1CETA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
305
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRLDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 305
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cetA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1cetA02
2BI7A 4DPLA 3P2YA 4PG8A 3WLEA 3OIFA 1J5PA 2AG5A 2C29D 3PK0A 4OL9A 4CQMB 2NUAA 4N5LA 4Z0TA 3VAZA 4E30A 1FDVA 2RHRA 1GZ4A 1MG0A 1I2CA 3G1TA 3H4VA 4FN4A 1F12A 5KNLA 3NUGA 2JFFA 3BMOA 3H5RA 1WDKA 2HRBA 3UGKA 4PG5A 3QIVA 2HCTA 2V65A 3DHYA 3RUCA 2D5AA 2J8ZA 3F9IA 2PD6A 3UXYA 1D7OA 2O3RA 5ENDA 4YT5A 4DVJA 4IDGA 1K6JA 1H93A 1UP6A 3PYMA 4W82A 1R0LA 2UAGA 2LDBA 3ITKA 1LQUA 2DUUA 1B8PA 1F17A 4OJNA 3ZV4A 4JP2A 5G0UA 3C7CB 4RVDA 4QEDA 3JQCA 1HXHA 2DFDA 1SEPA 2FHSA 3L4SO 1PWXA 3DBVO 3L07A 3WSWA 2Q4BA 3WGZA 5KJ6A 4J7XA 3TF5A 4YT8A 1UDAA 2I99A 4YRBA 4NBUA 2VWGA 3BMCA 1C0LA 3MJVA 4AFNA 2HK8A 3WMXA 1LTHR 3AM5A 2VQ3A 5L4SA 1D8AA 1U5AA 3AY3A 1HDXA 1LXCA 1U3TA 2DVMA 2J5RA 3MJSA 4UVDA 4IXWA 1GL3A 2P68A 4NJMB 2NU9A 4HKTA 4MDHA 3ZV6A 3UICA 1HEUA 2ZCVA 1LC0A 4OOEA 2Q1SA 2GNAA 5FF9A 1QLHA 4AJ2A 5JDIA 3DBRB 1E77A 1VL0A 5L40A 3HFGA 3RSHA 3C1OA 1CERA 1I01A 3F5SA 3ICPA 4JX8A 4BMSA 3CIFA 3JQGB 3EK2A 1L7EA 2DU8A 5GZ6A 2XAAA 4P4LA 3E48A 1E5QA 4UAGA 5TS3A 5H81A 4BNXA 1VC2A 2HU2A 4BO8A 1P77A 3QJ5A 4J6FA 3JCZA 2NQ8A 1CQIA 1KEPA 1DAPA 1UAYA 4L75A 1OC4A 4CM6A 4IIVA 3GN2A 4BQRA 2VUTA 3RJ9A 4Q3EA 4RQUA 4NFYA 4R1SA 3K5PA 2EJVA 1ZSVA 3PJFA 4GGOA 3QWFA 4O5OA 5TIIA 1MA0A 2GN6A 2IXBA 4YJFA 4U6SA 1ONPA 2ZB7A 4FD3A 5HTOA 1E6WA 5AYVA 4BO7A 3TQHA 1GD1O 1Y8QB 2HMUA 4L4XA 2Z1MA 4HBGA 2JHFA 3NKLA 2VHXA 3BAZA 4XYLA 4NI5A 4YJDA 1U1IA 2BRUA 5A3JA 1GUYA 1BSVA 2OXIA 4TZTA 1XWFA 2ZJ1A 3CMCO 3Q2KA 4I9NA 2AE2A 3RBVA 3BHJA 3KOUA 2P4QA 4EJ0A 1K2WA 2W8ZA 1VLLA 1HZZA 4WUVA 5ICMA 3VH1A 1ZSNA 2YY7A 2B37A 2ZB8A 2JJYA 1EE9A 3BZUA 4YWJA 1QV6A 4IPTA 3PIDA 3IAHA 3JQAB 2PZKA 4ZJUA 1EQUA 5C7LO 3TWOA 3S1LA 4OSPA 1XU9A 1DLJA 2I5PO 4RVFA 3LC2O 4K28A 4CLRA 1DJQA 4YAJA 2AQHA 3AFNA 3INGA 1MFPA 1NP3A 3V5NA 3OA2A 2PTGA 1HDOA 4GQAA 4B8ZA 5HRUA 3L4BC 4JJFA 1DC6A 4BNHA 5CDTA 4Z6KA 1MB4A 1U7TA 1Y81A 3U4HA 1WMAA 5IN4A 4XYBA 4ID9A 3KB6A 1YGYA 2O4UX 3UH1A 3IS3A 3WBFA 1A7KA 2JD1A 4TRRA 1PGNA 1JAXA 2QG4A 3LLSA 2DPHA 2B83A 2OGUA 3KHUA 3WFIA 1RYDA 3KYBA 4AJKA 3DFUA 2GCGA 3GPDG 4IMPA 3VH2A 4ALJA 1NVMB 2J3JA 2OHXA 4MVJG 3WG9A 2HJSA 3ZHYA 3BTUA 1OZAA 3DBRA 3GF4A 5T67A 1PX0A 3PHLA 1PJTA 3SJUA 1ULUA 2TMGA 1P1FA 2FSVA 1B0AA 3MJTA 4NBWA 5DCWA 2JFGA 3ZI0A 3PI7A 3JQGA 3TPCA 3GNSA 4AJNA 2Y67A 3GNQA 4YRDA 5I7FA 5C5IA 4JLWA 4XEHA 1JAYA 1U3WA 1EZ4A 2DBRA 3RFTA 4D3DA 1PJSA 3ULKA 4XWYA 2BF7A 2A92A 2EG9A 1UXJA 3DBHB 2BELA 2C82A 4MKXA 1HYHA 1F8GA 4W7HA 5AOVA 4AVYA 4IS2A 2EP5A 4JP3A 4DPKA 2FP4A 2OOSA 3PHJA 4YR9A 4K6CA 3L77A 2Y1EA 4RVGA 3C8MA 1GU7A 4XKJA 2ZQZA 3JD1A 2E4AA 5FFFA 5A04A 2VYVD 2VHYA 1R4MB 4UVEA 2VCYA 5B4UA 1PZHA 1RWBA 3I23A 4ALKA 3C7DB 1VJ0A 3DZFA 4D42A 1TT5B 3PWZA 1WDLA 3TL3A 2VOEA 1XKQA 3OIDA 3BA1A 3LSYA 5GZ1A 1Q0HA 3G49A 4MIYA 4XDZA 1QG6A 4JJIA 4PGFA 1WDMA 2WJPA 4OH1A 4QFCA 2Z5LA 1PJQA 1A9ZA 3L9WA 1VKNA 5G0SA 3C24A 1DRUA 4BNWA 1ZBQA 3RWBA 1U8FO 5DULA 5FI3A 3NT2A 5F1PA 4HFMA 3I9NA 1CETA 1IULA 2FPPA 1T25A 3ICCA 4I5EA 4RF5A 4IQGA 2DTXA 3R3SA 2Y1CA 3KLMX 4CM8B 4MVJF 5F1OA 3TNLA 4IY1A 3JQAA 3PGJA 2D0IA 4BV8A 4EITA 3GPIA 3OBBA 1DAOA 3EHEA 4BKOA 1KVSA 2D8AA 3ZW8A 2X0IA 5JDCA 4GLOA 2CDAA 4FDAA 2Y0DA 3PFFA 3Q3CA 3CZMA 2D5CA 4DIBA 4RL6A 3MCVA 4BO9A 3QWBA 4N5NA 3SLGA 1HETA 2O7QA 2YZ7A 4HFRA 3QE3A 1ENYA 2X5OA 1MXFA 1EFLA 1U5CA 4BV9A 2X8LA 3H2SA 1GCUA 5L7TA 1EBUA 5JLAA 1C0IA 1NVGA 3AW9A 3ZNNA 3MOGA 3DTTA 4A73A 4UVIA 4BNLA 2V7PA 1PZEA 3JQ8B 3RC2A 3Q6IA 2OP1A 4KQXA 4CM9A 2D4AA 5A9RA 4NU5A 5CEFA 1YRLA 3WGIA 2OBNA 3IMFA 3VPFA 3AFMA 2Q49A 2IYOA 3G1UA 1EDZA 4XQGA 2EGHA 4AJJA 1VL6A 1EBFA 4EDFA 5BSGA 1PGJA 2A94A 1SOVA 3PDJA 2EJWA 2AW5A 3WFJA 3VZQA 1P1JA 1W73A 5L51A 2NLOA 4HFJA 4MINA 4PLVA 3V1TC 1BXZA 2P5YA 3H9EO 5AQ1A 2X23A 2QYTA 1CF2O 1MGOA 2JD2A 5EMHA 2ZB4A 4O63O 4YJHB 1DHRA 2OO5A 4HV4A 1BXKA 3VH4A 2PKRA 2UYYA 1OMOA 1ZK0A 2IDZA 1KVUA 4MOWA 4RZIA 3U4DA 1XLTA 4WOKA 4A27A 1LA2A 4ALLA 3KTDA 5JY6A 1QSGA 3I3OA 4OXKA 2Q50A 1I0ZA 4WCFC 5KOIA 3ZNPA 3A14A 3PQEA 5IDQA 1GTMA 4Z9FA 1QORA 4I5FA 2O7SA 4ZRMA 5T8KC 4CLDA 4ZA2A 5CAEA 3WYEA 4BNFA 1W6UA 3FPLA 3I9OA 3R3JA 3DBHA 3LDHA 3WGQA 1YB5A 3ENNA 2EEZA 3RUFA 3ANMA 2G76A 5JMPA 1R6DA 1DC3A 3GGGA 1XQ1A 4GMGA 4XQEA 2B4RO 1JWBB 3S2EA 1J49A 4BVAA 3TL2A 5C37A 4GWGA 3RIHA 4Q9NA 1FMCA 3KYCB 1UXGA 4UVHA 1R4MA 1KVTA 3LU1A 1YL7A 1HLDA 4J3FA 4DREA 4HNGA 4M1QA 1LSSA 3QWAA 1SAYA 1TT5A 4QSMA 4RO0A 1YOVB 4RZHA 4CMJA 3OJFA 1ZK4A 4BS9A 4MVJH 1YL5A 3BHIA 3IC5A 4XR4A 2JFHA 4N54A 2NWQA 4ZN6A 3PPIA 3MZ0A 3NTRA 1G1AA 3DZJA 3HN2A 1DIRA 1LLCA 1MC5A 4DWVA 1HDCA 1EFKA 4J9UE 4I5GA 3FD8A 4DXHA 4R1NA 1U4SA 1UAGA 4XR9A 3O8QB 2FOIA 2HQ1A 2VNAA 1GEEA 4XIJA 3CH6A 4YQZA 3LF2A 4GX5A 4L8VA 4BGVA 3ZWXA 4LVUA 2Q99A 4WLEA 1IPEA 1DRVA 3T7CA 3L6OO 2FR0A 5C3MA 1NASA 3D7LA 1KEUA 4RV9A 2VHZA 5B4VA 5L9AA 4PLPA 1QMGA 3LF1A 4LCJA 4R3WA 2I9PA 4Q3NA 2ZTLA 1PJ3A 3DEYX 3DZGA 1JTVA 1FDUA 3UKOA 5A5FA 5A9SB 1E7WA 3P7MA 2YQ5A 5K0ZA 3HDQA 1QLJA 1D1SA 5JAIA 5KKCA 2BGLA 3B6ZA 1M66A 4XA8A 5DP1A 3JQ7A 1N9GA 4FBGA 1CDOA 2ZYAA 3JD2A 2EHDA 1Z45A 2AQKA 5A3VA 2AEJA 2R00C 1VJ1A 4JK3A 1ZO8A 4H15A 1ISJA 3GUYA 2ZTVA 1T2DA 3B70A 4FQ8A 2GPTA 4Y6SA 2BMAA 3GVIA 4LK3A 1WPQA 2AMFA 3D3WB 3D5TA 1QYDA 5IF3A 2C2YA 3E5MA 4JBGA 2QHXA 2B69A 4G2NA 4IDFA 1AN9A 3W6UA 3H9GA 5ADHA 4BKUA 2B5WA 2QZZA 1ADFA 1T4DA 3IDSA 3OQ6A 5L4LA 5COAA 4EI2A 2Q2VA 1UDCA 1XQ6A 2OUIA 3GZNA 1MXHA 2FZEA 4JNKA 1H6BA 3OMLA 1QYCA 1YB1A 2GGSA 2FR8A 4XCVA 4GWKA 3IL2A 3E5RA 4WEQA 3B1KA 4GGPA 4LISA 3T7EA 2POQX 3JD0A 4JROA 4BGUA 4P8RA 1NQOA 3KYDB 4IJWA 1IB6A 5CP8A 3OICA 4KP7A 1HE2A 1QXSA 3TSCA 2IEBA 4WNCA 4YVFA 2VOJA 5A06A 2NSDA 1MP0A 2G1UA 3BYZA 3I9LA 3O03A 3ZWOA 3BMQA 4D44A 3ROKA 1OBFO 2C7VA 1LDNA 2YQ4A 1ZMOA 3AK4A 2J5QA 4B3HA 4GI2A 5AXCA 4Q3BA 2JKVA 3DONA 1GY8A 1BW9B 4ZICA 1AHHA 3AI1A 3GT0A 3RUEA 3IP3A 2QZ9A 3WTBA 1LUAA 1GZ3A 4EGFA 4C7KA 4E31A 1PIWA 1RJWA 2Y68A 2X0JA 4O1MA 2PZJA 4F6LA 1M6HA 4BO1A 5BQFA 2J5KA 5TJHA 4CV1A 4JBIA 4IBOA 3QVOA 1XGKA 2YFHA 3QWHA 3RASA 4CL3A 1BVRA 1P45A 1GPJA 4IDCA 1UP7A 3QP9A 2BFOA 3V2GA 4BO6A 1ZW1A 2DTDA 4BNMA 4CV3A 1O6ZA 3MTJA 2ZYGA 2VNSA 3PXXA 3ZNOA 1IL0A 3R0IA 3FNEA 1I2BA 1JWAB 3O8QA 1QYXA 3PYXA 3WOHA 4R4JA 2WSBA 5H83A 3HWRA 4Y67A 1C0PA 3TFQA 4IS3A 4Z9XA 3UF0A 1GV1A 1WMBA 1X1EA 4CQLB 1IHXA 2BKAA 4NDNE 4HY3A 4TRNA 4RPJA 1E7SA 1TVEA 1CWUA 3OHSX 4MP3A 1KVQA 4OXNA 1TI7A 2P2SA 1FF9A 1K89A 4MP8A 5JXWA 5A9SA 2GZ3A 3D4NA 4R54A 3S2GA 5B1YA 5JW6A 3EVNA 2GZ1A 4ILKA 2Y0CA 3E9NA 4RQTA 5AXAA 2WYVA 3RUHA 4R1TA 5TT1A 1ZEJA 3GA0A 2O50A 1KEVA 4E5KA 1KVRA 4GSKA 5BT9A 2C7GA 1P31A 3F6YA 5IJZA 1KERA 1DLIA 4ITUA 4RVHA 2XOXA 4R69A 1XYGA 1MFZA 3OQ1A 1FXSA 4GLLA 5DBIA 3SEFA 5T8KA 3B20A 4GH5A 5B4TA 1ZZEA 1KIFA 2WDZA 3BHMA 3JD3A 4BHTA 4ALNA 2W4QA 1P1KA 1OAAA 2IODA 3PHGA 3O26A 4Z3KA 1CYDA 3PHHA 1LC3A 2OP0A 2QQ5A 2P4HX 3G79A 5G0WA 4AJIA 3E1KA 2V6MA 2Y99A 3JSAA 3NYWA 5TJ9A 1IUKA 1KY4A 4YPOA 5DT9A 2GDZA 1JKJA 2NTVA 3JQFA 4KQWA 3WNQA 2YJZA 1I24A 4NFSA 1ZK1A 5CG2A 5JO0A 2B5VA 1QKIA 1PQWA 1XEAA 1ZH8A 3SBOA 1GV0A 3IP1A 1DIAA 1SMKA 2X6TA 3WYCA 3N58A 3S2IA 1XHLA 4BGIA 4IXTA 3VC7A 2O23A 1V3VA 5DDIP 4JJGA 2W2LD 4NBVA 3QHAA 4QX6A 2NU8A 4ND4A 3W4IA 4G5HA 4FJ0A 4GSLA 4DYDA 1LSOA 2NACA 1LDGA 2D2IA 4R9SA 3ITDA 4HUJA 4TZKA 1OFGA 3NDRA 5AXDA 1X7HA 2CZCA 3AUAA 1IZ0A 1BW9A 1P44A 2JAPA 4F45A 2XF8A 3QVTA 1A27A 1A4IA 2NQTA 1L7DA 2W90A 1N8KA 1HKUA 1VRWA 4ND5A 2VRCA 4LSWA 1XU7A 3AJRA 4BOYA 5K6AC 1BXGA 1GCOA 2WD8A 2ILTA 4L0QA 4BNUA 4K6FA 2FR1A 3DQPA 3JYNA 2GSDA 5L45A 4FR5A 1ZK2A 4IM7A 1V0JA 4NBRA 1GFSA 2FWMX 4B7UA 2O2SA 2WWRA 4BNYA 4BO3A 1E7RA 3AOEC 3ETEA 2CVOA 3NTQA 3LVFO 4R68A 5COBA 4CM7A 4Y9DA 2R00A 4NIMA 1ZCJA 4B8WA 1E7QA 6LDHA 3ZN2A 1Z73A 3ONEA 4CQLA 3OIGA 3EZLA 3I6QA 1HSZA 1KC1A 3FCOA 3PLRA 4G81A 5ILGA 3KVOA 1GUFA 4TWRA 2ZJ0A 1A4UA 3NRCA 3V2HA 2W2KB 3RKUA 5KVVA 5A4DA 4CJXA 1C1DA 1CEQA 3KSDO 5JDCC 5IFLA 2RHCA 2HAEA 4ND2A 3NJ4A 5FI5A 5G4KB 1TA4A 4NR0A 3WQRA 4GVXA 4OAQA 4Z3DA 4D0RA 1QP8A 5T6BA 3CPSA 4S1VA 2EWMA 3S55A 3MTGA 1GDHA 1ZMTA 3GVXA 3AUSA 3KXDA 3TDKA 4IUYA 4I8XA 5JNLA 1ISFA 2DT5A 3RI3A 2QW8A 5T57A 1UH5A 1UUFA 4IQ8A 1Z75A 3F4BA 5CEEA 2HLPA 2JCYA 5ICSA 1DIHA 2Y1DA 2OFPA 2NVBA 2Q3EA 4CLXA 1LI4A 1IY8A 4D0SA 1X7GA 1E1MA 3M2TA 2PR2A 4UEJA 2R2GA 1BWSA 4M54A 4MPDA 4W99A 3KM0A 3WWZA 3OP4A 4CLOB 4F6CA 1SB8A 2X0NA 4B7CA 3P5SA 3BTSA 1YJ8A 3NDJA 1HWYA 4FW8A 3PJEA 4W7IA 1B3RA 2BI8A 4NZ9A 4Z0PA 2DBZA 3I9MA 2OMEA 1KOLA 1E1LA 4EUEA 3EY4A 3HJAA 3LT0A 2H6EA 2FSSA 3WWYA 2VUSA 2JL1A 1H6CA 2CF5A 1G0OA 4RVUA 3R6DA 4Y8VA 4WLNA 3HHPA 3I4FA 4D46A 3FF4A 1FDWA 5B12A 4CQMA 2V6GA 1KYQA 5KTKA 3FWNA 4KMSA 5FWNA 1T2CA 5KVCA 2DQ4A 1GYPA 4UEKA 1FJHA 5I7EA 2VZ8A 1NFRA 4R5MA 4WKGA 1U9JA 3DBLB 2QRJA 2ZK7A 3BIOA 3CSDA 3AM3A 1R0KA 2NM0A 3Q0EA 4J16A 3RC9A 1NAHA 4BNKA 3L0DA 4MVJA 5JYDA 4HWKA 3FHLA 1Y7TA 2PFGA 2YW9A 3KLPX 5IZ4A 4HADA 1WNTA 3UUWA 1B14A 3E9QA 3WDSA 4FC7A 4ND1A 3ZH2A 1H6DA 4PRKA 3PJDA 4LSMA 4XX0A 4D43A 4DLBA 4WGGA 4RGBA 4E33A 3QVWA 3RFVA 2P9CA 1KETA 2HKIA 5A05A 3H7AA 1UZMA 3ZU3A 4E5MA 1G6KA 2EKLA 4EJMA 5CPFA 1Y6JA 5T64A 5JAZA 1YONA 3NAQA 4LGVA 4CMKA 4L9RA 4I9HA 1I3LA 1UXKA 4OIMA 4OKIA 2W2KA 3MJCA 3H9JA 1GQ2A 5THKA 1H2BA 2UUOA 3UCXA 5DP2A 1W0CA 2YUTA 1NPYA 3ST7A 5IDXA 5I8WA 4GAEA 5G4KA 1YQXA 4NJMA 2CMDA 4PVDA 4XJSA 5U4QA 4A0SA 4A7PA 3WB9A 2DUWA 1Y8RB 1GQYA 4D3FA 4YQYA 4CV0A 2DFVA 3DOJA 2ET6A 5KIAA 2AEMA 3FSRA 4XZ3A 1C1XB 4YACA 3GEDA 4K26A 4MKRA 2J3IA 1OC2A 4J7CA 5CDGA 3AU9A 4DC1A 3U4IA 3DMYA 5I9MA 3DO5A 4DMLA 5EL0A 1BG6A 1AXGA 1NPDA 3O38A 4J2OA 4KTVE 2O3QA 4PLZA 4R1UA 4F3YA 3DTYA 3PHIA 4U7WA 1RPNA 3I52A 4YYZA 4OOFA 4QO7A 2I3AA 4G65A 3UVEA 3EDMA 5MGBA 2WM3A 1H0KA 1YVEI 3WQSB 5F21A 3W8DA 4BKQA 1B16A 1ML3A 5EESA 3VHRA 5K6AA 4XQCA 1YQGA 3E8XA 3CINA 2HMVA 3W8FA 4DL9A 1DDOA 3U0BA 3QY9A 4CLHA 4QFDA 3TRIA 1E7YA 1SEVA 5BSFA 2HMTA 3HDJA 3JQBC 3F46A 1YBAA 1E3WB 1PS0A 4ALIA 3QV1A 4PLTA 3RUIA 4NBTA 3KO8A 1Y8QA 1Z74A 4M89A 3O4RA 2UUPA 3GRKA 4XD2A 4XYEA 4QT0A 4YAEA 3TZKA 3KETA 4E5YA 3AOEA 3PFWO 2CVQA 4GX1A 1ADCA 1HLPA 2VYNA 4J0FA 3K31A 4II2A 3RAJA 4JGBA 2QYSA 1SC6A 3ON5A 4WNIA 3DHEA 4FOOA 4KUEA 1PJ2A 4TVBA 5F3RA 3NV9A 2Y93A 3EMKA 5KVQA 3V8BA 3LT2A 3GVHA 4WEOA 1AXEA 2D3TA 1QRRA 3IJRA 2X5KO 3VZPA 3HADA 3DBLA 1UXHA 2C5EA 4J4HA 2YV1A 2RCYA 1U2GA 1N7HA 3AOGA 3JQAD 2VN8A 3ZWNA 2X0RA 1YDEA 2NTJA 4YAGA 3TZQA 4WLFA 4CMIB 4B4OA 4FOSA 1EDOA 1PU2A 2Q1TA 2FY8A 1B15A 4DRYA 2VHVA 1W4ZA 5A03A 4TKLA 4DGSA 3NT4A 3VDRA 3ZHBA 1P0CA 1GUZA 4DA9A 4EEZA 3GN1A 4U5QA 3RQSA 3EUWA 3Q9NA 1Y9AA 2D1YA 3C7AA 4MKZA 4HX5A 1SBYA 3HNPA 3WMWA 1A71A 2NU6A 1SCUA 2VTEA 2X86A 1DPGA 3KSUA 3UHAA 2XPCA 4CM9D 4FFRA 4DLAA 3GGPA 2VZ9A 4KUHA 2EW2A 4R16A 2C2XA 1U2DA 4UEOA 1SB9A 1C0KA 1I3MA 4YAKA 1ISGA 3HG7A 3PP8A 5I7SA 4J1TA 1Y8RA 4TRMA 1ENPA 2UVDA 2Y66A 3CTMA 4YRAA 5ITWA 1X13A 3LK7A 1LU9A 1NTOA 3H5NA 3LYLA 2FN7A 1HT0A 4YAIA 4XGIA 1ISMA 5ER9A 2EV9A 1IOLA 3FBGA 3VPXA 4P38A 2NV6A 4TKMA 2HUNA 5I8ZA 4XGKA 4RVSA 2PH3A 3DR3A 1ZK3A 1BMDA 1DC4A 2SCUA 3ANLA 3CZRA 2WEKA 1PZFA 1T1RA 1V3UA 1WWKA 2PA3A 5JCJA 5L3ZA 4BMVA 4E21A 3LQFA 1B2LA 1D3AA 2EIHA 3K96A 2PY6A 1PQUA 1YL6A 3AUUA 1PWZA 4DC0A 3JQFC 2AQ8A 5KJFA 3DZIA 4JBHA 1SOWA 1XIVA 1KS9A 3BXXA 3GK3A 4BKPA 5T5QA 3PRJA 1ULSA 2PD3A 3OQBA 5JPIA 3WGGA 1MG5A 4HNHA 1H94A 4CM3A 1O94A 4ALMA 1E3LA 2O4CA 4E2WA 4FFLA 4J90A 5JE8A 4XRRA 4J4BA 4FJ1A 5G0VA 3LZ6A 1LRJA 4BNIA 4RPGA 4LW8A 3FN4A 3WBBA 4ZU3A 1P1IA 2P5UA 2P9GA 5G4LA 2X22A 3N7UA 4NK5A 4CM8A 1E7MA 3OH8A 3WJAA 3QRWA 1K6XA 4OKNA 1ZXBA 3BMNB 3SXPA 2AQIA 2WE8A 4Q3DA 1PJ4A 2QX7A 3QVSA 1NHWA 3DL2A 3GDGA 4RCVA 3AUTA 4CMIA 3ONDA 3INRA 4DQVA 3JTMA 4A5OA 2J3HA 4E12A 2DM6A 1YO6A 4YT2A 3FNGA 2X7HA 2PKQO 4JN6B 4UUNA 3RJ5A 4EEXA 4N18A 5GY7A 1BDMA 2HJRA 3AI3A 3NGLA 2JD0A 3JQ8A 1H6AA 2AHRA 1NR7A 2YHUA 3EC7A 3LLVA 5COQA 5DBGA 1JQBA 1UZLA 4GVLA 3ROPA 4E2YA 1Q1NA 1EVIA 3U5TA 4OGWA 1PL7A 2GASA 3JYLA 2WD7B 1NR1A 4J4TA 2Q1UA 5IAAA 1DC5A 1RM5A 1JKFA 3EW7A 2ZTUA 4PVCA 3QWIA 4R9RA 1YS4A 1Z7BA 3U9LA 3VPGA 1M6WA 3F1KA 2DLDA 2PGLA 5BSHA 2HO5A 4Z9YA 3L6EA 4RPHA 1O5IA 1YJQA 1E92A 3D3EA 4YJHA 5LDGA 2B35A 3JQBA 1DFGA 4CR6A 3WX0A 4DBVO 2X58A 3VTZA 1XG5A 4URFA 5K9ZA 1N1EA 4EUFA 3ORFA 1PGQA 1SO8A 4XYGA 3RC7A 3EAGA 2PKQP 3VTFA 1F14A 1EK6A 1DIBA 2WE7A 2W98A 5CG1A 3D5QA 4M55A 1T26A 1I33A 1TEHA 1NQAO 1Q0LA 4PZDA 4IMRA 4YT4A 1KEWA 3IJPA 4NK4A 3DB2A 4CV2A 3VVCA 4PLWA 2G17A 4E0BA 4FC6A 4ZQBA 1O89A 2EXXA 4MIOA 3KYCA 1E6UA 1V8BA 2BGMA 3PZRA 9LDBA 3AM4A 1HSOA 4B4UA 5L4NA 2DBVO 4K1LA 1GADO 4TROA 4EJ6A 2WTBA 3KRTA 4OXYA 4GX2A 1YOVA 4LRTB 4RORA 3TZHA 2AA3A 1ZXLA 3JYQA 1K3TA 3D1LA 4TRJA 1T2FA 2BFMA 1DSSG 3AY6A 1BVUA 1DIGA 3M1LA 3H8VA 1NPTO 4BNZA 4AG3A 5JS6A 4JXKA 1NWCA 1R16A 5TSDA 1J0XO 3W1VA 4AJEA 5DF1A 4YA6A 2I76A 1EUCA 2PGJA 1D1TA 3KEQA 3MWEB 3O9ZA 4NQZA 5TQVA 4ZQHA 4JQCA 4Y6PA 3BTVA 1WVGA 1C14A 3DDNA 5HA5A 3BMOB 1NQTA 2X1HA 1BRMA 1KY5A 2CSUA 4KWIA 2C59A 3QW2A 1RM0A 3HB5X 4MVJE 4UUPA 5CDSA 4BO5A 1ISHA 1N1GA 4NU6A 1TLTA 3E9MA 1YBVA 4UULA 4ESOA 2GR9A 4YJGB 2FZWA 2Q4EA 1LDYA 1MUUA 1V6AA 3VVBA 5MDHA 3D4PA 3I6IA 4J2HA 2Y1OA 3K9QO 1HE3A 4FGSA 3AI2A 3TJRA 3U4CA 1K5HA 1A72A 4R01A 2AE1A 3ZV3A 4RF3A 3A28A 1DB3A 4W9NA 2PV7A 3SJ7A 2CDCA 3E6AA 4LVCA 4UVGA 3MJEA 1ENOA 2AEFA 3OJ0A 2CY0A 2NVUB 3VZSA 1I30A 4MJLA 1H2HA 2WYWA 2NNLD 4GL4A 3TZCA 3OA0A 4M49A 2V6FA 3OF2A 3OM9A 1YB4A 2WD7A 1IPFA 3D3WA 1I3KA 2PZMA 5DNAA 4UREA 5EQFA 1SZJG 1YH3A 4CR7A 3M2PA 3BTOA 3GQVA 1ADBA 1UDBA 5TF4A 2ZCUA 3H3FA 1N92A 2GUGA 3COSA 3MOIA 5L7YA 3VOSA 3HFSA 5G2OA 1LJ8A 1M75A 4KOAA 5JFOA 2AG8A 2EW8A 4O6VA 5BNIA 4PG7A 1I2ZA 5IDYA 5KWEA 1X15A 5HBRA 2CFCA 4DTIA 1U4OA 3PQDA 4YDRA 1E3JA 3A06A 1RYEA 4J43A 3OJEA 1E6EA 2PZLA 2WYUA 1H9BA 2ZTMA 4IJVA 4ND3A 3IUPA 3KYDA 1JLLA 2ZKLA 5ENVA 2I66A 3RUDA 3E18A 5F1KA 1Q0QA 1EUZA 2IE0A 3DOOA 3ZU5A 2BGKA 2OL4A 4CMGA 3K2BA 3QVXA 3Q11A 4BNVA 4H7PA 1G0NA 2PNFA 1H5QA 1Z82A 4CPDA 2YV2A 2Y1FA 3GMDA 4OQYA 2CF6A 3ZWYA 5HS4A 1PS9A 3F3SA 4RPKA 4CMCA 2VT2A 3ZHZA 4AJPA 1H9AA 2BH9A 5EN4A 1GR0A 3GHYA 1ORRA 3QSGA 3TN7A 5JYEA 2TMDA 2YV3A 3B1JA 4K9DA 4BNTA 2GYYA 3LT1A 4BO0A 4PRLA 3K73O 1V3TA 4YJFB 5IDWA 3GRPA 3NGXA 3DAPA 3UOGA 6ADHA 3JYOA 2GO1A 2I67A 1YE3A 3K92A 3ENKA 1X0XA 3GFBA 2VRCD 3T4XA 3WTCA 1PR3A 2Y0EA 2IEDA 2J6IA 2E49A 3WGHA 3K2EA 5DZSA 2X9GA 1NBOA 3ZGYA 3JQ9A 4FJ2A 2X5JO 2OBYA 3INTA 1HZJA 3WXBA 3ZCXA 1PR9A 5TX7A 1QYVA 4PLCA 1LBEA 4ZQFA 2A35A 1ARZA 3RBXA 4ONEA 4CR8A 2GERA 1ENZA 2XXBA 4JIGA 1PL8A 3DAFA 2Y05A 3DFZA 1VE9A 5ES3A 4M8SA 1KBZA 2VWPA 4Q39A 3M1AA 2CNBA 3CMMA 4CLRB 3B1FA 2HMSA 2A9FA 3F1LA 4YJGA 3WQQA 3N74A 4QQRA 3SC4A 1R37A 3RU9A 4QTZA 3W4KA 1JVSA 2A4KA 3NJ8A 4YTEA 2H63A 4CUZA 3DWFA 5TT0A 2O2YA 1CRWG 2HRZA 3A9WA 4R3NA 1ZVMA 2C0CA 3E82A 1PJCA 2NVUA 4KTTE 4L4RA 1NWHA 5TLSA 3G0OA 4J91A 3CXRA 3DXFA 2RAFA 4YEDA 2NVWA 5LC1A 4D45A 1M2WA 1C3VA 3LC1O 3ZU4A 4DMMA 4ZVVA 4RDHA 1P74A 5JMWA 1WZEA 4INAA 3A1NA 4QXMA 2OZPA 2X9NA 5AVOA 3PZBA 4X54A 1LQTA 3PLNA 1KC3A 5JC8A 3OECA 2VT3A 4J0EA 5IG2A 1NM5A 1XSEA 4F46A 3AU8A 1T4BA 3OJOA 3TOXA 1P3DA 1UXIA 3A4VA 2UDPA 1HF3A 4KDEA 4BUCA 4E4YA 1WLYA 2E6UX 3ZWMA 3JQEA 2G82A 3IOYA 3PWSA 3P2OA 3V1UA 3UFXA 1JN0A 4W4TA 1EE2A 4FGWA 3GLQA 1J4AA 3EZYA 1U3UA 1EK5A 4L76A 3WYBA 5FEUA 1K6IA 3UW3A 1XCBA 1XR3A 4WJZA 3EVTA 1O9BA 4BKRA 4IGEA 2E48A 4E5NA 1FDSA 1ONNA 1TB4A 3FRJA 3W6ZA 4J1SA 4BGEA 1ZKMA 4NHEA 3ZNQA 4P22A 3DOCA 1Q7CA 3V2UA 1Y9EA 4ZQGA 1GAEO 4IZIA 5JBIA 3RUAA 1PZGA 3IIEA 4XB2A 5JAMA 4GKVA 1U28A 4TQGA 3NEPX 4RJTA 3OJLA 5F5NA 1MV8A 1E1KA 5B37A 1EVZA 2C07A 3WNVA 5A9TA 3D4OA 3WIDA 4BNGA 4CQMD 1R12A 4CLEA 4DQXA 2BLLA 3KZVA 1JW9B 4B7XA 4XIYA 1A7AA 1P0FA 2HK7A 1DOHA 5J23A 4WCDA 1PSDA 1QV7A 4IQ0A 3DMTC 4WE3A 4YB8A 5KVSA 2EF1A 3ZWCA 3UCEA 4HP8A 4DUPA 4MVJD 2B4QA 1EVYA 2C5AA 1DXYA 1HDYA 2DC1A 1HYEA 3F4LA 1PJLA 7MDHA 2B36A 4LN1A 3GZ4A 4NJOA 4PN3A 2PK3A 3ZWWA 3RBZA 4WECA 4UUOA 1N7GA 4R51A 4PLFA 3OFSA 4OO3A 1BHSA 4XYMA 1I3NA 5TC4A 4LMRA 1MX3A 2HMWA 4AL4A 4PG4A 3QA9A 5EQDA 3FR8A 1VI2A 4I9UA 5IZCC 4ZHSA 1JDJA 1AHIA 1Y5MA 3NDIA 3U49A 1P33A 1GYQA 1ZFNA 4BB5A 1IYZA 4IJUA 4OSOA 1YQDA 3ZHXA 2Q1WA 1LSUA 2GN8A 5KJEA 3H6KA 3RCBA 4IGFA 4DBZA 4WPGA 3HDHA 3PWKA 3UAGA 1I5RA 5BNFA 3KSZO 4Y6RA 5L95A 3ZWPA 5C7OO 1HTBA 3H9QA 1JA9A 3HN7A 3MEQA 5IN5A 1RKXA 4BO2A 5IXSA 3HQ4O 4BNJA 4ZGWA 2CUKA 3GAZA 3PQFA 4ROSA 2I3GA 4H16A 4PLHA 2O3UA 3GG2A 2V6BA 4J1NA 4XJTA 1CJCA 4BQPA 2DTEA 2PWZA 1AGNA 4BMNA 4RLSA 1DO8A 4CLOA 4CMEA 4U8GA 3GMSA 3ZZNA 3Q9UA 3VKUA 4B4WA 3FWZA 1PQPA 3P19A 3PDUA 3IKVA 1WXDA 4W6ZA 4XQ9A 1GYRA 1ZJYA 3K8ZA 3FBTA 3HZZA 3GR6A 1LRKA 3ROQA 3U09A 4RLHA 5BSEA 3GNTA 1ZJZA 3OEYA 4CUJA 1IHYA 3AWDA 4CL8A 1BGVA 1U8XX 1X0VA 2FMUA 2VYVA 3DAGA 5KCZA 4NFHA 2GLXA 4HFNA 3RD5A 3GH3A 2GD1O 3DC2A 4NNJA 2VYND 4RDIA 5G0TA 3GEGA 3DZHA 4FFOA 4FPXA 3RFXA 1HDGO 3C1TA 1O95A 1R15A 1ZEMA 5DCUA 1TXGA 2NADA 2QIOA 1LLUA 1O0SA 4E3ZA 3NTOA 3E03A 5TGDA 4BNNA 1UP4A 4LMPA 3W8EA 3JQ6A 1DFHA 5TNXA 2JHGA 3V1YA 4L4SA 2B0JA 3ZV5A 2PLAA 3ZU2A 4DYVA 1PEDA 5CEJA 1NX6A 1W8DA 5CPBA 1HRDA 3DZKA 1VJTA 4LCEA 2ZB3A 2PGDA 4IINA 5HM8A 1DRWA 4E2XA 1NYTA 4IIUA 4LRSB 1Q7BA 4OQZA 3IUSA 1DFIA 2VWHA 4GBJA 3U62A 3CE6A 5C7IO 3C3XA 1SPXA 2BHLA 3H5AA 3D0OA 2VUUA 4B4VA 2ZATA 1DJNA 4IDDA 5EJ2A 2NU7A 4N5MA 4PLYA 4MIEA 5H82A 3WLFA 3IKTA 4AJHA 3WGOA 3GEMA 1GZ6A 4R41A 3KEOA 1CIVA 1Y5RA 4EW6A 3I9JA 4RF4A 2C20A 1E0DA 3C1AA 4QUKA 1LDBA 3W4JA 1FDTA 3VZRA 5ER6A 4A26A 1MC4A 2HSDA 1R4NB 4FIZA 3PJGA 3WS7A 2O3JA 4I1IA 2ZQYA 1TT7A 1VSUA 1A5ZA 4H3VA 3H3JA 1E1NA 3GFGA 5DBFA 1WP4A 2H9IA 2E37A 2O3TA 2P9EA 3JQ7B 1N9GB 3TOZA 8LDHA 1V9LA 2WMDA 2YDXA 3WJ7A 3HB4X 1SNYA 2VRBA 2Z95A 4PZEA 1Y1PA 5BR7A 3KUXA 2Y1GA 1DHTA 1C1XA 3C85A 5U9CA 2YFQA 4MVJI 4PIVA 2EKQA 1R66A 1OOEA 3FTPA 2VZ0A 4PZCA 1ISIA 5U1PA 2O3SA 3DHNA 1I36A 4U0KA 1T2AA 4AJ4A 4AJOA 4L73A 4W9NC 3WICA 2HDHA 2QRLA 4DIFA 4NH4A 3G17A 5I9LA 2GF2A 3H65A 4KZPA 3R1IA 1FK8A 3GG9A 1YXMA 4II3A 1EUDA 3ZW9A 2O48X 4AICA 3GZNB 1A9YA 3I1JA 1X14A 5TRTA 3G3EA 3KBOA 4Y98A 4BO4A 4M86A 5JCXA 1WAMA 3HUDA 1S6YA 2D59A 2GRAA 5I7VA 3LC7O 1HDZA 3ROMA 2QRKA 5JCJD 2Z1NA 3GHHA 2Q2QA 3RVDA 4MP6A 2Q46A 1E3IA 1E3WA 3OETA 3Q2IA 3DMTA 1M67A 5AXBA 3DZBA 3L9XA 2F00A 1EQ2A 1Q2XA 4B3IA 3ZWAA 2EKPA 1UR5A 4XDYA 4XRGA 4D3SA 1VSVA 3PIIA 3BMQB 1LEHA 2ZYDA 2RH4A 3WSVA 2PH5A 3PYLA 5CHEA 4A10A 4MVJP 1XA0A 2IZZA 3ONFA 1S7CA 1RM4A 2CDBA 4Q3AA 4C4OA 2B4TO 1F06A 5DCYA 4D7AA 8ADHA 1LLQA 4EUHA 5IXYA 3NT5A 5CFZA 4OM8A 3NX4A 4O0LA 4FSHA 1JKIA 4IDEA 3OEWA 1XDWA 4BIIA 5JC1A 2HK9A 1IE3A 2GN4A 2BFPA 3QQPA 5BNTA 5IZCA 1HE4A 2RH8A 3UCFA 5HWSA 1ZNQO 4BL5A 4JCOA 4GMFA 1IZ9A 4U0JA 4TVOA 1ID1A 4BB6A 4IDBA 1B8UA 3L4BA 1PGOA 5L7WA 1YDWA 1UJMA 2Q45A 2X9VA 4EZBA 1VPDA 4A03A 1O8CA 3RROA 3KV3O 1N5DA 4HXYA 5GMOA 3M6IA 3FPCA 3ABIA 1NAIA 4OMUA 4CODB 3Q1LA 1M76A 5I9NA 3JQ9C 4NG5A 5KJ1A 1NXQA 2JAHA 4U6QA 5A02A 4M87A 3RU7A 4CMAA 3WGTA 4XB1A 3WGYA 3F5QA 4NMHA 4FFNA 3IQDB 4J9VA 5LCXA 1R4NA 2C54A 4NPCA 1J6UA 1WW8A 1QYWA 3VPHA 3HE3A 5JSFA 3I4CA 4C7JA 2I65A 3HDYA 3AY7A 1Z6ZA 4CMHA 3ZWBA 2I6TA 4DPMA 3ADPA 5EINA 1T1SA 2BD0A 3JQDA 1N2SA 2LDXA 3I9KA 4PG6A 4RPLA 4WCFB 4WOJA 4I5DA 4AJ1A 4CM5A 1I32A 1NQ5A 1T2EA 4IJKA 4B3JA 2OORA 4L74A 1HL3A 1MLDA 3STHA 5JO9A 4CM4B 1LRLA 2YHIB 4D79A 3VKVA 2E82A 1P1HA 5CDYA 3PEFA 4J1QA 1L1FA 4Z0HO 3WIEA 3D64A 1EMDA 1I8TA 1E3EA 1HYGA 1ZUD1 4XGNA 5DOVA 1V35A 5GZ3A 5JY1A 1LDEA 1X7DA 3RKRA 2IZ0A 4A2CA 4KUGA 3ASVA 2IRWA 3CEAA 5JDIC 2J3KA 3H9UA 4FFMA 1BTOA 3I5MA 4J49A 3VH3A 3GDOA 4ZRNA 3JD4A 1AUPA 4DIOA 3LT4A 1OI7A 4WLOA 5A1TA 4Q3CA 5EERA 4E5PA 3GY0A 2DKNA 3VDQA 4R5HA 1YWGO 3GAFA 1GEGA 2RIRA 1ADGA 1HE5A 1HDRA 2AXQA 2DAPA 4ZD6A 3X2FA 3K30A 1CQJA 3CKYA 3SX2A 1ZSYA 1GQQA 3SLKA 2XXJA 3WR5A 2H1SA 2CVZA 3ASUA 1Q7GA 1RM3A 5EPOA 1P9LA 1B8VA 3ZDFA 4N7RA 5ILOA 4EBFA 4IDAA 1JU9A 3OSUA 2IZ1A 2BFAA 1E5LA 2NTNA 4RF2A 1YBMA 4UUMA 4P4GA 4E6PA 1BXGB 3ANNA 4DLLA 4E32A 2VWQA 2IYPA 4MVJM 3UN1A 4GPD1 1LDMA 1VM6A 2EERA 3ETGA 3BMNA 3L6DA 1EVJA 1LNQA 1F8FA 3GOHA 4B79A 2FPIA 4GX0A 5LDHA 3T4EA 1K0UA 2F1KA 1DBVO 1D4FA 1NVTA 1ZIDA 3FR7A 4MO2A 5JAQA 4WLUA 1QR6A 1ONOA 1R0SA 1WZIA 2FRDA 2DBQA 4PCVA 4EYEA 4J7UA 3FNFA 3PVZA 3U3XA 4ZQEA 1U7HA 3TFOA 3I83A 1P1RA 5FYDA 2UV8A 3JYPA 5KKAA 3TZ6A 9LDTA 1PS8A 3ADOA 2CD9A 2FPGA 3EGOA 3K6JA 4WLVA 4FCCA 2G0TA 2ZIZA 2G5CA 1Z7EA 5DN9A 4FB5A 5A5EA 1I10A 4AJLA 3BMCB 5L53A 1NFFA 2EGGA 3SVTA 4S3MA 1T24A 3MWDB 3CUKA 3FI9A 1EEHA 2YYYA 1VKOA 1AE1A 4OHUA 1C1DB 2R6JA 4WASA 3S8MA 2PD4A 4YCAA 4P4NA 4FS3A 4PFJA 4D41A 3PTZA 2JCXA 4YXFA 4TMFA 1PL6A 4YBZA 4WCFA 1JVBA 2DPGA 5ITVA 1X1TA 4CMBA 4IZHA 4QECA 3F47A 2IXAA 3GDFA 1NNUA 3H2ZA 4TSKA 5HS6A 4FFPA 2RBEA 4KDFA 3VPSA 1PJBA 4I08A 2EP7A 1XELA 2P91A 2H5LA 4CM4A 3SC6A 2YHIA 1NHGA 1VL8A 2GZ2A 3FNHA 1LLDA 1GPDG 3JV7A 4CUKA 1U3VA 3GVPA 4DQUA 3GUCA 3ETDA 1B7GO 2X4GA 3EYWA 1NFQA 5CDUA 1PTJA 1PGPA 1B3BA 2VHWA 3GGOA 1E3SA 3RC1A 3PGXA 1DEHA 4OYRA 2JCVA 4QO8A 4E13A 1YKFA 3GC6A 3MJ4A 3S2FA 3QLJA 4CM1A 5DOZA 2W2LA 4PLGA 5KJCA 5THQA 4WK6A 3HSKA 4CMEC 2Q2WA 3FTNA 2GN9A 3GVCA 4KWHA 3ZWVA 1BDBA 4O59O 7ADHA 1B26A 2YDYA 1LX6A 4E2ZA 2VTDA 5EIOA 1UZNA 1F0YA 3X2EA 4GKBA 1LSJA 5F5LA
chains in the Genus database with same CATH superfamily
1SBTA 1SULA 1PR5A 1EBBA 3KIPA 3KFXA 2R6FA 4DPLA 3EQZA 4ZP1A 1OXUA 4UD2A 4EDHA 2WBLC 3EBOA 4HLNA 4PG8A 3T5MA 1FQJA 3TK1A 4DKXA 3WLEA 3M6FA 3N87A 3OIFA 4IVQA 3PK0A 4CQMB 5KTRA 2NUAA 4N5LA 3T9EA 1H5UA 1FDVA 2LCQA 2FPOA 2YMPA 1U5BA 1I2CA 1W5EA 1XHEA 2PUTA 3BZWA 4FN4A 1RS0A 2P9FA 3WLQA 3GRZA 3NUGA 4KREA 1UPAA 1WDKA 3OWOA 2E4XA 1S2IA 5KI6A 4TTVA 4IWYA 1O95C 3QFTA 3QG5A 1X7ZB 1ORDA 3GLSA 4PO3X 5DNVA 3PJRA 4MGHA 1XVAA 3WB1A 2C99A 3ZGOA 3A4MA 1T0JB 1I14A 3UXYA 2GWHA 4B71A 3CNNA 2O3RA 4BJ1A 5DLQC 4DVJA 3R7NA 1FTYA 1X2EA 2WM8A 1FDIA 2OSBA 4PC3A 5L3SA 4CEIB 3TKYA 1YDMA 3FOEC 3KXPA 2C9YA 4OF4A 1LQUA 3SY8A 1QRAA 2YV5A 3CFYA 3OEED 3FMGA 1URPA 1PZXA 1B8PA 1F17A 1VCMA 3BCSA 1SY7A 4DTCA 1GTRA 1E79D 3OOWA 4Q3LA 3EUEA 3JQCA 5I5GA 3M70A 1SEPA 2YJNA 1PWXA 3DBVO 4LBVA 4M8IA 1S2MA 4UFOA 4KZKA 1QP4A 3LI2A 3IVRA 1XX6A 4KR0A 3TF5A 3KKMA 1VG1A 3ERCA 3R0ZA 4OQPA 2IBTA 2FX3A 2QTAA 1OGJA 3L1VA 4JL8A 4AFNA 2HK8A 4IVRA 2JFOA 5ARDA 4UM8B 3SYLA 5L4SA 2XLBA 2XNCA 3QXSA 2VDWA 3HJNA 2F8LA 3NEAA 4O8CA 1PNOA 4PBTA 1HDXA 2ID8A 2H3HA 2RK3A 2DVMA 2W0SA 4KK4A 3HMKA 4UVDA 5I7UA 2P68A 1RLTA 2FLKA 3RYFB 3EY9A 2NU9A 4HKTA 5FBWB 2XNKA 5DHUA 5C4MA 1HEUA 4NCIA 5LN1A 3PNBA 4C2AA 2ZCVA 4AJ2A 2Q1SA 4Y9TA 1PYOA 2AZMA 1MIHA 2GHTA 4DG9A 1ORHA 4A4DA 4JVSB 2QX9A 5TPWB 3E22B 4MPJA 3RSHA 1ZM2A 2JFBA 4JT2A 1E60A 1FJXA 3NDBB 3ICPA 3CE9A 4JX8A 2E87A 1ZN7A 4JYMA 3EK2A 1L7EA 4INOA 4N8EA 1Q0SA 1KBQA 2DU8A 5GZ6A 5F7XA 2WP0A 2XQKA 2YOGA 4YN3A 1WETA 3TR0A 3ZJVA 1E5QA 2GOYA 3CUWA 4UAGA 3LBNA 1D07A 3FB4A 1J1ZA 4MV4A 3LUBA 5GINE 4A15A 1P77A 2ADMA 3QJ5A 4AP5A 3N86A 4QJBA 3GBVA 3JCZA 5KCMA 2GQ0A 3NRBA 1Q21A 1G60A 1KEPA 2CXTA 2XX3A 3QKSA 4RZ3A 3W06A 5IZCA 3GN2A 1YCGA 4XFKA 4TV8B 3RJ9A 3S7TA 4N7JA 4R7TA 5JCPA 2FRXA 1G9SA 1N6IA 2B61A 2EJVA 1X1DA 1CD5A 2ENWA 3GFQA 3HYRA 3K5PA 4JUFA 2G7ZA 4HQ6A 2CFRA 3OO0A 1LVGA 3DNFA 2IXBA 4PIPA 2QAGC 4YJFA 4V0MA 5TVKA 4FLMA 3R5SA 5HTOA 4PS0A 3T3IA 4HWGA 3JAWB 1GD1O 1MAAA 2HMUA 3TD6A 1EZ1A 1JRLA 4HBGA 4Q4HA 3PPYA 3IKLA 1WSAA 3BAZA 3QV2A 4UEWA 3TE6A 3QFHA 4JJZA 5ABPA 3B5IA 1U1IA 2JA1A 2XQVA 1WPXA 4G8CA 4YJDA 4BTVA 1ZU4A 2GUWA 4D2IA 1OTHA 5C0OE 1NJFA 3HKDB 5HIMA 4UBOA 2AE2A 5DX8A 3BHJA 4R8LA 4RXUA 3ZZMA 1AKEA 1K2WA 2W8ZA 4CCYB 2Q6VA 1L7MA 4BX2A 1FLDA 1Y6RA 4GD3Q 4YQFA 5ICMA 2RSLA 5CBPB 4DLZA 2BM8A 3R77A 4PYLA 5D3ZA 2ZB8A 3F49S 1G2PA 4NCBA 1TMGE 4HDSB 2F43B 4IPTA 4DC9A 2ID4A 4YXWA 4ITVA 3A9SA 1Y6ZA 3GJ3A 3JQAB 3V48A 2PZKA 3EVFA 1JF8A 1YVUA 2WHXA 3S1LA 1TKAA 1E5TA 1MO4A 2CHVA 2NXNA 4MR8A 2VH2A 2QQGA 3LC2O 3C3BA 4PU0A 1I1NA 4ZT7A 1R88A 4L0CA 3QG1A 3UC9A 1UFRA 1IN1A 2GJ8A 2JAOA 4N7BA 3STWA 4CEIA 1JDBB 1YIOA 1NP3A 1USUA 2QY6A 4MUHA 3TTTA 1WNFA 1SKQA 4RZ2A 4K9SA 1DKPA 3Q87B 4RYDA 4YJ2F 2O7VA 5B58T 3VGJA 2G63A 5T4HA 1YVDA 1FU8A 5BSTA 4KO3S 4B8ZA 1NRWA 3QXJA 1P2VA 2KI5A 3BD6A 5T3UA 4BMDA 1G8KA 1NW6A 2EZ8A 4BNHA 5FCDA 3LLMA 1U7TA 1Y81A 2ZULA 5AI9A 4MW4A 3U4HA 4DCMA 1ECJA 2BI4A 3IP8A 5AKJA 2GAOA 2LKCA 3KB6A 1YGYA 1CR0A 4M0MA 5CBKA 2CKDA 1M6EX 1C9DB 2I7CA 1BS1A 3IS3A 5JAHA 4KDRA 4NTZA 2ANCA 2IP2A 1HO3A 2Z3WA 1JAXA 3S70A 4GP9A 1PFYA 4EI7A 1F2TB 4YRGA 5F23A 3WFIA 4R8VA 2DFPA 2ASVA 1WS6A 4AJKA 3DFUA 1CJUC 2GCGA 3GPDG 4IMPA 3BGWA 3TSWA 5GIPE 4WFKA 1Z3CA 3RYFA 3OKCA 1R00A 2IT1A 3JWEA 4UPDA 2OHXA 4HLDA 3UUEA 4EHLA 4OX9Y 2BFDA 9ATCA 2ZIAA 1HRKA 1P4AA 1UBHS 4HXGA 4M60A 4PAGA 5EWJB 5IBQA 4BZPA 1N2XA 1OT3A 3BFJA 4JVOA 5TPWA 3E22A 4FYWA 3W34A 3JPWA 3BK2A 4HDNB 1ULUA 1PWYE 2ZZMA 3R5JA 4NBWA 3O1HB 4HJRA 1TO2E 3PX2A 2A0KA 1PDWA 3GNSA 4IDOA 5AK4A 4B83A 1HQDA 2Y67A 1EWKA 1NLFA 1O5TA 1VE6A 2R66A 4QLOA 2PX6A 1A9TA 4KN8A 4MWBA 1U3WA 4WX2B 4RHEA 3LRXA 1KOGA 2R97A 2OC4A 2XJ9A 5DW3A 1C30B 2H7CA 4D3DA 4DSAA 3RG8A 4UE2A 1PJSA 4CCAA 4KGZA 2BF7A 2RDMA 3LQYA 4PZUA 3VPCA 1UXJA 3CW9A 4MKXA 2C82A 1C0EA 2O2ZA 1H1TA 3GIWA 2G08A 1GCGA 3EWSA 1CUJA 2G40A 4HRYA 4OQNA 4JP3A 4LSGA 1GKIA 4R8MA 3TI7A 1O97C 2OOSA 3JY6A 4JLDA 4Y2XA 3E8SA 1QGED 1RW4A 4XKJA 2X19A 1PR6A 2FUG1 2ZQZA 3D4LA 1CY1A 5FFFA 1Q5PA 3DUWA 4ZRDA 2E5LB 1US8B 3B7WA 4PTZA 1R4MB 4UVEA 2F1HA 2IYLD 4AB1A 5B4UA 1PZHA 2WV7A 1C4XA 3QU4A 4HH1A 4OA5A 4QTXA 1DTEA 3C7DB 3OIYA 2WTXA 3DZFA 1AK2A 2FR8C 1N7IA 1W5FA 1PX2A 1FBTA 2RGUA 1TW2A 1WDLA 3CPJB 3JAWA 4K8RB 4LBYA 5EZ5A 3BCRA 2DG2A 1GM5A 3VU9B 1GAWA 1BA2A 1BRTA 2I7VA 3LSYA 3DKIA 3KOMA 5KOJB 5HMLA 3IULA 1PF7E 3P4UA 1E4EB 2X4DA 3OZGA 3PV0A 4I36A 4L2IA 4UHCA 4EBBA 3HXQA 4PGFA 2WJPA 1EEXB 3F2VA 3HKDA 4OH1A 3FCSB 1J0AA 4TMTA 3RYCB 1TC1A 2AOTA 2M6KA 3ZVLA 2EC5A 2VC2B 3E4CA 3G85A 4Y0NA 5EWLA 1C29B 1E9VA 3D2AA 3G2HA 4BNWA 4Z4FA 1MNQA 2J46A 3NT2A 4LQDA 4RF5A 4Z2YA 4NH0A 3ICCA 3MLEA 1A96A 2IP4A 3B1XA 4G26A 1LD3A 3PXCX 4IQGA 3R3SA 4Q1FA 5D1HA 2VQDA 4CM8B 2QLLA 4ZI3A 1SIUA 4X5OA 4I1OA 4YRRA 3TNLA 3JQAA 3PGJA 4C87A 5HHTA 1Y8ZA 1VMAA 2BEUB 2F17A 1S2OA 3NO4A 4BKOA 1KVSA 3ZW8A 3PFCA 1Q7EA 5YASA 2EDCA 2GBPA 3CF4A 3L8MA 4H31A 3LCUA 1QIMA 1G8YA 3CZMA 2BISA 4ZIRB 3T5DA 4RL6A 1R8QA 1JG2A 2CLIB 1A8PA 3MCVA 1MOSA 3NETA 1U1EA 3QKWA 4FFVA 3QKTA 4N5NA 4W5HA 4OBWA 2V5AA 3PEYA 4ZFNA 3QE3A 3V7FA 1KRHA 4RE5A 2X5OA 5FLKA 1WTAA 2X8LA 4K6HA 3H2SA 5DE3A 3OZWA 2UUCB 2EFEB 3ZCUA 1V25A 1NVGA 4H0FA 5JQWA 4XWWA 3ITNA 1XNJA 3D7SA 5H80A 2QVCA 3BCHA 4RK4A 2VBFA 1P2UA 1IDN1 2OP1A 2BT4A 2D4AA 5A9RA 5CEFA 3HGQA 2OBNA 3H13A 3VPFA 2Q49A 3NHSA 3G1UA 1EDZA 4XQGA 2EGHA 4ZVTA 3U37A 4AJJA 5HJ5A 1EBFA 2RHGB 4EDFA 2K4MA 1F2TA 4JOBA 4URWR 1SOVA 4RE6A 4KNVA 3WFJA 4FUQA 1P1JA 3B5JA 2C5SA 1DNPA 1WZCA 5AUNB 1ETUA 2GETA 4G0ZA 2WOJA 1NJ8A 5EUBA 2X23A 5ALYA 5LZ7A 4ZCTA 3IUNA 5C8XA 2JD2A 2BN4A 2W6PA 3NYIA 5EMHA 4UJ3A 5GV7A 3S1AA 1CZHA 3V80A 1L5VA 1E2JA 1G8JA 1QAQA 1RMTA 1QHIA 3SFTA 3DMDA 2OTCA 3TJZA 1K7CA 2VP9A 4HDNA 1CS4C 4Y3UA 3PNLA 4RIEA 1Z18A 1M2GA 3ER6A 3U4DA 4ESEA 3BORA 4A27A 1F3OA 3MLBA 1QSGA 2Q0HA 2XYHA 3HS3A 5CLLA 4WCFC 3V8MA 3GLFA 1O8BA 2HJHA 3EC1A 3QPBA 3ZNPA 3PQEA 3HXLA 3IR6A 1GTMA 1U0LA 1IPHA 3I8SA 2QL9A 3ND7A 4I5FA 2G8LA 2A30A 4RM2A 1LLFA 1XT6A 3B8EA 3KKLA 1EXDA 1W6UA 3R3JA 1UKYA 3LDHA 1RXCA 4NAHA 4B6EA 3ENNA 1FXWF 1UAAA 2GJAA 1U0SY 2FW9A 2W58A 4XIIA 3IE0A 2YVLA 3WL6A 1NF2A 1R6DA 1QFSA 1J8QA 1XQ1A 2MSKA 3GGGA 4GMGA 4A16A 4I81A 2ODWA 2AC7A 5C37A 1JHZA 3Q8WA 2XBMA 1MAUA 1NR5A 2LTAA 1N5MA 2V59A 3Q7TA 4OJTA 1JFFB 4PEVA 4UDYX 2R4QA 5JALA 1R4MA 2LR0A 3NOVA 1ZH0A 1CNEA 2OAQ1 4KWCA 3TO5A 3IODA 4OHRA 1WXFA 1FJGB 2YICA 1T9AA 1RBYA 3HCNA 4KNYA 2NU8B 5FTJA 1KJNA 3LHSA 1YOVB 1AT1A 2HA2A 4NV1A 4QSMA 4RO0A 3VU9A 4L72A 3ZEAA 4CMJA 5KOJA 3AGPA 1CTQA 2XB2A 3ZZ0A 4HQRA 4BS9A 2P9JA 1YL5A 1ZI9A 4L4YA 4FS8A 1QH0A 3IC5A 4O33A 1JR3D 5A7GA 1UBFA 1XLVA 2JFHA 1I2MA 4N54A 3PPIA 4TSFA 1UJCA 3RYCA 2YHBA 3MZ0A 3NTRA 5ELMA 3GD7A 4LV8B 2BC9A 2J9ZB 3QE2A 1LLCA 4OMCA 3VC2A 1EFKA 2RGBA 4IEEA 3A6JA 1KEEA 1UM9B 4QYXA 1U4SA 1UAGA 3WNDA 3O8QB 2VQSA 2VNAA 3BB4A 5AW9A 1Z39A 2Z8YM 1NVAA 1FQOA 3LSTA 3RU2A 2GN0A 2OVBA 3CH6A 1I7DA 1JHAA 3U80A 3LF2A 5CHYA 1N2IA 3KYIB 4K86A 5AKHA 2HSWA 3T7CA 3ZPXA 4RELA 1E2UA 1KEUA 5B4VA 5LNK1 1J90A 2WHPB 4C03A 1ZI6A 4AT1A 5A3QA 4ETWA 2LKDA 4EVSA 3D8HA 3D8NA 4OX9B 1JTVA 5ILQA 2WWYA 5A9SB 3SE7A 1V26A 2JIPA 3IMCA 1P4RA 1WBJB 4B2YA 2QP4A 1LZLA 3PF8A 2BGLA 2JF0A 4QFBA 4BTEA 4BLSA 5EPUA 5J2TF 4F45A 1FU4A 1KP3A 4GOMD 4MYSA 2EHDA 4K3UA 2A67A 2R00C 1VJ1A 4JK3A 4OB8A 4YRKA 1ZO8A 4MWEA 4YP0A 4AKEA 4H15A 4B46A 3GUYA 2JZCA 1BX0A 3PFIA 4TS4A 4Y6SA 3L7MA 1CZOA 1DQRA 1XTIA 2AMFA 3GVIA 2X1LA 2ZE6A 3UV6A 5C46F 1XCOA 3D5TA 1QYDA 5MN4A 2QDXA 2C2YA 4DDHA 5IF3A 5KAPA 4F9EA 1GGMA 5D1NA 4IDFA 1L7VC 2QV0A 4R8KA 4BKUA 3AESA 4LWZA 4V0KA 3NOXA 2G4LA 2JI8A 1ADFA 1C7RA 4LDQA 1VMEA 2XMCA 3KAKA 1F1JA 2Q1XA 3UMMA 3G5UA 2XCIA 1ULBA 4D6XA 5LSAA 2ZI6A 3DVAA 3IQHX 1H6BA 1YB1A 2IFTA 1EHIA 2D00A 4PSVA 4X97A 4GWKA 1JHPA 3IL2A 4OFZA 3OE7D 4B6OA 2PMWB 1ZJJA 1V16A 2X4LA 3B1KA 3HDVA 4WDRA 3T7EA 3TNFA 2POQX 3OFJA 2I55A 1TUIA 2IS2A 3I3SR 4P8RA 1NQOA 1R50A 2CDRA 5JZMA 5CP8A 4C7VA 1UINA 3OICA 1A88A 4H1VA 4KP7A 1HE2A 3CX8A 4WADA 2P8JA 3ORQA 2XMRA 4YVFA 1KF0A 3K8QA 5FOVA 1R8JA 3UHJA 2NSDA 1MP0A 3BYZA 2VCHA 4AQDA 3MTBA 4JASB 2ERYA 3LUPA 5DLYA 5A5GA 4Q00A 1M2JA 1NOJA 1Z06A 2D7JA 5I4CA 5ALLA 1KTIA 4RAQA 2J5QA 4OSEA 5DGTA 4QUIA 4OGFA 1I9GA 4KV7A 1BW9B 3WC4A 2FX5A 1JFFA 4V0ME 5JLJA 3TM5A 3RUEA 5BSKA 1OHHA 4DV1B 1UEXC 1A7UA 2IZ6A 1FVFA 1NY5A 1GZ3A 3MGGA 2EU8A 4O4HB 2WW8A 1UEIA 4EGFA 3LECA 4CT0A 4BWYA 1G66A 1RJWA 1YC5A 4E31A 4KAXA 3IAM6 3FH0A 3DCNA 4J0KA 4O1MA 4F6LA 4X6UA 5MHTA 4TQ9A 1ZPDA 1AKNA 2UXDB 3ITEA 3IURA 5JANA 3RASA 3V2GA 1P45A 2F1RA 3DBOB 1UP7A 4IDCA 2BFOA 1MO5A 2H7VA 1G41A 2C1EA 1MB9A 1ZW1A 1V95A 3A1EA 3GCGA 4X65B 2WYOA 2ODEA 1T9BA 4XVQA 5ESDA 5JI2E 4YAOA 1I7QB 2BIFA 3VU3A 1JDVA 3D6JA 2XUZA 1JWAB 1MRZA 3O8QA 1T35A 1T1GA 3PYXA 4FSDA 4QDTA 3GP5A 1G21B 3WOHA 1XEFA 2H1WA 2WSBA 5H83A 3TFQA 1C0PA 3N8KA 1M74A 1Q6YA 3O8OB 1WMBA 2GCIA 3C48A 3HACA 4IS3A 4JL6A 3TRKA 3ZH9B 1EG7A 4X7BA 2J7PD 4EFMA 3GEEA 2HNKA 3BGDA 4IVNA 2FLVA 3VKHA 3TCKA 2R6DA 1CWUA 3OHSX 5E4FA 1L4LA 3MD9A 4Y6OA 2QJFA 1KVQA 4OXNA 5BVHB 1TI7A 2J6BA 1FF9A 4MP8A 3HBAA 3UIEA 5A9SA 2GZ3A 3D4NA 1BHO1 3EB9A 4ZAWA 3WGKA 4H6VA 1OYYA 5GVRA 4YR7A 4LX8A 2PX2A 1UKAA 2PRZA 2RAUA 3E9NA 2WYVA 3RUHA 5CT9A 3RS7A 4R1TA 5TT1A 3U1VA 5I7HA 4UOQA 2JVIA 1RXEA 4BDSA 4E5KA 1WUIS 2QMEA 3EISA 4JMPA 3C4VA 5HQJA 3F6YA 2QUBA 2DH5A 3NAZA 5B1IA 3RHTA 2K2QB 4R69A 1XYGA 4GLLA 1FXSA 4L3WA 3SEFA 4BMOB 1PK8A 1SVNA 4GH5A 3G5MA 1KIFA 3B89A 3ENZA 1ABEA 1QG2A 3VV2A 4ALNA 1MGPA 3PHGA 4G0WA 1BNCA 2VA9A 5JSYA 3SEQA 1CYDA 3PNMA 4PONA 5CVEA 1BHQ1 1OUMA 4RCYA 2Y99A 3JSAA 4BUJA 4D8UA 3DLIA 1OIVA 5TJ9A 3CYFA 5IDVA 1IUKA 3MCWA 1OLUA 3Q98A 1E66A 5A4JA 3U3OA 4BJ5A 4BFCA 4RD1A 4Z2AA 1Q0RA 3LQ1A 3KQSA 2ID7A 2O20A 3THSA 2NTVA 4O2AF 3TPFA 1YKSA 4YFVA 1YUMA 3KKZA 4OBBA 1EHYA 3TXAA 2ZRDA 3VX4A 2O5CA 2YJZA 2IHBA 5IJ9A 2D2EA 3KKKA 1SCAA 4NFSA 3RV4A 1WU7A 1P7WA 2W6JA 1DCFA 4G4IA 4Y6LA 3A1TA 3SBOA 1Z4QA 4L78A 1J2TA 1DC8A 3SJAA 3TVTA 3CVXA 1SMKA 2OZLA 2Q5FA 2QP3A 3DOIA 3WYCA 4HNTA 3PEWA 2PUCA 3KEMA 4GPAA 4INJA 1V3QE 1B6RA 1FTWA 3ANTA 5HZHA 5T3YA 5M34A 1XPUA 3FJOA 3VC7A 2O23A 1V3VA 3KQQA 4G5QA 1RXVA 3G9XA 3WISA 2W2LD 4W5OA 4CRWB 1R9NA 4U9IS 3EGWA 2NU8A 5F9MA 1E9BA 1TL7C 4G5HA 2CNWA 4GSLA 1DBQA 1DO0A 4R9SA 1D0IA 1LDGA 1WY5A 4TZKA 3IEIA 4DR5B 5BSUA 4G9BA 1OFGA 1RYBA 2H4HA 2CLHB 5AXDA 2D1FA 1C4KA 1ZM4A 5C52B 1TYDE 1EA7A 2QBYA 3AR6A 3AUAA 1ZESA 1QIHA 1BW9A 1GO2A 4I2NA 4ZJPA 3DDWA 2XF8A 1CY4A 2JVKA 3HV2A 5JJLA 4NCNA 4KCGA 4BFWA 2SKCA 1IK4A 3O74A 4O4HA 4BEVA 5CA0B 2W90A 2XKAA 3GLGB 3MM4A 2PXCA 4IXMA 4PO9A 2OBXA 3AF2A 4AZ0B 1XU7A 4YUAA 1GCOA 2JJ1A 4BNUA 1KMMA 1EFTA 4R8SA 2NO9A 3FOZA 1RYYA 2R48A 2IHTA 3LM8A 4XD7D 2MYNA 4NOLA 1KPHA 4RIIA 4QQKA 3P9IA 2P41A 2IDMA 2GSDA 3NZEA 5L45A 4FR5A 4FYYA 5BORA 3RG2A 4AXBA 5EMLA 1GFSA 4TLMB 1ZLXA 3TXXA 4O25A 1JQ3A 2WTAA 1ZI8A 4IOMA 1MCZA 1AURA 2O2SA 4KB5A 4B7UA 4OXIA 2FE1A 1E7RA 2O0JA 4LDZA 2PKYX 3NTQA 2XKJE 5L3VA 2N46A 4Y9DA 2NT3A 3AQ4A 2FQYA 3KZCA 1YJAA 3KXKA 4PZAA 1ZCJA 1G21A 3AVPA 4A0HA 1U0BB 4B8WA 6LDHA 1EG2A 3ZN2A 3LGSA 1ULZA 1N4AA 5BRAA 3O8OA 2C2KA 1MIOB 3K9FC 3WMEA 3N07A 2GA9A 4K5QA 4X60A 2IQ5A 3FCOA 3INNA 1QE3A 2O1XA 3PLRA 1HV8A 5K6TA 3EOBI 3R7DA 4UTRA 4LX0A 3H86A 5KAMA 5BVHA 3NRCA 2HJ9A 3STYA 1IBMB 1U4NA 1QVZA 3ENWA 4FYKA 4AN0A 2W2KB 4YV7A 1UFOA 3DL7A 5A4DA 4R2KA 3QLUA 3HVRA 4BMCA 3K0AA 4ABTA 4TWIA 5I5EA 5IFLA 4ND2A 1F5SA 1HNNA 3D7KA 5FI5A 5G4KB 3P2JA 2QT1A 4NR0A 4D8YA 4GVXA 1Y82A 2A5LA 4CKZA 1EP2B 2P3OA 1JDBC 5T6BA 3CPSA 1QHYA 4S1VA 4H0CA 3TYXA 2QX8A 3Q0IA 3MTGA 4DCCA 1GDHA 1TZBA 2O9JA 3GVXA 3U3KA 1W94A 3MT7A 4IUYA 3RYHB 5KU1A 4EJSA 3ZVKA 3RB8A 3RI3A 2A9VA 4DQ0A 1UH5A 1UUFA 4IQ8A 5JPCA 1Z2NX 4UTVA 2ZDGA 1R5JA 3UJ8A 5CEEA 1FLNA 3HP4A 3W9SA 4Z54A 1DIHA 2RGCA 3BWCA 3ADDA 1JPNA 4UAUA 2QNIA 2CFSA 4RKEA 3K0SA 3B7GA 1G7SA 4JS0A 2CCGA 4D0SA 3REFA 2GD6A 1W1IA 1X7GA 4I4TB 5A6SB 1X39A 2PR2A 4UEJA 5HOEA 5JSQA 2DR0A 1BWSA 1GRCA 1NKTA 1ZMBA 2H8GA 1Y0BA 1H85A 3W77A 3WWZA 4YRCA 2UZAA 2P6PA 4F6CA 2IUUA 3X44A 4DLYA 3GQBA 1UKZA 2FGJA 2GVZC 2JGDB 3P5SA 4FZJA 3OFNA 5D01A 3GLFE 3S3TA 1RRPA 2KBFA 2ZRJA 3CG0A 1Z35A 3BTSA 1YJ8A 5CYFA 1KQGA 1KI4A 4W7IA 3MOSA 5G1PA 3ESZA 2ZKIA 1Y6FA 5BSRA 3NH9A 5AW0A 3MUOA 5LQRA 3KPWA 2XYGA 5B1HA 3VI4B 3AVYA 1KOLA 2R8PA 4EP1A 2XAUA 1Q77A 4CF3A 4KPYA 3LT0A 2BTQB 4D4GA 5DWVA 2VUSA 3CR3C 4K8OA 4RVUA 1SBCA 3R6DA 4RJLA 1IHDA 4JH0A 3PNKA 1X38A 4Y2VA 2YWHA 1WL8A 4TM8A 3ZTWA 1NQWA 3KEGA 721PA 5AM3A 3FF4A 2WIDA 4A9AA 4HXEB 1HYQA 1EFRA 1FTGA 3DVSX 1FDWA 3QMWA 3RSZA 2VPZA 1KYQA 3ILSA 1EFDN 4O0MA 2GXQA 3UMGA 2G25A 3LGAA 5FOQA 2B30A 2Q9CA 4R5MA 3F73A 4LJKA 2EZ4A 3DBLB 4B3CA 2RGDA 3BIOA 3LRTA 4RK7A 1IOVA 3C7TA 3JW8A 3Q0EA 2IV7A 3UYLA 4Q3OA 4HEA1 2BM0A 3L0DA 3GFRA 4MVJA 2MMGA 3AL3A 4AAYA 4QELA 1WG8A 2QDKA 4QBIA 1WNTA 3UUWA 3WJ2A 4ND1A 1RQNA 2HI0A 2RC5A 3TIIA 5CUQA 4LRWA 3Q3VA 2WHEA 1O94C 4XX0A 1KK2A 4TMWA 5CU7A 3QVWA 3RFVA 5FO1A 4KU4A 1JIJA 4RIFA 3MG9A 5LQCA 1MIOA 3H7AA 4G41A 5I9IA 5HJEA 3ZU3A 1B1AA 3HCDA 3GEHA 2EKLA 1LK0A 3LCVB 3QPUA 4NZPA 1X1CA 3ESAA 4EPWA 2WNIA 1YONA 3CLSC 4QRHA 5IC6A 1T0HB 1GGFA 1R3UA 3G1WA 4HC4A 1DEKA 4P7GA 2ZAMA 1J8MF 2YASA 3B82A 4I9HA 5FL7D 4BWVA 3V4OA 5SZJA 4OKIA 2W2KA 1SUPA 4Z3OA 1W0KA 1W88A 3AZOA 5THKA 3G2QA 3UCXA 4DA0A 3M4JA 2J9FB 3QLVC 1W0CA 3CLUD 2Z4SA 1Y80A 5GONF 5IDXA 2GKSA 2P7HA 2ZBPA 3FHJA 4GAEA 3C41J 4MA0A 4TLEA 2R4TA 4PVDA 5G4KA 2ZXUA 1M1UA 1SQ5A 2PWYA 2ADFA 2CGEA 4KXYA 4G86A 1RVDA 1XHFA 4ZV7A 3WB9A 4A0SA 2DUWA 1Y8RB 2RHHA 2DSNA 5HM6A 5AJZA 3NIDB 4B74A 2ET6A 1RZRA 3RVOA 2AEMA 2HTFA 3FSRA 4XZ3A 1MPXA 5KX5A 4LFCB 2PVSA 1JP7A 1IEVA 1IWBB 3HU3A 3LE8A 1JJFA 4K26A 1FZTA 5DU2A 3UMVA 3WK4A 3WLTA 1WF3A 4J7CA 2QQ0A 3AU9A 5JCZA 2RGWA 1OFTA 4C0XA 4DC1A 3DMYA 3QEJA 2NIPA 1BG6A 2ETVA 4K81B 5D3MA 3O38A 3R3XA 4R1UA 4ZOLF 4L85A 4WJKB 4BBAA 1U8TA 3VUFA 4MQUA 6AT1A 1IAQA 3PHIA 4G8BA 4ACBA 4J94A 3OLQA 2DMRA 5LOVF 2AK2A 2FX2A 1KO7A 4X20B 1O6CA 1JT2A 2PRYA 3RSGA 3I1YA 5MGBA 2WM3A 4G3XA 5KINB 2P78A 2NP6A 5M29A 1B16A 4MWTA 4UMFA 4YYEA 2MSCB 3VHRA 5K6AA 4QG7A 1L5RA 1NMXA 3W8FA 1KTVA 3HC7A 3QMPA 4QTTB 1EVLA 5GV8A 3MS4A 1D09A 1KK1A 2J0QA 1SA0A 2HMTA 3HEBA 2YMLA 3OZXA 4B2LA 4RACA 2X0EA 4NBTA 3KO8A 1RBMA 2HF2A 3RUIA 3TZKA 1JEQB 1YB6A 1ZS9A 2O7NA 1PLLA 2UUPA 2R5WA 1BCSA 3GRKA 4DNXA 7MHTA 1AKWA 3BB1A 1N4DA 4X71A 3VYVA 1X9HA 2ASEA 2CVQA 1AH2A 1HLPA 2FPKA 1XRPA 2BTQA 4OATA 1K2VN 1P7CA 2QXUA 4J0FA 1QRTA 3AZPA 2NZ8A 2VVTA 2MR6A 3IAS6 5K0BA 4KAJA 1REQB 2FPRA 4J8PA 3AHHA 2Y93A 3EMKA 3IEVA 1M6NA 4DCPA 2QE7D 3HVHA 4PZ9A 1EDBA 4K9PA 2H4JA 3V8BA 5K8TA 4QVIA 5KBYA 5AUOB 2P2NA 1RDFA 1YT5A 4ZAXA 4WEOA 5BV7A 7AT1A 3Q3EA 1TUBA 3SYMA 4L8GA 1AOXA 1M5UA 4N3AA 1HTWA 3OSZA 5ALNA 3VZPA 5JRJA 3DBLA 5EVJA 3TIVA 4A82A 5IM4A 3JXEA 4MYCA 1UKBA 4QJ3A 1RP1A 1U2GA 3HR7A 4QXRA 1ML4A 4QM7A 3D0KA 5AM0A 3P20A 1EJ2A 2X0RA 4P3OA 3SIRA 2HYIC 3E70C 2ZIGA 4OUDB 1U9IA 3ASYA 3LO8A 1EDOA 5JXHA 4RXMA 3A3NA 5HCUA 3UUGA 2FY8A 1CRQA 4X6YA 1RABA 2E3JA 2NYUA 2YOFA 1K3FA 4DGSA 1NNLA 1P0CA 5IAEA 3DULA 1OROA 3TNYA 4TPKA 4U5QA 5I9BA 2GZHA 3WMFA 1XZPA 4PPGA 4QYTA 2JARA 3Q9NA 1P5ZB 2ESRA 4MKZA 4QGAA 5CDFA 2CYAA 2VTEA 3C6KA 4JITA 4EFKA 2A33A 2CLOB 1WMDA 3OIUA 2R8EA 2XCOA 5F9HA 1OWOA 4CM9D 1MR3F 4GM4A 3IIKA 4ARIA 1TRHA 1UOPA 5CFNA 2XUAA 1OYOA 1O2DA 2X0KA 1NURA 2EW2A 2WQ6A 2HW8A 1EB8A 2P69A 2WSMA 3LFTA 4M0FA 5IULC 3LK6A 1E1RD 1XEWX 4YAKA 2TECE 2FPUA 1GUDA 3WLNA 3FUWA 4LE0A 5JAOA 3PQ2A 1O0BA 5CH8A 4WFJA 4ZZ2A 4FKBA 1EDEA 1Y8RA 1Z9BA 4F2HA 2UVDA 5LYYA 5AD1A 4YRAA 5AICA 5FPTA 1S9DA 1X9IA 1X13A 2H2DA 4QXOA 4KXWA 4AO8A 1LU9A 2IW3A 2AYXA 1NRIA 3MMNA 1ODKA 2GBIA 3ZE7A 4HN2A 3WK6A 1ISMA 5F73A 2A1TR 3CNOA 5C34B 3TW4A 2B0CA 3HA5A 5ER9A 1IOWA 1Z0IA 3KOZA 1MQSA 1XJ5A 3OX3A 3ZDZB 1RHKA 4P38A 4OP3A 4HI0E 4DKJA 1PT9A 3EHDA 4RMIA 5I8ZA 1GRVA 1VGQA 2VIIA 2YYAA 5BUCA 2WEKA 4X20A 4TOIA 4P0QB 1FFAA 1V3UA 2ECFA 1JHRA 3LQFA 2A9OA 2PHZA 5CTAA 4S2EA 5GVSA 3SHFA 3K96A 3IVXA 421PA 1JHVA 4ZHQB 1XCMA 3I45A 4CL3A 3PHBE 1GGNA 4Q82A 2BMWA 1BMTA 3HBNA 2WWIA 1C7EA 3DZIA 2JKZA 3LY7A 4JBHA 3E7DA 4LS3A 3RVQA 3ZQUA 4A23A 5J4YA 1JAZA 1KFKB 1C8KA 2W48A 4K9RA 4OLFA 4DANA 3N0XA 5JBNA 4H4DA 4S35A 3ICEA 1IM2A 1VIMA 1XFDA 3C3JA 3OQBA 3QF7A 3Q40A 4HNHA 5AM5A 2BEKA 1YKGA 1U9ZA 4GZMA 1K75A 5EJIA 2QAJA 1SVUA 5CNMA 1Q7RA 5JE8A 2IPLA 4XRRA 3ZGXA 4WFQA 3RT1A 2IY7A 1REQA 2ZIEA 3JX9A 3U31A 4LW8A 1G6OA 3RBAA 5I4KA 3WBBA 2QNRA 2VJNA 1F48A 1T8TA 2OCAA 1MVNA 1WSBA 3S6JA 1ZRHA 3P94A 5G4LA 1QFZA 2X22A 3MT9A 4E08A 1OB2A 3OH8A 3DEIA 3NASA 3WJAA 2BMFA 2GZDA 5EJ5A 1DJPA 2KSQA 1N34B 3R9XA 2IVZA 2Y0BA 4EG8A 2DWOA 3SS7X 4UU0A 5CB4A 2IK8A 3BMNB 2AQIA 4FP9A 1O87A 1PJ4A 3AJAA 2JGNA 3M33A 3QENA 4J0HA 4Q3DA 4BYMA 4CKBB 4JB2A 3MN1A 1T36B 4BNDB 1C7FA 1L4MA 3JALA 4OUDA 3T9AA 3MCTA 4CZ2A 1Z4MA 2FP3A 5IC4A 2AKAB 4WACA 2QD1A 4HCJA 5LWQA 3OD1A 3KB8A 1IMOA 1K8QA 1A8QA 4BWGA 1JHMA 2W6MA 4E70A 2IPNA 1NVKA 3JTMA 2VF5X 2YRWA 1G21E 2EBFX 2NAFA 2VYCA 5CT5A 2DM6A 3ODPA 5LQSA 2B20A 2PKQO 5DX0A 3DR5A 1E99A 4N18A 1FEZA 2VAMA 4MW9A 3JQRA 3AI3A 4M53A 5AIBA 5HJ2A 1M6VB 1SU8A 1IRXA 1EXVA 2ZJ4A 4LHVA 1ZNYA 1RZVA 1Q1NA 1EVIA 2HO4A 3KTFA 4GBMA 4JDUA 4QNRA 5TDHA 5IAGA 3BGVA 1QIDA 3C4JA 3S2UA 4OXQA 5C5EA 2RI6A 5K4GA 4P92A 3LTNC 1AC5A 3GPCA 3OMWA 4J4TA 1L4EA 4P9NA 5KKNB 5AP9A 1ZX1A 5IAAA 2ZSIA 1EI9A 1DC5A 2JGAA 1QV9A 4IJ5A 4J0QA 1ZIXA 1DAHA 4PVCA 1Z7BA 2ZEJA 5JVDA 1TYCA 3F1KA 4WFIA 5JRZA 1Q91A 4Y2QA 5EFZA 2HO5A 2VBGA 4Z9YA 4RPHA 5LDGA 3PC6A 1E92A 1E96A 3QLUC 4X0EA 3WGJA 1DFGA 4CR6A 3WX0A 2ISCA 4MW6A 1SKYB 1AB5A 1R9GA 1TE2A 2QRGA 4DHWA 5KYVA 5ISMA 1SZCA 3EAGA 1U2ZA 4N6NA 3VTFA 3L0PA 1Q17A 3QU2A 3H17A 1JLLB 2CLDX 1F14A 1GOTA 2P9YA 2GHQA 2PX0A 2WE7A 5FA6A 3F7MA 4V1CI 3DG9A 5K4HA 3SYTA 4EJSC 4F4UA 2Q1YA 4JU9A 3CXUA 2JAQA 1DCMA 1FFSA 2GEDA 4HGRA 4M55A 3CEJA 5KPJA 4JEHA 3RLIA 3BH6A 4L6AA 2YV4A 4R2XA 4L95C 5AJUA 1NQAO 1Y3IA 3KDPA 3AEQB 1J0CA 4PZDA 4QOJA 3KQNA 2RK6A 2JGEA 4NK4A 3W6OA 1L4NA 2VH1A 1QCYA 4CV2A 4ERNA 4W5NA 5B3LA 3AJDA 2VJDA 3OZSA 3ZU6A 4C78A 1QC5B 1CIPA 4NZNA 1DXOA 1A9PA 1NI3A 3Q9LA 2WFMA 4ZHQA 1DJOA 1WMSA 1IN6A 1V8BA 2II6A 4BLVA 9LDBA 1KKLA 3RREA 4CIBA 2V3WA 4EAQA 2OHIA 4LFBB 2DRIA 3FPKA 5TXGA 3VR2D 4FZRA 3UH0A 3VOTA 4IFBA 1UOOA 1ECFA 1GADO 4RCZA 1JVNA 2VDJA 4S1NA 3KJFA 4FHGA 1VJ5A 2W9XA 5G40A 2MSEB 1LQ2A 1PV4A 4RORA 3K3PA 4PNHA 1UIMA 3AVQA 5CA0A 3SHTA 4GBGA 4FDLA 3LQKA 3FDFA 4RZXA 4QDOA 1WM1A 2C4VA 2B8NA 1DSSG 3FYHA 3UC5A 3I5AA 1JGTA 3OZIA 3M1LA 2X4IA 1JS1X 2YJGA 3W9UA 1KFEB 2BCJQ 2OFFA 2JLCA 4FM9A 4AG3A 5JS6A 2FFHA 3VNRA 1LWOA 2VNIA 3KOXA 4P5PA 2HWKA 3LGXA 4WN3A 5LP6B 5FUMA 3G2IA 2NV2B 1KOJA 2PGJA 3AKCA 3KEQA 2H1IA 2P2DA 3MWEB 3O9ZA 4NX2A 4ZQHA 5FYQA 1Z6QA 4RXTA 1FMFA 1O9GA 1HC7A 1WVGA 3L05A 3MB5A 5HA5A 3A4YA 1C4OA 1N5JA 4JUBA 3SQMA 2B2NA 2WU0A 4TV9F 1DBIA 1T13A 1TLFA 2C59A 3HCRA 4O2LA 4YBRA 4MVJE 4YUVA 3DKVA 4UUPA 4BO5A 4CKCA 1CY2A 5DTQA 4C0BA 1VB3A 5EHZA 3KYJB 4UULA 4Q1AA 5DEOA 1ESNA 2B4KA 2GR9A 1VMIA 3VO1A 1LPMA 4UBNA 2FZWA 2Q4EA 4O4LA 1V6AA 3VVBA 2XYVA 5IKMA 5JRDS 3C3PA 1NXXA 3W2GA 4MXDA 5MDHA 1HPLA 1ODIA 1HE3A 2Z4RA 1T3LA 3QBDA 3KPVA 3AI2A 4H18A 3U4CA 4R01A 2AE1A 1MZVA 5EY5B 3A28A 1O6FA 3HN6A 1JU4A 3QE4A 4NU8X 1KYYA 2C3UA 2PV7A 3DV9A 3GJ5A 3LC0A 4QU9A 3ZE8A 2CBGA 2HD4A 1M6VA 4EO7A 5KYWB 2GD0A 3IH5A 1MEOA 2GEKA 2KS6A 4F85A 2D5BA 3HUEA 4W9MC 1F4VA 1MO6A 4AZSA 3BSSA 2FEPA 2WYWA 3TZCA 1YR1A 2MYUA 3OM9A 2XWPA 3EMVA 1QVAA 3E5NA 3O4HA 3K71B 3HSYA 9GPBA 2FZ4A 3CVOA 1GXSA