1CETA

Chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
305
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTNRLDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-LACTATE DEHYDROGENASE)
publication title Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 305
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cetA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1cetA02
2AXQA 4QSMA 1X0VA 1BTOA 2FY8A 4JJIA 5LDHA 1PL6A 1YXMA 3V2UA 5BNIA 4CV1A 3HN2A 3EGOA 4DYVA 1DC3A 2C82A 3VPHA 3PHLA 1GV0A 1GFSA 4MP3A 3MTJA 2YHUA 1Y7TA 2Q2WA 3ENNA 4BO3A 2PWZA 4E0BA 3S2GA 3GZNB 5FI3A 3WSVA 4DPMA 4WCFA 3HWRA 1BVRA 1PTJA 1F8FA 1TEHA 4RGBA 3UVEA 3JYLA 3ZWWA 3TWOA 5C3MA 5JY1A 2IEBA 2RCYA 3QWFA 2G0TA 1PSDA 1ZW1A 2NTVA 3DBLB 3DO5A 5GY7A 2CDBA 3QP9A 4NBVA 3B6ZA 3K96A 3K8ZA 4W6ZA 1NQ5A 1ZBQA 5JO0A 4TVOA 2PY6A 1ZJZA 2GYYA 2EP5A 2VWHA 4JK3A 1UJMA 5FEUA 3AW9A 3DZFA 4UAGA 1JW9B 3AI3A 2JAPA 3I9OA 3DZBA 2PKQP 1HKUA 3M6IA 1PZFA 3KSZO 4ALIA 4MKRA 2Y05A 3I9LA 1LDYA 5T64A 3TOXA 2E37A 3Q9NA 1QV7A 3MJCA 5I9MA 4EGFA 2VNAA 4K26A 3PDJA 4KWHA 1AE1A 2ZTMA 5TX7A 1ONOA 3LDHA 3ZW9A 4Y67A 1SOVA 2F1KA 1U1IA 1UXKA 3NYWA 3WNVA 3WTCA 5L4LA 1ZUD1 4A7PA 1PL8A 5JYDA 5COBA 2IYOA 5JDIA 2PGJA 1F0YA 5KJ1A 1EUDA 1UH5A 3VPGA 3PK0A 1N1EA 5THQA 3PWSA 4PLYA 1CF2O 1B3RA 2CD9A 3DEYX 5KIAA 1D8AA 2GERA 4AICA 2WYUA 1ZXBA 2ZCUA 3LC2O 1LSOA 3FPCA 4PLVA 3ENKA 4M49A 4CMHA 3WLEA 5AOVA 1PGNA 5KTKA 1DHRA 2VN8A 1SAYA 4YT8A 3AU9A 4K6CA 2YUTA 4CQLA 4KDFA 1NASA 4Z6KA 4RLHA 1JVSA 3I6IA 4CQMD 4S1VA 3OETA 1Q2XA 4XDZA 2W90A 3KV3O 3U3XA 3JYQA 4BKOA 2BFOA 3D4OA 1N7HA 1KVUA 1QR6A 2Q50A 3NTOA 1I2CA 4WLNA 2JD1A 3DR3A 4DPLA 1UDAA 2G5CA 1LEHA 3KOUA 1IUKA 1LU9A 2Q1UA 2TMDA 4CMJA 5IFLA 1UP6A 3OECA 1WZEA 1GPJA 3N74A 3INRA 2C29D 2EJVA 2UDPA 3PXXA 1AN9A 1EMDA 5IN5A 1AHHA 5KWEA 3LT0A 3WWZA 3LC7O 4HNHA 3VDQA 1K6XA 3BHIA 5IAAA 1IE3A 3GNTA 3PJFA 1MXHA 1YDWA 4LRSB 3I9KA 4BNKA 4D0SA 3GDFA 4NK4A 3D3WB 2B35A 3OEYA 5COAA 3LLVA 2VTEA 3SC4A 4H7PA 4NPCA 4M86A 2W98A 4FGSA 4B7XA 1UAGA 3GC6A 3GRKA 3KLMX 4LISA 4E31A 6ADHA 3D0OA 3U4DA 2AQHA 5EPOA 1ENPA 4ZN6A 2P9GA 1X1EA 4J2HA 3L6EA 1Z75A 3DC2A 4GX1A 2GZ3A 4YAIA 3GVXA 1RYDA 3VC7A 2PKQO 1XWFA 1H6DA 4Q3DA 1M2WA 3HN7A 4YWJA 3NDJA 1Y8RB 4MVJE 1U9JA 2YQ4A 2RHRA 1C14A 1KEWA 2ZTVA 4DGSA 5HA5A 4DVJA 1A27A 1UXIA 1ZO8A 4AFNA 4CM4B 4DBZA 5A5FA 3ZCXA 4J1NA 4KOAA 2EKLA 2WYWA 3FR8A 1DJQA 5DOZA 3PDUA 4L4RA 1I10A 1DLJA 1IHXA 2HDHA 3ZN2A 4DYDA 5JW6A 5U4QA 1J49A 4YPOA 1KIFA 4R3NA 1ADGA 1I3LA 3QQPA 1BXZA 5G0SA 4JP2A 5IZ4A 1Q7BA 2H6EA 4EI2A 1KC3A 4WPGA 3DB2A 2Y1GA 5JSFA 2PGLA 4ITUA 4ALMA 3JQ7A 4OYRA 4NFSA 4EUHA 5L9AA 3DBRB 1GQYA 3CEAA 4J0FA 1ADBA 1M67A 2C07A 3QLJA 4PLWA 1C1XA 4BO6A 4EEZA 4FGWA 1IYZA 4Z0TA 3WGHA 3UOGA 4I5FA 1F14A 1P74A 3GVIA 1NQTA 4YAJA 4DIOA 1NHGA 1BMDA 3PHIA 2B37A 1WMAA 1Y6JA 5BR7A 5FYDA 3O4RA 4B4UA 7ADHA 3NGXA 1CIVA 1Y1PA 1GAEO 2XPCA 3GRPA 1YBAA 2EKQA 1IL0A 3GEDA 1UZMA 3NX4A 3P7MA 1KYQA 5L7WA 4RVSA 3HB5X 1EEHA 3C3XA 4J6FA 3LLSA 4EW6A 4K6FA 2P9EA 4YJFA 3RUHA 3WLFA 5JFOA 3FNEA 2EEZA 5ER9A 3FRJA 3JQAD 4I1IA 2BKAA 2LDXA 4F3YA 4TROA 3WNQA 3ZWVA 1E1NA 1U7HA 5A04A 3U0BA 3WG9A 1HZZA 5MGBA 3AOEC 1JWAB 1VJ0A 1MFZA 4A27A 3LF1A 4DXHA 4BNVA 3F1KA 3VAZA 1P77A 3W4IA 4IXWA 3PVZA 1N5DA 4UVIA 5DP1A 2EJWA 1ML3A 4RJTA 5I9NA 3FR7A 3ZU3A 1HL3A 1VPDA 2ZYDA 3K73O 3OQBA 2VNSA 4XQ9A 5CDGA 7MDHA 1OBFO 5JMPA 1VI2A 3LSYA 4NU5A 5A3VA 1YVEI 2QHXA 2NTNA 2D2IA 2HSDA 1EVYA 3D3EA 4N5MA 3ZWCA 2AG5A 3RSHA 2Q4EA 4IQGA 3WGGA 2J6IA 1QYVA 1QMGA 1QSGA 4M1QA 4MOWA 4QO8A 3W4KA 3GUYA 4R68A 1NXQA 1CEQA 3L9WA 4BQRA 3GOHA 2OFPA 2I65A 4IY1A 2NV6A 4PZDA 5AQ1A 2NWQA 1T2EA 5FFFA 3WQRA 4E2YA 3RI3A 1LRJA 4NMHA 3NGLA 1ULUA 2C0CA 3H7AA 1BDMA 2NVWA 4CMIA 4EJMA 2FSVA 1EVZA 2QW8A 1B7GO 2Y0CA 3RUEA 1VC2A 1R66A 1WVGA 3WQSB 1S6YA 3CXRA 1D3AA 1U7TA 2PLAA 3UN1A 5JLAA 2BGLA 5CG1A 3GF4A 1VJ1A 1PZGA 2IE0A 3UKOA 5CPBA 2RHCA 2BH9A 4GLLA 1B0AA 4ND1A 1HETA 5A05A 3RVDA 3AK4A 1X7GA 1FJHA 2YZ7A 2OL4A 3EK2A 3ICCA 3GAFA 1HF3A 2PD6A 4OHUA 4YAGA 5I7EA 3KXDA 4PZCA 4G65A 4FIZA 2HK8A 4MJLA 1N9GA 3LK7A 5EESA 1YRLA 4B7UA 4HADA 3RASA 3I6QA 5ENDA 5A3JA 3KSDO 4I08A 1NFFA 4I9NA 2IRWA 1IHYA 3LT1A 2XF8A 1OZAA 1YONA 3AFNA 3H9JA 4FFRA 2GF2A 3GAZA 5B4UA 3CKYA 3ZH2A 1BXGB 5AXDA 4IMPA 1BRMA 1C1DA 4NJMA 3SLKA 1U8FO 1M66A 1BW9B 4BB6A 3PRJA 3NT5A 2HU2A 3SXPA 1Q7GA 4BMNA 4Z3DA 5HRUA 4BQPA 3BHMA 3RJ5A 4OO3A 3FHLA 3SVTA 2V6BA 2ZK7A 2AMFA 4YDRA 4AJNA 4BV9A 4N5NA 3GNQA 1W4ZA 4CM9A 4BNHA 4OSPA 3FSRA 2EIHA 1E1MA 1GTMA 1E3IA 3M2PA 1P44A 4WLEA 2X0JA 3ZZNA 1RKXA 5AXCA 2ZYGA 3DFUA 1U3VA 4DC1A 4RL6A 2RH4A 2I66A 4IDEA 3JD1A 1I36A 3HQ4O 4IPTA 4E5YA 1DB3A 3U4IA 3TFOA 2J3KA 4XJTA 3I23A 2OHXA 1EUCA 5KVSA 2BI8A 1T1SA 2F00A 4F45A 2E6UX 2VHZA 3ZNQA 3DZJA 5T5QA 4FJ2A 4YAEA 5EIOA 1XSEA 4BGEA 4DUPA 1G0OA 2ET6A 3H3JA 2JD2A 2YHIA 4BB5A 1ZMOA 1GQ2A 3WSWA 4ND5A 1DIHA 1NR7A 4XB1A 4BNZA 3FPLA 1KY5A 1XLTA 3R0IA 4OM8A 3S2FA 4BNTA 2GLXA 3U9LA 1HYHA 3IKVA 4WJZA 4LCEA 1B3BA 1KBZA 2GN4A 3FWNA 4AJOA 5F1PA 4AG3A 4Y6RA 3TPCA 1LDMA 3H9QA 1H93A 2VZ8A 2AQ8A 4GMFA 4KTTE 4BMSA 2NUAA 5G4KA 3EUWA 2CF5A 1OC4A 2GPTA 4QEDA 3OA2A 4D42A 1PQPA 3F4LA 4PG4A 5EQFA 1I3NA 2B4TO 2O48X 2PZMA 5AVOA 4CLOB 2VRCA 3P5SA 1DIGA 4MINA 2GSDA 1T2DA 2GCGA 3BTVA 4A26A 2GUGA 1H6CA 5ENVA 4E13A 4BUCA 4K1LA 8ADHA 1P1FA 3TZKA 1LLUA 2WD7B 4ZHSA 1JTVA 3TN7A 4XRRA 5C7IO 1FMCA 1VM6A 4WE3A 1Y8QA 4CM3A 5BNTA 3BMNA 3VKUA 5IXYA 3BMCA 4UUMA 3WIEA 3BMQA 5L4NA 3JD3A 2V6MA 3H3FA 3BAZA 1ISHA 3WYCA 4BS9A 4IJWA 4U6QA 5CAEA 2CDCA 2DAPA 3ZW8A 5IDWA 1VKNA 4PIVA 3WOHA 2ZB4A 3IP3A 1DFHA 3RKUA 3DAPA 1M6HA 2NACA 5I7SA 1WPQA 4R51A 3F5SA 1EK5A 4MVJD 3RJ9A 5T8KC 4YJGB 1YBVA 3JYNA 4CJXA 5A9SA 4E30A 2BFMA 4CQMB 1HDYA 3VZQA 2HMUA 1C0LA 1WDLA 2X5KO 4UEOA 3WQQA 3ZGYA 2CY0A 4PCVA 4E33A 3W6UA 2YV3A 4ALNA 3CMMA 4HFNA 3ZU5A 3B1JA 1U4OA 3SJUA 3DMYA 3FI9A 4MPDA 1LBEA 5G0WA 3KYCB 4IDGA 3NKLA 1KC1A 4GI2A 3ETGA 2OO5A 2JL1A 1SC6A 2YFHA 4J9VA 4M55A 4AVYA 4FFOA 2WE8A 5I7VA 1R6DA 1O5IA 1SBYA 4U0KA 3VKVA 1VJTA 2D59A 2DM6A 9LDBA 3UGKA 1ISMA 1EZ4A 4W7IA 2X9VA 4MVJI 3TZHA 3SC6A 1E3EA 1LA2A 2WM3A 3OHSX 3DZHA 4EBFA 2X58A 4YT2A 3I9NA 3I9MA 4C7JA 4HUJA 4GWGA 4ALJA 1TT5A 3IOYA 4BGVA 4D3FA 3BTOA 2ZB3A 1Y5RA 4LMRA 3IP1A 1B2LA 4RZHA 1H6BA 1I32A 1Q0HA 1DPGA 4RDHA 4DPKA 4FW8A 4UUPA 2I5PO 5JAZA 1IB6A 3JYOA 3U4HA 4W99A 4M8SA 3AM3A 1LLDA 4Z0HO 5EERA 2A9FA 2NU6A 3A4VA 1PS9A 4BGIA 2TMGA 5AYVA 3AUTA 1LJ8A 2O2YA 3NT2A 1UP4A 3GHYA 4HFMA 1QRRA 3K2BA 4RPJA 1NNUA 4XDYA 4IJKA 3X2FA 2VZ9A 4ID9A 1SB9A 2Y1EA 1GEGA 2QYTA 3DOJA 2FHSA 3T4XA 2NQTA 2X5JO 3JQCA 5L3ZA 4CODB 4BO8A 4D44A 3OQ6A 2VTDA 5IN4A 1UZNA 1LXCA 1R15A 1NPTO 2FOIA 5BSFA 1XU9A 1ADCA 3HG7A 4LN1A 3K5PA 4MIOA 2X4GA 1MA0A 3HE3A 2GD1O 5FWNA 4Z9FA 4FSHA 2OP1A 4IM7A 3GHHA 3DBVO 2VRBA 1E3WA 3JQEA 1B8VA 1JAYA 5HTOA 2VQ3A 2VCYA 3F6YA 3IS3A 3IJRA 4MP6A 3RUFA 4C4OA 4MDHA 3WMXA 5KVCA 1MG0A 3HNPA 4J1SA 1EBUA 4MVJF 1HE5A 5KJ6A 1Y9EA 3AFMA 1DRVA 3NTRA 2XXBA 3S1LA 4CM8B 3QVXA 2UV8A 4HBGA 2DBRA 4DL9A 5L95A 5IDQA 2B83A 1E7SA 4YXFA 2EW8A 3LQFA 3NDIA 4R16A 1T25A 1Z45A 2R6JA 3V5NA 2O23A 3ASUA 1KERA 1Y81A 1Z73A 3FNHA 3PGXA 4DIBA 5TC4A 4JBGA 4R5MA 2HK9A 5B12A 1O89A 3CE6A 4B3JA 4RVUA 1KVSA 3GFBA 4W9NA 4E3ZA 5B37A 3QVWA 2ZB7A 4A73A 4PLGA 3L77A 2C54A 5TF4A 2CSUA 2NVUB 5IDYA 3GFGA 4LRTB 4CUZA 3JQAB 3I83A 4MKXA 3H2SA 4YT5A 4WLFA 1PZHA 3RU7A 4BKPA 4XQGA 3IDSA 1U2DA 2VT2A 3KSUA 2E49A 2X8LA 4AJJA 4OKNA 9LDTA 2HRBA 4PLHA 5F5LA 5G4LA 1DRWA 3F5QA 2HRZA 4DBVO 1W8DA 4XKJA 3DBLA 1JKJA 4RO0A 3DAGA 5CHEA 4FCCA 4Q9NA 2B4RO 2DFDA 3CTMA 2Y66A 1ZSNA 4BNIA 3MJEA 2P9CA 3Q11A 3K31A 2JKVA 4BKQA 3UW3A 4INAA 3TOZA 2BD0A 1QYDA 4XZ3A 3Q1LA 4CLDA 3INGA 2ZCVA 3ZV4A 1BWSA 5ES3A 2D0IA 4BNYA 2DQ4A 2WEKA 3CZMA 4Y9DA 4RF5A 2CF6A 4H15A 5IZCC 2HMVA 3JD4A 4RVFA 4J7XA 1YL5A 2PK3A 3PLNA 1QXSA 4HFJA 4XJSA 1U3TA 3JQGB 3ZHBA 3MJSA 4CMEA 2R00A 4CMGA 3GPIA 2J3IA 2J5QA 2NSDA 5JCJA 3RBZA 3AOGA 1V8BA 4GKVA 5CFZA 4XQCA 3OBBA 1NWHA 3W8DA 3PJEA 4BO4A 1YH3A 4Y6SA 4QO7A 5TT1A 2IZ0A 2VHXA 2ZTLA 4OXYA 3ZWYA 4CM9D 3BYZA 2FZEA 1V9LA 1LSSA 4J90A 4A0SA 1P33A 1OMOA 1QYCA 3H5AA 5ICSA 5TT0A 2X86A 4AJ1A 1J4AA 3DQPA 1DIAA 2P5YA 4Z0PA 5TQVA 4B4WA 1U2GA 2CUKA 4TRNA 2NVBA 2Y67A 1YO6A 3LC1O 4RVDA 4MKZA 4PRKA 4O6VA 2HJSA 3HHPA 4CMCA 1MUUA 3I1JA 4NQZA 5MDHA 1XEAA 2I67A 1FF9A 3HB4X 4J4BA 3L4BC 4ZQFA 1K5HA 4D79A 4RQUA 5K0ZA 1NFQA 3C8MA 3QJ5A 5ADHA 1ZK4A 3I52A 2X1HA 3PIDA 3H9UA 2RBEA 3FNFA 1EVJA 3B70A 1V3UA 3W4JA 4EDFA 1Y5MA 4CV2A 1LLQA 2X22A 3OA0A 4Z3KA 5KCZA 2H63A 1KEVA 4WASA 3MZ0A 4GGPA 1ONNA 2JFHA 2Q49A 3DZKA 1YBMA 3E9MA 3PI7A 3KETA 2IXBA 4MO2A 4CUJA 2JFGA 1I3KA 3KLPX 1PGOA 2Q2QA 3FTNA 5I9LA 1F8GA 3WJ7A 2GZ1A 1XGKA 1LRKA 1PGQA 3G1UA 4KUEA 1YB5A 2RH8A 4ZRMA 4JJGA 3TNLA 3OFSA 4I9UA 4BOYA 1R12A 2O7QA 3GDOA 2VHVA 1HRDA 2VRCD 3AOEA 4WEQA 5KVVA 1FDVA 2FR8A 4P8RA 3S2IA 4NG5A 3W6ZA 2PTGA 2GN8A 2CZCA 3C1TA 1BXKA 2VWPA 3JQBC 3UAGA 5I7FA 3E5RA 1Q7CA 3E1KA 2CVOA 4IDAA 3E9NA 2OXIA 3RUDA 3Q2IA 3UF0A 2GGSA 3KZVA 4QQRA 1GPDG 2IDZA 5CP8A 4BNWA 4U7WA 4OOFA 3PJDA 4D3SA 5JCXA 1R0KA 4J7UA 3C7CB 1PJTA 4Q3AA 5F1KA 3MTGA 1E77A 3V1YA 3VH3A 1QV6A 1ORRA 5IF3A 3LYLA 2DLDA 4XYGA 3P2OA 4J4TA 5TSDA 1MP0A 1H2BA 2VUSA 4IDBA 4IS3A 1TI7A 4CM4A 3JQDA 2EGGA 4CQLB 5BSGA 4WKGA 2Y99A 2YQ5A 5DN9A 3ZV6A 2CNBA 5K6AA 4GGOA 4XR4A 1ZIDA 5CDTA 4MVJA 3UXYA 4O63O 3RFXA 4CR7A 4DMLA 4DQXA 1A7AA 5KVQA 4BHTA 3JD2A 1HYGA 1LTHR 4AJLA 1G6KA 1PIWA 1R4NA 1PQWA 3CZRA 3NRCA 3RC2A 3L07A 2OOSA 2VT3A 3DZGA 3C24A 2DVMA 5JPIA 2DC1A 1FK8A 4C7KA 2ZYAA 1SOWA 2NU7A 2Q99A 3CH6A 3WJAA 4U5QA 3VZPA 3JYPA 4TKLA 4F6LA 5I8WA 1MC5A 3PFWO 1RWBA 2W2KB 3RU9A 4P4LA 4WCFC 5TNXA 3OJOA 2X5OA 5JAQA 4M89A 3GK3A 1E3JA 1JA9A 3A06A 5F1OA 4FOOA 1ARZA 1A4UA 1LDGA 3AI2A 1YB1A 5CEJA 4ZGWA 2QX7A 4LK3A 1XYGA 3BXXA 1SNYA 4A10A 4BNMA 1YKFA 3F9IA 4RPGA 2Z5LA 3W1VA 5FI5A 2J8ZA 3QWAA 5HWSA 5F21A 1E1LA 1EDZA 2EHDA 3R1IA 5C7LO 2DBVO 1UZLA 5JMWA 3VPFA 1AHIA 2J3JA 3QRWA 2OBNA 2Y0EA 3QWHA 3COSA 2HKIA 4FPXA 5GZ1A 4ZQGA 3GH3A 3WDSA 1CJCA 2DT5A 2PR2A 3G0OA 3RKRA 2I9PA 3HDQA 5A02A 1IPEA 1Q1NA 3FF4A 5L40A 3O9ZA 1D1TA 1KY4A 3HJAA 4WOJA 1HLPA 2HAEA 3VPSA 3ZWAA 1BGVA 1PWZA 8LDHA 5JDIC 2D5AA 4GBJA 1ZNQO 4B4VA 4ROSA 3VTFA 3GN1A 4OXKA 4R1UA 3JQFA 4HV4A 2EW2A 4CUKA 4NFYA 1RM4A 1GYRA 1RM5A 4TRRA 5CDYA 3UCXA 3H9EO 3TFQA 3JD0A 4QUKA 4YJDA 3ROKA 1P3DA 1L7DA 3VH1A 4AJEA 5BNFA 1I3MA 3R6DA 4DRYA 4GX5A 1VL6A 2JHGA 4P4NA 4JIGA 3RUIA 2PZLA 4R1TA 2FN7A 3JQ6A 3JQ7B 3L0DA 4RF3A 1P0FA 1K2WA 4F46A 1JN0A 4BKRA 1XCBA 1YOVA 4NIMA 4CLRA 1P0CA 2PD3A 1HSOA 5JDCA 3E03A 3QSGA 1LNQA 2GO1A 4J4HA 4BV8A 5EJ2A 1LQUA 1U5AA 2BGMA 1CWUA 2I3GA 2HMTA 4U0JA 2QQ5A 2VHYA 5DT9A 4ZRNA 3U62A 3WGYA 3DTTA 3PJGA 2E48A 3AY3A 3KM0A 3A14A 4QFCA 2DTEA 1ZFNA 4WCDA 3DBHA 3O26A 2JAHA 3MJTA 4HX5A 4P22A 1DAOA 2SCUA 4IXTA 1RM3A 2XAAA 5A03A 4HWKA 3RC1A 3EHEA 1IZ0A 1YQDA 4KWIA 5T6BA 3ROQA 5T57A 4YJFB 3WFIA 1EFKA 4D0RA 1H2HA 1XQ1A 4BO9A 4FQ8A 1F06A 4CPDA 4L73A 2AE1A 3ZU2A 3EAGA 2GRAA 1DBVO 1WDMA 4XQEA 4X54A 4E2XA 1SEPA 3JCZA 4J3FA 4BNGA 3ADOA 2NTJA 5BQFA 4HNGA 4BO2A 5ICMA 1E7MA 3A28A 3W8EA 4DREA 1D1SA 1BXGA 3QY9A 2C7GA 1Z7BA 3WB9A 1BW9A 3V2HA 2Z1NA 2BMAA 2W8ZA 3U09A 3MWEB 1XIVA 2JCYA 1T4DA 2VYNA 2FWMX 4GH5A 4LSMA 5F5NA 3PQFA 1H5QA 4FS3A 2AEJA 3SLGA 5TLSA 1YDEA 4OXNA 1VLLA 2V65A 4IJUA 3RBXA 5LDGA 1V3TA 5LCXA 3A1NA 3H5RA 5KJEA 3UH1A 3HFGA 3E5MA 3VPXA 4ZJUA 2X7HA 4IZIA 4RVGA 1MLDA 5EL0A 3WGOA 1EVIA 1GD1O 1K89A 4Q39A 3WICA 4D3DA 4P38A 4R9RA 4R5HA 1VSVA 5JCJD 2HMWA 3ABIA 4ESOA 4CMIB 2YDYA 2DFVA 2DBZA 3KB6A 2X0IA 2HJRA 2BFAA 2D5CA 1SZJG 3H9GA 4A2CA 3SEFA 2HUNA 1OC2A 3SJ7A 1EBFA 5H81A 3KYDB 1Q0LA 1N7GA 4XB2A 1XELA 1DJNA 2B0JA 2HO5A 1GDHA 1M6WA 3PHGA 3ZWOA 1EK6A 4I5DA 1PJ2A 3Q6IA 1Z6ZA 3KRTA 4MP8A 3OF2A 1DFGA 4Q3NA 4ONEA 5KJCA 3GG2A 4JBIA 2Y1OA 1N9GB 4E4YA 1A4IA 4PFJA 1CYDA 1DEHA 4D7AA 5JNLA 2P2SA 4G2NA 1PEDA 1J0XO 1K6JA 3SX2A 1NQOA 1NR1A 2Q2VA 3GDGA 2OUIA 1E3LA 4IUYA 1YGYA 1XQ6A 1PR9A 3FNGA 4RF4A 3NV9A 1LC0A 4WGGA 4TRMA 3I9JA 4Q3EA 4CLXA 4OIMA 3U49A 1ZMTA 1DHTA 2GDZA 5HM8A 1Y9AA 1QLHA 3ZDFA 2NQ8A 3BMOA 2WSBA 1GU7A 1UAYA 2UYYA 2X9NA 4KP7A 4YJHA 2AQKA 1KETA 4IIVA 3ONEA 1X7HA 1ZVMA 1GZ3A 1ZSVA 3O03A 2DBQA 1E1KA 1HE4A 2Q1SA 2UUPA 4FR5A 3RROA 4GKBA 4J7CA 3OEWA 3U4CA 3AY7A 2V6FA 3D1LA 4AJPA 1PL7A 3F47A 4QT0A 5HBRA 4CMBA 2NLOA 1S7CA 1DOHA 4EZBA 5JYEA 3QWBA 1T26A 3W8FA 1LQTA 2AEMA 1LDEA 4YJGA 3LT4A 3ZWNA 3Q2KA 2C5EA 4PLTA 3EZLA 4J91A 1AXEA 3AJRA 3E9QA 3EZYA 2O3JA 3DFZA 3K2EA 4OKIA 1E5QA 3E48A 3MWDB 1EQUA 4G5HA 2EWMA 2YHIB 4CM5A 4EEXA 1R4MA 4RPLA 2O3SA 3H8VA 3TL2A 3UCFA 2EERA 1K6IA 4R3WA 3ZI0A 3KEOA 1DXYA 1FDTA 1R37A 4EUFA 3RC9A 4AJ4A 1W73A 1P9LA 3WMWA 2V6GA 4CM6A 1NHWA 4EJ0A 4XRGA 5EMHA 1EE2A 5CPFA 1FXSA 2VWQA 4OGWA 5THKA 1WNTA 1DRUA 4IDDA 2AE2A 1LUAA 1NYTA 4JJFA 1T4BA 1TB4A 3IMFA 4UUOA 1YWGO 4BO0A 3JQ9C 5C5IA 4E5MA 1SMKA 3KTDA 4UUNA 3WXBA 1HXHA 4NHEA 3PQDA 5DBGA 1ZK1A 1VE9A 1NX6A 4Z9YA 3AUSA 4JLWA 4OL9A 1KEPA 1B14A 3GG9A 3NT4A 4BIIA 3FBGA 3O8QA 1NWCA 1CETA 4UEKA 1D4FA 1PU2A 3BMNB 3BMCB 3TF5A 2WDZA 3ROMA 4DTIA 3BMQB 1IULA 4XA8A 3VTZA 4TZTA 1NVGA 1LC3A 3TSCA 1GR0A 3DWFA 1P31A 2JD0A 4G81A 4GX0A 1XHLA 3VZSA 2BLLA 3R3SA 4RORA 3ORFA 1NAIA 4HKTA 4IIUA 2JCVA 3ZWXA 1IY8A 3AI1A 1M75A 3GMDA 3NEPX 1F12A 2WJPA 2I3AA 1HDXA 4ND2A 4OSOA 5A9SB 3GNSA 2CDAA 4NFHA 4XIJA 2HMSA 1I0ZA 4E6PA 3GGPA 3JQ8A 3E6AA 1SEVA 3GN2A 4BMVA 5LC1A 1O8CA 2WE7A 3L4SO 2HK7A 2PFGA 1J6UA 3G1TA 3ZWBA 3FBTA 3ZHZA 3WS7A 4E21A 3AY6A 2NU8A 4RPKA 4GVXA 2VOEA 3L6OO 3RQSA 3BIOA 3GA0A 3AM5A 4NBWA 4QECA 2EP7A 3HZZA 4XGIA 1GL3A 1KVRA 1Q0QA 4D43A 4JGBA 4NBRA 1ENYA 2IZZA 2ZJ0A 3KVOA 4KTVE 5L53A 3GEMA 4YRDA 2DUWA 1PWXA 4NK5A 1TT5B 3MJ4A 4WECA 1VSUA 1B16A 3JTMA 3H2ZA 4UVDA 3ZNNA 2WYVA 4PVCA 4Z9XA 2J3HA 1YL6A 4AL4A 3HUDA 4TKMA 3G3EA 1NM5A 5ER6A 4DLBA 3C1AA 2NVUA 3FWZA 4BO1A 1XKQA 4D46A 1UXHA 5C7OO 3QE3A 3ADPA 2X6TA 4PVDA 1O95A 5KNLA 1WW8A 3PYMA 4TQGA 5G2OA 3ITDA 5JC8A 2I76A 1T2CA 4KQWA 4YVFA 4NR0A 3HDYA 3HSKA 1WMBA 3BHJA 5DBFA 3V2GA 3CSDA 4IQ0A 1H0KA 3T7CA 4RZIA 3TQHA 4OJNA 5A5EA 2NADA 1HDRA 3F4BA 5DULA 4DC0A 1RYEA 2P4QA 1BG6A 2A35A 3LT2A 4CL3A 1B15A 3CINA 5JAIA 4DWVA 4J16A 1PJSA 3IUPA 1ENZA 3TZ6A 4FB5A 4ND3A 3GZNA 2Q46A 5JE8A 3MOIA 3RFVA 4YRBA 3PQEA 1E3WB 4JX8A 3OJ0A 1KEUA 4YAKA 3NAQA 1HTBA 3PLRA 3WTBA 1XU7A 3DHYA 4AJ2A 3JQGA 3S55A 3T7EA 3RUAA 2VYND 4AJKA 4R69A 5GMOA 1X0XA 1E92A 2P68A 4L4XA 4E5NA 4FFPA 4TMFA 4RVHA 2FZWA 1QORA 1ZSYA 4N18A 1A72A 4S3MA 2C59A 4NBUA 1V6AA 5BSEA 4HXYA 1AGNA 4J9UE 4TWRA 2PH5A 2YY7A 2PKRA 3GT0A 3MEQA 3WBBA 1YE3A 4BNFA 4BNUA 4J0EA 1UR5A 2AEFA 3LU1A 1WWKA 4QTZA 1TXGA 4OH1A 4A5OA 4LMPA 3TRIA 2FMUA 4J1TA 3ZWPA 2ZKLA 2Q1TA 2DTXA 2IZ1A 3AWDA 1BSVA 5HS6A 1DIBA 2DPHA 4IBOA 4XR9A 2HQ1A 3L6DA 3ST7A 3IAHA 3QA9A 1ZJYA 1LDNA 1HDCA 1E6EA 4FFLA 1HE2A 3TZQA 1DIRA 3OJEA 2WTBA 3DOCA 4B8WA 3EYWA 1L7EA 3RC7A 3WGQA 1B8PA 2QG4A 4MVJH 2HLPA 4ALLA 5EINA 1GUYA 2QZZA 1P1RA 4F6CA 2QZ9A 1F17A 1UDCA 1X14A 2PZKA 4O0LA 4GSLA 4XYLA 4NH4A 4FC7A 3S8MA 4O59O 2FRDA 4FD3A 1LRLA 4UULA 1IOLA 3GGGA 1C3VA 1MFPA 3E18A 4FOSA 1DC6A 4BO5A 1YQGA 4MVJG 3ZU4A 4DMMA 1WXDA 1ZZEA 1E3SA 1HDGO 1ZEJA 4WCFB 1UXGA 3PEFA 2VYVA 2GR9A 1ZH8A 2FR1A 4Q3BA 3RWBA 2G1UA 2EXXA 3RAJA 1JDJA 1WLYA 2A92A 4BO7A 1GEEA 3O38A 3QWIA 1PJLA 4I5GA 3OJFA 4BNXA 2C20A 2PNFA 2ZIZA 4R1SA 4ZU3A 2NNLD 4K28A 4QXMA 1UP7A 5G0TA 1EQ2A 3VOSA 1PX0A 4PLCA 3DMTC 4GPD1 3VHRA 1O0SA 3PIIA 1A5ZA 4D45A 1HDOA 5TIIA 3D3WA 2WD8A 3OP4A 3WX0A 5DZSA 4XYMA 5FF9A 2FP4A 3X2EA 1NQAO 1O94A 4E5PA 1I5RA 1P1IA 5EQDA 4ILKA 1C0KA 4YRAA 2X0RA 3MJVA 4IS2A 3FD8A 5DNAA 1NVTA 3PP8A 5EN4A 4ZVVA 2H5LA 2X9GA 3N58A 3PHHA 5TS3A 5B4VA 4XGKA 2EG9A 3IIEA 3H6KA 4FJ1A 1TVEA 3QHAA 1MC4A 3WYBA 4LVUA 2O7SA 5GZ3A 2EKPA 5GZ6A 3HDJA 4K9DA 4TSKA 2W2LA 3D4NA 4HP8A 4W9NC 2ILTA 3QW2A 1V0JA 2YV1A 4FDAA 1Y8RA 3GGOA 2VUUA 4AJIA 4J1QA 3G17A 3WFJA 2VWGA 3P19A 3ZHYA 4XD2A 3PYLA 1ISIA 2B4QA 3ONDA 2W2KA 3OM9A 3D64A 2OMEA 1WDKA 3FN4A 4M54A 2UVDA 2VUTA 5IDXA 1LX6A 2QRLA 3F3SA 3FCOA 1NPYA 3H5NA 3M1LA 4PG6A 2JJYA 2FPIA 2A94A 4ZQEA 2DUUA 4UVEA 5KKCA 3QVTA 4GL4A 4ZICA 2IEDA 5JO9A 1FDSA 1O6ZA 2AW5A 3E82A 3LVFO 3DBRA 2EV9A 1G1AA 2RIRA 4NI5A 1R0SA 1ZCJA 5ILGA 4EJ6A 1RM0A 4N7RA 1VKOA 4CMKA 4IJVA 1KVQA 1ISGA 1TLTA 3I4FA 1N2SA 4YCAA 3NTQA 5TJHA 4FBGA 5CG2A 2QIOA 5L45A 2YJZA 2QYSA 3NDRA 5L51A 5DCYA 4B3HA 1U4SA 3GQVA 2GN6A 4WNCA 4OQYA 4CMEC 2Z1MA 4KUHA 4UEJA 4BNJA 2R00C 1B26A 3LF2A 2B5WA 3ROPA 2P91A 3RIHA 4GMGA 1WAMA 3OH8A 4NZ9A 2D1YA 4EITA 4RPHA 1JKFA 2PZJA 5G0UA 2DKNA 1CDOA 5JS6A 4FN4A 1KVTA 3B1FA 1UDBA 3AU8A 3WBFA 5BSHA 2RAFA 1HWYA 3DL2A 3ULKA 1KOLA 2BRUA 2Q3EA 1R4NB 4L4SA 3VVCA 1GADO 5KJFA 4IGEA 2R2GA 3F1LA 3PYXA 3PZRA 1T2FA 1XA0A 2O3RA 1MGOA 3NJ8A 3OIDA 4Y98A 1ZK0A 2JHFA 3VH2A 2O3QA 4IDFA 4JN6B 4YQYA 4OMUA 3VH4A 4CL8A 5H83A 1KS9A 1I30A 4DIFA 3OICA 5DOVA 3TZCA 3U5TA 1HE3A 1BDBA 4D41A 3IJPA 2GASA 4KZPA 4PLZA 1HLDA 1YJQA 4XYEA 1PZEA 4CR6A 2PA3A 3CUKA 4R9SA 1Z7EA 3ETDA 3IUSA 2D4AA 4JNKA 1DC4A 2JCXA 4H16A 1DLIA 2I99A 1P1KA 3L9XA 1SCUA 4YQZA 5IJZA 4KQXA 5DCUA 2YYYA 5ITVA 1I2BA 2FSSA 3GY0A 3EY4A 2B36A 4IQ8A 3C7AA 4MIYA 4N5LA 2G76A 3NJ4A 4BVAA 2EF1A 3ZV5A 1C1XB 1P1HA 2W4QA 3D5QA 3EMKA 5IG2A 3I3OA 2O4CA 4XWYA 3OSUA 1CQIA 5TGDA 1K3TA 3C1OA 4NBTA 4RCVA 1PS8A 2P4HX 2CVZA 4J2OA 5ITWA 1VL0A 5L4SA 3TDKA 2VHWA 2C7VA 3M2TA 3ZNOA 5CDUA 3TL3A 3HDHA 3E8XA 1JKIA 3GVHA 4N54A 4W7HA 3ONFA 2E4AA 2XOXA 4PG8A 1GYQA 2HCTA 2IXAA 3WGZA 1CRWG 1M76A 2O3TA 3F46A 4GQAA 4OOEA 5TRTA 3QIVA 4PLPA 4PN3A 1LI4A 1VRWA 4YYZA 3R3JA 1PQUA 4NJOA 3DONA 1ISFA 3OIGA 3PTZA 5JAMA 1NTOA 3C7DB 4JCOA 4B4OA 3G79A 3KO8A 2AQIA 3BTUA 4IGFA 3GLQA 4UVGA 3EDMA 3P2YA 4FFNA 2Q45A 4IDCA 2BF7A 3Q3CA 2BGKA 4KMSA 4URFA 1D7OA 3A9WA 2WMDA 2YW9A 2FPPA 4CM7A 1U28A 3WYEA 4WNIA 3RD5A 1E5LA 5K6AC 4R54A 4WEOA 3JV7A 1LSJA 1YJ8A 2O50A 3EVNA 1YOVB 4HFRA 4CLRB 4PG7A 3BTSA 5CEFA 3RUCA 2VZ0A 1NPDA 3GVPA 1ADFA 3K9QO 3LZ6A 2C5AA 1NVMB 4TRJA 1A9YA 1HYEA 4OQZA 3CMCO 2QRJA 3VZRA 1ZEMA 1JWBB 5CDSA 4II2A 1P1JA 3UICA 3N7UA 3V8BA 5T8KA 3DBHB 3KYDA 5A4DA 4R4JA 5JBIA 1UUFA 2G17A 1PJCA 1XG5A 3ZNPA 4RLSA 4E12A 1A7KA 1JAXA 3ASVA 4YR9A 3UCEA 1FDWA 3AM4A 3IKTA 3JQ9A 2P5UA 2YV2A 1QYWA 1MX3A 3K92A 2Y1FA 5A9RA 2B5VA 1ZXLA 4RF2A 4B79A 2Y93A 2O3UA 3I5MA 2GN9A 1E7RA 1DSSG 4PRLA 4DA9A 4P4GA 2Y68A 1TA4A 3ANLA 3S2EA 1H9BA 2Y1CA 5ILOA 3I4CA 1Z82A 4ND4A 4H3VA 4LVCA 2FPGA 1DDOA 1ONPA 1JU9A 1C0PA 2BHLA 5COQA 1HSZA 3DHEA 4CV0A 1E7YA 4MVJM 2A4KA 5JY6A 3ZHXA 4OAQA 2PGDA 3PGJA 1U5CA 4R41A 1FDUA 5L7YA 5DCWA 3ZWMA 4DLLA 5DP2A 2ZJ1A 1GQQA 4AJHA 4B8ZA 3AUAA 4HY3A 5DF1A 4DLAA 5A1TA 2VYVD 3GPDG 2H1SA 4II3A 1ZK2A 3JQFC 3OJLA 4UREA 3V1UA 1TT7A 2IODA 1JQBA 1SPXA 5H82A 3B20A 4CLOA 1C1DB 4NJMB 3VVBA 3WR5A 3OMLA 1QP8A 1GUZA 1N92A 4M87A 3WGIA 3GR6A 1MXFA 1QYXA 4JBHA 1G0NA 3PWKA 5DDIP 2AA3A 4E5KA 2WD7A 3D5TA 1OFGA 4J49A 4L0QA 1EE9A 3UHAA 2XXJA 1ENOA 4WOKA 1IPFA 4XYBA 4JXKA 1DO8A 3T4EA 2UAGA 2Y1DA 5CEEA 5JDCC 2E82A 1ID1A 2NU9A 2OORA 1R0LA 3WGTA 1QKIA 2OP0A 2OGUA 2J5RA 3INTA 3HADA 4PLFA 1BHSA 3G49A 5K9ZA 4W82A 4DQVA 3UFXA 1BVUA 4EUEA 2CMDA 3KEQA 4CQMA 5IXSA 2ZQYA 4PZEA 1H9AA 2W2LD 4YBZA 3SBOA 2BI7A 3KYBA 1PR3A 1C0IA 1I33A 4YACA 1X1TA 1I2ZA 1W6UA 4RQTA 3HFSA 1HDZA 1U3UA 4YB8A 5F3RA 4ZQBA 1ULSA 1L1FA 2ZB8A 3KYCA 5I8ZA 3BZUA 3DTYA 4LGVA 3OIFA 4R01A 2AHRA 2V7PA 3H4VA 1JVBA 3MOGA 1E6WA 1LLCA 1HZJA 4XX0A 5C37A 4JQCA 2POQX 4XGNA 3EVTA 1NBOA 3BMOB 3NUGA 3RFTA 5B4TA 2OBYA 4WLVA 1X7DA 2D3TA 4BNLA 4YJHB 4E32A 5G4KB 4U8GA 4QX6A 5KOIA 2NM0A 4B3IA 2PD4A 4YTEA 1T1RA 1ZKMA 4WUVA 4L75A 4YT4A 3B1KA 2EGHA 4TVBA 1WZIA 4CV3A 4KUGA 4I8XA 1A9ZA 3V1TC 2PH3A 3GVCA 4QFDA 3GZ4A 1MG5A 1GV1A 4R1NA 1QG6A 2UUOA 2YDXA 4L74A 3GUCA 4XCVA 6LDHA 2GZ2A 3PWZA 2YFQA 4GWKA 3DDNA 1GZ6A 1W0CA 4BNNA 3WIDA 4U6SA 4GX2A 1CQJA 4NDNE 3DAFA 1PJBA 3MCVA 4CLHA 1GY8A 1DFIA 1PS0A 1RPNA 1XDWA 1Y8QB 2DTDA 2O4UX 4GVLA 3KBOA 1R4MB 1NAHA 1YQXA 4IMRA 1T24A 1DC5A 3DHNA 1IZ9A 3EC7A 5U1PA 2JFFA 2C2YA 3H65A 4LSWA 4Y6PA 1J5PA 4GSKA 1OAAA 4EYEA 5IZCA 4WK6A 4Y8VA 1B8UA 3K6JA 3K30A 3QV1A 2PV7A 4W4TA 4A03A 4B7CA 3KHUA 1N1GA 3JSAA 3FTPA 2CFCA 5A06A 1I8TA 4FFMA 4RDIA 1E7QA 1I24A 2Z95A 5B1YA 1NP3A 1UXJA 1H6AA 1H94A 3DXFA 2G82A 2IYPA 4MVJP 1WP4A 3ANNA 2FR0A 1I01A 1LDBA 4XEHA 3RCBA 3C85A 4J43A 1X15A 2X23A 1GYPA 1V3VA 1Z74A 3PHJA 4CM8A 5L7TA 4ZA2A 4Q3CA 1OOEA 1X13A 1SO8A 3ON5A 5HS4A 1EFLA 3PFFA 1PJ3A 3O8QB 4PGFA 3ICPA 3M1AA 3IQDB 4TZKA 1PGJA 2H9IA 1K0UA 2D8AA 3PPIA 4GLOA 3L4BA 4LCJA 4E2ZA 2LDBA 2O2SA 2ZATA 3BA1A 3AUUA 4YA6A 1MV8A 5TJ9A 2DPGA 4JP3A 5J23A 1N8KA 1AUPA 5DBIA 2BELA 1GUFA 4XIYA 1EDOA 1SB8A 3GMSA 4I9HA 1PJQA 4YEDA 4BKUA 4I5EA 4O5OA 3JQAA 2OZPA 4UVHA 3IL2A 1E7WA 3PZBA 4CMAA 3IC5A 4CLEA 3DZIA 1VL8A 3DMTA 3JQ8B 5U9CA 5T67A 3OQ1A 4RV9A 4O1MA 1E6UA 5JC1A 4DQUA 2X0NA 4NNJA 3WWYA 1ZK3A 1QLJA 4FC6A 3ANMA 2GNAA 4PG5A 1XR3A 4ZD6A 1R16A 2Q1WA 1GCOA 1JLLA 3RBVA 1LSUA 1YS4A 5JXWA 4ALKA 1AXGA 3CIFA 1YB4A 1YL7A 2B69A 4FJ0A 4NU6A 3JQBA 1A71A 2CVQA 1T2AA 3EW7A 3Q0EA 2AG8A 1ISJA 1HEUA 4MIEA 2ZQZA 3D7LA 3QVOA 3KUXA 4ZQHA 3ETEA 4LW8A 1E0DA 3QVSA 3CPSA 1NFRA 3DOOA 4E2WA 2C2XA 2WWRA 1PJ4A 5BT9A 3TJRA 3ZV3A 4BL5A 4CR8A 1U8XX 5AXBA 1EUZA 1GCUA 2QRKA 4JROA 3Q9UA 4GAEA 3ITKA 1V35A 4IINA 3VDRA 1PGPA 3STHA 5G0VA 1MB4A 1HT0A 2BFPA 2ZTUA 1U3WA 5A9TA 1P45A 4WLUA 5KKAA 1RJWA 3D4PA 1DAPA 4KDEA 1O9BA 2Y0DA 4CM1A 1CERA 1OI7A 1GZ4A 2DU8A 2VOJA 4L8VA 4L76A 3GEGA 3UUWA 5AXAA 4L9RA 4WLOA 2Q4BA 4IZHA 2I6TA 2J5KA 4BGUA
chains in the Genus database with same CATH superfamily
3DPIA 3IALA 1SJ9A 1BC5A 3KHSA 1X0VA 2FY8A 3A37A 2QORA 2PVCA 2RGYA 4ER3A 1QDLB 3VJKA 3DDSA 3ZQJA 1T6ZA 5BNIA 1YVPA 3OUZA 4BLTA 4IXMA 1SCBA 3PXBA 4K9MA 1TD1A 4KRXA 4KYVA 1GV0A 1QHHA 3DE5X 1GFSA 1Y1SA 3HY3A 1VGQA 2RK4A 1EH5A 1Y7TA 3ENNA 4BO3A 1M6VB 2FEMA 4H1WA 1I1HA 4N82A 1VJDA 1GG9A 1RJDA 1T1JA 5G41A 1JIXA 4WCFA 3I8OA 4A91A 4FM9A 2OOKA 4EOGA 4DT1A 3FPEA 2I34A 2VJPA 3DHVA 3LUPA 2GLUA 4OYLA 4RGBA 4CEHA 2VA8A 2JDID 3HMQA 1RAEA 3PC6A 3CN9A 4FWTA 5JU6A 2B99A 1QTNA 3ISVA 2RCYA 2NYAA 2AFRA 3HJHA 2WG0A 3JR7A 1JU4A 2PX6A 1C7ZA 3AHDA 1KDPA 2PQMA 2RGBA 1DOAA 5D7BA 2CDBA 5E7QA 3K96A 1CXZA 1Y3FE 1SCNE 2FK8A 2IELA 2KYRA 1W75A 1CDDA 3DTVB 1ZBQA 4AMGA 1ZJZA 4XASA 3ET4A 4G1VA 3MXOA 2DP4E 2P9BA 1KQFA 2Q4RA 2XTJA 3DZFA 4S1OA 2IYRA 4XH9B 3RFUA 4DW8A 5CNJA 1U7UA 3AI3A 3I9OA 2XMDA 1KZ4A 5I6DA 1PFGA 1C7EA 1RAIA 4KQCA 5KSZA 3P2IA 2QPAA 3IP5A 5BT8A 2QP9X 5JYBA 4JYAB 1PZFA 1IQUA 1W0KD 3F5FA 3UK0A 3FDXA 1LDYA 5T64A 2HW8A 3WL6A 3Q9NA 5DHFA 1LX7A 3MJCA 5I9MA 1Z3CA 2XUOA 4QDUA 2K4MA 2IJGX 3SC3A 1AE1A 3ZW9A 1GGHA 1ONOA 1H1DA 1BFKA 4B6RA 1Z8HA 5LPNA 1M6EX 1HR0B 3LRXA 5JS1A 1U31A 1UXKA 2GSWA 2ID9A 1QH9A 2X9LA 4RA6B 2OBLA 4PYNA 5FIUA 2FPKA 5L4LA 1ZUD1 4C2AA 1OXVA 4GM0A 1I1NA 1J8DA 5JYDA 4FT4A 3KSBC 2IPOA 2PGJA 3CNNA 4OF4A 2F3SA 1EUDA 1UKVY 3HP1A 3U7FB 3W79A 2I1VB 3AEZA 3K5IA 1DKUA 1GXSA 1KORA 2DWOA 3QIAA 5E8RA 4FHCA 4EG5A 2O20A 4KQ9A 4F3KA 4Z8YA 4JVMA 1D8AA 4AICA 2WYUA 3T0GA 5K0BA 1K63A 1L5VA 1V71A 2QQEA 2WHEA 4NS1A 5EKUA 1NNLA 1EP2B 2BEUA 2OC4A 1TK2A 3HRHA 3LXRA 5J2UA 2OZKA 2KJQA 1FFDA 3EFBA 3HYSA 1P6UA 1I7QB 1DHRA 4EB8A 3V4RA 1G4UR 1KFEB 2O8DA 1SAYA 4BP3A 1GJRA 3A4IA 1X19A 2B78A 3KSMA 2EWWA 4Z6KA 2A14A 1UQTA 4GZ6A 2QGNA 2AK3A 3GFSA 4S1VA 5ALPA 3THYB 4L5BA 1C41A 4EELA 3BZWA 4XDZA 2BMFA 4LJAA 4BKOA 5JJCA 3BMXA 4MQFA 1KVUA 1QR6A 1W581 2Q50A 2YY5A 5F2OA 4EX7A 1Z0UA 2ZPTX 2FCAA 1QAQA 2JD1A 4BAZA 5IFLA 5EEHA 2TMDA 3VNQA 3BOSA 5JASA 3UJ7A 4YMTA 1FTNA 3INRA 1F6DA 3TECE 3BXEA 4CF3A 3C87A 3NHAA 4R8VA 3Q3JB 4DCVA 1CJTC 1EMDA 1W9MA 1YVDA 1N0IA 3BWVA 3P94A 4JMLA 3ILSA 3RQIA 4AWAA 2I6XA 3HS3A 4UMFA 4DA4A 1TAGA 1K6XA 3WK4A 3RSGA 5EUMA 2IPXA 5IAAA 1IE3A 1X8LA 1CUDA 4D0SA 3TG8A 1QV9A 4MW2A 3FPKA 4NK4A 4EF4A 3A6DA 1KEKA 4L8WB 2BJWA 4HAOA 4FDUA 1RSZA 5CDHA 1MT3A 2ECOA 5LD2B 2VTEA 4RDCA 3SBDA 2C4WA 3SC4A 3WLKX 4RD6A 2IOQA 1SGWA 3MFYA 3ONWA 3R5JA 4RK7A 2Y2VA 1UAGA 3QEJA 1CR6A 6ADHA 4PGHA 1UBTS 4PU0A 3C5VA 1XCMA 5EPOA 1H8HA 4US1R 3GRCA 4QQKA 4TTAA 1NTRA 5EHNA 2BMVA 4PQYA 4AZ0A 4DDUA 5HW0A 5HQJA 3WWPA 2JEZA 1VE1A 1WV1A 1LGYA 3K32A 4V0QA 2NIPA 2R84A 3I8XA 4MKFA 3GVXA 1W5TA 5IFKA 1V96A 2PKQO 3HYCA 4JBWA 3T3GA 3VC7A 4F60A 1QPBA 3HN7A 4Q1CA 1RQXA 1TVKB 2BFCA 3NDJA 3L04A 4OHVA 1JJFA 2LZ0A 4GOLD 3AM1A 1F2UA 1J0DA 4RETA 2NUTA 1C14A 3SS9X 4DGSA 1ND5A 1AQIA 1QGOA 4C30A 1A27A 2OWDA 2Y71A 4AFNA 4CM4B 2PZEA 3ROXA 2FW8A 3ZCXA 4EKIA 2C2GA 2WYWA 4JV5B 4WZZA 1Z8DA 2YHBA 4YRJA 3PDUA 4M1MA 4YRLA 3A1EA 4WGFA 4OAPA 3ZN2A 4EB6B 1SKYE 5U4QA 4QPNA 4C2TA 4JLMA 1SHJA 1ADGA 3WNDA 2NO7A 4LSZA 5T4FA 4LDQA 5FOTA 4EF6A 2PBLA 2PJDA 4GO1A 1Y8CA 3MNFA 5BYJA 2Y1GA 1ZR4A 4ITUA 2XMZA 2N9UA 4K9NA 2Z3WA 1Z2EA 2FRDC 3CUVA 3PKZA 2GRJA 3F7MA 2LTAA 5AJXA 3DBRB 3AEUA 4JBNA 3OAAA 4RZQA 4DF3A 4HNQA 2IYTA 1ADBA 3D6VA 1PNQA 2C07A 4J0FA 4EGQA 5K2OA 4KR7A 4EEZA 3OQVA 4RJLA 4EMUA 1IYZA 2JGMA 3WGHA 1YA6A 3K2QA 1LZKA 1N7IA 4YAJA 4BMOB 3ZG6A 2EJBA 2ZRMA 2UUCB 3BRWD 1WLSA 4TV8B 5P8WA 2ZBFA 5DM2A 3H2YA 3O4RA 3ZZ0A 2E4WA 2YWGA 3NGXA 3URKA 4LVOA 1SU6A 3T7DA 5BV0A 3BK7A 1KJQA 1G2OA 3GRPA 4EARA 3D3JA 2IYEA 3TINA 3NX4A 3P7MA 2RKBA 1EFRA 3RT9A 5KHOC 1Y7LA 4RVSA 4U2BA 3TM4A 5MHTA 2QJRA 2QBYA 1SOAA 2A6PA 3BXFA 2PWBA 1LJUA 3RUHA 5I9IA 3G2QA 5DNVA 5H5JA 2IYFA 2HLDD 5ER9A 1SWWA 5LDDC 1Y4SA 4QICA 1THMA 2FMHA 4I1IA 3T4UA 1EVQA 3DDHA 2JI6A 1CW2B 3TPZA 5LD2C 1YCFA 3PQ5A 4HQRA 4F3YA 3V8QA 1R0WA 4TROA 1P4RA 3OTHA 1VMIA 3AEQA 1PVVA 2QDKA 3K9BA 1BQ4A 4OPMA 5MGBA 1HZZA 3NV7A 5CVDA 4D9GA 4GL2A 4R2IA 4US0R 2H0AA 3LF1A 4QTYA 1JJ7A 2IIQA 3F1KA 2BFFB 3AO0B 3EXHB 1P77A 6PFKA 4IXWA 3PGLA 4P31A 1C7JA 1N5DA 2VCEA 5JECA 5G02A 5TE9A 1FTGA 4F3RA 2FX3A 2PUDA 4WKOA 4MUBA 1I4EB 3FR7A 2V7VA 4ZZIA 1VPDA 5CDGA 1FTSA 3V1NA 1VG1A 3A2MA 1TKAA 2ZJOA 3LYAA 1VI2A 3CRMA 5A4JA 1F5NA 1V11A 2QHXA 3FWPA 2MINA 2CNDA 2OYCA 1JQDA 2HSDA 4I1OA 5BMOA 1H4QA 2M6SA 3ZWCA 2AG5A 3QU9A 4KYTA 3RSHA 5BN4B 5B3KA 3DLTA 3GLRA 3EG9A 3R7LA 3ZLTA 2R6DA 1HTTA 4QLAA 1QMGA 1VPVA 2CXOA 2I03A 4ER0A 3TIGA 1NXQA 3L9WA 4LY6A 2VDUE 4CF7A 1XCJA 4IY1A 2WWVD 1NUUA 2GX6A 3LQYA 5AQ1A 2I6FA 2PTHA 1FUYB 3MT7A 3AHGA 1LRJA 3DS8A 5JH7A 5AI0A 4NMHA 1IM2A 2C5HA 1OWMA 2R6FA 2P8SA 3G89A 4HB0A 4DG8A 3C5CA 4YLGA 4MV9A 2Z57A 3GXBA 5A4FS 1FSGA 2QW8A 2MYTA 3LKZA 3RR2A 5K8JB 1P7CA 3ACCA 4A8HA 5LJLA 5L3SA 1TPYA 1YHNA 4HNRA 3ZE1B 1YFLA 3UN1A 3V4VB 2EJCA 2BGLA 2H00A 1VJ1A 4X1KB 1LF5A 4RGVA 4X63A 5CPBA 4A0FA 1R9NA 3EVGA 3E53A 5H80A 2O54A 4GLLA 5D2CA 1VJ5A 2BOVA 4WOBA 5A05A 1A5AB 3G8BA 5KX5B 1C7QA 1J9GA 2NXEA 4MULA 4UMEA 1KH2A 3PA6A 2Z9DA 3QUCA 3ICCA 3O3OB 4A92A 4UD2A 3AETA 2RI0A 3K0HA 1XNJA 3SYKA 1HF3A 4Z8XA 4OHUA 5I7EA 2Q5LA 1FW8A 3FGZA 2ARKA 3HU2A 3KFVA 1MD9A 2XMQA 3LK7A 5EESA 3WGVA 4HADA 4OMCA 4LXUA 2GJAA 1USKA 5ENDA 1BWPA 5LLDA 4CCWA 4RMNA 1HFEL 2C1EA 3VU9B 1U8YA 3U0BA 1RJGA 1YI1A 2XF8A 4EVIA 5JSZA 1IEWA 1NDHA 2GF2A 1XMXA 3KX2A 1NBWB 1S89A 1YR1A 2ATIA 2IBTA 1OROA 1R5NA 4L0CA 1ACLA 1K8RA 5JAPA 3FJOA 4JI3B 1C1DA 3HYRA 2QLFA 3O0DA 1BW9B 4ZCIA 1BE8A 1TA9A 3PRJA 1D4AA 2H4JA 4BMNA 3O9MA 3RJTA 5HRUA 1TRHA 4BQPA 4LJ7A 1OILA 3RJ5A 4PANA 1G3UA 1NVEA 3FHLA 1DINA 5HJEA 1UKEA 2FSPA 1FFEA 2FUKA 2V6BA 5CT4A 5EJ7A 4X71A 4BFCA 1A2BA 1GU0A 4HEJA 4OBWA 3EXHC 5DV9A 4QKQA 4G0VA 4YDRA 4BV9A 4N5NA 4FQ7A 1RI4A 4XVQA 3BFKA 3EZ9A 5HSGA 4KW7A 1Z12A 1AQ6A 1UK9A 4X00A 1M1NB 4BNHA 4CM9A 1OZGA 4ARAA 3FSRA 3B1ZA 3BXPA 3R3ZA 1CZHA 1GTMA 4F4UA 4TXNA 1XLUA 3RVBA 5AXCA 2G70A 3S7TA 1QJCA 4YRNA 4DC1A 4F1JA 3W3ZB 1GZDA 2DERA 3HQ4O 4TGLA 1IXSB 2AGVA 3N8GA 4AX4A 5HK9A 5CR9A 4EA9A 1CUCA 2RONA 3I23A 2YZKA 5KNCA 4ENWA 2YWRA 1XA4A 1T1SA 4GWLA 1JAHA 2F00A 2GJKA 3QOXA 4HDMA 4FJ2A 5BV7A 2Q0SA 1I2MA 2XGGA 1NN1A 3GLFA 4RYLA 4BGEA 2YWHA 1N2ZA 1JDUA 1KFCB 4PBSA 4HQ0A 1DDGA 2YHIA 2O8NA 3DNPA 5IJAA 4BB5A 2IT1A 2Z9BA 3GAMA 2ZJ3A 4ND5A 3KPUA 5D86A 4UU0A 2JIBA 2LBPA 5AOCA 5CDFA 1Y7IA 4RV5A 1JMVA 4V0ME 4BNTA 2G9RA 5IUNC 2GLXA 1JEOA 2ACKA 1RJFA 1T0PA 3U9LA 5BO5A 2ZIFA 4LCEA 1B3BA 4L6AA 2YXNA 4IIJA 4LNAA 4AG3A 5BWNA 1OW3B 4Y2YA 1AA6A 1C2YA 4M53A 1LDMA 2O5EA 3KVVA 1H93A 4Q3KA 4Y9TA 2QN8A 2JI9A 4GMFA 4UMDA 2P2NA 1SXJE 4F5WA 1OV6A 1QKJA 1LPAB 5JAOA 2NXNA 3BB4A 2CF5A 2POCA 4CDMA 4JZKA 1KOJA 4QEDA 1MAHA 5E95A 3P20A 4D42A 3M6FA 4LQ4A 1QQ5A 1DAKA 1XDZA 2O48X 5AVOA 3UK7A 2VRCA 1F7VA 4JI5B 3FFTA 3VPAA 1MJHA 1EESA 1GTVA 3VQTA 1XMSA 3PEEA 3CUYA 2GCGA 4A26A 3P4YA 5JADA 1HE8B 1NSTA 3H18A 1OKKA 1VHDA 4G0NA 4BUCA 1CRQA 4RE5A 4DWWA 5C35A 1SK8A 1SFRA 2QRMA 1TMKA 4JNCA 3TZKA 3IBTA 1A8PA 4CKWB 3PJRA 3L4JA 5C46F 4MS1A 1USVA 3HCCA 4DEYA 5KSPA 2GUWA 4Z3OA 1C3EA 5BNTA 1JSXA 3AKYA 2ZBQA 1NI4B 3VKUA 1O96B 4HQOA 4H1HA 2OQVA 1ZI8A 2VDVE 3SJAA 1KSFX 2GFIA 2VI5A 2JLZA 1E79A 2QE7A 4B4DA 1ZJ5A 3WYCA 4KMRA 3DMFA 5EJEA 3B85A 3R4VA 1QG4A 1H8HD 2TECE 3QPBA 4UCWA 4C0XA 3RKUA 3DAPA 4YV1A 5HR5A 2ZYHA 4JBXA 1WPQA 3DM5A 3HC7A 1BD4A 3L6RA 4MVJD 1NN3A 2Z5GA 5T8KC 3JYNA 2LVBA 1TA0A 2ZYTX 2BFMA 4CQMB 1FMTA 3WYDA 1WHTA 3OPMA 2HMUA 1C0LA 2JLSA 4H3HB 4V1CI 2UYHA 1ND6A 1UC4B 1XA3A 1J2RA 1PWEA 1Q74A 4DCNA 3A1FA 1BDHA 2P2YA 1ZIXA 5JJIA 3Q7PA 3LP5A 5EJ5A 1AMUA 4M0EA 3IE2A 1OJLA 5CLHA 3SJUA 3DMYA 2PSEA 4U2FA 2PPVA 3FUCA 5DPMA 1XP5A 4HN9A 4CI0B 4A2PA 3W7VA 2B6NA 1SC6A 1TX4B 2GILA 3B1XA 3IHTA 5EXPA 5FBQB 1Z6XA 3FETA 3CZQA 3RHTA 1U0TA 3E22A 3IUNA 4L3VA 4OGGA 5F9MA 5C8YF 5L3VA 3WHIA 3RK4A 9LDBA 1ZAYA 4ZOQI 2XUPA 4L7VA 1BCSB 4UD6A 4HO1X 4W7IA 2QRGA 2YRXA 2P67A 3PXEA 3DYBA 3FB1A 2FFJA 2P30A 3SC6A 3ICEA 4FGLA 3QMMA 4EBFA 3GQBB 3O8RA 1A8QA 3VSAA 3ESXA 4KAXA 4FCVA 4C7JA 1CULC 1G59A 4G1CA 1GUDA 3IOYA 4JQYA 4S2UA 1E9FA 3OAAD 3B53X 4RZHA 4YRGA 1VCMA 2IEYA 2B4KA 3LUHA 1I32A 2IQ5A 3K8YA 5G1NA 2ZRKA 4FW8A 3FWYA 4H0CA 4LZWA 2AW3A 4O02B 2MHCA 3S3TA 4KXXA 2BGGA 2B25A 3G1WA 1DC7A 1E4EA 3U4HA 2XB9A 1SQ5A 1L5YA 1HY3A 4M8SA 4MS4B 4RMIA 1CE8B 4XUGB 3NDBB 4E5UA 3NM6B 1J7KA 4V0NA 3S2YA 5CIYA 4C0SA 1VE5A 5J2TB 1NF8A 3BFVA 4I14A 1ZHHA 4D99A 2TMGA 3ADBA 3M0EA 4JP5A 2VHEA 1LJ8A 2O2YA 3BXGA 1UP4A 3FNRA 2HOQA 5IHPA 4XJVA 3A7EA 1HNXB 1QRRA 3C3DA 3VNAA 2PGXA 3K2BA 3SZRA 4HC4A 3RIYA 1O6CA 1Y1RA 2JHPA 1EFRD 3QHQA 4IHKA 3ISTA 3W5JA 4GM4A 3W5CA 1GPYA 3D43A 1DG9A 4RXUA 4TQUS 4N4AA 1NQXA 2QYTA 1U11A 2FHSA 4CODB 1DX9A 1U9YA 1VJCA 3N3BC 3QHPA 5DXFA 2VTDA 1WXXA 5YASA 1UZNA 3BWXA 5CM9C 2A0KA 5E9QA 4GVPA 1ZIPA 1NPTO 1FUUA 5BSFA 2OD2A 1Z26A 1C4KA 2WHRA 1FSPA 3DLCA 1OX6A 4WZBB 2X4GA 1MA0A 3HE3A 4EB0A 2GD1O 1QHFA 1ZY2A 4CL0A 2MSKA 5FWNA 3JRWA 4HDSA 1EXWA 4EA6A 2E21A 2RAVA 2OP1A 3K05A 4FSHA 1Q16A 4S24A 1G8MA 1Y6ZA 3GHHA 4MR7A 5FTNA 3JQEA 1X39A 5FA5A 1KMIY 5JIBA 2VSNA 1T3LA 4IICA 1BAPA 1JAYA 4KN6A 4RTMA 2EGUA 2VCYA 2VQ3A 3F6YA 2J9ZB 3RFFA 2PUHA 3IJRA 4HMOA 1SCIA 4MDHA 3WMXA 5FA6A 3S6JA 3MXTA 3HNPA 3O4JA 4URYR 3ZDEA 4MVJF 3PT9A 3AFMA 1ZM7A 3HACA 2Z6AA 5F35A 2UZ3A 3O31A 2XVAA 4OA8A 5BSVA 2D2EA 1AT1A 2E4VA 5JALA 4CM8B 2I4OA 3FCEA 2VKTA 4AC9A 2LD4A 1RJEA 2UV8A 1XPUA 1A88A 1SR8A 2ODNA 1Z47A 1WDTA 1N6RA 1QPGA 5IRCD 3ORSA 4XUCA 3IEVA 1KERA 1Y81A 1Z73A 4DIBA 1D2MA 1PK7A 1PFKA 3D4BA 2HU5A 2XNHA 3OKFA 4K9OA 1F2TB 3RYHA 1PW5A 3IHKA 5DEOA 1B8NA 1J9EA 4G41A 4HDNA 2ZUWA 4GF5A 5IKXA 1QF9A 4NYMR 4YN3A 2H11A 4MCHA 2HHCA 3B1VA 2J3QA 4ID3A 3ZY5A 1W48A 3RYTC 4C4SA 4W9NA 1DTSA 4E3ZA 2QAJA 3QVWA 2PGIA 3HLKA 4A73A 1XXHB 4DIEA 1XTVA 4PZYA 3VR1A 4M99A 1X92A 1RMYA 4J29A 1HM5A 3U7GA 5C37A 4OX9Y 3A6LA 4FHFA 3U3MA 2H17A 4WLFA 3IT1A 4LWZA 3TKYA 4AG6A 4ZV9A 1RYBA 3MVEA 3K9HA 3ZJTA 4XQGA 3A1CA 4GDMA 2Q29A 1Z7WA 4JVLA 5BXQC 4FYJA 3T3IA 3HRIA 3HUTA 3F6CA 3S40A 4PZZA 2C04A 2HRZA 1W8DA 4XKJA 3QJGA 4GRIA 5ALNA 1DXOA 4V03A 4DNQA 1RXWA 4JEIA 2CNOA 3M70A 1TCVA 2C42A 3MJEA 2NUPA 1C7FA 3OTGA 5A4MS 2JKVA 4G5FA 1ZRHA 4INAA 2BD0A 1NSFA 4G07A 2IZ6A 5DIZA 2X8BA 3ZV4A 3PHCA 1C1HA 2HTEA 2IEGA 1UPCA 4H7IA 4BNYA 3KE9A 1JQKA 3T3NA 3K1AA 4Y9DA 3RSZA 1BO6A 1XRPA 1K7FB 4H15A 4RVFA 4ETWA 2OCPA 1QVZA 1HQCA 1PYGA 3HJCA 4RJKA 4TXLA 4XD7A 5KSYA 4XJSA 2VYFA 1UBNA 2JIQA 3I32A 5LWHA 4EMTA 2H2DA 4RTPA 1YRAA 2EBHX 3IT0A 3MJSA 3MFQA 4RA6A 1T91A 2A2ZA 3PL5A 4LXQA 4RKFA 2AOUB 4TWBA 3KQKA 4CMGA 3F7TA 2J5QA 2QLMA 3C8DA 2JFVA 4MDYA 5EGNA 3RBZA 4YP7A 4X6UA 4YJ2B 4FYIA 3WDKA 4Q7JB 3B51X 4XQCA 2ZSEA 3OBBA 1YZHA 2WJWA 1T0IA 2XMRA 3I01A 4QPCA 4CM9D 2IZ0A 4OXYA 4ZYYA 5LP6B 3KVYA 3BYZA 1NBHA 1V9LA 2FF7A 1LSSA 4B46A 2PMWB 4A0SA 3N8IA 1V5FA 3H5AA 5ICSA 3MUEA 1J97A 4XE5A 3P96A 3SDSA 1DIAA 1S1CA 1X1SA 2P5YA 3ILYA 1U2GA 4YP0A 2W71A 5JWOA 2FMTA 3T5MA 5KNCD 3ANXA 2HJSA 3H9BA 3M4NA 1E2NA 4I4TB 4KXLA 4OGLA 3KR9A 2WHPA 4HK4A 4DZRA 3EPLA 1RBQA 1NJ2A 3UC9A 4YUZA 3L4BC 1CSEE 3LMKA 2QSZA 4KPEC 2XXAA 2WTNA 4RQUA 3BGOS 1NT4A 3HXTA 3I52A 1F8UA 2X1HA 1WETA 1YB7A 3PIDA 3A6EA 1UKYA 1Y4ZA 3L7LA 3FNFA 3GIDA 1CNFA 4MWZA 1V3UA 2WJJA 1ZJ4A 4B87A 4O2AB 5E2AA 1EXDA 5ISMA 4CV2A 3LBFA 5BV8A 4WUTA 2QM0A 4I50F 4OUDA 2BM8A 4HF7A 4EVSA 2ECKA 3T1TA 2D1QA 2FG6C 4GGPA 1ONNA 2EP8A 2JFHA 3PI7A 3PT5A 1A7JA 4YRFA 4F2DA 1I6WA 1U65A 1NKSA 2QMUA 1J8YF 2JFGA 2QTLA 1GKLA 2PXXA 1KI1A 1QX4A 4NBSA 4RY0A 3CGWA 2V0NA 2CHQA 3BL6A 3TW8B 2GZ1A 1FXWF 5HM6A 1LRKA 3WL4A 1VDMA 1DXHA 1NJ5A 1NC3A 1XYVA 3G1UA 4YV2A 3KTFA 3Q2OA 4EBBA 3OFSA 2ECFA 3VJRA 3PC4A 4ZO6A 2PXAA 1HRDA 4DG9A 2VRCD 4B44A 1FDVA 4ZTZB 4NG5A 5ES4B 3L18A 4IXNA 1TM1E 3CVOA 2GZMA 1OKKD 4KQJA 3MK31 3MCUA 3DDUA 3E9NA 3OCJA 5ALWA 3QU2A 5ESXA 4IRMA 1XTJA 1B6TA 2HDOA 1VKJA 1XNGA 2MYPA 3IP6A 3TZLA 4B6SA 4MWEA 1QTQA 4MICA 5JCXA 2Z83A 5HCNA 1CJUC 3O7MA 2ZSJA 4NARA 4Z0NA 1IAQA 1QE5A 3IP9A 4N65A 3H1FA 4Q3AA 3RVQA 4WV3A 5EXEA 3V1YA 4E94A 2QE7D 4DNXA 2RGAA 4M3NA 1KP9A 3LYLA 4IQFA 1C0EA 1EG2A 5K8VA 4XYGA 3FYUA 3DZ8A 4DB2A 3W6OA 5KU7A 4J4TA 2R66A 3OMWA 1Z0KA 3VR2A 4QFBA 4C0HA 2ZWOA 2BHSA 4RCZA 4L15A 5B2EA 1TI7A 4CM4A 1EDBA 2BDTA 4ITVA 3SHTA 4CQLB 5LP6C 5DN9A 3ZBTA 3EB9A 3DGEC 4G26A 1MORA 1ZIDA 1W96A 3LBNA 3UXYA 4O63O 4CR7A 4YS6A 3ZLVA 1A7AA 1NF3A 4AJLA 4NABA 2B0CA 4OKSA 4BHTA 1PIWA 1PQWA 2G5GX 4C29A 3SR3A 4CKEB 2REOA 3ET5A 1UJ4A 3WHPA 1U3CA 3DZGA 3C24A 4XWWA 1KY3A 1WY5A 3THXA 1RXIA 3DMDA 1BS9A 3MD9A 2UYQA 3HLYA 4C7KA 3MRSA 4MMXB 1Z07A 4X61A 3VSDA 3CH6A 1M7HA 1PJAA 4R98A 3WJAA 1WQ3A 4H4DA 3PUKA 3EXIA 3VZPA 2YJ3A 3JYPA 4TKLA 4F3NA 4F8YA 5I8WA 4QXPA 5JMOA 1AQYA 1MC5A 1C9MA 4ETIA 4B3MB 5DYIA 3LNCA 4P4LA 3RU9A 1RC1A 1R8SA 1PTJC 2X5OA 2XQFA 1A5SB 5FB3A 4B73A 4ENQA 4TV8A 4GS5A 3T38A 1E3JA 3IEXA 4EYOA 1SHLA 1E1CB 2QTVB 5HIKA 1MEEA 3IBFA 4L16A 1ARZA 4AMYA 4DR7B 1JLKA 3AI2A 2QTBA 4CI9A 3EX7C 4P0TA 2G7MC 2M98A 3OLQA 1IN5A 4ER7A 3WAGA 3OZIA 1XAIA 1SNYA 3TX2A 1YKFA 1T1EA 4B6QA 2Z5LA 3G2HA 4Q9LA 1F4PA 2J8ZA 4NY1A 3VGPA 2NSLA 4L8FA 1E1LA 4RZ2A 2JEOA 1BMQA 5HWSA 3T5PA 2EHDA 3ONNA 1UM9B 4QOHA 3PUIA 4LWOA 4ZVSA 1X74A 3IEPA 1AHIA 5A4AA 2WM8A 5ESRA 2PLRA 3PC8C 2HKIA 3SIRA 3KXIA 3IBGA 1RFLA 4Q3LA 4UJ5A 3TW4A 3ND6A 4HXGA 5DK6A 1U0SY 2I9PA 2PGAA 4D92A 1FMJA 1OI4A 4HG2A 3FF4A 3WP0A 1CUBA 3O9ZA 3O84A 4XOIA 2BFFA 3BFPA 1KY4A 3TTVA 3UK1A 1HFWA 4XCQA 3FTFA 3QQ5A 3FH0A 1EWVA 4IWYA 4R2LA 2YJ5A 1PWZA 2ZJ7A 2CJYA 2ZWPA 1A04A 2LRHA 4OJYA 8LDHA 5JDIC 2O2JA 4QHSA 1ZNQO 4KO8A 4QOSA 2HSEA 2QSYA 4NZZA 4KL8S 1MHPA 2QE6A 3M5CA 1TEZA 4OXKA 2JGLA 5FFMA 2EW2A 4CUKA 4UNRA 2OLEA 4ZO8A 1RM5A 1EM8A 3K1YA 4TRRA 5AK3A 2GHQA 4B31A 4EH1A 5CDYA 2WWHA 4MK4A 3IAM1 2XECA 1N2HA 1H8EA 3NASA 1JDBB 3QF4B 3VH1A 1KQPA 1XTIA 1I3MA 1WD7A 3CX6A 3ELDA 3R6DA 4LRQA 3HEAA 4S2EA 2JHGA 1EXVA 1ZN2A 3LX4A 1JQLB 3H87A 3I2JA 2PZLA 1W29A 2BEVB 2FN7A 2FMFA 2H2FA 4KAFA 3GLUA 3JQ7B 3OHPA 2BCEA 4S1TA 4UHCA 5GJVC 5JZOA 3R9XB 5B3LA 4OI4A 1E8NA 1XD2B 1OU0A 1NBEA 2W2VA 1YZVA 2II6A 1G7TA 3LYHA 4HNAA 4CLRA 2PUAA 2KI5A 4BE4A 1V2GA 1D1QA 4J4HA 1FDOA 2C78A 4KI7A 3ZDCA 1QYIA 2XUDA 2WTEA 1QIIA 2M32A 3GJ8A 4BFWA 2GZHA 5KNCH 2QQ5A 1KRHA 2R5WA 2RSLA 3OG9A 2C84A 1J99A 5DT9A 5F78A 3CURA 3LQRA 5L6MB 3PJGA 4MYUA 3KM0A 4K6MA 4ZT4A 1IN4A 4GICA 4NG4A 4YMGA 4WCDA 5IUKC 1VHQA 5KX5A 5EJMA 3H83A 4E4TA 4EPYA 1BNCA 4EIWA 2QLJA 4ZC8A 2ZT5A 2GBGA 1M10A 3MCAA 1RAHA 3LKBA 4HWKA 2R6GA 2VPXA 3EXFB 5T6BA 4JWTA 3KYIB 1CUUA 3DLIA 3EPRA 4U63A 3FDJA 4YJFB 1O5TA 1EFKA 1D6SA 1RADA 3N07A 4BO9A 5CFNA 3LQ2A 3FFWA 1PN3A 3LECA 2GRAA 2WHQA 1DBVO 4YP9A 2QUIA 3QKRB 4HTFA 1WDMA 1X2BA 3Q98A 3DL7A 1G3RA 4ZFNA 5L3QB 2GAFA 3DFIA 1SEPA 3VU9A 4B8YA 4WFIA 4W1PA 1LVHA 1IFXA 4WQMA 3VVMA 3MOSA 5ALYA 2WV9A 3ICQB 3UATA 5JROA 1CR2A 2XCRB 3AEYA 2IS4A 1SQSA 5DYNA 5JNWA 3WB9A 5EZYB 1BW9A 3RJMA 2QRQA 1NIPA 3DTVD 2R4UA 4B76A 4F5DA 3L46A 3VMFA 1CPYA 3T0FA 1A97A 2H06A 1T4DA 2JCYA 2FWMX 3FUVA 4GH5A 4OJTA 1OXKB 1Q3TA 4NMMA 1Z3IX 4OXXA 4FNAA 5AVXA 1YIAA 3QEBZ 1F8YA 1RXYA 3R7DA 4KNYA 1J0AA 2BGJA 1QFJA 2AEJA 3GFQA 3NHMA 4FS3A 4RSGA 3SLGA 2F62A 4MPPA 1AURA 3AP3A 4DLWA 3PUJA 1YDEA 3EVBA 2BKVA 2V65A 1WG8A 2P6RA 1E2UA 1OJ7A 2QUHA 4IGIA 4QAQA 5LCXA 4BBPA 5B3JA 1H42A 4R81A 2CLEB 2KLHA 2Q3LA 3HFGA 3UH1A 3E5MA 4XD7D 3V7FA 1TCCA 3ZE0B 4AT1A 4ZJUA 3PA8A 1RBMA 1RYHA 1JEAA 1HH4A 4A1OA 4IZIA 1FFGA 1T6BY 1KOFA 2W22A 3MRTA 4HAIA 5EL0A 3U80A 1EVIA 1K89A 2XCQA 1OZFA 1XZEA 3UKDA 3Q8KA 4P38A 4EJSC 4EPWA 2CLHB 3T3DA 5EIEA 5B1IA 4P2BA 3UYLA 2HMWA 3K1JA 1JDBC 1W94A 2WWIA 4CMIB 4K2AA 2YMMA 3DLAA 4B7ZA 2YDYA 1ETUA 5J63A 1Z39A 4YXWA 1EDDA 1JPVA 3ESBA 3EJWA 3KB6A 2X0IA 5IAKA 3V9PA 5LQRA 2BFAA 3FGNA 2CEAA 2D5CA 1GPAA 3S1AA 1FSSA 3QKIA 4D8XA 4GZMA 4D96A 3SEFA 4M21A 2HUNA 5JPDA 4UM7A 5HIIA 2VATA 1Q0LA 4MWGA 1N7GA 4XB2A 3K6RA 4ZPXA 2GAAA 3VI4B 2GPJA 2B0JA 4EO7A 1GDHA 2Q7XA 1II9A 3PHGA 3KKZA 5K4HA 1CFJA 1HYQA 3VYSB 4E5VA 1VLHA 1ZGHA 4KMMA 1OE0A 2PT5A 1DFGA 3OF2A 3QFFA 4Q3NA 4BFLA 1SVSA 3GG2A 4C7VA 2HRDA 2Y1OA 1N9GB 4B35A 1O6BA 1HT3A 2FDRA 4JENA 3WNCA 4V0MA 5JNLA 3IVAA 2P2SA 3B3GA 4G8DA 2JLRA 3VX3A 1NQOA 5BWOA 1ZI6A 4ALKA 4MARA 4CIYA 2W37A 2Q0HA 3UMGA 4G0WA 1ETHA 4LF7B 4FHEA 3OZSA 4L9SA 3WK9A 3VR3A 1XQ6A 1X42A 1H4SA 1I1OA 1Q1ZA 6REQA 3KV1A 3D7NA 2FWPA 4V0SA 4WGGA 4I46A 4A0QA 1D5WA 1MVOA 1Z8FA 1ZOIA 2OMKA 2QR5A 4OBXA 1Z35A 4NBLA 4OIMA 3G0BA 3KB1A 3KUKA 1D9XA 4R2HA 3UAYA 1EWRA 3DOEA 3WBKA 1ZRSA 1N77A 1Y9AA 3EVAA 4R0NA 1GIAA 2NQ8A 3FCXA 3AKZA 2WHYA 5AR1A 2BIFA 1UAYA 3BD7A 5KZMB 3DO6A 2WG1A 3QFHA 4I4NA 2JLCA 3N9IA 3OF3A 3B82A 4E6EA 3ONEA 3OZVA 4BMCA 1RHUA 2NQ2C 2VCHA 3O74A 2IOHA 1LJLA 2DBQA 2IOYA 3T0IA 5AVZA 1E1KA 5KPDA 1JFLA 2UKDA 4BE7B 1DT5A 1ZITA 3BZBA 4M0UA 3LRPA 4PC1A 4PHHA 1UT6A 5FBZA 4OHKA 3LX6A 1IN6A 4GIBA 4OHBA 5LZ4A 2OKCA 1EIZA 16PKA 4EZBA 5IVIA 1T26A 4FFVA 1ML4A 4MV5A 4Q1DA 1C9NA 1LQTA 1RLJA 3I1YA 3OWOA 2YC2C 4KB5A 1FA9A 3DM9B 1ESCA 1O9GA 1C30B 2C5EA 3O83A 1FNBA 3EZLA 4U2DA 4MW4A 4JEUA 1AXEA 3AJRA 5ED0A 4ZAZA 1U99A 1Z63A 1Y1LA 4PO3X 5DASA 3M4ZA 4BVKA 3S5UA 5SV2A 3WMGA 5LYYA 3MWDB 3NBQA 4R7TA 3CH7A 3BE6A 3ZI7A 4OK5A 3VR2D 2OVFA 4AN0A 2ETVA 1C29B 5I7UA 1Y3HA 2NPIA 2ZI7A 3GPLA 1QIMA 3FHCB 4IVQA 1FDTA 4EYGA 3IEIA 1IOVA 1R37A 3JZIA 5CT8A 3RC9A 4AJ4A 4FXPA 1UF9A 2G4CA 5DE3A 2V6GA 2QU7A 4CM6A 3IKLA 2AS0A 2P2CA 2XT9A 2XQGA 4A8JB 4EJ0A 5FTLA 3EXG2 3G8DA 1BCSA 3UFXB 5C81A 3KKKA 1LK5A 2A9JA 1EK0A 4HRVA 4RUKA 1NJSA 1WNTA 3F4KA 1R6XA 2NUAB 1KE2A 1LUAA 4LS3A 5HKLA 5HVNA 2ID8A 3NWPA 5HQ3A 4IIGA 3HXOA 1VKZA 1MPTA 4RKEA 1TB4A 1Z18A 2OXEA 3SQNA 3DDOA 2G5TA 2ZIVB 3GDHA 5F1YA 5D6OA 4OB7A 3OOEA 3CWQA 2ZSBA 2I6UA 1ORDA 4RTJA 5FWYA 4UNQA 1BFDA 1CE8A 1WKBA 3EIFA 1G8FA 1U9IC 1KHHA 3AVWA 2G07A 4Z9YA 3BH6A 3EXG1 2XTAA 3N2ZB 1LPSA 3QE2A 3GG9A 1AUOA 2NYUA 2C7QA 1Q20A 2CHVA 4KOEC 3UXMA 3VR6A 4CG0A 5IJ9B 5K0FA 4UEKA 2IYXA 3QTTA 5EMKA 5DTEA 4QHYA 4ZYVA 4P36A 1L4BA 1K5GA 4DTIA 4AUMA 1Y37A 3BMQB 2COKA 3AIMA 1UBRS 3FZNA 1G5HA 1N34B 3BB3A 1SVKA 2G9QA 4LG1A 3VTZA 3TSCA 1NVGA 1LC3A 1JG1A 1OGIA 1SUWA 3O3NB 2YN4A 3RVKA 1R9JA 5EKSA 2WI8A 3T9DA 4EY8A 2CJFA 2OVBA 2Q8NA 4JDUA 2JD0A 1P5HA 1B1CA 2O8EB 1URPA 3VZSA 3R3SA 4TTTS 4XWTA 1NAIA 1S9DA 3EA5A 3NTVA 3OOWA 3K35A 2O0HA 3L1UA 4IIUA 3D6TB 3ZWXA 2WVJA 1IY8A 3A2KA 3GMDA 3IVGA 2A88A 3N5KA 4P98A 5BW6B 1Q7RA 2I3AA 4OSOA 2YVQA 2B3TA 2WA2A 3GNSA 3GELA 3L8YA 1CYEA 1G20E 1I0ZA 1GN9A 2EEPA 3EFEA 1P0IA 3GJQA 3JQ8A 1OIXA 1AV6A 2H5EA 3WB0A 2FE4A 1I6KA 3I6MA 5LC1A 3I6ZA 5NLLA 3L4SO 1WUTA 2HK7A 3TK1A 2IYWA 3TR5A 2QZPA 1J6UA 3HJUA 1DAHA 3KL2A 1PNTA 4FMPA 3ZHZA 4E21A 4EG7A 1SZDA 4HEQA 3OD1A 2XADA 3DT9A 2RBKA 4G1EB 4MUIA 3SHQA 4J0CA 3C39A 5CYGA 2WYIA 2WWTA 4O08A 5ERGB 5C4IA 3UPUA 1H66A 1L7BA 1WSBA 4LZJA 4QECA 3L0BA 2EP7A 3JWEA 2IS1A 2CYAA 2QTZA 2VSYA 3EIHA 2G88A 4Q19A 2HLHA 3P9YA 4IO0A 3TIIA 1ENYA 1ATZA 2GHIA 2BT4A 2JFNA 1XLTC 2I1QA 3GJXC 5DIFA 3GEMA 1UMCA 2XGSA 2B5OA 1FFAA 3ZCSA 1LPNA 1RWWA 1PWXA 1QHNA 1EX9A 4NK5A 1WZ2A 2R6R1 4JXXA 4DANA 2O05A 1DAEA 1TYEB 4N0EA 2Q07A 2JKZA 3C8ZA 4Q7EA 3FHTA 4A8JC 4GLFA 2AXEA 2P9HA 5FLEX 2W6MA 2VNIA 2NYVA 2GEJA 4D82A 1DJOA 3TDMA 3K9WA 3G2IA 3VHXA 1E2GA 2V7TA 5C7OO 4IJ5A 1WMDA 1AQLA 3ADPA 1MN6A 1BE6A 2BDUA 3E3OA 2CW5A 3KOOA 3LOPA 4ZAXA 2LIPA 1QHXA 1QIFA 3COZA 4HRYA 4PVDA 1KI4A 2ZJBA 4TQGA 4KVFA 2OK8A 4WT7A 1Z0ZA 2IW3A 3RSSA 1MC1A 1M2KA 1VPTA 4FHDA 4KQWA 4N3GA 4NTZA 5H3LA 3TSZA 1L2TA 1Q1AA 3CSDA 3ZU6A 8ATCA 3ZQUA 1ZISA 3OM0A 3BJIC 1YS7A 4OJNA 4WN9B 3F67A</