1CETA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
305
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRLDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
total genus 114
structure length 305
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cetA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1cetA02
3U5TA 1KBZA 1B3RA 3WMWA 1NASA 1PJLA 2NU8A 3ROKA 5AQ1A 4TRMA 1C1XA 4IDBA 4ZVVA 4J4TA 4LVUA 2C2XA 4CM3A 1U3UA 3FCOA 4OOEA 5A5FA 3B6ZA 4A5OA 3FN4A 1Q7CA 4TROA 5G0SA 3IOYA 5JDCC 5AXDA 3H5AA 5T6BA 3WFIA 5A3VA 3ZWMA 4BMNA 4RVUA 5T5QA 3Q9NA 4E5MA 1OMOA 3E82A 2DVMA 4YXFA 1BMDA 1UZMA 2BH9A 1U4SA 1I2BA 3KZVA 3K8ZA 3A06A 4I8XA 3QSGA 1HKUA 3F9IA 1WMBA 1KEWA 2CDAA 3NUGA 3VC7A 1LC3A 4OGWA 1HDRA 3UFXA 3PIIA 3I6QA 2ZTUA 1YJQA 2Y0DA 2GZ2A 2YV1A 1PWZA 4R1UA 5B4UA 3VTZA 1TI7A 3U4CA 1WVGA 1HF3A 1I3NA 1LQUA 2C54A 3K31A 3ZU3A 1OC2A 4DPKA 3PK0A 1J49A 2FR1A 3M1AA 3NT5A 1PGJA 3MWDB 1J4AA 2YHIB 4D46A 5IJZA 1NFQA 3GDFA 1ZBQA 1NX6A 5TT0A 3LZ6A 2PKQP 3DAPA 1DIGA 3SJUA 4LW8A 1KVSA 1KVRA 4EYEA 4IXTA 1DC6A 3DZHA 2QRLA 3D5TA 1YO6A 1DIHA 4NBWA 4B3IA 4RL6A 1DRWA 4QXMA 2IDZA 2GDZA 2IYPA 3ZNQA 4BNZA 4Z6KA 3CINA 2D1YA 2D2IA 5KJEA 1X14A 3BMCB 1AXGA 1IY8A 3P19A 3PIDA 4TMFA 3E8XA 3AY6A 2X23A 4WUVA 1Y8RA 3R3SA 4PLGA 2UUOA 1B8PA 2ET6A 2PKQO 3DBLA 3BTUA 2BGLA 4WCFC 3ZWAA 4EW6A 2Q45A 3T4EA 2Q4EA 3ABIA 5H83A 1UXKA 1EDOA 1DJNA 2X1HA 3FPCA 4MKZA 4TVOA 1A71A 3UOGA 4HNGA 3H6KA 4IDAA 4AJHA 4I9NA 4JX8A 4EJMA 2HAEA 1C0LA 1ZW1A 1CWUA 1X7HA 4PGFA 3GOHA 4RPGA 1JLLA 3WGTA 2I76A 3VDRA 3PFWO 4R54A 2CDBA 5JBIA 1PQWA 1YBMA 4M87A 4Z0HO 3V2UA 3DC2A 1F17A 2EP7A 4OKIA 4Z9FA 3RUAA 4J9VA 3ADOA 3K73O 2PGJA 5KVQA 4WK6A 1C3VA 1PZHA 1SZJG 3VVCA 1TEHA 1YQGA 5GZ1A 4PLCA 1R12A 4JK3A 1YQDA 3BMQA 2VCYA 1QLHA 2HMSA 3G3EA 3GVXA 4TWRA 5F1PA 4EEZA 3P7MA 4NR0A 1QYDA 1U4OA 4A73A 2BGMA 3PRJA 4CLOA 4L4XA 4BKQA 3D4OA 4YJHB 1D3AA 2GUGA 3AOEA 4J2HA 5T64A 3RC2A 1T2FA 3CEAA 2TMDA 1HDXA 4PG7A 4CR8A 1LXCA 4NG5A 3W6UA 4GX2A 2ZB8A 1X0XA 1TVEA 3PI7A 3JQBA 1PS9A 3DZBA 1VKNA 5IZ4A 1ZSVA 3DHEA 1HZJA 2D5AA 1E7SA 3GG9A 1MUUA 4GKBA 3OJ0A 3PJFA 2QIOA 4I5EA 3EW7A 2VHXA 3VH4A 4OMUA 1EUCA 1MXFA 4CJXA 4YT2A 3BMOA 3E5RA 2GCGA 3L4BA 4OAQA 2ZB4A 4DC1A 4XQCA 3OJEA 2WSBA 3WS7A 4KDEA 2JAHA 4BO8A 2VZ0A 4CM5A 1ISIA 4CMIA 1S7CA 4AJNA 3EAGA 4QEDA 1P0FA 2ZYAA 3WICA 2X0IA 3NT4A 2RH4A 5FI5A 2YZ7A 2OOSA 5KJ1A 5CP8A 2C5EA 2B4QA 2BF7A 2V6GA 2ZTMA 1E1MA 3D3WA 3Q9UA 4FC7A 3N58A 4DQXA 3C24A 2GD1O 5ES3A 3S2EA 3VZSA 2XOXA 1KS9A 3E9NA 1YJ8A 3OJLA 1HLPA 1DIBA 1BXGA 2VNSA 5I9LA 2DKNA 1OFGA 4RLSA 3OH8A 4PN3A 4OKNA 2IXBA 4D79A 5A3JA 4IQ8A 1H9BA 1F14A 1PZEA 3FNHA 3DBRA 3PZBA 4YEDA 5ITVA 1NTOA 1P44A 4J9UE 1HZZA 4Z3DA 1LQTA 4ILKA 3NAQA 3ZHBA 2DBRA 3ITDA 3WNQA 1IHYA 2DUWA 1CERA 3VPSA 4IINA 1QYXA 5COBA 4OL9A 1R4MB 1NWCA 4M55A 2DFVA 4RPKA 3WBFA 4IJVA 4PVCA 1NFFA 2NQ8A 1HDGO 1DHTA 1P1IA 4IS3A 5GMOA 4J1QA 5A9SA 1JU9A 2PD3A 3BMNA 3N74A 4F45A 1KEUA 3ZZNA 4XYMA 4KOAA 4ZQHA 1UAGA 4FB5A 2RIRA 3H65A 4IUYA 3JQAD 3HWRA 4CQMD 4YR9A 1ZH8A 4RV9A 4HKTA 1KEVA 4HFRA 4RGBA 3R6DA 1NQTA 4TKLA 4DA9A 4RZHA 3R0IA 1M6HA 1MC4A 3H5RA 1Y8QB 1F12A 3NTOA 3IKVA 4Q3BA 4EUFA 1SCUA 2DQ4A 3L6DA 4KTTE 4M49A 2GF2A 3ENKA 4D45A 2P5YA 4UULA 4KUEA 4MKXA 4QFDA 3ZWNA 4MVJD 1ULUA 1XIVA 1JVBA 1GV0A 3WXBA 4OXKA 1I36A 1ZEJA 2HU2A 3H9QA 1H0KA 3JQ9C 5CEJA 3QVXA 5JAMA 1XSEA 2CVOA 2CSUA 1RYDA 5GZ3A 5A9SB 1PX0A 1NAIA 2JFHA 4CL8A 2Q99A 4IDEA 4XGNA 4AL4A 5BR7A 4J0EA 2EV9A 5JY1A 5G0UA 4GVXA 3EGOA 1E7YA 2PH3A 3G79A 4L4SA 4KWIA 4JJFA 4B4UA 1P31A 9LDTA 1E3EA 4R9RA 5DCUA 1GU7A 4NZ9A 4DLLA 5JSFA 1N7GA 4B4VA 1GUZA 4D3DA 2GN6A 1MXHA 3CMMA 1H2HA 1Q1NA 2C20A 2J5QA 4OXNA 4HV4A 4O59O 4AJ4A 3ZV6A 4BIIA 1EUDA 1LSJA 2PD6A 4RVHA 4LCJA 4B8ZA 5KWEA 3UH1A 3C7DB 3S2FA 1DHRA 1J5PA 1B16A 1E6WA 1E7WA 2XPCA 5KIAA 2C59A 3U9LA 1OI7A 3H2ZA 1I10A 4XYLA 5KKAA 3DONA 2WD8A 4N54A 2VHZA 1B8UA 2C29D 4RF4A 4TRNA 2C7GA 1VKOA 4B7UA 4GKVA 1YBAA 5TQVA 5CPBA 2WMDA 4ND5A 4IDCA 4RVSA 3ZHXA 4ID9A 3BMOB 1IHXA 2YQ5A 1RM3A 4I9HA 2CY0A 2XXBA 3VH1A 3CH6A 2UAGA 4NBUA 1P1KA 3JYQA 4MP3A 3UKOA 1EK6A 3DZGA 1I2ZA 2CF5A 5T57A 3JQEA 3GGOA 1ONNA 5F1OA 3K2BA 4YJHA 1H9AA 3H5NA 3M2TA 5HWSA 1GQ2A 3BHMA 5ILGA 1OBFO 3U3XA 3U62A 3I9KA 3VHRA 5EPOA 1U9JA 2H1SA 4Q3EA 2SCUA 3GDOA 4NIMA 1BXGB 3ONEA 2FPIA 1NHWA 1UZLA 1CF2O 3FD8A 1ID1A 4O0LA 4BO6A 4BNLA 4OHUA 4PLYA 3W6ZA 2X58A 3GN2A 2HMUA 2B5WA 2O48X 1N1GA 1GADO 2G5CA 2W2LA 3JQAA 1HEUA 2O4UX 3I83A 2O2YA 4I5FA 2B5VA 1XWFA 3QWAA 1YBVA 2BMAA 1B2LA 4J4HA 1LU9A 3RQSA 3IDSA 1P1JA 5L4NA 2HMWA 2OORA 5IAAA 1IOLA 2VTEA 2G1UA 3JQ6A 4K1LA 4WKGA 1PL8A 2QRJA 1LJ8A 2DAPA 4OM8A 4XQGA 1LSUA 2JAPA 3HJAA 4D0RA 3AM5A 1K3TA 1Y5RA 3ROQA 4DIBA 3AU8A 3JYPA 3S2IA 5IXYA 3CXRA 3IIEA 3RVDA 2YV3A 4YYZA 1B15A 1KOLA 3DQPA 1Q7GA 2Q46A 3KO8A 3PYXA 4PLVA 3TFOA 3ZNPA 1XYGA 3JQGB 3JD0A 1E7RA 5ENDA 5FWNA 4WNIA 4MP8A 4IBOA 2H63A 1DLIA 3BMCA 3QRWA 1VLLA 4D7AA 1EVJA 4Z0TA 1WMAA 1K2WA 2BELA 5F3RA 5H82A 4EJ6A 1V35A 3V1TC 5BQFA 4Q3DA 3GPIA 1V0JA 3AY3A 1YB4A 1DLJA 1MLDA 3DL2A 3ANNA 4TQGA 4IGFA 1HWYA 1X13A 2YQ4A 3OICA 4FGWA 1ZIDA 4ONEA 3S55A 3F5SA 5TIIA 1ZK2A 1ZVMA 1YL7A 2ZYDA 5K6AC 2Q50A 4JBIA 4TZKA 4H15A 5ENVA 4CMAA 1NYTA 5JYEA 3D3EA 4OOFA 1NQAO 5F5LA 5JXWA 1NPDA 3D1LA 1U5CA 2P68A 2V6MA 2Y67A 2JCXA 1XDWA 2Y99A 4PLZA 4E4YA 1GCUA 4CL3A 4JIGA 1QMGA 1ZZEA 5JC8A 1MGOA 3PLNA 1AHIA 1V3VA 1CETA 3BAZA 4RPLA 3FI9A 2WE7A 3JYOA 1R0SA 2O3QA 2P5UA 3WGIA 5CAEA 5I9NA 4IZHA 3PEFA 4LRTB 1R0LA 3DFUA 4P4LA 4BNFA 1K0UA 5KVSA 5COQA 1IZ0A 2ZB3A 3Q2KA 3VAZA 2E49A 4CM8B 3DZIA 1ZK0A 2AEFA 3DBHB 4ZQFA 4JBHA 3F6YA 4CR6A 3AM3A 1DFHA 4AJ1A 1RM4A 2PV7A 3K92A 1V3TA 1MX3A 1RM5A 1VM6A 3TSCA 1I3MA 3IL2A 1QORA 4XGIA 4XQEA 1P1FA 1F06A 1WP4A 4MO2A 4TSKA 3DTYA 3I9NA 3FSRA 4XJTA 1DC4A 4W6ZA 2EERA 4RJTA 5JCXA 3NRCA 1LDNA 3UCXA 4DBZA 3NDIA 5I7EA 3LF1A 1F8GA 3DZFA 3UW3A 1HE2A 3AOEC 2IYOA 1E3IA 3ZHZA 1A72A 1UUFA 3PZRA 4ZA2A 4ZD6A 3H9EO 4E3ZA 3WX0A 1AGNA 3LC7O 2E37A 2PGLA 2WE8A 3ZW8A 4YAKA 5BT9A 5FF9A 2C7VA 3FNEA 4CMIB 1H6AA 3OECA 3Q3CA 2ZQZA 4Y9DA 1Z82A 4BL5A 2NM0A 4WLFA 3COSA 4XDZA 1N8KA 4NJMB 3HFSA 4CMCA 1U8XX 3ZHYA 1BXKA 3F4BA 3B20A 4GLLA 3P2OA 1YOVA 5JFOA 2IEBA 1H5QA 3RU9A 4R1TA 1YL6A 4YB8A 4NK4A 4GGPA 4M89A 3CZRA 1OZAA 3DOCA 4LRSB 1FF9A 2DPGA 1C1DA 3QHAA 1TT7A 4ZN6A 1GYQA 3QVWA 1TA4A 1PJ3A 2P91A 3CIFA 5JS6A 5ILOA 3QA9A 5JDIC 5U9CA 2QG4A 2BGKA 1GR0A 1GY8A 1KC1A 1LSOA 1EK5A 3WYEA 2V7PA 1I3LA 3L4SO 1E5LA 5U4QA 5JAZA 2O23A 4QO8A 4TRRA 4ZRMA 5IZCC 3KYDA 3ZNNA 1K6IA 3JQ9A 5DCWA 3CKYA 4PRLA 3FHLA 1T4BA 2DC1A 2G17A 1YL5A 3ITKA 1GZ6A 4J7UA 2NVUB 3M1LA 1UDAA 1ULSA 1NBOA 3PXXA 1QKIA 3GR6A 2IXAA 3JQ7B 3S1LA 5JNLA 1UXIA 4W7HA 3ZNOA 2GZ1A 3JV7A 4LSWA 4CLHA 1BWSA 1LX6A 2AMFA 2X0RA 3MJ4A 4OSPA 1UZNA 1DB3A 1ZSYA 4Q3AA 5DOVA 4R01A 4TKMA 3W1VA 1TT5B 3IUPA 3QQPA 1GDHA 3U4IA 5HA5A 2NADA 8ADHA 3NGXA 1YWGO 3QVOA 4E2ZA 5JLAA 1JWAB 3JQCA 1PJQA 3O26A 4OYRA 1OOEA 3ZV5A 1I5RA 3ONFA 4KUGA 5A03A 4D0SA 1BTOA 1EVZA 1XG5A 2FSVA 3B1JA 4JLWA 4YAJA 1O5IA 4N18A 1JW9B 1CRWG 4DC0A 3EVTA 2VNAA 3GVIA 2PZKA 3HE3A 3JD1A 3VZQA 1NFRA 4ZHSA 1TLTA 1PGNA 4BNNA 3GY0A 3KTDA 1Y7TA 1GV1A 1FDWA 2QX7A 3KYCA 1P9LA 3KRTA 4JCOA 2UUPA 4J1NA 4ZQEA 4CMBA 3KETA 2FY8A 3BTVA 3FF4A 3PJDA 4NNJA 4MKRA 4F3YA 2VRCA 3KVOA 3DAFA 1U2GA 2DM6A 4UEOA 1PGQA 1UDBA 3HDQA 2DTEA 3GVCA 3W8EA 4ND3A 4DTIA 3SLKA 4AJ2A 1WZEA 3H4VA 4DVJA 3FR7A 3PDUA 2Z5LA 4FFPA 4HFNA 1ADBA 3HDHA 1GFSA 1D1SA 4R1NA 5I9MA 3DTTA 5IXSA 5L9AA 2Q4BA 2NSDA 4JN6B 4WOJA 4GI2A 2D59A 2FMUA 3H9GA 5TGDA 1B14A 1E3LA 2V6BA 3FPLA 1ZNQO 3OQ6A 1C1XB 4R51A 1VJ1A 3KSUA 3L6EA 2JFGA 1DOHA 2HO5A 4FFNA 4XIYA 5B4TA 4JQCA 1WZIA 1X7DA 1KETA 3AY7A 3QY9A 3UCFA 4PZEA 3T4XA 1E77A 4Y67A 5GZ6A 1UR5A 3D4PA 1J6UA 4WGGA 3RSHA 1RYEA 2RHCA 2J8ZA 4YDRA 1HETA 3WG9A 1O9BA 5CDTA 1PU2A 4HNHA 5TT1A 4PLWA 3IS3A 5AXCA 3EUWA 2EF1A 4BNJA 2FPPA 3WQRA 3WTBA 2GERA 3PPIA 4JP3A 4A7PA 1BG6A 2OBYA 1E6UA 4I9UA 2GSDA 4A2CA 3OEWA 4FFMA 4D44A 1GCOA 2VTDA 2VQ3A 1DXYA 1ZEMA 5G4KA 3IAHA 5IFLA 1EE9A 1R16A 4XQ9A 3A1NA 3ZWYA 1WDMA 1GPDG 3IC5A 4XYBA 3ZN2A 1LDGA 1BHSA 4HY3A 3VH3A 3VVBA 3PLRA 3ZGYA 2FP4A 1DIRA 1N2SA 1PR3A 2OHXA 1SMKA 4LSMA 4CODB 1RWBA 3P5SA 1A9YA 4X54A 2JJYA 3C1TA 2YJZA 4CM7A 3KEQA 4BOYA 4TRJA 2BFMA 3ANLA 3VOSA 1M66A 2YV2A 1AHHA 4WCFB 1UP7A 3O8QA 2OGUA 3RAJA 3ULKA 2X9GA 3ZU2A 4FD3A 4NK5A 2W90A 2P2SA 4Z0PA 4B7CA 1Q2XA 1JKIA 1SPXA 2PZJA 2AQIA 4E13A 2D5CA 1EVIA 3U4DA 1T4DA 5C3MA 1SB9A 3IQDB 4YVFA 2H6EA 1R4NB 4OQZA 3GG2A 2O4CA 3FNGA 4CR7A 4JNKA 3I9OA 3TZQA 3ETDA 1HRDA 3KYDB 4HBGA 4GPD1 3VH2A 5A02A 1KVTA 3PQFA 3IP1A 4NI5A 4BV8A 3OFSA 4M86A 5CHEA 1JDJA 4W99A 1WNTA 4H16A 4CLOB 1SBYA 1R15A 2QHXA 3RASA 3D64A 4LK3A 4XA8A 5MDHA 2HJRA 1PGOA 2QW8A 2W2KA 3WGZA 4FDAA 1FDTA 2R00A 4IGEA 3TPCA 4BNXA 5A1TA 1NVTA 2J3HA 3WYCA 3WJAA 1X1TA 2Y1FA 4YQYA 3TNLA 1YS4A 3OIDA 3DBHA 4WCFA 4WECA 1R6DA 3ICPA 4E31A 4Y8VA 2VRCD 4GLOA 3TJRA 2GYYA 3GAZA 2NU6A 3INTA 5A05A 4ALLA 3NJ4A 2HKIA 1BRMA 3OMLA 5BNIA 3HDJA 4E30A 1PEDA 1T2AA 2DFDA 5L7TA 3B1KA 2Q3EA 4I08A 4WLEA 4WEQA 2BD0A 4Q39A 2C82A 4IPTA 2C2YA 4YRBA 4BMSA 4U0JA 3KV3O 4H7PA 5DN9A 3KEOA 2AXQA 4DWVA 5IDWA 2XAAA 2OP0A 3GMSA 4IZIA 3Q11A 2JCYA 4MJLA 3PWZA 3JYNA 1YQXA 2FRDA 5AOVA 1P1HA 4YPOA 1CJCA 1XHLA 2PNFA 4P8RA 4MVJE 4HP8A 4HADA 2ZCVA 1XQ1A 2W2KB 4PRKA 2B36A 3QV1A 5BSGA 4NFYA 4YRDA 2ZTLA 3EK2A 4QUKA 5B1YA 3OF2A 1E92A 5KJFA 1U3VA 2D4AA 4RLHA 5ADHA 4PG5A 2GASA 3M6IA 1U5AA 2RCYA 3GA0A 4DQVA 2IEDA 4WE3A 4D42A 3K30A 3JQFC 3GAFA 3RKRA 3ZWWA 3TZHA 3I9LA 3VPXA 2HMTA 3E9QA 1IYZA 4UVGA 4E5KA 2Y1DA 2Y1EA 3AU9A 4XB2A 4R5MA 4EUEA 5IG2A 2LDBA 4UUMA 3A14A 4CM8A 2PR2A 1YB1A 4OO3A 1QYWA 3GVPA 5F1KA 2I66A 3H8VA 3I6IA 3WFJA 5LDHA 3GK3A 5IDQA 4LVCA 2Y0EA 5CFZA 2DTXA 1HE4A 1EBFA 3D3WB 3KYCB 3NJ8A 3PHJA 4DMLA 1YONA 4L0QA 1E0DA 3ZCXA 4BO1A 4FFOA 4TZTA 5HM8A 3AFNA 3HUDA 1KVUA 4CLRB 1B7GO 4CPDA 2OO5A 2A94A 1U3WA 1L7DA 1BVUA 2R00C 3QJ5A 5COAA 1FJHA 4YQZA 4BKUA 1EQUA 3GZNA 1IL0A 1H6DA 1NVGA 1PZGA 1I01A 4A10A 5HTOA 1DIAA 4JP2A 1Y8RB 1I3KA 1YRLA 3G0OA 1VSUA 2J3KA 2ILTA 5JMPA 4IMRA 2GN9A 3WSWA 4IJKA 4AJIA 2AQ8A 3QVSA 3FNFA 5J23A 4YBZA 4K28A 3WOHA 1XU7A 2JKVA 4DYDA 1P0CA 4CLDA 2WD7A 1DO8A 3VTFA 2I99A 1SB8A 3IJRA 3BYZA 5LDGA 3WNVA 4BUCA 2C07A 4XDYA 4A26A 2BI8A 2DU8A 2WM3A 3HN7A 4MIOA 5BSFA 1NQ5A 3I3OA 1ADCA 2Z1NA 3EZLA 3B1FA 3MJTA 4J90A 4YT4A 3WMXA 1TB4A 4DGSA 1DBVO 5U1PA 2VYVA 3NGLA 4D3FA 5TRTA 1GPJA 3F4LA 4R4JA 1ZJYA 3DEYX 4WNCA 3ROMA 1A5ZA 1Y8QA 4NJOA 1DFIA 1HL3A 4QECA 1LLQA 2NTVA 3AUAA 4XZ3A 5ICSA 5IZCA 4N5MA 1VRWA 3GT0A 1EMDA 1I8TA 3PHIA 4DREA 2Y1CA 2E82A 1DEHA 1GAEO 3ETGA 3GUCA 1VPDA 3G49A 4R16A 4BO9A 5CDUA 5KJ6A 1IZ9A 1UXJA 5JO0A 5EQFA 2AHRA 3AI3A 2NVWA 2FOIA 3GNTA 3GFBA 3V2GA 4GQAA 4CQLB 3QW2A 4YAIA 1TXGA 4IXWA 3BTOA 2IRWA 5B4VA 2GNAA 4E5PA 3LF2A 4YJGB 3B70A 2UVDA 5AXAA 1GEEA 1HDOA 3F1LA 4YACA 1ISJA 3K9QO 1T25A 3FTPA 4O6VA 3A28A 1PQPA 3O4RA 4ND2A 1YDWA 4WLVA 5GY7A 3ZWPA 3DO5A 1N9GB 3NKLA 4C4OA 4PCVA 5IF3A 5C7LO 4GL4A 3JSAA 5MGBA 5THKA 5DBGA 4ZQGA 3GZ4A 4XIJA 4XR4A 4YJDA 3DDNA 4MP6A 2GN4A 3TZCA 2HQ1A 3OEYA 1U7HA 1W73A 5G4LA 2UV8A 3UHAA 5BNFA 3PP8A 3RUIA 5CDSA 3GRKA 2OZPA 1U7TA 1GUYA 1LC0A 2IZZA 4H3VA 5EINA 1DAOA 1N92A 1S6YA 3SLGA 1NPYA 4O63O 3GGGA 5A9TA 3TRIA 4KTVE 3CTMA 2CFCA 4RVFA 4FCCA 3X2EA 2I67A 1MA0A 1KY4A 4B3HA 1PQUA 1H2BA 1ENOA 2AW5A 4O5OA 2VZ8A 5JW6A 1X0VA 3MTJA 3NYWA 4IJUA 2Q1UA 1FDVA 3GH3A 5F21A 4AJPA 1V3UA 1WDKA 2ZYGA 4KMSA 1UDCA 3HN2A 5DNAA 4BKPA 2HUNA 1KERA 4LMPA 1R4MA 1J0XO 2CDCA 4DYVA 3L07A 5JCJA 5KNLA 3C1AA 2AEMA 1I30A 5L3ZA 1M67A 3DWFA 4KQWA 2BFAA 1WPQA 1RM0A 4UUPA 4NQZA 4E0BA 3K5PA 5LC1A 2RHRA 3H3JA 3OQBA 4BNMA 1KVQA 2O3UA 3PGJA 4DPMA 3O38A 5JCJD 2X5KO 3ANMA 4FFRA 2VOJA 3FBTA 3DR3A 1P74A 1ARZA 2NU9A 3ON5A 3TZ6A 3DXFA 2Q1SA 3V1YA 1Y9EA 2R2GA 4QO7A 4BKRA 3ORFA 3ENNA 1BVRA 2G0TA 3QWHA 1OAAA 5JDIA 2TMGA 4GBJA 3WYBA 5EMHA 1XELA 3MOIA 1V8BA 4YTEA 4FJ0A 5KJCA 4R69A 3MTGA 4YT5A 5L53A 1C0PA 5T8KC 2NV6A 3AUSA 4CLRA 4OSOA 3TDKA 4F46A 4FFLA 3TQHA 3FWNA 2VWQA 3V5NA 4KWHA 4EEXA 4UVDA 1ZJZA 2A4KA 2GZ3A 3L6OO 4QT0A 5DZSA 4MIEA 1W4ZA 3W8DA 1U2DA 4DIFA 4L4RA 2YFQA 4ROSA 5CEEA 2WYWA 1T2DA 2ZQYA 5A06A 1CIVA 1ZK3A 4KQXA 5IDYA 3UICA 1MV8A 4YT8A 1DPGA 4ZGWA 3W4IA 4J7CA 4J1TA 5CDYA 4A0SA 5JO9A 1EDZA 2DUUA 4NDNE 4RQTA 3FWZA 2NVBA 2WD7B 1GTMA 3KLPX 4R3NA 1DRUA 3JQ8B 2QZ9A 4XKJA 4Y6RA 2P4QA 3RUDA 3U09A 4L76A 3C7AA 5L7WA 3OP4A 1G6KA 3ADPA 3Q1LA 1AXEA 2FZWA 1QYCA 2JFFA 2X86A 5EESA 3H3FA 4WJZA 2IZ1A 2VUSA 4R5HA 4XEHA 4WLUA 2JD0A 1LA2A 3UCEA 3KOUA 4BS9A 2BI7A 2IE0A 2CF6A 2JD2A 1ENZA 1XLTA 3HNPA 1XU9A 4FC6A 4BGIA 1M2WA 4GWGA 5TLSA 3LT4A 3W4JA 5I7VA 4L8VA 3WGGA 4J0FA 3KM0A 4B7XA 3RBZA 1LDBA 1UJMA 1ZKMA 1VL8A 3WIEA 4BVAA 4UVHA 4K9DA 1LNQA 4HWKA 4A27A 3WGOA 2HSDA 3TWOA 1X1EA 2YY7A 4I1IA 5EL0A 1X15A 4G65A 4W82A 4IJWA 2QQ5A 1F0YA 4DLAA 1FDUA 1PGPA 4F6CA 2VT2A 5JAIA 5HS6A 2FZEA 4NJMA 1HYEA 1Z7EA 3GEMA 3ST7A 5TF4A 3ZW9A 4Q3CA 2J3IA 3F1KA 1QSGA 4IDDA 1LSSA 3KLMX 4W9NA 5F5NA 1ZK1A 2VWPA 1U28A 3HFGA 3QLJA 1HT0A 3V2HA 4D41A 3ZWXA 4BO4A 2O3RA 2ZJ0A 1C1DB 3WJ7A 1RJWA 1MC5A 3GC6A 2PZMA 4BMVA 2OL4A 3WIDA 1ZMOA 5BSHA 4IQ0A 4E12A 1G1AA 1SOVA 1NQOA 4MVJG 4N7RA 2VWHA 1JQBA 2HDHA 4MINA 3NEPX 1ZK4A 3PQDA 4BGVA 1ISHA 1DJQA 2YW9A 2O3SA 4ESOA 3E1KA 4YAGA 1PJBA 3I9JA 2YDYA 2BKAA 2X5OA 5KVCA 4FOSA 5JY6A 1A4UA 2QYSA 3K6JA 3W8FA 2PZLA 2X5JO 7ADHA 2W2LD 3TOXA 4CM4A 3CSDA 3PFFA 1GEGA 4NU5A 2FR8A 4CLXA 5EN4A 1T2CA 2FWMX 5C7IO 2AA3A 1E3SA 2NU7A 3LK7A 1CDOA 3C7CB 1P33A 2VT3A 4PIVA 4LCEA 3ZWCA 1JAXA 3DAGA 1ENYA 1H6CA 4ALIA 3INRA 2B69A 1C14A 1GD1O 3OJFA 1LRLA 2B0JA 1EFKA 1KIFA 1GYRA 2AE1A 3GZNB 6LDHA 4IQGA 4RF2A 5DDIP 3PWKA 4LGVA 3RUCA 3WGQA 1YB5A 4J2OA 3I9MA 3PJGA 2YUTA 1XCBA 3G1TA 2AEJA 2B4TO 2Y1GA 4GX1A 1HDCA 1W6UA 4WCDA 2Y93A 4XR9A 4CV2A 3JQDA 4NHEA 1D1TA 4CUZA 4YRAA 5K6AA 4UUOA 4C7KA 2NLOA 4KDFA 4NFSA 3JQAB 5TNXA 4FJ1A 4P4GA 1PL7A 4E21A 1M6WA 4CLEA 2W8ZA 2X9NA 4GGOA 4CM4B 2DT5A 3I52A 4PLPA 3DBLB 1G0OA 1EVYA 2F1KA 2NTJA 1ENPA 2QZZA 3PHHA 1ISMA 4LMRA 1SEVA 1GQQA 2IODA 1ADFA 3CE6A 3G1UA 5FEUA 1QXSA 2GN8A 3BHIA 4NH4A 1PJTA 2WDZA 3JQ7A 4Z9XA 2VRBA 2RBEA 3KXDA 1EE2A 3PHLA 4OH1A 1Z6ZA 1HYGA 4U6SA 1ISFA 4PLHA 3RC7A 4BNUA 4CQMB 1LI4A 3SBOA 1R4NA 4IM7A 3OETA 1R0KA 4E2XA 4CV1A 1VE9A 5I8ZA 3MCVA 2ZK7A 3AW9A 2PGDA 4OIMA 5DP2A 1BSVA 2GPTA 1WAMA 4KZPA 3FR8A 3BZUA 4J91A 5IN5A 2EW8A 1A4IA 1I33A 1WDLA 1BW9B 1XKQA 3ASUA 3OIFA 4KUHA 4QSMA 4B79A 1NWHA 3GLQA 3RCBA 4U6QA 4FGSA 4B3JA 3MJEA 2BFOA 1B0AA 3U0BA 4JROA 3LVFO 1O6ZA 4R41A 5JPIA 1ISGA 1ZUD1 3DMYA 4PG8A 1DC5A 1U8FO 4B4OA 4BNTA 3NX4A 2DLDA 3GN1A 3RFTA 4IY1A 3S2GA 4DRYA 4D3SA 3BTSA 3ROPA 1PS0A 3IP3A 4DXHA 1VSVA 4QX6A 2I6TA 1Z74A 1KEPA 2CD9A 3L9XA 5JE8A 1D4FA 3ICCA 4R9SA 3MJSA 4WPGA 5DP1A 1DDOA 3QWIA 3AM4A 4OXYA 4ALMA 4BGEA 4MVJH 1XQ6A 3JD3A 3HADA 3P2YA 2UYYA 3OA0A 3WSVA 4AFNA 1WXDA 2X9VA 1YH3A 2JL1A 5FFFA 2VHYA 3GPDG 2G76A 5C37A 1I2CA 1JAYA 3HZZA 2Z95A 3I4FA 1DFGA 3PHGA 1VJ0A 1HE5A 3C1OA 5G2OA 3WWYA 2E4AA 4AJOA 2OFPA 2QYTA 4FSHA 1P77A 1WW8A 3PVZA 3WLFA 2Y68A 4MPDA 4U8GA 1QP8A 1YGYA 2ZIZA 4DUPA 2JHFA 1QLJA 3UAGA 1Y9AA 5ICMA 4R68A 1PJCA 3DOOA 2BLLA 3PYLA 1IUKA 1VJTA 1MG5A 4ALJA 2HK9A 4FN4A 1ORRA 1M75A 2NQTA 3NDJA 4NFHA 3HB5X 4CQMA 4XD2A 1EEHA 2B37A 4FW8A 5K9ZA 3PJEA 5L51A 2Q1WA 3RFXA 4DPLA 3AK4A 2HJSA 3D5QA 3ONDA 3AUTA 3JTMA 4UVIA 3DZKA 4QTZA 3O9ZA 1BDMA 1MFPA 4RZIA 5H81A 3E5MA 4JBGA 3INGA 4CMEA 2A92A 4EGFA 2X0JA 1Z7BA 1QR6A 5G0WA 3PGXA 5A04A 4GMGA 3ZDFA 5B12A 1N1EA 4W4TA 1G0NA 4FOOA 3RI3A 5KCZA 1KY5A 2HLPA 3AI1A 3EVNA 1HLDA 1CYDA 1HE3A 5TX7A 1QG6A 3U49A 1UAYA 3EYWA 4I5DA 5L45A 2HRBA 3LT2A 1YDEA 1GZ3A 4C7JA 2CMDA 4UEKA 2J3JA 2GGSA 1ZSNA 1Y1PA 4P38A 1Z73A 3UF0A 1HDYA 3ZV3A 4WLNA 2J5RA 1MG0A 4BB5A 4PVDA 3K2EA 1K5HA 1JA9A 1LBEA 3AI2A 4IDGA 1PJ4A 3H2SA 1B8VA 3T7CA 4IS2A 1H6BA 3EY4A 3WBBA 3GHHA 4CM9A 2POQX 3NT2A 3PYMA 2EWMA 3TOZA 3L0DA 2X4GA 3GEGA 3I1JA 3VZRA 4J7XA 4AJLA 3F47A 4O1MA 4MVJA 4Y6PA 1I0ZA 3TF5A 4WASA 1CEQA 2YDXA 3D0OA 4ZICA 2Y0CA 1H94A 3A9WA 3CPSA 3E9MA 1SEPA 2DPHA 3KBOA 3STHA 1T2EA 1PIWA 1L7EA 3FRJA 1K89A 2W98A 4HFJA 1RPNA 4UVEA 1GZ4A 2PK3A 4E5YA 4IIVA 1Q0LA 1EUZA 1RKXA 2O7QA 3AOGA 2EGHA 4FBGA 4ND1A 2WJPA 1YXMA 3OIGA 3DFZA 1E1KA 1K6XA 4M8SA 2CUKA 4II2A 2J6IA 2O3JA 3GNQA 3KHUA 1H93A 3NTQA 1PR9A 3F3SA 3JD2A 3O03A 1XA0A 2RH8A 3R1IA 1QV7A 3VZPA 4PZDA 1T1RA 1QV6A 4RDHA 3JCZA 4DQUA 3H7AA 3LT0A 3ETEA 1W8DA 5AXBA 1O0SA 4BO0A 1V9LA 1E1LA 3X2FA 1EFLA 4CMEC 2C0CA 2GO1A 4YJGA 1NPTO 2CVQA 2HMVA 2OUIA 2X6TA 1IPFA 2YFHA 2VYND 1O95A 3DBRB 3EHEA 1GL3A 3UN1A 4S1VA 4QQRA 1LLCA 5L4SA 2YYYA 2X8LA 1GQYA 1NM5A 1HTBA 3LDHA 3V8BA 1Z45A 2R6JA 1VL0A 2PKRA 4M54A 2CZCA 2EG9A 1ADGA 4AJEA 2F00A 2PLAA 1KC3A 5CG1A 1Y5MA 4GX5A 2EKPA 5JMWA 3GFGA 1E6EA 1PZFA 4PG4A 1MFZA 3NTRA 2VOEA 1D8AA 3M2PA 3UGKA 4CUJA 3K96A 1NP3A 1P45A 3E6AA 2OXIA 7MDHA 3VPGA 2NWQA 9LDBA 2AG8A 4WEOA 4XYEA 1AN9A 2WWRA 4BNVA 3EZYA 1LDEA 4RORA 3QWBA 2J5KA 4XX0A 4NBVA 1E5QA 5THQA 5K0ZA 1PTJA 4XB1A 5G4KB 3HG7A 1D7OA 2PWZA 1DRVA 3H9UA 1HSOA 1JVSA 4YA6A 1T26A 2P9GA 2PFGA 4FQ8A 1LEHA 3GUYA 4PLTA 1R66A 3UXYA 1LLDA 4D43A 5CEFA 4ZU3A 4YWJA 2DBZA 4NU6A 2WEKA 4N5LA 2XF8A 4FPXA 1Y81A 3C85A 5G0TA 3E18A 2P9EA 5FI3A 3I4CA 3KB6A 3R3JA 3VPFA 3RJ9A 2PTGA 3IJPA 1L1FA 2ZATA 4UEJA 4G5HA 3VDQA 2H9IA 4GWKA 1O94A 2CNBA 2O50A 4B4WA 2A9FA 1NR1A 5TSDA 3PDJA 2FHSA 1GUFA 2NUAA 3JQGA 2VUTA 4WOKA 3LLVA 2NNLD 3CUKA 1LUAA 4ALKA 2CVZA 4AJKA 4FIZA 4HXYA 4K6CA 1Z75A 2JCVA 4GSKA 3LSYA 3AWDA 3KSZO 4DIOA 4E32A 2B35A 3L77A 1HSZA 2D0IA 3OQ1A 1BGVA 1JKJA 2GR9A 4Z3KA 4Q3NA 2D3TA 2ZTVA 2O3TA 3UVEA 4BV9A 4CQLA 1FMCA 2VHWA 2EEZA 4BNWA 1E3WB 4PFJA 3C8MA 3BIOA 3ASVA 3DBVO 4E33A 1EZ4A 3DB2A 1PL6A 1ZXLA 3TL2A 4NPCA 3MWEB 1SNYA 3LC1O 4XRRA 5DCYA 4XYGA 1LRJA 5EIOA 5A4DA 2I65A 1IE3A 4URFA 4J6FA 3AFMA 1NAHA 1ZFNA 3GRPA 4EI2A 1NR7A 3MJCA 3CZMA 1IPEA 5ITWA 2ZJ1A 2EHDA 4U7WA 4CMHA 4DBVO 3SVTA 2DBVO 4PZCA 3MEQA 3KUXA 3PQEA 1LLUA 3NDRA 3D4NA 1N5DA 1JN0A 2EKQA 1N9GA 3QVTA 4CMJA 3DOJA 3BHJA 4MVJP 3JD4A 4FJ2A 4CV0A 3BXXA 1FK8A 4YJFB 5TC4A 2VN8A 4KP7A 4P4NA 2PD4A 4MOWA 1DAPA 4HUJA 4FR5A 3DHYA 1PJ2A 1A27A 3HB4X 1FDSA 4XRGA 2FR0A 4JJGA 3EDMA 4PLFA 2GRAA 4IDFA 2EGGA 4F6LA 4NMHA 4Z9YA 2E48A 3RIHA 3FTNA 2QRKA 5LCXA 3HHPA 4CM6A 3I23A 4FS3A 1Q0HA 4XGKA 3JYLA 4MIYA 1SAYA 4LISA 5DBIA 1B26A 3LC2O 3OJOA 1F8FA 4Q9NA 4L9RA 3HSKA 3KSDO 3GHYA 3S8MA 3TN7A 3RJ5A 1C0IA 1P3DA 1QYVA 3LLSA 1BW9A 1PS8A 3WTCA 3GVHA 4YAEA 4DMMA 3TZKA 3JQFA 2RAFA 1JTVA 3F46A 3RU7A 3OBBA 4AVYA 1UXHA 2OMEA 3BA1A 4ITUA 3AJRA 4ZRNA 2EKLA 2C5AA 4YJFA 5JAQA 3RWBA 2VHVA 5TS3A 2OP1A 3GQVA 4BNIA 1SOWA 3RKUA 5CDGA 3DMTC 1JWBB 4M1QA 4XJSA 4W9NC 3WQSB 4ALNA 4J4BA 3EC7A 2X22A 2VUUA 5DF1A 2FSSA 2WYUA 3HDYA 1WWKA 1YKFA 1SC6A 4GVLA 5IN4A 3JQ8A 2EP5A 5EJ2A 1Y6JA 1UP6A 3GEDA 4E6PA 1EBUA 1LRKA 4BNKA 2YHUA 4A03A 3H9JA 3GDGA 4JJIA 3IKTA 5JYDA 4RVGA 4L74A 3G17A 1NXQA 3RD5A 4Y98A 1JKFA 3E48A 3PWSA 1WLYA 1XGKA 1PWXA 3IUSA 4J1SA 4UAGA 1XR3A 1UP4A 2YHIA 3ZV4A 2EXXA 4E5NA 2Y1OA 3N7UA 2BRUA 3SC4A 2Z1MA 3ZU5A 4XWYA 1DC3A 5KKCA 4JGBA 1IULA 4BO5A 1A9ZA 1HYHA 2VZ9A 5HRUA 1E7MA 1VC2A 2WYVA 3L9WA 2BHLA 2FN7A 4J3FA 3RBVA 5CPFA 3F5QA 2Q49A 4UUNA 3W4KA 1UXGA 5KTKA 1YVEI 2DTDA 1BXZA 3QIVA 1FXSA 4MVJF 2FPGA 2VYVD 4GH5A 3V1UA 3KYBA 3OA2A 3UUWA 1QRRA 2AE2A 4W7IA 2A35A 3ZU4A 4EJ0A 5I7FA 4II3A 2AQKA 4EITA 2X0NA 2Q2VA 5JDCA 6ADHA 2PA3A 1I32A 2ZCUA 2H5LA 3EMKA 5A9RA 4JXKA 2G82A 2B4RO 2Q2WA 3C3XA 4EDFA 4BB6A 4EUHA 4MVJM 1Q7BA 3WQQA 1ML3A 3GF4A 2Q2QA 3SXPA 3QE3A 4GAEA 5T8KA 3Q0EA 2EW2A 2ZB7A 2HK8A 4BO2A 1KYQA 4AICA 4B8WA 3PTZA 4OJNA 4MVJI 3WWZA 2HK7A 4NBTA 4I5GA 3OHSX 3RC9A 3OSUA 4DL9A 3WDSA 1NVMB 4CV3A 4BHTA 3DMTA 4G2NA 1NHGA 3FBGA 1U1IA 4CUKA 3MZ0A 5AVOA 3LYLA 2NTNA 4INAA 1U3TA 3HQ4O 4P22A 3DZJA 2EJWA 4UREA 2V65A 5ER6A 2OBNA 4K26A 4RQUA 3WR5A 5BNTA 5T67A 3O8QB 1E3WA 1N7HA 4HX5A 2W4QA 4J16A 3D7LA 3MJVA 1DSSG 3WLEA 4WLOA 3RROA 3QP9A 4E2WA 1NNUA 1YOVB 4YCAA 3SJ7A 2VWGA 3LU1A 4RF3A 1HXHA 1CQJA 4L73A 4R1SA 4AJJA 1IB6A 1C0KA 8LDHA 4E2YA 3VPHA 2O7SA 2EJVA 4G81A 4S3MA 2NACA 4BO7A 1B3BA 3RFVA 3NV9A 3WGYA 5L95A 5ER9A 3WB9A 5CG2A 5A5EA 4CM9D 1ONOA 3BMNB 4GSLA 1EQ2A 4IMPA 3RUEA 3RBXA 1Q0QA 2BFPA 4NBRA 4U0KA 3ZWVA 4TVBA 4GX0A 4HFMA 4MDHA 4K6FA 1VI2A 2E6UX 5L7YA 4BNHA 4RO0A 1HDZA 4PG6A 3GGPA 2XXJA 1X7GA 3BMQB 1LDMA 1PJSA 3RUFA 4R3WA 4DLBA 3U4HA 1R37A 2WTBA 3ZWBA 5EQDA 2HCTA 2P9CA 2X7HA 4ND4A 4BKOA 2Y66A 4LN1A 4GMFA 1SO8A 5DOZA 4BO3A 5KOIA 3RUHA 3I5MA 3A4VA 3QWFA 4EBFA 3JQBC 2B83A 3DHNA 1T24A 4BQPA 2HRZA 3SC6A 5I8WA 2NVUA 1MB4A 4J49A 1ZO8A 1E3JA 1AE1A 1AUPA 1O89A 2JHGA 2AG5A 4IIUA 4N5NA 4OQYA 4RPHA 5FYDA 5C7OO 1W0CA 1ONPA 4Y6SA 2I5PO 3ZWOA 4BNGA 1OC4A 3IMFA 3VKVA 4CM1A 4U5QA 4RVDA 1ZXBA 1XEAA 4CMKA 5BSEA 3T7EA 1A7AA 2LDXA 3Q2IA 5HBRA 2ZKLA 1V6AA 2PY6A 1A7KA 3TFQA 4AG3A 2D8AA 4QFCA 5L4LA 4RF5A 5DULA 2I3AA 3AUUA 1CQIA 3LQFA 3GNSA 4EZBA 1LDYA 2DBQA 2Q1TA 1E7QA 2JD1A 1I24A 5I7SA 3SEFA 3SX2A 1BDBA 1E1NA 3CMCO 3GMDA 1T1SA 4XCVA 5L40A 3WGHA 4CMGA 5C5IA 1GYPA 5G0VA 5AYVA 3Q6IA 1YE3A 5TJHA 5DT9A 1M76A 2I9PA 4ZQBA 4BGUA 5IDXA 2Y05A 1UH5A 5HS4A 5JC1A 5B37A 3MOGA 3TL3A 2EIHA 4RCVA 4ZJUA 4BNYA 3OM9A 5DBFA 2GLXA 3ZH2A 2UDPA 1PSDA 3LT1A 4BQRA 3L4BC 2PH5A 4L75A 3E03A 2I3GA 2P4HX 1ZMTA 2O2SA 3ZI0A 2V6FA 5KVVA 3RC1A 1P1RA 1ZCJA 5EERA 1K6JA 4RPJA 1LTHR 4RDIA 1MP0A 1TT5A 5TJ9A 3VKUA 1VL6A 2IZ0A 2AQHA 4J43A 2VYNA 1O8CA
chains in the Genus database with same CATH superfamily
2B8TA 1VMEA 3OPYI 2R62A 3G85A 3NWJA 1ZUHA 2HBRA 5LFAA 1PJLA 2OAGA 5AQ1A 1Y89A 3HEMA 4TRMA 2Q9BA 3C3MA 1C1XA 1M83A 1SCKA 1UPXA 2C4MA 2H31A 4N3NA 4Z8XA 5KNCD 1H9CA 3LUFA 1OF1A 2YIJA 2C2XA 1EFRA 2FW1A 1ICIA 1U3UA 3EIWA 2ZYTX 3FCOA 1E9DA 1SVWA 1O58A 3AIKA 1CJTC 1PFWA 1T1IA 5A5FA 3L0SA 5SV2A 1Z5PA 1QGUA 3JZFA 2YW2A 3AFHA 4W5QA 1AIPA 3L8DA 5A3VA 5HG0A 4XWTA 4DV4B 2I62A 5JZSA 1AGXA 4PQYA 4M7WA 3ZUGA 2D6FA 4BAZA 4YXFA 1NSTA 5KPJA 1GZHB 4INZA 1M8JA 2VK4A 4HZIA 3GAMA 2ZSAA 5LQKA 4DR5B 1I2BA 1PSZA 2V3VA 4LRQA 5DI3A 3QSGA 3IILA 3RYHB 2XZOA 2Y4NA 4BYGA 3PPXA 4H3HB 1JJIA 1TQHA 1Q7RA 1SCUB 2GTIA 2V9CA 4KK4A 5DT2A 2YHSA 2CDAA 3ZY5A 3C6QA 5KBYA 3LX6A 4Y2VA 1CDEA 2ZE8A 4P3KA 3VC7A 1HDRA 4RV5A 3OT5A 5DU2A 4L51A 4OM7A 3BB4A 3LG2A 5C4GB 4R1UA 2QUBA 2CV2A 2RHHA 3LCVB 2Z3WA 1I3NA 3NVDA 3UMBA 1Z5WA 3RDPA 2C54A 3IAM6 3ZU3A 2X9LA 3C45A 5F73A 3H1FA 1VCOA 3X1MA 1ESZA 2O2ZA 5HHTA 3NT5A 3PVCA 4DSNA 3ME5A 1J8QA 1V6SA 3OIYA 4NCJA 4OUKX 3ZD9A 3RADC 4HGYA 4BX9A 4PTLA 3SJUA 4MTCA 4JEMA 2FG7C 1KVSA 1PT7A 2AX4A 1KVRA 1GFWA 1QH9A 2OOKA 3IDFA 1VE5A 1GL9B 3NG1A 5DCLA 3SSMA 4CHTA 3HBLA 4XDGA 4UU8A 3VDXA 4Z4FA 1WU8A 3D5TA 4U7JA 1FS5A 1DIHA 3R7SA 5NLLA 2D06A 2GX6A 2J0SA 2IDZA 1X8KA 3I37X 4LI3X 2GHIA 2GDZA 4HDSA 4ZOBA 1MEEA 1XMIA 5J5CA 1NVVR 2D2IA 3FDIA 1X14A 3LCUA 5FX2A 1IY8A 2C2ZA 4A23A 4Z0NA 3E8XA 3AY6A 4OLHA 2JH8A 5DNWA 2ZCJA 5FCDA 1EZ1A 1L5WA 2FN3A 3VRHA 3RVSA 2DKFA 1CUYA 5IHXA 1EK0A 1X7XB 1VSTA 3R3SA 2EJCA 1R8QA 4LVOA 4QEKA 3GP8A 2BEUA 1E0JA 5EIWA 3A6HA 4G4GA 4EW6A 2Q45A 1XNJA 1UFRA 1WM1A 2B8JA 2ZEJA 4TTVA 2Q4EA 4S24A 4KOEC 4C0WA 1EDOA 1DJNA 1L5VA 3FPCA 3L92A 5DK4A 4G0YA 4LHZA 5PNTA 1A71A 3EFHA 2VSXA 1OXVA 2CBZA 3UOGA 3O0DA 2H17A 3RS9A 1EX9A 4HOYA 4O4LF 3AHHA 4EHLA 5KDDA 4GMHA 1QRAA 2VHTA 3ECAA 2WT4A 3R24A 2HWXA 3L8CA 2JASA 2BHSA 1RZ3A 3EXIB 3WE7A 4F2WA 1XTJA 3I1IA 4LPSA 2QMUA 2AMYA 1ZJ5A 3VDRA 4LF7B 4R54A 3MRSA 3H2YA 2C5FA 2IITA 4ZAVA 1PQWA 1H69A 4M87A 5CT5A 3S7TA 1KXZA 5IT5A 4LFCB 1F17A 4HDSB 1QUEA 1YZGA 3GB9A 2BN4A 3SS7X 4LY3A 4PQFA 2D8MA 2HY7A 1XX6A 1IBKB 4R05A 3FOAA 1BYIA 3E3OA 4I3GA 4RTLA 1D2EA 3FFWA 4HB4A 3O1LA 3F49S 5CH3A 3PEWA 1O1YA 2EFHB 4PLCA 3QPBA 2F64A 1YR9A 1GLNA 1YQDA 1M73E 4HN4B 2B5OA 1NUQA 1V8DA 5FAXA 4EEZA 4ZEVA 1QYDA 4LJYA 4TKUB 4CLOA 4BKQA 7AT1A 4M1EA 4C7OA 3PUZA 4RGYA 5T64A 4ZMBA 4IF4A 4IEFB 1A2QA 5JAZA 3QNMA 2C2BA 2JCBA 3OOHA 2B4AA 3DYIA 3UUGA 2Y6UA 3ZK9A 2QAGA 4NG5A 3U7HB 1GRRA 4GX2A 1TVEA 2E4UA 3JQBA 3SEQA 5IZ4A 1VKNA 3TRJA 1VLMA 2OORC 1HZJA 2QUKA 4E88A 1PJZA 3HCOA 1JU3A 1ZGGA 3NALA 1VCHA 1H4TA 5KOHA 3FNIA 3VH4A 5EP2A 4BP3A 5B6PA 2DULA 1EX7A 4KSYA 4OAQA 1AKNA 1MJNA 4DMRA 1J39A 2C8JA 4P34A 2AFHE 1G7SA 1YKGA 4DC1A 4GL2A 5CVJA 3D8BA 4BZPA 1CZLA 5AJTA 2WSBA 1NBWB 4FUQA 3VNQA 5FA6A 4D99A 1GGVA 2VZ0A 4L7VA 5JR3A 3UPUA 3DFIA 3BJZA 5IW8A 1S7CA 4L3WA 4NQRA 3QOYA 4L07A 1T5LA 2V4ZA 5F4BA 1P0FA 2ZYAA 2HPVA 3T1YB 3U7IA 4Q4JB 3W5VA 4YMHA 4MR8A 4W5WA 2VHQA 1EZZA 2JIQA 2YZNA 4PYLA 3DCIA 4OUDA 3SKVA 2ZTMA 3MLBA 1A7JA 3KZXA 2C9DA 2WAOA 4LDPA 5ES3A 3V8NA 3VZSA 4X7RA 3USES 2B4KA 3E9NA 2C88A 4Z3KA 3OJLA 3UJBA 2AHOA 1BXGA 1QB7A 3NP9A 5HKKA 1FP6A 2DKNA 1B93A 4A2PA 4CT0A 1L8LA 1OVMA 3BERA 4QXQA 2JA2A 4ENTA 2VDVE 2OPBA 4BTEA 2IXBA 3Q8XB 4D79A 5E7IA 3ZK8A 4E4TA 1H9BA 4ND8B 1P9WA 2FQXA 3K1ZA 3KPVA 1NTOA 3O90A 4RD1A 1KEEA 3LCJA 5D3MB 4ILKA 4AZ3A 3UJ8A 1RHMA 3NAQA 3RSQA 4FZRA 3ZHBA 2DBRA 3ITDA 2P9YA 4M6WA 1JDTA 2YXBA 2H9AA 2PNJA 5ALNA 3T5AA 3VPSA 2X40A 4YNBA 5IT4A 2QM0A 4NABA 4OL9A 4HYEA 3L7OA 4OYYA 4IJVA 4DDKA 1X42A 1X80B 5GMOA 1P1IA 2GPAA 1QQ7A 4J1QA 1CUVA 4O4JB 1W19A 3K72B 3AEYA 2PZ8A 5B3JA 2Z98A 5LWQA 1XMOB 1QCCA 1YE8A 1A5BB 2J85A 4KQJA 2PD3A 4F4UA 2AUMA 1KEUA 4MW0A 1RQNA 2ORVA 3ZCRA 1SBHA 1ZMBA 3MRXA 4BMCA 1UAGA 5H3HA 1CUWA 4BP1A 4I50B 3V00A 4YR9A 1PFUA 3A4TA 1WOYA 3UFXB 4DIEA 1TJ4A 4KWTA 1KEVA 1F7VA 1CUDA 2HF9A 1TYCA 1H0HA 4PFSA 4RZHA 1Q3TA 3MERA 1PLJA 2HBZA 3R3ZA 1M6HA 4L8GA 3W3ZB 5LD2B 1MC4A 1Y8QB 5BV8A 4NE2A 1SCUA 3FKQA 3EVBA 2GF2A 4KYIB 4D45A 5BRJA 5DWVA 1U6KA 2BM0A 4NVRA 1XK6A 4KUEA 3STWA 1JXOA 4QFDA 2E0IA 3H8JA 4HAVA 3RRMA 1N77A 1ULUA 3W3AD 5AT1A 3HB9A 4L5JA 2B9EA 1U7UA 4OXKA 3WXBA 1Q84A 3DEZA 3KSMA 3LXXA 5SY4A 5B57C 3H9QA 4NFLA 2IKQA 3MT9A 5FBKA 4QOEA 4D9CA 2VXCA 5A9SB 4MAFA 4UEWA 3IOBA 1QOPB 5LZ9A 4E6PA 3JARA 1GA1A 2D1RA 4QUDA 1P60A 3F6EX 1O96A 2UYCA 1UEXC 4ARCA 4F9FA 3ER6A 1JQDA 2FEKA 5G0UA 3HY3A 1Y5LA 2FW0A 2GPSA 3A6KA 3EGOA 4CT5A 2PH3A 1R18A 3G79A 4LY6A 3SR4A 3KYIB 3GAAA 4TVSA 4O4LB 3ZDZB 4DY6A 5DPMA 1E3EA 9LDTA 5JSFA 4OFBA 1N7GA 3ILXA 3Q88A 4XFKA 4B4VA 1CJUC 1GUZA 4MUGA 4D3DA 4UMDA 1ZRMA 1H2HA 1WS6A 5DGIA 5AI0A 4I4LA 1Q19A 1E6MA 1IJEA 3PKJA 3OVMA 5FADA 4AJ4A 5E2AA 3OCZA 3QTLA 4GP7A 1CEYA 2QM3A 3ASZA 4BIIA 1TYDE 1LSJA 3GFVA 1XJQA 1Z13A 4RVHA 1O87A 1UDRA 2WFLB 2XV1A 1N6RA 3U7QA 3UH1A 4B8ZA 5A0FA 1C8VB 5C5EA 3S2FA 4YUWA 1BWPA 1J5PA 1B16A 1DHRA 1E6WA 1R0CA 4JVOA 7MHTA 2IZ6A 2OV8A 2R8XA 3H2ZA 3MA0A 3L18A 2OCXA 3U16A 3DONA 1M6VB 2C29D 4U7HA 5BVGB 1H1TA 1P1BA 3HLYA 1XD2B 5ERYA 4LYYA 1P72A 1QFXA 2I6UA 2JLRA 3C7KA 2WMDA 1SZCA 3F96A 4U6NA 3TMYA 4J07A 3OX4A 4CHGA 2J45A 2WVGA 3A05A 3ZHXA 3R5SA 3UK6A 4MYTA 3BMOB 1SBQA 2HDWA 4JNCA 1V6CA 2YQ5A 3H6GA 3L1JA 4RSHA 3U7FB 3W5AA 2E3JA 1RM3A 3AJEA 2XRYA 2Z2XA 5DHAA 3V7UA 4I9HA 1XCOA 2XXBA 3VH1A 4BRUA 1ETUA 1KEKA 1FRNA 4MP3A 2I80A 5BSWA 4J0DA 5C5DA 3PGKA 1MU0A 5FBWB 3M6XA 2R68A 3QU4A 4E5UA 2ZRQA 3JQEA 3T7KA 5JLJA 3VI4B 1RYZA 4FYXA 2QW1A 5F1OA 3K2BA 4RVNA 4YJHA 1RRPA 4DDTA 3P52A 1GQSA 2DH5A 4RTRA 1VLQA 2QPLA 1CRQA 1X74A 1C7IA 1MBZA 1WXXA 1N25A 3BHMA 2PLNA 3IAM1 5JS2A 5F3DA 5EPOA 3V33A 3A9TA 4QBHA 3VOBA 3AF5A 2RGNA 4GZ5A 2CL6X 2AXNA 4BFTA 1M7HA 2D4HA 4D4IA 4XWWA 3FD8A 4UMVA 4C5BA 4P9NA 1E2NA 2QT0A 4RS4A 3B12A 4WJKB 1CR6A 2Q5JA 4B82A 2QJRA 3CW8X 3MWEA 4FFSA 3SF8A 1Z63A 2G5CA 1F0NA 2W2LA 1HEUA 3JQAA 4NV3A 2P2CA 5KNDD 2CD7A 1UK7A 4L5BA 3BD7A 1XWFA 3DR5A 3NH9A 3EFOB 1OZFA 2OV3A 1C41A 1B2LA 3WIUA 3QF4A 4J4HA 4EJSB 1KRXA 5A6SB 2FZCA 1LU9A 4R81A 3RQSA 4DAOA 2CNWD 4RA9A 3IDSA 1EH5A 4INJA 2OORA 3T5PA 4PICA 2HNAA 5IAAA 4GNRA 3KQMA 4BECA 5ITZB 1IOLA 2QRJA 4EO4A 1Z2DA 1GNRA 3QPWA 5KX5F 4RKQA 3A11A 1EUDB 4OM8A 3FHJA 4ZKDA 4HH0A 5JS1A 3URKA 2D7JA 4RUKA 2JAPA 4Y0AA 3S2ZA 3WGUA 3GO4A 3ET4A 3SYNA 3ZHTA 1K9VF 1EBBA 2HA0A 3PCXA 1XZDA 3JX9A 4G6ZA 4YK7A 5AI8A 3AU8A 1PP4A 3L04A 4I6JA 3O3MB 1OX4B 3CXRA 2GB4A 3D3KA 4UCFA 5IXYA 1KOLA 3DQPA 3KNZA 4CKZA 4Y2GA 1Q7GA 4PZYA 2Q46A 2EWVA 3PYXA 4KPUA 2IKSA 4O4IB 1VBNA 4PLVA 5BRAA 5J2TB 5CNKA 1E7RA 1E63A 2VJKA 4WNIA 3DEHA 5I4KA 4IBOA 3SZLA 3CPHA 1NBEA 2H63A 1DLIA 3HRIA 4HR7A 1M2GA 1S4MA 3BMCA 3ZI7A 4WFIA 1VLLA 3NATA 4UTVA 4RHYA 3T7DA 2FJ0A 1K2WA 1NXXA 2ZRLA 2IY8A 2ZI5A 3JATA 3AF3A 3LL4A 3NWBA 4FHFA 4IDNA 4Q3DA 5ALTA 1TRHA 1T35A 1XL1A 3QKRB 5EUCA 5F51A 2EKZA 2J4DA 4NARA 3ZIAA 3IRUA 3FDFA 4HDRB 5CNJA 3DL2A 1G64A 4EA8A 3CLUC 4ZZ2A 3WLQA 4F5WA 4GOMD 2QUAA 1RPJA 2H5JA 2RCNA 3R5FA 5TIIA 4Z2AA 1YL7A 2P9QA 3CSSA 2Q50A 1ZH2A 4FTWA 5EIFA 5EMKA 2PJRA 3L46A 1EWKA 3FKSD 1MW8X 4G1FA 4OOFA 5HCIA 3UHOA 7GPBA 3N9IA 4OEHA 1AMNA 1NQAO 5IKMA 4HVCA 1XZBA 1ZRNA 2Y67A 3KJQA 1N6HA 3KQVA 1Y7IA 3N87A 4U02A 2HA6A 1XDWA 1OX4A 2Y99A 4MH0R 1GCUA 1E0SA 4PLZA 2BJVA 3DEJA 4JSRA 1W34A 4YAFA 1AHIA 2BL4A 2BWJA 2D62A 3LX5A 4WVLA 1TCVA 2PN1A 4MA5A 5IUJC 1R0XA 2WE7A 1IG0A 3G13A 4EX7A 2WPDA 1TMOA 1ACLA 1QHIA 1VI6A 2HEIA 1GZDA 2OENG 1FYFA 2PJUA 2FQYA 5HZGA 1F3OA 1JPNA 2H29A 2H4HA 2PS0A 1TZBA 4ENUA 2R7AA 2DB3A 1VQ1A 2VP9A 4QDKA 1Z4OA 1HNWB 2MTBA 2GKGA 1QVRA 4O2AA 1GPWB 4Q9KA 5COQA 2PL3A 7YASA 3UB2A 5FNVF 2QK4A 3NHJA 1SUFA 4ERNA 5JZBA 4BBPA 1PAUA 3G02A 4BV2A 1QQ5A 4LHYA 3DZIA 1ZK0A 1WKCA 4J29A 4Y2UA 3L8YA 4YREA 5BY2A 1L7NA 1VIDA 2BR5A 4XD7A 3HVIA 5FPHA 2Q07A 3ZVNA 1OZ0A 1Q0RA 1RMQA 2PCJA 4X60A 2WUGA 2P2DA 4NYMQ 4AJ1A 4D1YA 4EPRA 1Y6ZA 2Q9CA 1MX3A 5F2EA 5KJCA 1MVNA 3RF7A 3TSCA 2FMIA 2ZVJA 1XRPA 3IL2A 1XEFA 1DS6A 1C4XA 4Q1AA 4XGIA 2F1RA 2QDXA 2Q8QA 1CRZA 2VBIA 1E60A 2VSOA 3AUXA 5TMPA 1WTAA 5HOQA 5BMVA 4R7TA 3RHSA 1RS0A 1QGYA 3CVJA 4ZVTA 4UBIA 3UCXA 3ROTA 1PEYA 4DBZA 4EHJA 3U9SA 1FTGA 1HE2A 3PENA 2PGIA 1YV9A 1A72A 2PO7A 1TW2A 1VMIA 1RKBA 4IVQA 3CQ9A 3ZHZA 4ZA2A 1DTEA 4E3ZA 4UTOA 1HMYA 3HUEA 1X1SA 3UWSA 5IVKA 2C9OA 4CNBA 3T8YA 2ZYRA 3T7AA 5K0CA 4BCBA 2NIPA 3FNEA 3WK5A 5ALXA 2HBQA 3IVGA 2WAXA 4CMIB 1H6AA 3C3EA 4WKBA 4DKJA 2ZQZA 2NM0A 1R74A 1PZMA 3COSA 1N8KA 2EATA 1IK6A 4QEZA 1ECJA 1L7QA 1P9OA 4C5AA 4LQLA 4NJMB 4PO3X 1CQZA 2OBFA 4OQEA 5FBZA 4EHBA 1L4UA 2UYGA 4YFVA 1FZQA 5DIFA 4AXBA 4DTCA 1USUA 4GLLA 4L7QA 5DX0A 4U7GA 2IH2A 3P2OA 1J90A 1YOVA 2JLZA 5LYJB 1M1XB 3AEXA 1H5QA 3QMMA 1VKRA 3C4VA 4YB8A 4NK4A 5KWVA 4GGPA 1PFKA 1KI1A 4KGVA 1XEXB 3QFSA 3A0RB 3W5UA 1AA6A 4KHPB 2CXUA 1FF9A 2OHGA 4K6GA 4LRSB 2DPGA 1LX7A 2CHQA 2FDCA 3PSHA 2IUUA 1GYQA 2GHTA 3F98A 1TOAA 3FPFA 3QVWA 2Q2OA 1PJ3A 3I2KA 2JIBA 4LBZA 5BQ3A 4CIYA 5U9CA 1DQYA 1JLKA 2BGKA 2L17A 3KWLA 4DR4B 5TPZD 1GY8A 3I1YA 4ZVQA 4IH4A 3WYEA 5ALFA 1EFPA 1MN6A 2C3YA 3V97A 2GS9A 5EP1A 3WL3A 1E5LA 1XWIA 1IY9A 1PVDA 2O57A 1ZWKA 3PB3A 5CJJA 4NOLA 2PWBA 1ZNYA 2ZI7A 2IWRA 4QQFA 1ZM4A 5E7MA 3HBAA 3ZNNA 3JQ9A 3IDZA 4QUAA 2HRDA 4MI1A 3D9QX 5K0JA 3YASA 1T4BA 1UMCB 2DC1A 2G17A 2JFQA 3ITKA 4J7UA 4RL4A 3KC2A 4KDRA 1NBOA 1OPXA 3SQDA 3RE1A 4ZO4A 2I2XB 3IERA 3GA5A 2H1LA 3EH2A 1LW6E 2X8JB 3ICVA 1UXIA 5EVCA 5BSRA 1NL3A 3RSCA 2ZB2A 1DWQA 4W7HA 1N75A 1W85B 4H0NA 1VFNA 1BWSA 2AMFA 1A97A 4D4KA 1UZNA 1VPLA 1L5OA 3UM9A 1SUWA 3VYWA 4DA4A 3G2PA 4I19A 3U4IA 2K5UA 2NADA 4L16A 3W78A 3G8YA 3QVOA 4JFAA 1J24A 4E2ZA 1HBJA 1WPXA 4ZAZA 5JLAA 1U9IA 1OOEA 2HU7A 5CLJA 4O02B 5IVIA 1BTOA 5JH7B 1Y5IA 4YAJA 1O5IA 3AR5A 2B1JA 5AVQA 1ZY2A 4Q01A 1Z2CA 3EVTA 3ZK7A 4DC0A 3MXOA 1NFRA 2XZTA 2A4MA 1PGNA 3KTDA 4G0OA 3Q8WA 4YCLA 1OYVA 1XUOA 1Q92A 3RLFA 2AWNA 4J1NA 5HUJA 3GEHA 1XZPA 3EPHA 1YNSA 3NBAA 1QWOA 1WP9A 3AESA 1YIDA 1DG9A 4M98A 5KS2A 3LOPA 3AEQB 2WFMA 2C7QA 4DG8A 5AVJA 4LX8A 2V45A 3DAOA 2DTEA 5DHFA 1TKCA 2YOHA 3CWQA 1OILA 1ZXXA 1PZXA 2JGNA 3K20A 1PWYE 2WJ3A 3MFYA 2FG5A 2Q3LA 1NT2A 2Z5LA 5E6UA 3L8FA 3L43A 5FL7A 4ZARA 1GFSA 1D1SA 5I9TA 2FZ4A 3ID6C 4I1UA 4JQZA 4K9OA 4MWTA 2HXSA 3BGWA 3LSTA 4R1NA 2IEAA 4JN6B 4WOJA 5HKBA 2JJ2A 5D5QA 4BMNA 2FMUA 1KMCA 1JDZA 1ZU4A 1B14A 3H9GA 2HFKA 4A2QA 1HUQA 3FPLA 4TXMA 4R1LA 2IPLA 5LYYA 5FH9A 1J33A 1BFUA 5KSPA 2YASA 1NBHA 5EFOA 2ACVA 3TLGA 5IH7A 1F6DA 4MWCA 3ESDA 1R5OA 3OX2A 1NNSA 1T3HA 1IAQA 3TCXB 3UCFA 4PZEA 3UWOA 1E77A 4TPKA 1NE7A 5ADWA 1UR5A 2Y0BA 4WGGA 3RSHA 3Q15C 4IG9A 4OU5A 2P2ZA 3E58A 3ZQKA 3UJNA 3SQWA 1Y98A 2GEFA 3CF0A 3IOCA 1PU2A 4QXOA 4AURA 1OY1A 1ZI6A 1TIPA 3IS3A 1T0BA 2PT7A 5AXCA 1P0IA 3SJZA 3K70C 4A36A 3DKIA 4ADSG 2OHFA 1BG6A 4EG3A 4ES6A 1RYFA 4YIKA 3VTAA 1QDUA 1KBOA 2ZRNA 1W36C 4ML3A 3LRPA 4D44A 4FFMA 3TBKA 2DBYA 1DXYA 3H5LA 3OTQA 4EMUA 5A4AA 3RH0A 1L5HA 3IALA 2WB4A 3A1NA 2IXDA 3MGCA 2XTAA 3CO5A 4O4HA 3UKJA 4A16A 3VH3A 3RSLA 4B1FA 3ZGYA 4M1OA 2SECE 4HAWA 3ZLVA 1RWBA 2H0AA 2Z5GA 3P5SA 5LA6A 5A6VA 1QHYA 2VSYA 5LDDC 3NB0A 1ATIA 1O6BA 2UYQA 4RACA 3GLFA 1V43A 4ZYTA 4BOYA 4XWAA 4JLUA 3AMVA 3ANLA 3FDJA 5JASA 3IIJA 1XD9A 2WINI 5IYZF 2PUHA 3T3MB 5C1IA 3P9KA 5DASA 3ULKA 1E59A 4FD3A 1JFSA 3OQHA 3I61A 2NSLA 2ESRA 5E38A 2AQIA 3TECE 1QGZA 1SHUX 5LPNA 3U4DA 4M0PA 5AM2A 2EBHX 3UT0A 3AF1A 3V34A 4OQZA 3AB7A 5BN3A 1C1HA 1YCGA 1JJFA 4KIFA 3TZQA 1VMDA 1TM2A 3VNUA 4CEHB 3FYHA 5KX5A 1E8MA 3RAEC 2WDPA 221PA 1XQWA 3LBFA 3OCCA 1KVTA 2EFYA 3IP1A 3PQFA 1JMKC 4FMBB 3EWSA 2ZXFA 3OFSA 3I92A 5TVGA 2UZAA 4COOA 1X3SA 1A2OA 2C5BA 1JDJA 1CQPA 1WNTA 2ZT6A 3NOXA 4CLOB 4DGQA 2JAUA 3B82A 2QRGA 3D64A 3O84A 4XA8A 2I71A 4GKAA 3B1XA 3R76A 2OSVA 4NS1A 5GQSA 2X8JA 3SC3A 4GE3A 2QW8A 3A1EA 1FDTA 2P4UA 1VYHA 2R00A 3DM5A 3TPCA 5KHLB 3RS2A 5A1TA 3NIFB 5BUSA 1X1TA 3TNLA 3E81A 4FYVA 2DOKA 2HZBA 3DBHA 3LCCA 3R23A 3R77A 1NDUA 1JVNA 1ZGJA 4GLOA 3NHYA 1FX1A 3INTA 3AIMA 3IOEA 1KKLA 1ZOLA 2ZYVX 4EVSA 3NJ4A 2HKIA 3SKYA 3HYTA 1OH5A 1W0KA 3R5TA 2YY5A 4P92A 1P5JA 1WU7A 2IOQA 2QMHA 2CUNA 1CULC 3I2GA 4N65A 1MTZA 3GT3A 3IAUA 5L7TA 1V96A 2CFRA 2QJOA 3UTDA 4I08A 3EFOA 2AFRA 4M9SA 3A4LA 4IPTA 4V0KA 3G5MA 5DM60 5AUOB 4FGLA 2HGSA 2WSSD 4U0JA 3TVTA 4BMSA 4YXWD 2YXDA 1OPRA 3ZNPA 5FTJA 3D7NA 3FKJA 4KBYA 2TRSB 3U1BA 2ZXUA 4IDPA 2WMOB 1NJ6A 3THRA 3P0JA 4V03A 4F8JA 4TXLA 2JCYA 4M9ZA 4YRQA 4GXTA 3JYNA 3M4JA 2WICA 2ZYHA 5H68A 2FTKE 4YPOA 4U8HA 1QFSA 4CDRA 3FAZA 2PNFA 2H4JA 3EFEA 2LP4Y 4Q9AA 5C8YA 1ZD1A 2Q7DA 3PX2A 3QV1A 4K46A 4YRDA 5BSGA 2ZTLA 4QUKA 5AW3A 1UWVA 3OF2A 1E4EB 1TEXA 1U3VA 3LPNA 2DMRA 4GNKA 4BFZA 5JXGA 2HSZA 4Z7OB 5ADHA 5C51B 2NO5A 1ZGAA 1P4AA 2GASA 2GKOA 4FP9A 4IHAA 5KOYA 2AVDA 3KVYA 1AXRA 2J3DA 2O14A 4R1QA 3GA0A 3KOMA 4XVQA 5KYWA 1OH8A 4DQVA 2IUYA 5FNVA 3K30A 1QHXA 3QF7A 3LL7A 2BI4A 3RKRA 4XSHA 3VR5A 1RXEA 2FP3A 3KTAA 2IZ5A 2R87A 3G2NA 3VPXA 4I6EA 2YC2C 4I2VA 3AZOA 3E9QA 1IYZA 4A4DA 2JH3A 4JP8A 4EB6A 1MT0A 2Y1DA 5ADVA 1V4BA 2GAFA 3AU9A 3MTAA 3ODGA 3WHKA 4Q19A 4N5DA 4ZWNA 4UUMA 1K7YA 3BSYA 4I1VA 3QK7A 4CM8A 4XLZA 5TEVA 2BFBB 1L5RA 5EHZA 3OE7D 2B99A 3MCAA 5F1KA 3MRTA 1SOMA 3WFJA 1EFVA 3Q8LA 2Q6KA 2ZBUA 4U2EA 4HAOA 1FTYA 5EGSA 1J8YF 1XALA 1BHQ1 1WA5A 3T94A 3OFND 2QB5A 3D3WB 3OQVA 1YONA 1GSHA 2NUTB 1ZGCA 2ZVDA 2B1QA 5HM8A 2MMCA 1QFZA 1GFIA 2O0LA 3HUDA 4Q3LA 4RTQA 5AKYA 3NWOA 2Y9PB 2A94A 3L0BA 5CX1A 4LI0A 5COAA 4YQZA 5TS2A 1RRVA 4BKUA 2WJ6A 4TTAA 4MCAA 2GLTA 4QJIA 2QMOA 4TUYB 1ZN7A 4AQYB 4DIBA 5CD9A 1IPHA 4HDQB 1LS1A 4KX5A 3WJ1A 1I01A 3OAAA 5HTOA 3B6JA 4HLUC 3P0EA 1P62B 5K0LA 3KAPA 3QEBZ 1I3KA 5AHOA 2XNDA 3G0OA 1TA0A 1IEXA 3MMPA 1JSCA 4HGZA 2XCOA 5TB5A 4OI0A 3FCEA 4V3BA 2VF2A 4JH0A 1TDJA 3WOHA 2W2MA 3GGDA 3PC8A 3A9VA 5EQJB 1L4HA 4CLDA 2WD7A 3FNQA 2X1VA 4OJYA 4UUBA 2I99A 3OCYA 2XDQA 5LDGA 3WC4A 1OXBB 1GSIA 1XTZA 3LRTA 2QS9A 3QKWA 4FHEA 4MCJA 1M2OB 1CP3A 2OT3B 4AY5A 5GTDA 2DU8A 1QONA 1K6EA 5BSFA 1KORA 1NQ5A 3I3OA 4BFVA 1ADCA 2Z1NA 1Q0TA 3WRXA 3MJTA 4GOKA 4J90A 5CCDA 4YT4A 3TGPA 2YMPA 2BJHA 1DBVO 4R7ZA 5U1PA 2VYVA 4FNAA 3OCWA 4GO1A 4MLDA 3WHPA 2WWHA 3NGLA 1XFAA 3DPIA 1Q16A 1KY3A 2VJAA 3EY9A 4R8LA 1H4SA 5K1ZA 4G84A 1L5MA 1Z0JA 2VPXA 4H60A 5HWSA 4LE1A 3DEYX 2BW0A 4NE7A 2HREA 4J16C 4WNCA 1T9GR 5DGHA 1AV7A 3A6PC 4QECA 1LLQA 4C22A 5ICSA 4G8BA 5KINB 1JE1A 3O3OB 3UW1A 2NOAA 3GWZA 1P5HA 5LLTA 1NMEA 3U13A 3JAWA 1BNCA 3PHIA 5K3EA 2CWDA 5DRYA 3R0XA 4BWFB 4EQ6B 3BE8A 3FYUA 4Q9DA 3T7TA 3G23A 1JR2A 1N78A 1BMQA 2J3EA 3CUSA 3W6OA 2RIPA 4EA7A 1VPDA 2JGEA 4R16A 4BO9A 4DLKA 1JALA 1E0KA 3RGGA 1S89A 1G5TA 3LZCA 4HMQA 5AVSA 2FWNA 5EQFA 1VXRA 4MUYA 3BGOS 2ZJ6A 3CS3A 3BUSA 2ZIWB 3C3WA 3KR9A 1CZNA 4OJKA 1JSZA 2PS3A 4E2FA 1RWPA 2BCEA 4JLPA 4CQLB 3QENA 2FW9A 3PC3A 4M4SA 1UPUA 4G0XA 4HH4A 2JVKA 3ZE0B 4ND7A 1V48A 1MOSA 4NZNA 2AR9A 1V7PC 2PGXA 1QPBA 4YJGB 1GEEA 1COWD 3F1LA 4YACA 1EWQA 1WW3A 3LDAA 3ICOA 4ZREA 4BE7B 4JT8A 3NO4A 4JEUA 1YDWA 1K5PA 3IQHX 1VG1A 3O8BA 4WLVA 3WLOA 4PQEA 2HCRA 4E1BA 1NU8A 3NKLA 4DIMA 2GZHA 2QLLA 1D9XA 5C7LO 1I3CA 3QFHA 1GZSA 3D8HA 4ZQGA 1J42A 1DE0A 4NENA 4XR4A 1Z9BA 4RCZA 5CA1F 1N5LA 3N2LA 3N7AA 2EFEB 4K6HA 1N2IA 3BWEA 2HQ1A 4EYQA 4G97A 3LQRA 3UHAA 1R6UA 4MYRA 5BNFA 4DVGA 1VLHA 3RUIA 5BVHB 2IEIA 3NFYA 4OBEA 3GRKA 5FUVA 1U7TA 3EXEA 5CDSA 2CUTA 2IZZA 2W22A 3AZPA 2JI6A 3PT5A 4WMLA 4DRXB 4F3KA 4JSYA 1N92A 1S6YA 4LWPA 5JS8A 4QU0A 5ELMA 1G8FA 2YNMC 1U02A 1TJNA 1Y5NA 3M8KA 4O63O 1I7NA 1JHPA 5A9TA 3TJMA 3TRIA 1CCWA 2C1EA 2ZE7A 3PUJA 5H4HA 2IU0A 3KSRA 3AEKA 2GKSA 2I67A 4JMPA 4WQMA 2F55A 1MA0A 1VRCA 2PANA 3SF0A 5FV4A 2KPOA 5C52B 1KJJA 1WUJS 4AX4A 5A4MS 5EJEA 5G41A 4AZWA 2AW5A 4CGZA 2F8SA 2H54A 1BX1A 2V55B 3ZJ5A 2XNHA 2QU8A 3I01A 3A26A 4IJUA 2Q1UA 1FDVA 5F21A 3DW3X 2BRUC 5LIPA 2ZSEA 2ZYGA 5KDOA 4R0NA 1Y7LA 3LXMA 2AD5A 1TRKA 1C3OB 2QQEA 4PPFA 2GH1A 1UDCA 2W83A 3KELA 4M6WB 3H11A 1ADJA 3UT6A 5DBEX 4GKJB 4XARA 2VC2B 4G26A 4GPAA 1R4MA 2AMVA 1ACJA 1J0XO 2OO7A 4IWXA 3E3LA 1S3GA 2C7OA 3DDSA 3AM1A 4YP6A 4ZOLA 1JFFA 4A0FA 4DLVA 1BWRA 1G8AA 3DNFA 1PN3A 2O07A 2OB1A 5KNLA 4DB4A 5E9QA 4P0PB 3NDBB 1YCDA 3C4QA 1FRVA 4W9MC 1KGDA 4PFQA 1Z5OA 3H75A 1KSHA 1ODSA 3ABRB 1WPQA 1RM0A 3HLTA 4IV8A 1BEZA 4E0BA 2NV0A 2MJLA 5LC1A 3RS4A 4DPMA 5HUQA 3DZDA 5B5SA 3KAJA 5JCJD 1NVDA 3F3MA 1OBOA 4C29A 1P74A 1K5GA 1ISSA 4OI4A 1UC5B 5FL7D 3JYHA 1IXRC 4J6EA 2NU9A 3T9FA 3TZ6A 4CI9A 4EKGA 2X7XA 1XQYA 1EWRA 1KQ3A 2MSCB 3O7WA 3K4HA 3ZDCA 1RPZA 4B80A 3ENNA 2Z58A 5SY6A 1NSYA 1OAAA 3RU2A 1W5BA 1DBWA 2PX3A 1P91A 3ND5A 4AMZA 4FHGA 4J0GA 3PEYA 1O95C 4Q3OA 4YTEA 4FJ0A 3T0GA 1J2UA 1VDMA 2BEVB 2FSUA 3G5LA 3MTGA 4YT5A 1RC1A 1C0PA 3A6FA 3OZCA 3KT3A 3AUSA 5LUBA 4I9FA 4A1OA 1XZFA 3KEMA 3LIPA 4WAUA 3TDKA 1BOOA 4DG9A 4F46A 3ZDBA 3MGKA 2JEOA 2P69A 1LF5A 3BD8A 5HKKD 3BL6A 3B2EA 1ZJZA 1XZGA 1P5RA 3L6OO 3E2PA 4PTYA 1JEYB 4F92B 1IDOA 5FJIA 4GI5A 2WHQA 2Z3VA 2Q5EA 4FX5A 4DJDC 2FWJA 4PZLA 5D84A 1X3LA 3SYRA 4BC0A 2XUPA 3RT7A 4MW6A 1ZK3A 2NSHA 3V8RA 1W47A 1DPGA 2ATIA 3OFJA 4I4CA 4DXDA 4J1TA 3S6JA 4YXWA 4A0SA 3KE9A 5JO9A 5CDYA 3CU5A 4KR9A 1MR3F 4LYDA 2ZRJA 4F4FA 2UUBB 2IYVA 5IULC 1I2MA 3DD1A 1E2KA 1XWWA 1FUUA 2P0YA 1DRUA 4XKJA 3RUDA 1KZ7B 2WV7A 3ADPA 4ZI2A 1CQXA 1XKLA 2IZ1A 1ZWLA 2O5CA 4UFPA 4WLUA 1EB9A 3DNMA 4DBLC 5L6LB 3IX7A 3KOUA 3HCAA 5HKOA 2BI7A 2YYAA 2IE0A 1ENZA 2WTNA 1WXHA 3HNPA 4Q1DA 1FFBA 3C8DA 1S7GA 3X43A 821PA 1KH3A 1R4ZA 5TLSA 4MV4A 3DKPA 3WLKX 3DVQX 1H2WA 1TLLA 2D7CA 2E4WA 2QJTA 2VA9A 3I53A 4PHHA 4Q1FA 3F3KA 3GJQA 5FTMA 4BFCA 5FUMA 5K4HA 3CZAA 2R6HA 5HQTA 2AYZA 4M7PA 5BN3B 2PRKA 3HXQA 1NMSA 1VL8A 3W9UA 2VK8A 3WRXC 1CEEA 4RJKA 4K9DA 1S3FA 4OHKA 1JT2A 4AYXA 4DM3A 3WGOA 1H42A 4MR9A 3BCSA 1X1EA 1EM6A 1KJQA 5LZ5A 5AR1A 3N6VA 5BUQA 2RI1A 4IJWA 1GG9A 1KDTA 1N6LA 2ZVQX 4UNNA 2GJ8A 1A2KC 1D1QA 1OFUX 1L5NA 1N1DA 2E1PA 1MB2A 1DO0A 2C2KA 2OG1A 2P4EA 2VT2A 2B1RA 2WOJA 2X42A 1TQ6A 5K09A 3RG2A 3VNRA 2D1QA 1K88A 3VR4D 4HNVA 4DZZA 1NI4B 4P4SB 1G21B 1ZD5A 3ST7A 3T3IA 2V3CC 1UBCA 1A9TA 3KP1A 4J7AA 3GCGA 4Q3CA 2J3IA 3KFXA 1QSGA 2YJ3A 3ETNA 4IDDA 4U2FA 4ZO6A 3GU3A 3SFZA 3KLMX 1CZHA 5A3SA 3I04A 1T9BA 4EABA 3T7SA 3HFGA 3OZRA 2D2EA 4NONA 5J43A 4H7FA 3EVDA 3ZWXA 3TW8A 4D41A 5MN5A 5F5XA 5UKDA 4NMLA 2XCTB 4BO4A 2ZJ0A 3B3JA 3O75A 3MS4A 3BH0A 2J9XB 3WJ7A 1RJWA 3GC6A 4A8PA 1XAHA 4KG7A 2R5NA 1FBNA 4IQ0A 5HK8A 5G1PA 4O4IF 1PW5A 1AO3A 1NQOA 2HWUA 3GARA 4QRIA 4WXPA 1EXWA 2V1UA 4W1RA 3ZVRA 1C4WA 1JPVA 1SWVA 2EG5A 1D0IA 1TU3A 2ZUSA 2QP3A 4G36A 2XVXA 5E1MA 2ISCA 4LTMA 4IZ6A 5AJUA 2YDYA 1DO2A 3PQ2A 3KQTA 3BF7A 5I7HA 4MNTA 3QYAA 2R47A 2FI1A 3FRIA 5FNZA 1PT5A 3BIFA 2X5JO 3B6EA 4TL8A 5E95A 7ADHA 4MB6A 1UIMA 4HLQB 2W2LD 4MUJA 5TPWA 3TOXA 3PFFA 4C88A 4C1NA 4M0MA 4YV0A 2OAP1 5ANRB 3ZR4B 5EN4A 3E7FA 4CLXA 4F11A 2PUAA 2ASVA 4IYJA 3QFFA 5C7IO 2AA3A 1H3FA 3AEUA 5KU1A 1B00A 1CDOA 3C7CB 1P33A 1IIRA 4DCCA 1QIFA 2GBLC 2JJ8A 4WN9A 2R85A 3KJHA 3ANYB 4LCEA 1BXRB 4MQFA 4ALIA 3EMDA 2B69A 3QPVA 4EJ6A 3HHEA 3EIOA 2H0RA 4YRPA 1GD1O 1MZPA 1LRLA 1NDHA 1KIFA 2ZI4A 1GYRA 2XBUA 2B98A 6LDHA 4JASB 2Y2UA 5AVYA 4J2OA 2NQ2C 3ADKA 4NYJR 5KYYB 1XCBA 3G1TA 2ZI6A 2ZBDA 1F5SA 1L5HB 2B4TO 2H4WA 2Y1GA 2GF0A 3HCCA 4TKZA 3UAXA 3TXXA 4C6TB 2BEWA 3L0IB 3GMIA 3M3HA 2EARA 5LZ8A 3ZY3A 4RTJA 1CJBA 2O5VA 1XCMA 5K6AA 4UUOA 1C3JA 3HKDB 5TNXA 3L7YA 3RSGA 1DXQA 1PL7A 4YX9A 5B58T 4NLLA 3U3DA 4RANA 5B7PA 4JEHA 4CLEA 2X9NA 3SI7A 1KO5A 4HLCA 3I52A 5JQGB 3LTNC 2H8KA 2TYSB 1G0OA 1EVYA 4OMFG 4QUGA 4FT4A 2F1KA 1I4LD 1USWA 3PHHA 1ISMA 3IPAA 4JITA 1GLVA 1UBHS 4N0EA 3W5IA 1RLMA 5J40A