA 2H9IA 2CUKA 3FNEA 2OP1A 4DLLA 2H1SA 2HDHA 3QVXA 1NAHA 1GCUA 3DQPA 2W4QA 4YT2A 1F06A 2EW2A 3JD3A 3V5NA 3LQFA 5IZ4A 3OMLA 2VUSA 1C0IA 2YFHA 1D3AA 1N2SA 1GADO 1QYVA 4PZEA 3JQAA 4YJFA 4KOAA 1ML3A 3PGJA 4YRDA 1K6JA 2BMAA 4Y8VA 3S55A 4YB8A 3AY7A 3LDHA 3JQAD 2G5CA 4P4GA 1OAAA 1H9AA 1LI4A 3RUEA 2DQ4A 2VRCA 1ZBQA 3IOYA 3L0DA 5K6AC 3CSDA 1YGYA 2EERA 2ZTLA 2Q1SA 2HRZA 4KMSA 1E7YA 4PLFA 1DFHA 4JGBA 1JQBA 3LT4A 3JQ7A 4OH1A 4WUVA 3IQDB 1CERA 2VRCD 4NJMA 4DBZA 2ZQYA 3FHLA 1PEDA 4FIZA 4BHTA 3ON5A 2QW8A 5KNLA 3WWZA 4NIMA 4Z3DA 1PJ4A 1EVJA 1B26A 2W2KB 3AI3A 5LCXA 2NLOA 1GY8A 2AEJA 1ENOA 1Q7CA 4L76A 2GUGA 1H9BA 2GRAA 1OZAA 2RBEA 2VNAA 1YB4A 3F4LA 3BAZA 3NX4A 5EINA 1ZNQO 4CUZA 3HDYA 4JJGA 3QWHA 2BGMA 4BNWA 5DN9A 3OICA 5I9MA 1IUKA 3ZHXA 1NNUA 1VI2A 2EIHA 2QRJA 3ADOA 4MVJI 1WAMA 1YWGO 4BNIA 1BW9B 2W8ZA 4M54A 9LDTA 3MTJA 4Q3NA 5KJCA 2AQ8A 3C1TA 4IDBA 1HYEA 2Q49A 3PWZA 5DULA 1YBAA 4Q39A 4DLAA 5IAAA 1Q0QA 1E7SA 1H94A 3AK4A 4UREA 3VTZA 1JWBB 4J9UE 1XGKA 4DGSA 4IBOA 3AFNA 3ZV4A 1QORA 2UUPA 3CMMA 1AE1A 3KTDA 3PJFA 4XQEA 1R0SA 4TKLA 2YV3A 3TL2A 4NK4A 4XD2A 1TLTA 3PZRA 3GDOA 4J0EA 3L07A 1C1XB 4NI5A 4Y6SA 4YWJA 2D8AA 3LYLA 3V2GA 3QSGA 2JCXA 1ONOA 3K2EA 2B5WA 4XDYA 2GF2A 4A2CA 1N5DA 4J43A 2X0NA 4PG8A 2I76A 2CMDA 1QSGA 4CMAA 1MGOA 4II3A 1CIVA 4YT5A 5JDIC 1CF2O 4PLYA 5L4SA 5MGBA 1CWUA 2OHXA 1KC3A 4ND4A 4OXKA 2B5VA 1WDKA 1KYQA 3PP8A 3QVTA 1V9LA 1TI7A 3QW2A 4AJLA 1WMBA 3RKUA 4BNJA 1G1AA 3JD4A 2X1HA 3JQGA 4RLSA 4UVDA 3GUYA 4NMHA 1N7HA 2JKVA 1E1LA 1RYEA 1Y5RA 3RQSA 2YQ5A 1DIRA 2V6MA 3D64A 1UUFA 1P1JA 1BWSA 3MOIA 3WLEA 5K0ZA 4YDRA 5HA5A 3TNLA 2DUUA 3VDQA 2D4AA 2HMVA 1WWKA 2BELA 4XWYA 4FS3A 3RD5A 5JMPA 4WOKA 4MVJG 4E21A 3WYCA 2E6UX 5KVSA 4YJHB 4HNGA 3C85A 4B8WA 4C4OA 3GNQA 1R37A 4ILKA 3GHHA 1N9GA 4A73A 3CE6A 1U3WA 2P4HX 1GU7A 1E6EA 3GEDA 3WYEA 1LLCA 1TXGA 3GY0A 5HTOA 2PA3A 3RASA 3JQ9C 1XG5A 3MJVA 1QV6A 5JCJA 4CMGA 4CPDA 1ISJA 1Z82A 1ZO8A 4INAA 4TKMA 4GWKA 1EUCA 3B20A 1I2ZA 1HZJA 1KERA 1EZ4A 3PVZA 5BSFA 4B7CA 1C0PA 1HXHA 4OOFA 4BO7A 1NR7A 3GN1A 4EUEA 1LNQA 5CDGA 2YQ4A 1LDEA 4YTEA 1L7DA 3S8MA 1NVTA 4BO5A 1UP6A 4M55A 5ILOA 3I83A 5F5LA 2PWZA 2Y68A 4BMNA 5AXAA 1NFRA 1YQGA 3VPGA 2XXJA 2GN8A 4IMRA 1PWXA 5I7SA 3ASUA 1VE9A 1YOVA 3M1AA 1D7OA 3JYQA 5BR7A 3KXDA 4L0QA 1PJ3A 2DTDA 3NGLA 3OSUA 2A35A 4RPHA 1P9LA 5HS6A 1QLHA 2C54A 4B4WA 4DYVA 1FDTA 3PI7A 3RROA 3TN7A 3WYBA 1P77A 4XB2A 3ITKA 4XGKA 1GPJA 3DL2A 1ZK4A 3GMSA 4J4TA 5COQA 3RCBA 4IJWA 5CDYA 3NT2A 3C1AA 5KVCA 1UR5A 4II2A 5F1PA 3ZWCA 4FFLA 5THKA 1XCBA 4KUGA 5KWEA 1X13A 1ZXBA 2VTEA 3JQ7B 3U3XA 2VT3A 5HRUA 3SEFA 3WJ7A 4ZU3A 2YV1A 4GKBA 2CD9A 1OC2A 1DDOA 3OM9A 3QE3A 3FWZA 1DJQA 4A7PA 3WBBA 1DRWA 4PLHA 2G82A 2IRWA 4YAEA 5MDHA 2NM0A 3I9OA 4K6FA 1BTOA 4WLUA 2X5JO 1ZEMA 5JLAA 3CUKA 3Q2KA 3BTSA 1CETA 3UCFA 1W4ZA 1NR1A 4E2XA 3K8ZA 1X0VA 4D3FA 3OECA 1U5CA 3PFFA 2XXBA 1QYXA 3F5SA 2Z95A 3BMOB 5EERA 2EGHA 4DIFA 1EMDA 1Q0LA 1J5PA 3ZCXA 2C2YA 4OJNA 5AXCA 1PZGA 4YQZA 3N74A 2X8LA 2NVUA 3X2FA 4IQ0A 4RV9A 1PGPA 4GSLA 4N5MA 3GEGA 4I9NA 3DBRA 4BNZA 1E3WA 3EC7A 3DMYA 3I6QA 3QY9A 5JC8A 3GZNB 4ONEA 1WZIA 4OAQA 2HK8A 1JAXA 3IKTA 1RYDA 3OA2A 1SBYA 1IZ9A 3S1LA 4YR9A 1DFGA 1S6YA 5TLSA 2I5PO 4JJIA 3VTFA 4HXYA 4NFYA 5G4LA 4BO0A 3C8MA 3O03A 4YJDA 4K9DA 1H2HA 2PD4A 3NUGA 1H6CA 3NV9A 3DBRB 4NBTA 3IP1A 4WNCA 3PXXA 2Y05A 3IDSA 2EEZA 3DBHA 3GGGA 1FMCA 3RUAA 4IDCA 4D44A 3EYWA 1HKUA 2PV7A 3JD1A 4IQGA 4L4XA 4QO8A 4IJVA 4BNXA 4DVJA 3F9IA 5AOVA 1R4MB 2NTNA 3JQ8A 2UVDA 1YONA 1ZK1A 1E7QA 2Q1WA 3PEFA 4YJGA 5ER6A 2DPGA 3Q9NA 5EESA 4AJKA 1GPDG 4CQLA 3JQCA 1E77A 3MJCA 1DB3A 5JYEA 3RAJA 2WDZA 3RC1A 4UVEA 1Z6ZA 4NBWA 2Q1TA 5BSEA 3DAFA 3M1LA 4A26A 5KJ1A 3OA0A 4J1SA 1YJ8A 5L45A 1SZJG 4CM1A 1NPYA 3TRIA 5L7YA 4CLHA 1XHLA 2ZYGA 3H2SA 3VOSA 2HK9A 4FW8A 2YYYA 3VZPA 5KIAA 1HSZA 1P74A 2O7QA 2IXAA 3JQ9A 2HQ1A 3OJEA 4W6ZA 3GK3A 5EPOA 3UAGA 5IDXA 2UUOA 1X7HA 2Y1DA 1UJMA 3GH3A 4PLTA 3VVCA 4ZQFA 2CF6A 4BO1A 2J3JA 5G0WA 3WQRA 1W0CA 2DTXA 2GYYA 2YV2A 5GZ3A 4FR5A 1I01A 1EDZA 3BTVA 3TDKA 4DQUA 5I7VA 1HDGO 1RM0A 1DXYA 2VHYA 4JBGA 4JP3A 1YOVB 1YVEI 5T6BA 3IP3A 3TL3A 3H65A 3QWAA 5CEJA 1ADBA 5JBIA 4DL9A 4GLLA 2VYVA 1I36A 3ZW9A 4FFNA 4HX5A 3I52A 3VDRA 1C1DA 1ZCJA 1CJCA 4DWVA 1GUFA 1JLLA 1P1IA 3MZ0A 1AHIA 5DOZA 1V0JA 1LDYA 3U5TA 1YB1A 3GVHA 3H9QA 4B4VA 1XU9A 3ROMA 4CV2A 1E5LA 4FCCA 4IDDA 3NYWA 3A28A 4BNLA 3BYZA 4Y6RA 4DIBA 4XQ9A 5CP8A 3PTZA 3WMWA 2Q2QA 3DO5A 1DRUA 1UZMA 4ZICA 4MVJM 4LSMA 4QUKA 4AJEA 1G0OA 4IS3A 3AOGA 3QVSA 1BHSA 5JNLA 2WMDA 1DC5A 4TZTA 1ULSA 2RIRA 4RQTA 4WK6A 1R0KA 3IJRA 4R5MA 4R3WA 5FFFA 4L8VA 1ZK0A 2PLAA 3WICA 3UCXA 2JD2A 3KSUA 3FCOA 3UF0A 1ISHA 2FR1A 4R9RA 2RH4A 4GX0A 1U7HA 3WLFA 2QZZA 3PYMA 2C2XA 3CH6A 4CQMD 2EW8A 4BNFA 2Y0CA 1LLDA 4LVCA 3F5QA 4ZD6A 2YFQA 1O6ZA 3NTQA 2NU9A 3QHAA 1EUDA 4M86A 1X7GA 4B4OA 1A5ZA 3GEMA 4W7HA 2P91A 1NXQA 4XB1A 2C7GA 1X7DA 2J5KA 3AM5A 1IOLA 4UEOA 2O3QA 2ZTUA 2G17A 4J3FA 4ID9A 1EQ2A 3DC2A 4NU6A 1VL8A 5A06A 5T67A 1E3LA 3NDRA 1WW8A 4Q3DA 1B8VA 1YRLA 4U7WA 5I7EA 5C37A 2V6GA 1E7MA 2B36A 4JXKA 3SX2A 1QYCA 3PPIA 1OFGA 1KVRA 2VWHA 4IMPA 2TMGA 5IXSA 3V2UA 4BNYA 4J0FA 4DPLA 4MPDA 4BNMA 5KOIA 3DTTA 1XELA 4NJOA 4FFMA 2BFPA 2UV8A 4HUJA 1EQUA 1LXCA 3N58A 2B69A 4TRJA 3WSWA 3UW3A 5THQA 3KHUA 5T5QA 5T64A 1UAYA 2PKQO 4AJOA 3SXPA 5B12A 2GZ3A 3E9QA 1E0DA 2VT2A 4D42A 3SVTA 5ILGA 3H5RA 4CL8A 4B3HA 2DM6A 2Y67A 3F47A 3WBFA 3HB5X 2RHCA 1WDMA 2BLLA 2P9GA 2GR9A 5TIIA 2VOJA 3ONFA 1DLIA 2GDZA 4EEXA 2D2IA 4OKNA 4MVJA 2F00A 1PWZA 3RC9A 4CM4A 4CM8A 2QIOA 1GZ3A 1GR0A 2EP7A 3I3OA 2GZ2A 2AG8A 3DZHA 2FR8A 4M89A 2NU8A 4E33A 4MVJD 1Y9EA 4IJUA 4LMRA 3TOZA 1ADCA 3AM4A 2WD8A 4F3YA 1HLPA 1E7WA 1I30A 2PD3A 5BNFA 3U49A 4WE3A 1DJNA 3T7EA 3UGKA 2OL4A 2R6JA 1SOWA 3ENKA 5JO9A 1YQDA 3GG9A 1RKXA 4W4TA 4W9NA 1ZSYA 4DLBA 1G0NA 2VTDA 1GUZA 3GDGA 1YO6A 3UVEA 4BKUA 2B4RO 3A06A 5EL0A 1NASA 1YBVA 3BHJA 4TZKA 4BNVA 3JQBA 4BO9A 3G1UA 5A3VA 1R12A 3I5MA 2Y1FA 1H6DA 3TFQA 3KM0A 4NPCA 3U4DA 3FR7A 1XKQA 4CM7A 1C0KA 1WLYA 3LLSA 4FJ0A 2NUAA 2JFHA 2Q4EA 5DBIA 4FFOA 2HKIA 2BKAA 3DHNA 3IL2A 1EBUA 4G2NA 1V8BA 1ZJYA 4EJMA 2OORA 4E2ZA 2GASA 2CVOA 3GVXA 5ES3A 3L6OO 4CMJA 5G0VA 3WQQA 2UYYA 5DCYA 4KDFA 3LSYA 2FZEA 2J3HA 4J9VA 5FEUA 3DWFA 3VC7A 2OBNA 3WGGA 3GGPA 4GVXA 2H63A 1ONPA 2FSSA 4NBUA 4BNNA 1PJ2A 4XYGA 5IF3A 3UICA 3MCVA 4A0SA 4O6VA 2X86A 3TWOA 1BRMA 3ABIA 1DPGA 1ZEJA 4PFJA 4E5PA 1BDBA 2PGJA 3U0BA 2PK3A 4Y98A 1HE4A 3VPFA 3HSKA 1IZ0A 1ZIDA 1DEHA 2YJZA 1GQYA 2EWMA 4BNKA 1PQUA 1PJSA 3M2PA 2O2YA 5DDIP 1B3BA 4R51A 4G81A 1WPQA 3JD0A 2QRKA 1K89A 4IPTA 5DBGA 1KOLA 1HYGA 2BD0A 4U8GA 5AXDA 3ZNQA 5COAA 1E3JA 2ZYDA 2PH5A 5ADHA 2DU8A 1ZH8A 4RVGA 2GN9A 2AEMA 5U9CA 1IHYA 3TQHA 4ZRMA 1D1SA 1DC6A 2P2SA 3PDJA 5DCUA 4I5DA 5A9SB 4EITA 4UEKA 1HE5A 4KUHA 4WCFC 1H5QA 3JQEA 1PQWA 5JXWA 1DLJA 1JWAB 3HFGA 1F17A 4HKTA 3DZFA 3OBBA 2Z1NA 3GT0A 2QHXA 1U2GA 4E6PA 4YYZA 4FFPA 1ZMOA 1K6XA 2JFFA 1C1DB 2HJSA 2D0IA 1Z74A 1SEVA 3BA1A 1G6KA 1KVQA 3JQBC 1I2BA 1DO8A 2G0TA 2BI8A 1Y8RA 2J3IA 4RVDA 5B1YA 4GLOA 4BO8A 1LQTA 3DAGA 4Z9FA 5H83A 1M2WA 5A4DA 2RCYA 4DTIA 3O4RA 5C3MA 1LDGA 4CR8A 3UN1A 1TA4A 2DBVO 1PJQA 4BO4A 3EK2A 3WGQA 3G17A 1XR3A 3M2TA 2I67A 4GH5A 2NVUB 1P44A 3H3FA 3GNTA 4L75A 4D43A 4XYLA 1GV1A 2VYND 3CPSA 1YBMA 1FDWA 4NG5A 4ZVVA 1XIVA 3D3WA 5A5FA 1Y8RB 3S2EA 1C0LA 5ITVA 3P5SA 3GPDG 1VJ1A 3DZJA 1VSUA 1C14A 1JDJA 3BMCB 3PHJA 1BVUA 1ZZEA 4D3SA 1GQQA 1JAYA 3D3EA 1YDEA 4GX1A 1EEHA 1NPTO 3UCEA 1GDHA 3PWSA 4RVHA 5JAQA 2NNLD 3ZU5A 3DBLA 3PQEA 1ISGA 2O4CA 4Z9XA 4RPJA 3OJFA 3HNPA 2BRUA 4KUEA 4E31A 2O4UX 3IAHA 4R16A 2EKQA 1R0LA 2WM3A 3PHLA 4J7UA 4CMEA 3F4BA 4WASA 2X9GA 3H6KA 1EBFA 1BXKA 3FTNA 3K5PA 3OIGA 3O26A 4J91A 5GZ1A 1U4SA 4OXYA 4PLCA 5I8ZA 3ULKA 4CQLB 4ITUA 3ZWWA 2GN6A 1JTVA 4ALIA 1I3NA 3L9XA 3T4XA 4D0SA 1WXDA 3JQ8B 4J2OA 5I7FA 4M87A 3BZUA 1KS9A 4JBHA 3K73O 4UUNA 2Y1EA 3B6ZA 2EJWA 2P68A 3U4HA 4YXFA 4DUPA 2ZK7A 4JX8A 5TF4A 3BMQA 3JCZA 2RH8A 3HZZA 1GTMA 1GZ4A 3LC7O 4PCVA 1V3UA 2EV9A 4Q3BA 1U4OA 1LRKA 3PHIA 1UZNA 1R15A 3AM3A 3K92A 1HRDA 5F3RA 4I9UA 1HF3A 1Z75A 1IPEA 3KYDB 1H93A 5CPBA 1PL6A 4J4BA 4U6QA 1DHTA 1M6WA 1ZK2A 3G79A 5KJ6A 4R54A 1M6HA 4GMFA 7ADHA 1NVGA 5G0SA 1ISIA 3AY6A 2J8ZA 2X6TA 1I33A 2Q4BA 2DPHA 1UXIA 1Z7BA 3QP9A 1Q7BA 5FF9A 1VSVA 3ZGYA 1U28A 5L7TA 2ZQZA 3DTYA 2C82A 2Z5LA 4MOWA 2HK7A 2AXQA 4PLWA 3QWBA 5B37A 3V1TC 2WJPA 2WEKA 1EFKA 4PLGA 1MC4A 2EG9A 1ISFA 1U3TA 6LDHA 4DMLA 3FD8A 2ZB8A 3RBZA 3DFZA 2TMDA 4UAGA 3GLQA 4XR4A 5U1PA 4MKRA 3QA9A 5FI5A 2GERA 1I32A 4HFRA 4FJ1A 3PQFA 3TZ6A 2IEBA 2IEDA 3WR5A 3K31A 1LJ8A 4ZQHA 4FGWA 3W4KA 3GZ4A 4WEOA 4BV9A 3U4CA 2I6TA 2O3UA 2P5UA 1NHWA 1HE2A 1KY5A 3HG7A 3JQGB 3LF1A 2YW9A 4FC7A 4CL3A 3AU9A 3R3JA 1PL7A 1LC3A 4BV8A 1O89A 4N18A 3OP4A 4Y9DA 4PRLA 2WD7B 1P1HA 4RPKA 1VRWA 4TVOA 2HMWA 5JDIA 2C59A 2UAGA 4CUKA 4PZCA 2BFOA 3O38A 5JY6A 2J5QA 1ZW1A 4GAEA 4EW6A 1AXEA 1SOVA 1Y7TA 1IY8A 2JHGA 3AU8A 2B4QA 4NDNE 4XEHA 4M1QA 4O63O 4XDZA 1N8KA 1JN0A 3OFSA 2VRBA 4DREA 3OJLA 3TZKA 1PZFA 2XF8A 3LF2A 2HJRA 2FSVA 4QTZA 4GQAA 4YQYA 2CVZA 3KRTA 1HDZA 4S3MA 3BHIA 4LGVA 1KEVA 4EI2A 4D3DA 1M66A 1UXJA 4PLPA 2WYUA 2IDZA 5A02A 3AFMA 4WLEA 3AJRA 2O3TA 3WFJA 2VHXA 3WMXA 4GKVA 4RVFA 3L6DA 3RWBA 3H8VA 3IS3A 3H9EO 1LUAA 1ZFNA 3CZMA 3RUCA 5IXYA 3RUDA 2Q50A 1PJTA 3GAZA 4JJFA 1LX6A 2O3JA 3LVFO 1A4UA 1AUPA 1UDBA 2DFDA 1EVIA 3IC5A 2E48A 3B1KA 1ENZA 2Q2VA 3OJ0A 4CMKA 3AI1A 1VJ0A 3GMDA 1NTOA 2WSBA 1FJHA 1V35A 4FB5A 3HN2A 2Y99A 2NWQA 4BVAA 1PGNA 2DAPA 4PG6A 2AQHA 2JJYA 5F5NA 2X0JA 4R5HA 5CPFA 2V6BA 1SO8A 4GPD1 1HLDA 3B1JA 1H2BA 5JSFA 5L40A 1A72A 3H9GA 4E0BA 4B4UA 2GLXA 4AICA 4BKQA 4OSOA 2PTGA 3WSVA 3PZBA 5TX7A 1T25A 1VL6A 3H5AA 5DT9A 5CHEA 4AJPA 4FBGA 2DC1A 2IZ1A 3DMTC 3VH1A 3AUAA 1LSJA 2O7SA 1VC2A 1QP8A 3LC2O 1IYZA 1HEUA 1EFLA 1U1IA 3FR8A 1GZ6A 3SBOA 6ADHA 2JHFA 2OZPA 1GQ2A 2UDPA 4H7PA 4RF5A 3DBVO 1Z7EA 1MFZA 4MIYA 4RF4A 1MA0A 3JQAB 3ZHBA 1KEWA 3AUSA 4EZBA 2GSDA 2ZB7A 4FDAA 2IZ0A 2LDXA 5B4UA 4TSKA 1Y9AA 1U2DA 4WOJA 3WQSB 3I9MA 3D4PA 8LDHA 4PG5A 1P0CA 3ZN2A 3PLNA 1XYGA 1KY4A 1N1GA 4FJ2A 1UH5A 2VOEA 2PNFA 4XRGA 1VM6A 3GNSA 2PZLA 2OXIA 3D7LA 2VZ8A 4NQZA 4BKOA 1B14A 3GG2A 4QXMA 4GGOA 1MXFA 1BW9A 1T2DA 2HLPA 2JFGA 3MWEB 4HWKA 3VAZA 3W1VA 5HWSA 3VVBA 2YY7A 3PIIA 3FPLA 4LVUA 4XQCA 5HM8A 2QG4A 3WOHA 2C0CA 2QYSA 2W90A 1NX6A 2ET6A 1VKOA 1HDYA 4GMGA 4LCEA 2J3KA 4U0KA 4FOOA 1A4IA 1YL6A 5JAMA 4IINA 2PGDA 3PHGA 2IYOA 2G1UA 3VH2A 2CSUA 1UXHA 2A92A 2XOXA 1OC4A 2D59A 3H3JA 4IDGA 3HB4X 4W7IA 4KWIA 4BNGA 1P1RA 4L73A 4CV0A 2NADA 2W2KA 1DAPA 2GPTA 1T26A 5T8KC 3MEQA 3JQ6A 3AUTA 4FFRA 3GHYA 4AJJA 4FOSA 1J6UA 1Y8QB 3OEWA 4CMHA 4R68A 4BQPA 4NJMB 3L4SO 3S2GA 2AQIA 4QO7A 3UUWA 4F6CA 3ETDA 4PZDA 1TEHA 1Y81A 2CF5A 2FRDA 2WYVA 2O2SA 2H6EA 3FBTA 4PG7A 1L1FA 3WB9A 4DYDA 5I8WA 1PJCA 2A9FA 4PVDA 4F46A 3TF5A 3WFIA 4TMFA 2OP0A 1PS0A 3NKLA 3LT1A 4PGFA 3E5MA 4CM5A 1M76A 2O3SA 4ZHSA 4JN6B 1E7RA 3NDIA 3K30A 3A1NA 4XYBA 4E30A 1TT7A 2BGLA 2OO5A 4AJ2A 4BB6A 1GL3A 2YDYA 1I10A 4ND2A 4R41A 2GZ1A 3U09A 3SLGA 2R00A 2X4GA 2GN4A 2E49A 2JD0A 3G1TA 1NHGA 2VWQA 4W82A 3LC1O 4AG3A 4D7AA 1HDXA 5GY7A 3DBHB 2VWGA 5JO0A 4WPGA 1HTBA 3JYOA 5CDUA 1GFSA 1NP3A 4PIVA 3W8FA 4DXHA 5T8KA 4R9SA 1QV7A 3E48A 1ZSVA 1P45A 5IDYA 1AXGA 1R4NA 2YHUA 4XA8A 4CM9D 3WGTA 3JV7A 1LQUA 5JCXA 3GZNA 1FF9A 1JKIA 1MV8A 2CVQA 1E3WB 4WLFA 2C20A 3HDHA 3QQPA 3UH1A 1C3VA 1JU9A 1DIHA 2I66A 4RCVA 4CM9A 2E4AA 1LA2A 1N1EA 1HE3A 3HN7A 4RZIA 3UOGA 4MO2A 3INTA 4FC6A 4LW8A 2EP5A 2NU7A 1OI7A 1K6IA 1Z45A 2DLDA 3WGZA 1E3EA 1B16A 3NTRA 4CODB 3FN4A 5A03A 2NTJA 5ITWA 1QKIA 1WDLA 2HMSA 4E13A 4RVSA 3ETEA 5BSGA 1EDOA 1R4MA 1ZK3A 4LK3A 3ADPA 3FNGA 1PZEA 1BXZA 2BH9A 4MVJE 4WCFB 4P4LA 5G4KB 3WNVA 1PS8A 4G65A 4BL5A 4D0RA 4BNUA 4KTTE 5EQDA 3NT5A 1PR3A 3GVPA 3ZWXA 2PZJA 3P19A 2GD1O 5BQFA 4IS2A 1CYDA 2NSDA 5KJFA 5L4LA 1DSSG 4EGFA 1E6UA 3NTOA 3BMNB 3QVOA 3U9LA 4ESOA 4NBVA 4P38A 4NK5A 4RVUA 1DC4A 3KOUA 3WJAA 1K2WA 1NFQA 1NBOA 4AJ1A 1JVSA 3ROPA 2R2GA 1OMOA 4EUFA 3A4VA 1I5RA 4U6SA 2NVWA 2VHZA 3IMFA 4Z6KA 1Q2XA 4ZRNA 5LC1A 4Q3EA 3SC4A 3GF4A 2P5YA 3NEPX 1ADFA 2X5OA 1UP7A 4L4SA 1F8GA 4J7CA 3T7CA 4RLHA 5JDCC 3W4IA 1BMDA 4DRYA 1NWCA 1A9ZA 2AEFA 4B7UA 4ZN6A 4BKRA 1EVYA 1E1MA 4RZHA 4FSHA 4U5QA 4M8SA 2HUNA 4BB5A 5TS3A 3AUUA 3UXYA 4WCFA 2O48X 5K6AA 2VUTA 1U8XX 2AMFA 1XEAA 3C7DB 2B0JA 3W6ZA 3QJ5A 3EMKA 1NVMB 4S1VA 1W6UA 2W2LD 4CV1A 4LCJA 5TRTA 5BT9A 3PDUA 1HT0A 4J7XA 1PJLA 5IDWA 5TT0A 1IULA 3GFBA 4YAGA 1NM5A 4XJSA 2Y66A 4CLRB 3WTBA 4WGGA 4ZGWA 2YHIB 1J49A 1MUUA 1LU9A 4FPXA 4IUYA 2X0RA 1T2EA 2VN8A 1U5AA 1I8TA 1SCUA 2ILTA 1PZHA 1GEGA 1PGQA 1R6DA 5ENVA 3B70A 3I9LA 4DPKA 2FOIA 3I9JA 3ROKA 3ICPA 4AL4A 3F1KA 5IZCA 4GL4A 2DBQA 1X1EA 4O1MA 1LC0A 4XCVA 3VH4A 4GSKA 3EZLA 4OHUA 4R1NA 4CM4B 4CM8B 1R66A 2XPCA 1CQIA 1R4NB 3IIEA 4YBZA 4L74A 1B2LA 2IE0A 3H9UA 1Q1NA 3WGOA 1MG5A 4UVIA 4KDEA 4NFHA 4E3ZA 3OQBA 4PRKA 3F3SA 2PZKA 3GVCA 3OH8A 5CG2A 3NRCA 2I3AA 1BVRA 2F1KA 1GYRA 2D5AA 3SLKA 4JQCA 4KP7A 5CAEA 1HZZA 1V6AA 3PJDA 2PFGA 1IHXA 4CMEC 2OFPA 3EDMA 8ADHA 5H81A 1M75A 1XA0A 4N5NA 1DIGA 2BF7A 1SB8A 3HE3A 4TWRA 4DC0A 1QRRA 4XZ3A 5ER9A 3V1UA 4BO2A 3RI3A 1RM4A 3ONDA 1C1XA 3BHMA 4NH4A 4J49A 3BTOA 2D5CA 2R00C 1NYTA 4JROA 3E6AA 1F0YA 2VZ0A 2CZCA 4QQRA 1PL8A 4RF2A 4OMUA 1Y6JA 4RO0A 1A27A 1N9GB 3T4EA 3EAGA 1BDMA 1ENPA 2JL1A 3S2IA 3VPSA 4HFNA 3NJ8A 4YJHA 3ZWMA 3KZVA 4QX6A 3OHSX 5ENDA 1E3SA 2ZTVA 4OOEA 4DPMA 3NDJA 4RDHA 3CXRA 3HJAA 1Y8QA 3P7MA 3NAQA 5EN4A 5FI3A 4YAKA 3TZQA 4B79A 4FQ8A 4WNIA 3GA0A 1X14A 4EUHA 4OQZA 4RPGA 4CMBA 3B1FA 4BQRA 2O23A 3P2YA 2FHSA 3ANLA 3VHRA 1KEUA 1EK5A 2CDBA 4BNHA 2VYNA 2Y1OA 1B7GO 1QXSA 1UP4A 2C7VA 1E92A 3PIDA 2I3GA 1DHRA 1MC5A 1CEQA 1EE9A 1LSUA 3KEOA 3RUFA 4CMIB 3OIFA 3E5RA 3M6IA 3PQDA 3UFXA 3H4VA 5C7OO 1WZEA 3ZI0A 2EXXA 4JK3A 4AVYA 1T4BA 4D79A 4MKZA 4YEDA 4ALNA 2X0IA 2WTBA 2HMUA 9LDBA 3E03A 3E9NA 4TVBA 4ND3A 2EJVA 3QWFA 1JVBA 4B3IA 3MWDB 3NT4A 1DIBA 4L9RA 3U62A 1LSOA 4CQMB 4F6LA 4I9HA 5A9RA 1EK6A 2D3TA 1LDNA 4WEQA 3WDSA 4UULA 5GMOA 2A4KA 3WS7A 3R6DA 2POQX 4IQ8A 4EBFA 3VZQA 3ITDA 4RL6A 2X9VA 1XLTA 5K9ZA 1P3DA 4E2YA 3EVTA 3W8EA 4C7JA 4DQXA 3ZWNA 4P4NA 1T2FA 2OOSA 3GN2A 1NPDA 4LRTB 5KVQA 1EUZA 4I1IA 4DIOA 4IXWA
chains in the Genus database with same CATH superfamily
2WFZA 2UZAA 4GR5A 3VU0A 3TIFA 3N2YA 4UUPA 4INZA 3A2MA 4I19A 2C5EA 4Q9JA 1PKEA 3D0RA 2I34A 4K81B 1OX5A 1WPGA 1F6WA 3PJEA 2C9DA 2ETXA 3HLKA 4X94A 3LHDA 4JVLA 2GBLC 4FN4A 2OZKA 3OZFA 4GOOD 4RKQA 3C7AA 1GO2A 1RWNA 1MB9A 4HGQA 4US1R 1CDOA 5H3LA 3DM5A 3MUEA 4TL8A 4B3XA 1E32A 1N2EA 2AFRA 4DV7B 4OKIA 1S4QA 2CLIB 3RK4A 4Z7NB 2OOKA 1JTFA 5JSZB 5TGDA 4A6EA 1SWWA 1ZUD1 4B6PA 3EC2A 3E8SA 3VOBA 5JC1A 1K3TA 1GEEA 4O25A 4OSPA 4KPFC 4W5RA 3HCOA 4MQLA 1R4AA 2VJPA 2GBLA 4RK6A 4BVGA 3OZBA 4AS2A 3AUFA 3SNHA 4REMA 2KYRA 1LI7A 2IIVA 2AFHA 3CRQA 2VDVE 5ARCA 3B9RA 2CNKA 3VHXA 3HUUA 4ERNA 2HLDA 5EAIA 4DR4B 5EMJA 3A9TA 4URFA 5FPYA 3LYHA 4DV4B 2GZMA 2XYHA 3GJZA 1J21A 3UGQA 3VKHA 1C9DB 1L8OA 1ULUA 2BFDA 4J0IA 4AJ4A 3ZW8A 2NQ2C 3QXHA 4XIJA 3U3MA 4Q4JA 3L06A 1BWRA 1XMQB 4D25A 1M1NA 3GFPA 1HG0A 3BSWA 1NIPA 1TT5A 1Y4ZA 4FFWA 4DA4A 3I23A 4DCVA 4ZOEA 2YJ5A 1F60A 1KH3A 4CUJA 3LIIA 4KC0A 3DPSA 2YV5A 4YJFB 3ZU4A 2KPOA 3X1XA 1M2HA 1HYHA 2AI2A 4GYYA 3UT6A 7REQB 1NBMD 1GD1O 2CCKA 3AB3A 1V8PA 4L27A 3HM9A 3T7KA 4W9NC 1GUDA 3GI1A 4V24A 1OGIA 4YJGB 3FMGA 2ZZKA 2ORIA 5DXFA 1PSDA 1C2TA 3CKYA 3NVDA 3ZJ4A 1ZW6A 4WBNA 5DHTA 2CNBA 4F9GA 4OLAA 5GONB 1L5HB 4XGQA 1VBNA 4JITA 2Q6VA 1PSWA 4JVSB 1M34B 5AWFC 2GYUA 1IDN1 3FF1A 4JLWA 4MAMA 4D8XA 2FP4A 2HMTA 3ESDA 4TV8B 4IYRA 4PLZA 4E5NA 4OM8A 5D6NA 1K08A 4BVHA 3KVNA 3ZJ5A 1H4QA 1YH3A 3R3WA 4G5OA 4LI0A 4ZT6A 3DKPA 3NBAA 4E4RA 5JQGF 4RTMA 4W5JA 1ULZA 2AG5A 1YMUA 1I3LA 2WINI 1MFPA 3BSYA 4OA5A 1E1YA 4RQAA 1XP8A 2DSTA 1EFTA 4WX2B 1VPTA 2BHLA 2IUTA 2OBFA 3DKKA 5ALIA 4RC9A 4BTEA 1EHCA 1XVLA 5H70A 1MR3F 1N7JA 1W4RA 2RKOA 2HSGA 2VBIA 3EB9A 3ENNA 1IWOA 1D6JA 3FBGA 3JYLA 3R7SA 3L1HA 2EZ9A 5GVRA 1KYYA 4TUYB 4OF4A 1W4BA 1SGWA 1T0UA 1B8UA 3BMNA 3RT9A 5BNIA 1B8PA 1EAYA 3A6EA 2HIHA 2GYWA 3EEQA 3LOPA 2NO7A 3SC6A 2VH1A 4G0WA 2OBYA 4MV7A 4LZOA 5HEKA 1RWBA 2X15A 4BLWA 1AO0A 2FF7A 2PX3A 1DDGA 1TF5A 2R5WA 1S8AA 4OBBA 3CUYA 4UNNA 3RLFA 1P2GA 1G2OA 1BC5A 4M8KA 4U6NA 2XVXA 3SQLA 3QVGB 3TZCA 4LRQA 4KTVE 3STTA 4NU5A 3T4UA 4RK5A 1OH8A 4IXNA 3RB8A 4I4IA 3OD5A 4Y30A 2PUTA 4OQNA 2AK2A 1OPRA 4CIDA 3WSTA 4HFJA 5I4CA 3V8EA 1O9HA 4K0KB 3L6RA 4PC2A 2G8NA 2R0QC 4R4JA 5ITZB 1RM3A 1T24A 2Q3CA 1U90A 2B4TO 2OXEA 3IBTA 1U2GC 3COPA 1ZD9A 3PNPA 4I5EA 1KP2A 4RSMA 4CCWA 4DILA 1JLHA 1G5RA 1XRJA 4YCAA 3ZTYA 1Z35A 2J08A 3KT6A 3LC0A 2WJGA 1OFUA 4C0LA 5L95A 4UDNA 3N39C 3GJ5A 1IB6A 1MJGM 4BN5A 4F2WA 4B1FA 1D6NA 3A1DA 4RH3A 2FSFA 4HQNA 1FFAA 2ZBDA 4GZ3A 1HT3A 1MN6A 1H4TA 1NUQA 2G04A 2P7HA 3CN7A 4TX1A 5KJEA 1RM5A 1WMAA 5PGMA 1CP2A 4AF6A 4KR2A 1D07A 1EIZA 3BH7A 4E3WA 1Y3CE 3M4NA 3SHOA 1BU5A 7AT1A 4I2NA 1XFAA 4JDPA 4LJ5A 1Y3FE 5C5IA 3AHJA 4ZI7A 3I1JA 3SM3A 1NFFA 4E5YA 2C4MA 4HN2A 1RBMA 4JX9A 2JI7A 5CFOA 1BCSB 2EZUA 2DFVA 1OXTA 1U0SY 3C4VA 1OW3B 3D6TB 2Q07A 1EDEA 1A9PA 2IP1A 1NWHA 4JCOA 4MMXB 1KPIA 3L6BA 4EELA 2FN7A 1A71A 3F67A 1L5ZA 3K6JA 5GAJA 1UOQA 4QWMA 2J3MA 3WIOA 5A3JA 3NHPA 4OFXA 5B57C 3S2FA 1HWYA 3DH0A 4HYEA 5JAZA 2AK3A 4B3RB 2QN1A 2GAJA 2QX7A 2YXPX 1XA3A 4GGMX 5A05A 5E95A 1P5ZB 3A0RB 2CFCA 3GOHA 5LLSA 2Y3IA 1SKAA 1YXMA 2J85A 3E1KA 5BSHA 4LHZA 4X8MA 5FPHA 5TPWB 2BONA 1D8AA 2NPIA 2XLCA 3N7AA 1HURA 2ZRLA 4KO4S 2PLWA 3BRCA 4IR7A 3DR3A 4YAWA 3MMSA 1UDAA 2E2WA 3U6KA 3OZDA 2J87A 3K1AA 1QYWA 1FJXA 1VRCA 4V03A 2GPAA 3FVRA 3DYBA 1CVLA 4I55B 4Z4QA 2P3SA 1H6AA 1TM4E 1PTJA 1L7EA 4EL0A 5EGSA 2BGJA 3NNSA 3AIMA 3WRVA 2C2WA 1H8HA 1U8ZA 1HNZB 1YRAA 4YALA 1JYEA 3MIZA 3IRUA 4PW0A 4W99A 2QVZX 1O96A 2RDMA 3PXUA 2AQKA 2VZ9A 1E2IA 1GNLA 4ZOCA 4WZAA 3UV3A 5KOYA 3TGPA 4DIMA 3SOPA 3AHIA 1I7LA 4H7DA 3IJPA 3EFHA 4JOBA 1EVEA 3MMPA 1DQSA 2WYHA 1TK3A 4LZPA 5T4EA 3KEFA 3IP9A 3S8EA 3BMCA 4REQB 1I0LA 1PK8A 3VYTB 4RY8A 1FB5A 2V65A 2ZU6A 3LRPA 3N0RA 2P40A 4P3NA 3D0KA 4UUOA 1P73A 2AC7A 3UGJA 4DC1A 4G5HA 4O4JF 2FF5A 2VDWA 5K51A 1JG6A 3W2FA 1BO6A 3BX1A 5U4QA 1RRPA 2QZJA 1L4MA 3CRRA 1ODFA 1RRMA 3T0IA 3DL0A 5ERXA 2PDAA 4YT4A 3L6EA 1AURA 3OLYA 1USGA 2ZYHA 2DVMA 4JL8A 4AD8A 4F4HA 1RQNA 3P45A 2I1WA 2IW1A 2EF1A 4FYHA 2O2IA 1KOJA 2NTVA 4E5KA 1T5HX 2OSBA 5GINE 3I5UA 2AA3A 4A8PA 1BKDR 4P8RA 1C8LA 2Q3DA 3KPUA 4F85A 1G20B 1SC9A 2GRJA 2Q46A 5IKPA 3OKAA 4FOTA 1SU4A 3VZRA 4WLVA 4BZXA 2EOAA 1GT91 1C3XA 2Y6UA 3MXTA 2CKDA 4N49A 4LVNA 4WK4B 3OIUA 3I12A 4IFEA 4LYHA 2I4TA 4EG7A 1VYUA 4LGMA 3CFYA 1CDEA 2HA6A 5F1YA 3UOAB 3ZQKA 3DG9A 1GGJA 1FMJA 1NC3A 4AK9A 1JR2A 3DHVA 5FOWA 2R8YA 1RMQA 3HGQA 1PU2A 2REXB 2FEOA 3QNMA 2GBFA 5E4YA 3BIOA 1SUPA 2IF0A 3RC7A 4J90A 2Y0EA 2UXDB 3WLLA 4CU5A 4JUCA 3U40A 1XTQA 4ZZIA 1SQFA 1RPNA 2AEEA 2IX9A 3HBLA 2VQ3A 4TUYF 3N7UA 3BRWD 2QRNA 5FTKA 1P3JA 5DBOA 1QZTA 1D7AA 4I36A 2TYSB 1YULA 3TSOA 1PHPA 2BSXA 4IZHA 4WMLA 3TGWA 2AZ4A 5F2OA 3Q0EA 4Z0NA 2IHNA 3LY9A 3HFSA 3L1UA 3OFND 4R2IA 3TPCA 5JAIA 5FYQA 3THWA 2W2MA 2Y1CA 4DM4A 3FOEC 4LQCA 3ST7A 4NZYA 1DZ3A 4OGFA 3U7JA 4MIOA 3I5YA 4NJEA 2YZKA 1ULBA 5AK3A 4RIFA 5IN5A 3KQWA 3WK9A 4WRRA 1NAIA 1AGNA 3H1AA 3L46A 4JYBA 2JFZA 3PNOA 1ECPA 2ZYRA 1U6IA 3ZQ6A 3A1TA 4M9CA 4OQDA 1DELA 3E18A 2IHTA 3O8QA 2JCGA 1QMGA 1W4LA 3KKZA 1A82A 1JG7A 2ZT8A 4Y6GB 1OFVA 5KCMA 2JHAA 3FPGA 3LX4A 5KNDH 3K09A 2VUHB 2V7QA 3U56A 1FSFA 4XGNA 1DPFA 2WZDA 2DE0X 4G1BA 2P9EA 4N8EA 5FA5A 3UK2A 4BAZA 2XBLA 2Y2VA 2QI9F 1CS4C 1EWYA 1EM6A 3R40A 1KC1A 4OVKA 2H92A 4PCUA 4R9VA 4UUBA 2NVOA 4E5MA 1Y4SA 5JCOA 1EPUA 2V8BA 4AQ7A 3C1UA 2H52A 2LCIA 4KKXB 3TI7A 3VO1A 1KSJA 2I8AA 1N6OA 3ZDCA 1B15A 3CEAA 1W59A 2BFEA 3QFFA 2G5PA 2ZSKA 4KV9A 4ZYLA 4JOQA 3NVKI 3QTTA 4TSRA 3Q6NA 2QG9A 3IP5A 5CBPA 4P0PB 4X90A 2GCGA 3WMRA 1SELA 3CVVA 3D4OA 3OM1A 4HEJA 3E2MA 2BMWA 4UU8A 1TZKA 1YHZA 3KOYA 4I08A 2C4WA 4MJLA 2HSDA 2IU6A 1X94A 3Q9LA 5CUQA 2Z3WA 1U81A 4ZVOA 4RMJA 2X0DA 5DFAA 4BZWA 2EBHX 1NVBA 3OQVA 4TWBA 4UU0A 5A2QA 3OHPA 1JEYB 2I29A 2JFYA 2VF7A 3PUZA 5HMLA 4EYKA 3D8HA 3RSLA 1DCTA 3PT9A 1JJVA 4RELA 3WX0A 1GTG1 1Y3HA 4QC2A 5A62A 1X15A 2G1KA 1YR6A 5ALUA 5IJ0A 5M5BA 3SBXA 4HB4A 5BNWA 4CLOA 4BOYA 5KYXA 4WNAA 2KW5A 4N1AA 1JU4A 5CDTA 4L4YA 1RKVA 5L3VA 4IG9A 3D6AA 5CB4B 3DDUA 3E7XA 1VL0A 3F46A 1CQZA 3SXJA 5HBGA 1B3RA 4Z0TA 2BKVA 1WNFA 3C14C 3F6CA 4OI4A 2JVJA 2ONCA 2Q2WA 3F1LA 3RFCA 2IX3A 1T9ZA 5E6UA 1D4OA 3VHQA 5CDFE 3FGOA 1CYEA 2F90A 1JDBB 1UF9A 4ZVQA 1TPZA 4M53A 3VR6D 4LOLA 4XSGA 4HADA 5F5XA 4ZALA 4EJ0A 2W2LA 3CURA 1EP1B 3TMKA 4AO6A 5MFZA 3NAMA 4HBGA 3I62A 1I2MA 3IERA 3PFWO 5DSTA 3DLHA 1I13A 2H4YA 4RL4A 2PFSA 4MDEA 5T57A 2ZXFA 2HRQA 3CLHA 1DFIA 2E37A 2W37A 2FR0A 2CXUA 3E2PA 4EPTA 2HT6A 1B6TA 5I9NA 2HZ7A 4RDCA 3Q4GA 1JT9A 4QLBA 1SJ9A 3L0YA 1FVOA 1XDZA 2A0FA 2YNMA 1YL7A 1UADA 4D6XA 4HVTA 2I99A 1PT7A 2BGNA 2Q62A 3EUFA 4P86A 4WFIA 4DJTA 4EFKA 3ECAA 1ILWA 2PMFA 5H9WA 5IT4A 1NMQA 2R4QA 4P84A 4YVFA 3C3CA 1Q91A 1CEEA 2EFJA 1NN5A 1PR1A 5IFLA 3H7AA 3GFRA 4CFZA 4EL5A 1JA1A 1QWOA 3KXPA 1YSCA 1MW9X 4RA9A 3W04A 1V3VA 2GHQA 4A15A 3UHOA 3PPYA 3ZPXA 2V7TA 4MWZA 3V80A 4PHCA 2LNDA 2XIQA 5D6OA 1JKFA 3DAPA 1XCMA 3G8CA 3I9V1 3OT1A 4B74A 4E12A 4MP8A 4UQLA 2JLRA 5A4KA 3EHEA 4Z9YA 1SZCA 1RE0A 4Q1VA 1CY4A 1E6KA 1YL5A 3ONVA 5C0OE 2NU9B 5EJFA 4RZXA 1MB4A 3GJSA 3ZVMA 1HEIA 2IU4A 1BG6A 2LDBA 4A9AA 1UOEA 1KZ4A 4MA5A 4OFBA 3IBFA 1PR9A 4JJ4A 5HPYB 5CEFA 5CYGA 3UO8B 5FTJA 5HUHA 1T34A 2OLEA 4MA0A 4X1KB 5BVHB 1OFIA 5D3MA 2BUBA 2CL5A 2WIKA 1FDUA 3DHYA 4ZYUA 4N65A 2OGWA 4K9MA 4Q0MA 3V8MA 1LPAB 4YAUA 1KQPA 5A3SA 2FJUA 5IKMA 1X7ZB 3LHIA 4CF5A 4DM3A 3OTIA 3RQIA 4CLEA 2E82A 3CIFA 4PGGA 5EE5B 2V74B 4M49A 1FIUA 3SS7X 3WZLA 2ZJ4A 3V00A 3MTQA 1GKKA 3HNOA 2Z2ZA 2D1TA 3REGA 3B6EA 3LKDA 4M4SA 3W8DA 3O75A 3ZI4A 2CBZA 2XVMA 1RI3A 1SVWA 4QEDA 1GLGA 4OK6A 4DV6B 3DE0X 1QQ7A 2V98A 1UZAA 4B85A 2CEKA 1ZM7A 2QTRA 3MCTA 5TQ2A 1Z68A 2PIAA 3HCEA 2I9KA 1OXUA 1UQUA 2C78A 4OAOA 1UOPA 3ROXA 4G0MA 1IOZA 5E1DA 2VJBA 3TRDA 4EJSB 1Q22A 3KB2A 3DBOB 3BD7A 4P80A 3KQMA 4R05A 4R69A 4DA0A 5I7RA 3O0TA 2PLFA 4AROA 4EDHA 5K05A 1YA6A 2Q7OE 1JLKA 1WEHA 5K3DA 4Q7MB 1N7GA 2DECA 3HJUA 4MGZR 4QGFA 4MA4A 3DXFA 3E15A 1T1RA 1FK8A 1PKXA 3KK0A 1RXCA 4IM7A 2ZUFA 2PXHA 3Q3IA 5AVOA 5T4HA 3VTKA 1ZR2A 10MHA 3OQ1A 2AG0A 3HUTA 1DEXA 5M34A 3QPWA 4JWTA 3EHDA 4HC4A 4JZKA 4PCAA 3BFVA 3D3WB 3TX2A 1AH2A 4RORA 4UUMA 2ZIVB 2SCUA 4DCTA 1CP3A 2C2OA 1L5NA 3GO4A 4IFBA 5DN6A 4NX2A 3FUWA 2GEKA 1TMOA 1VP3A 5WRFA 2WQ7A 4KH1A 3H9BA 4FUQA 3ZBTA 5J23A 4NWIA 3H18A 3COVA 3OEYA 3BMQB 2R66A 2ZCVA 2ZCJA 1PN3A 4G0YA 4BZZA 3RC3A 3PEEA 4WKCA 4AIRA 2V0CA 4NBLA 2Q45A 1GFIA 2FFQA 2YVAA 1SNYA 1ZD4A 1HKHA 3ZCTA 2VJYA 1NC1A 1RQRA 3KR9A 3TUZC 1GA4A 3LY8A 2ID9A 3L7NA 2DBZA 3BRSA 1UXKA 3NIWA 1Y5IA 4GP9A 2GSWA 4M22A 2RBKA 4O2AF 4OIMA 4XX0A 2BCJQ 2AMLA 5EMMA 5L3QB 1T9GR 4IKEA 3ZYCA 1QVAA 2HJHA 2KS6A 4HLNA 1W34A 2DT5A 4MQEA 3OZIA 2NQTA 3PKZA 5DOVA 1XTRA 2QSYA 3CLUC 5I7HA 1PJBA 4MB6A 3N3AC 4P3YA 3KKLA 2X5KO 4MS4A 3HBFA 3QTLA 4DCMA 5LQKA 3WRXC 2CY0A 3KUUA 4OLFA 4EEKA 5A9SA 5D5PA 3ZJVA 1IVNA 4L22A 4K9KA 3U4AA 4OUKX 1OZ0A 2FQXA 2X42A 4DEYA 3EGEA 2WHEA 3Q9UA 4H1TA 4QSMA 1L7MA 3UT5B 1Y5MA 1R6UA 3PG5A 1TK9A 3EVAA 3UXMA 2P65A 3EEOA 5K0LA 4O8ZA 5CLQA 1A5SB 2LCFA 3L7OA 2UZ3A 4Q4AA 2NU7B 3OTOB 4D46A 1N2BA 4UTRA 1M1NB 4QVKA 2QZ9A 1CF9A 2JD1A 2ZT7A 5I9LA 5A2GA 5D01A 4HXGA 1N3IA 4D81A 3FTPA 1SCQA 1TUBB 4BS9A 5IABA 2EHDA 4YACA 3RF7A 5PNTA 2V7WA 2KWIA 3A6JA 1BMQA 1LBQA 1YDWA 2QL9A 3E82A 1KMMA 4L07A 5E7JA 5DM70 4YUAA 1RIIA 1LFDB 1OXMA 1Q1QA 1UFQA 2OAEA 3H2ZA 4K05A 4MKFA 4G26A 2GVDC 2V5VA 1S2OA 3SAJA 4F21A 5SYAA 1YE3A 4GUDA 2H2DA 2BBOA 1XTPA 1J99A 1KDRA 2GN2A 5G1NA 3DT9A 3H5WA 5TEVA 3SX0A 1XZFA 5IFKA 3G49A 3RS0A 4KX5A 2OK8A 1GUYA 3WIEA 1SB9A 2FEWB 3CRW1 2Q6LA 2GDJA 3A3KA 4HEA1 3U1VA 3TLEA 1AK2A 1F8YA 2XX3A 3IHWA 1U0TA 4GGPA 4LZLA 4V0KA 2R4TA 4L1KA 3QXSA 2D1FA 2DWQA 3PFHA 4G8CA 1L9XA 4D9IA 2OV8A 2H1SA 2HDHA 3CU5A 3QVXA 1KK3A 1NAHA 4W8OA 3VX3A 3TBKA 3KB8A 2W4QA 4YT2A 4PHFA 5KPDA 4BE7B 2WY2D 2VUSA 1IHUA 4AZTA 2HQOA 2B61A 2DQKA 1OLSA 3HKCA 1U9IC 1ZHFA 4JC0A 4JR1A 2FLWA 3ELYA 3AF4A 3VISA 2WF5A 1JBQA 4YMLA 1K0FA 1KZ7B 1Q1AA 3R5FA 1ETHA 1MKYA 2GA8A 1XVTA 2BEVA 2D62A 3CJRA 1XL1A 3DEAA 4HH4A 4GXNA 3HUFA 4YRDA 4BFXA 1DOAA 2PGOA 1L5RA 4RLFA 1F2VA 3S55A 1P3Y1 4ROTA 2C4HA 3HU2A 2G5CA 3M6AA 4QBKA 2Q7DA 2WKWA 4GF5A 3UPUA 1RQ2A 1LI4A 4IO0A 5C1OA 3NUQA 3ZJUA 1FDIA 3L0DA 821PA 3PF9A 1Z36A 1U2QA 2EERA 1FA9A 2ZTLA 2Q1SA 3EBPA 3RVOA 1YUBA 3SSMA 1DFHA 4JGBA 2QM3A 3CF6R 1CERA 4ES6A 1MDFA 5IVDA 1JV2B 1DAHA 3C41J 1CJBA 2ZQYA 4CF7A 5I45A 5A5DA 3FM9A 2IEZA 4BHTA 3QF4B 1I1NA 5KNLA 1SD5A 3DD5A 3UWOA 2ZUCA 4NIMA 2XZOA 1PJ4A 2R97A 2W2KB 3P9PA 5LCXA 2FE1A 1WMEA 1H8HD 2FEKA 1BVHA 4KGDA 1Z0ZA 1HEYA 1Z7GA 1H9BA 3EG9B 4JS0A 2GRAA 4BLVA 2JCBA 1F6DA 1W44A 5F52A 4ZWNA 2IV2X 2NUBA 1SU8A 2XZLA 1Q0TA 1V7ZA 3CEMA 1A77A 1Y8ZA 1DBQA 4ARCA 3OICA 3IBCA 4QEKA 3PX2A 1WZUA 3P0RA 4HWSA 1EFPA 4HQ6A 3ZHXA 4CN9A 5HSGA 1VI2A 5DK4A 1SCIA 4MULA 3ADOA 1U8YA 4MVJI 3HK2A 5DT2A 2O8FB 2D1SA 2H2GA 4YIKA 4W5WA 1N1DA 2P2ZA 3UJ7A 2W8ZA 1TF2A 3B82A 5K2MA 4M83A 1IN4A 2YCBA 1TO2E 4TTIA 5CJJA 1G291 3MTJA 3ZKWA 2JIZD 3IEIA 5KJCA 1GTJ1 4IDBA 5JG7A 2Q49A 3K09C 4B4DA 1YBAA 2JEOA 2XTZA 3I05A 4WOBA 4DLAA 4F2DA 1H94A 3AK4A 4UREA 6REQB 3OCVA 2E4WA 2ZE5A 3VTZA 3GCWA 4Q6WA 3UB2A 1XL0A 4J9UE 1UBTS 4F5WA 4G23A 3UG7A 4YRSA 4WK2B 3V32A 2GPJA 3R23A 3AY0A 6AT1A 4G3XA 1MO4A 4MJ3A 2QORA 3C7TA 3VI4B 3C45A 3PJFA 1AE1A 3TZBA 3MMNA 2PS9A 3KWLA 3LFHA 4M37A 4QUDA 2OCDA 4TKLA 1WF6A 4XQEA 3WGVA 2YV3A 4EECA 1U99A 4EMUA 4F4DA 1SIUA 5EHXA 1G4AE 2FGJA 1SHJA 2O8EA 2B1IA 4J0GA 4RACA 3T1NA 4Y2TA 4YWJA 3GJ8A 1T8YA 2D8AA 3BSSA 5JI2E 3QSGA 4MLDA 3OOSA 4NCXA 3SFZA 3FOCA 4XDYA 5DXAA 3WB1A 1ZWLA 1EP2B 5IP5A 1PRYA 2V0NA 3BCSA 4JJEA 4BFZA 2PWAA 1T3SA 3H05A 1Z6AA 4YT5A 3V8VA 4ENSA 3VYVA 3AR5A 4PLYA 4H6VA 4GYJA 1XD2A 3Q85A 2OHXA 1UBFA 1YAHA 3IVRA 4G24A 1KC3A 4ND4A 2B5VA 1WDKA 3U3KA 2ZVQX 5ALRA 2WOOA 3IOCA 2GD0A 4G0PA 1F8UA 2V5UA 1QK3A 4HO1X 5ALPA 4AJLA 5KUTA 3RKUA 3VO8A 4BNJA 4Z53A 1HT2E 1C7QA 3UUEA 4CKYA 4MGEA 2GEDA 1UKBA 3OPVA 4FFSA 5ENZA 1NVVQ 1RYEA 1Y5RA 2I3ZA 3WKCA 3F5FA 4P08A 1DIRA 3R0VA 3RQSA 2PANA 2ARKA 1UUFA 1P1JA 3EWAA 3MOIA 3AEUB 1U2EA 3TNLA 4BTVA 2DUUA 5LQSA 1WWKA 2G9RA 3HMKA 5LL6P 3GLVA 4MAFA 1Y89A 3C3WA 1K4MA 2REBA 2PQ6A 1Z8DA 4MVJG 4E21A 3GJYA 4GSYA 3WYCA 1U7OA 3P27A 2MINA 4BX2A 4YJHB 3M5DA 3C85A 2ONKA 3P26A 1NYQA 5DM0A 3WDMA 4GRIA 4B8WA 2O8EB 1N9GA 4LDRA 3WY9A 2Y2UA 4ZT7A 3I58A 2XEXA 3UG6A 1HQDA 1U3WA 2YWXA 3HABA 3HB9A 4D0LB 4ZJYA 4D97A 3GLGE 3E84A 2UZ4A 4G07A 1DTSA 1Z4LA 3P9XA 2CXSA 2WIFA 4ER5A 2PA3A 4RTRA 1XG5A 3MJVA 1J0CA 1MOQA 1QV6A 2PG3A 2X1MA 2HD4A 2H8KA 1ISJA 2BFCA 4GLBA 2QMHA 4INAA 1DZIA 4E09A 1Y6FA 2CBGA 3TX6A 1QVWA 2GX6A 2X7JA 5I8PA 4JT2A 5ALKA 1H65A 1A4XA 2QZ4A 1EZ4A 4POAA 1C0PA 1HLFA 1QZXA 4RM2A 1KRWA 4TYQA 3TAHA 4ARSA 2TECE 4ZRDA 1LNQA 4F4IA 3C6QA 5EXPA 2GEBA 2YQ4A 5J4VA 3HCNA 1KU6A 1XTUA 3S8MA 4XVRA 3VSDA 2OECA 1XNQB 4M1MA 4BO5A 1ZMXA 4JR0A 2O2CA 4HYTA 1XKLA 2GFHA 1XRSB 1SVIA 2BAGA 3QYJA 5KC8A 1RC8A 4UHKA 1NFRA 1KMHB 1YQGA 4ZOAA 2O8BA 2XXJA 2GN8A 4IMRA 4PPNA 2VDNB 1PWXA 4OB7A 4UHHA 4GG1A 1UBJS 2BHRA 3ASUA 2H1VA 2WUWE 3LPMA 1D7OA 3FW1A 4CG0A 1GCAA 4LFBB 1ID8A 1FS6A 5JECA 2ZIXB 5JT1A 5HILA 3MTEA 2IYSA 3WA7A 1NNSA 2A35A 2AIRA 3IEXA 4RPHA 2AI1A 3K0FA 3EA4A 1KBQA 4JC8A 1Q2UA 1IHDA 2WMOB 1OHHD 4RHEA 5LU8A 2C54A 3M89A 4NEGA 2I03A 2A1TS 1YQTA 2GESA 3EGDB 3BFKA 1P77A 2ANBA 1T0BA 2WUVA 1ZK4A 4J4TA 2VUIB 5COQA 4TS3A 5EHGA 4II2A 1UPUA 2E1PA 1XCBA 4KUGA 4HNTA 4Q01A 1E60A 1ZXBA 2VQSA 2VTEA 1NBME 4TN1A 1CF4A 5HRUA 1BS1A 2CL7X 1F4LA 1QKJA 3PSHA 4A6XA 1OROA 1J5XA 4XUCA 3NHRA 3T7IA 2YV1A 2GM4A 4EQZA 5AKZA 4ZZ3A 2CD9A 2CXOA 2IXGA 5I7WA 1OC2A 4DMHA 3OM9A 1H1LB 2QTFA 4PTLA 4NHOA 4A7PA 2CKMA 1T9DA 1NMSA 2BEUB 2R9VA 4IF6A 4MW7A 3F8SA 2G82A 3D8NA 4I3HA 4LXGA 3NBYC 3P9KA 4WFJA 5KAMA 1PR4A 2FTKE 3PC7A 2OYRA 2I55A 2YXEA 2Z6VA 1BTOA 4WLUA 1FYXA 1TQ2A 3K32A 2IBSA 4S1WA 1FRFS 3GJQA 5EI5A 4EO9A 4AYWA 1G98A 3EIHA 1C0EA 1BEZA 1JLLB 1W4ZA 1NR1A 4UM8B 2FX3A 4QRDA 3K8ZA 5JD3A 4JBWA 4K1XA 4W1PA 4O4LB 4M98A 1SXJB 4D3FA 1AMNA 1U5CA 2QJFA 3PFFA 3RK1A 1C7EA 1ZNWA 3MAAC 3BMOB 4FN5A 4K8RB 1XX6A 4OJNA 1XNGA 5I4KA 1MB0A 3LBHA 4YQZA 3NANA 2JFVA 1ZN8A 1WM1A 1RXVA 3NYQA 4KHPB 1YD7A 1Q6ZA 1XFDA 1ABFA 2FG6C 2X8LA 4ZT3A 4IQ0A 2YWGA 1AMOA 4XWTA 1NGSA 3HRIA 3RADC 5JC8A 3DMYA 1E2LA 3LNCA 5JRDS 4P0QB 1R5BA 3GZNB 3RYHA 4NAUA 1WZIA 4E14A 2ZP1A 3NR2A 2YNMD 3RVJA 1KJWA 2K2QB 3A05A 3VU9A 1ILEA 1DFGA 1S6YA 2QTGA 4JJIA 5KNBA 3VTFA 4HHEA 5DB4A 3ZK8A 1RPJA 1XZIA 5DTMA 3VSEA 2W71A 1G3QA 3RTAA 1T43A 1VGQA 4YJDA 4Y6QA 2QUKA 3NUGA 2J0VA 3NV9A 3CISA 2A88A 4YK7A 2HA7A 4NBTA 1Y1LA 5FORA 3D7RA 3W77A 3EPRA 3RR2A 4CKWA 3BCHA 2PEYA 4OATA 2GTPA 3IDSA 4HNAA 4R6XA 3DBHA 1P0PA 3OUZA 5FFNA 1ULAA 2ILVA 5JSKA 2NO4A 3OI7A 1E3MA 3HZRA 3ONNA 2PCLA 3JD1A 1Z0UA 4N0EA 1JHRA 1TTHA 3E70C 3EARA 4WNYA 5FNVF 4UBIA 3F9IA 2YR0A 2Z3VA 3LY5A 5AOVA 2NTNA 2ZRQA 1AKTA 2WM9B 1UOOA 1XD9A 4C08A 3RVQA 3WNDA 4W5QA 2R96A 4AJKA 1GPDG 4KQ9A 4BWVA 1D8TA 5ELLA 3RAJA 2WDZA 3T41A 4FWTA 1AV7A 3CPJB 4BB0A 4OEHA 4U2CA 3V7NA 3AEKB 1ISRA 2JFPA 3GFTA 3M5CA 4A8TA 3M1LA 2DFLA 2Q7XA 1IXYA 4QPJC 4DMUB 3HKDB 3HP7A 4UFOA 1VPWA 1ECGA 1YJ8A 5L45A 1L4LA 4EJSC 1U0FA 1TJNA 3KTAA 1JJFA 4M9ZA 2ZYGA 3U3RA 1H66A 4D9NA 1KFBB 1W0JA 4F93B 3IOMA 1Q1EA 3OX4A 2O8NA 5IBQA 1NXOA 2HQ1A 3HVIA 3UY4A 1ND6A 3GK3A 4LOJA 4DUYB 1EA5A 2UUOA 1X7HA 3GEIA 3T9EA 3WAKA 4EKIA 5IDXA 3AVYA 1D0SA 2XQKA 1BX3A 1FUYB 1UJMA 2Q5JA 4MNTA 3VVCA 5A1JA 1FX0B 1XVUA 2J3JA 5G0WA 3VFDA 5CB0A 4F71A 3U7RA 2DWOA 2RK6A 2DTXA 4OHPA 4BFWA 4YRMA 2GS9A 1VFPA 3LCJA 4X45A 5GZ3A 1RYHA 1EDZA 3J81k 3USCS 3BTVA 1O2DA 3UMBA 5JADA 1YI8A 4JT4A 3LUFA 4QJ3A 1IBKB 3MMZA 4JP3A 1CR1A 3L7CA 2ORWA 4NE9A 1GAJA 2A5LA 1BEUB 5E6SB 3SHVA 1TJPB 3TL3A 3K9LA 3H65A 5LA6A 5CEJA 3C0KA 1ADBA 3IT1A 4UBNA 2EKBA 3DKVA 3W8FA 5E0KB 3RAFC 1XNHA 4DL9A 5BYBA 3V4PB 3CWQA 2J9FA 2ZYIA 3ROGA 2YCLA 3HYRA 2VYVA 2BTOA 3ZW9A 3ZWQA 4HRYA 2MIIA 4LNAA 4MIKA 3PGVA 5CURA 5DHRA 5IRCD 1X9GA 1YACA 2C84A 1MTZA 1GUFA 1P1IA 3DJYA 3L84A 1GG8A 4ZJZA 2PUBA 2PU7A 2C7BA 3L2OB 5DOZA 1V0JA 3M6LA 4U00A 1LDYA 4D4KA 5KYGA 2KMLA 3LLUA 3GVHA 4QBGB 5EZYF 4C5BA 4B4VA 3PNBA 4Y7CA 2A58A 4UTPA 1JNYA 1RHQA 3G6WA 3NYWA 2R6GA 2HM7A 4DIBA 1ECJA 3WMWA 5CM8B 5IYZF 2FFHA 3RJTA 1R1DA 2W43A 3F9RA 4LKOA 4N9QA 5TQ2B 1THMA 3PXEA 2IELA 3GGDA 4D4LA 2VXBA 1CSEE 5K45A 4OU4A 1ZISA 5ECWA 5LWHA 3AUJB 5B7QA 4C7OA 1I7NA 1CJTC 3BEDA 3DAYA 1LWNA 5FFFA 3SF8A 1ZK0A 2PLAA 4RJIA 3KSUA 3N6XA 4MQ5A 2IUYA 3UF0A 3CT6A 3VMMA 4COKA 5C34B 1S4MA 1JDTA 2XUKA 3JATA 2I2BA 3CUWA 3L1JA 1GCIA 1V41E 1WBBA 3WLFA 3ADCA 1SY7A 2WIAA 3IKJA 3BXFA 4N5DA 1PZXA 3TMAA 1T6NA 1S2MA 3WKBA 4CQMD 4BNFA 3L82B 1LLDA 2EBWA 4XDGA 2QLBA 5HZKA 3F5QA 2XNDD 3NIGB 2ZSAA 4R98A 3HO1A 3S1AB 1ML4A 2V9ZA 1U6JA 2NU9A 4Q4HB 4B4OA 3TDMA 1A2KC 2BC9A 3JVIA 3N75A 4QLOA 2BW0A 2OD7A 4C9BA 1NXQA 1GL7A 3OOEA 1T3HA 2EZTA 2J5KA 1PVOA 3EOBI 3AYZB 3PENA 4XARA 3S7ZA 3NC0C 2BF4A 2O3QA 1VCNA 4GOXA 4Q7KA 3DE6X 1EG2A 3JWEA 1WQ1R 1A9XB 3PL5A 4S0XA 4DJFC 1P7VA 1GN9A 3IOEA 1F0KA 2QUIA 3F6SA 1N77A 1T9GS 4KGZA 3NDRA 4PRZA 4YWHA 1WW8A 2VP3A 5T67A 4U7WA 1YE8A 1FSPA 2EL7A 1ORWA 1PEKE 1P6XA 1Z88A 3GNLA 4BMDA 1DNPA 4TXNA 4DNPA 5C37A 4LSGA 4LJLA 1QYCA 1YC2A 2A5GA 3L7LA 2OLJA 4JWKA 4R2JA 3WC4A 3EULA 2GHTA 2VWHA 4IMPA 5IXSA 5FJIA 3V2UA 2ZBUA 4YN3A 1N9ZA 3W7BA 1J25A 4FFMA 1TQDA 4HX9A 4UMDA 3PHCA 3UKDA 3L8DA 3SZLA 3E58A 2XRYA 2UV8A 3LFUA 4IIJB 4JMLA 5KNDA 1LXCA 2WKPA 3FPHA 4TRJA 3N2GB 4JU8A 1YKSA 5T5QA 4OM7A 2F62A 3FRHA 3SXPA 4QHSA 4E6EA 3Q2OA 3KPWA 3DFMA 2NYRA 3JVDA 5H7XA 1IM8A 1R8JA 4L9WA 4RU1A 1UK6A 1O5OA 1TO6A 1Q77A 2VT2A 3A6LA 3H1PA 1QV9A 5ILGA 3H5RA 1CY1A 1Q95A 2RMKA 5D5HA 3EIOA 3I9V6 1MB3A 1O4WA 2DM6A 4CI9A 3F47A 2W42A 4TKVB 3WBFA 3ZDXB 5FNVA 1XWIA 2Q27A 1VE6A 1FFYA 1AY0A 2P9GA 3K1ZA 2GR9A 1RI5A 3CJTA 3L43A 3R20A 5TIIA 1S2IA 3UK0A 3QKUA 2GDZA 2D2IA 5HP4A 4FMDF 1EIWA 1QONA 2F00A 4ASUA 1U0LA 1NDHA 1PWZA 1APBA 1OT5A 1UBCA 5BWMA 4UNIA 1T6XA 1Z38A 1Q92A 5E7QA 5IT9A 4ZTZB 1UXOA 2GZ2A 3HR4A 1RLIA 4FD2A 1ES9A 4NE2A 4RZ2A 4X60A 1TZCA 1QFSA 2Z8YA 2F3SA 5JCPA 1L5WA 2VSXA 2XNSA 4LMRA 3TOZA 2XNJA 1B76A 3V6LA 3LHSA 5A0TA 1Q84A 2EDAA 1E7WA 2ZTSA 1AZSC 4RHCA 1I30A 5GGYA 3GLFB 5HX7A 5CTJA 4ZI7F 3MPUA 3T7EA 3A8TA 1TYEB 1YQDA 5IPFA 3KEGA 4LY6A 1R9JA 3ZHVA 3PNYA 4AG5A 2XGGA 1G0NA 3ZHCA 2VHEA 1YO6A 2B8TA 1JXMA 4ZU1X 1JAHA 3CLKA 5HKKD 4LBVA 1RZUA 1CQXA 3A06A 4Q19A 1JZTA 1KJ9A 1YBVA 2HMAA 5B7PA 1BJRE 4TZKA 4BNVA 3IAAA 3IXLA 1K8YB 3O82A 3FHTA 5E8JA 1BDHA 3L8ZA 2FKNA 2Y1FA 1H6DA 3R41A 4PPFA 5DK6A 3TFQA 4PC6A 3FR7A 3WO1A 3U3JA 5AIBA 4G36A 4OXQA 2OT3B 1DJMA 3KQVA 4Z3OA 2Q4EA 3IL2A 1CZRA 4L8LA 4G2NA 3RSFA 1FL9A 2DG2A 1E2PA 3S99A 4XTRA 4E2ZA 4QUGA 3L6OO 5E6SA 4JJ6A 2HQBA 4CMJA 4DCNA 3FWYA 5G0VA 1ND5A 2GLUA 3DCYA 4K6OA 4KDFA 4LEIA 5DCYA 2FZEA 2I2FA 2J3HA 3VNRA 3WA6A 4BNDA 5EJ6A 3KQKA 5KTNA 2OPBA 1GSIA 1FYWA 3VC7A 3DC7A 5DVZA 3Q7IA 4MS3B 3TQIA 4PZAA 4JH0A 3ROFA 2GO7A 2YZNA 2FSSA 1IZ8A 2XE4A 2ZDQA 3AJAA 4NBUA 3MJRA 3F7OA 4BDTA 1PJ2A 2GXUA 5B1SA 1M6VB 5IF3A 1BWQA 3RTDA 3IIMA 3UICA 2P9YA 2WAOA 2VYFA 4QWWA 3ZVKA 2VAMA 2B1JA 3IHTA 3PL1A 4FZJA 4YRNA 1FRNA 3TWOA 3ABIA 1DPGA 2YWHA 3DDZX 4FHFA 3CC8A 4JQZA 3FPBA 3R76A 2CNWA 2PK3A 2FQWA 4IIJF 4Y98A 3A4LA 3U0BA 2C31A 1CG6A 1QMPA 1UKVY 1IZ0A 1J1ZA 3BDIA 4UHBA 2O8DB 1GQYA 2PR7A 5CXUA 3S4YA 2W48A 3M2PA 4GECA 5BWLA 5DDIP 3CNNA 4X92A 2FWIA 3TPZA 1MIOB 2AR9A 3JAKB 3A6FA 1H1TA 2FRVA 4UHDA 5MN6A 4JEUA 2GMWA 5J43A 4IPTA 1EQAA 2BD0A 3C4JA 3QPBA 2P9ZA