1CEVA

Arginase from bacillus caldovelox, native structure at ph 5.6
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
299
structure length
299
Chain Sequence
MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ARGINASE)
publication title Crystal structures of Bacillus caldovelox arginase in complex with substrate and inhibitors reveal new insights into activation, inhibition and catalysis in the arginase superfamily.
pubmed doi rcsb
source organism Bacillus caldovelox
molecule tags Hydrolase
total genus 113
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 1999-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1cevA00
4RHKA 3RLAA 1D3VA 2PLLA 3SL0A 1WVBA 3TH7A 4CEVA 4DZ4A 3KV2A 1TA1A 4IU4A 4IU1A 4IXUA 1T5GA 4Q3PA 3NIOA 5HJAA 2EF5A 1P8OA 2PHAA 3CEVA 5CEVA 4Q3SA 1HQ5A 2EF4A 4I06A 4FCKA 4GSZA 4GSMA 3TF3A 3THEA 3MFWA 4HXQA 4IE2A 1ZPEA 1HQFA 1WOIA 3SJTA 3LP4A 1P8PA 1TBHA 1HQHA 3PZLA 3NIQA 3LP7A 2EIVA 4HZEA 1P8QA 3NIPA 1T4PA 4Q3UA 1T4RA 5HJ9A 4MYKA 3GN0A 3DJ8A 4Q3VA 4Q3RA 3SL1A 3F80A 1P8NA 2CEVA 4RHLA 1P8RA 4HWWA 1T4TA 1TBLA 4RHIA 4MXRA 4RHQA 2A0MA 1T5FA 2PHOA 4GWDA 2RLAA 4RHJA 4RHMA 3E8ZA 1TBJA 3E9BA 4Q3TA 4GWCA 4IU0A 3GMZA 4IE3A 1XFKA 3MFVA 4IU5A 3MMRA 4MYNA 5RLAA 4Q3RC 3E8QA 1GQ6A 4Q41A 4Q3QA 1WOHA 1WVAA 3E6KA 1P8SA 4FCIA 1T4SA 4ITYA 3THHA 1CEVA 3SKKA 4Q42A 4RLAA 1R1OA 4GSVA 4MYLA 4MYFA 1GQ7A 3M1RA 3MJLA 1ZPGA 1HQGA 3THJA 4G3HA 4Q40A 2AEBA 1PQ3A 3E6VA 3LHLA 2ZAVA 4IXVA 1WOGA 1HQXA 4IE1A 1P8MA 1RLAA
chains in the Genus database with same CATH superfamily
5THSA 4RHKA 5DC8A 1D3VA 2PLLA 3RLAA 3SL0A 5G0IA 5DC5A 4ZUQA 5A2SA 4ZUNA 1WVBA 3TH7A 4CEVA 4DZ4A 3KV2A 1TA1A 4IU4A 4IU1A 4IXUA 1T5GA 4Q3PA 5G0HA 3NIOA 1ZZ3A 5HJAA 2EF5A 1P8OA 2PHAA 3CEVA 5G1AA 5CEVA 4Q3SA 5EFGA 5G0YA 3MZ3A 1HQ5A 5G1CA 4CBTA 2EF4A 3EZTA 1T69A 5G3WA 1C3PA 4I06A 2V5XA 1C3RA 4ZUMA 3F0RA 4QA4A 4FCKA 5EEIA 5EEMA 4GSZA 4BZ6A 3EZPA 4GSMA 4BZ7A 3THEA 5EFNA 3MFWA 3TF3A 1ZZ0A 4HXQA 4IE2A 5EEFA 5DC6A 1ZPEA 5EFKB 1T64A 1HQFA 1WOIA 5G0XA 3SJTA 4BKXB 3LP4A 1P8PA 3MZ4A 5G0GA 1TBHA 1HQHA 2VQOA 3PZLA 3NIQA 3LP7A 2EIVA 4HZEA 1P8QA 5EFJD 3NIPA 4ZUOA 5LI3A 1T4PA 4QA3A 5DC7A 4Q3UA 5G12A 5IWGA 1T4RA 3F06A 5HJ9A 4MYKA 3ZNSA 3GN0A 3DJ8A 2VQMA 4Q3VA 5G10A 4Q3RA 5D1BA 3SL1A 3F80A 1P8NA 2CEVA 4RHLA 1P8RA 4HWWA 5EFHA 1T4TA 1TBLA 4ZUPA 4RHIA 3C10A 4MXRA 4QA5A 4RHQA 2A0MA 1T5FA 2PHOA 4GWDA 3Q9BA 5EF8A 1VKGA 1W22A 2RLAA 4RHJA 5D1DA 5THTA 5THUA 3SFFA 4BZ8A 4RHMA 4BZ5A 1ZZ1A 1C3SA 3E8ZA 1TBJA 2V5WA 5G1BA 5BWZA 3E9BA 4Q3TA 4GWCA 4IU0A 4CBYA 3GMZA 5FCWA 5ICNB 4QA7A 5EFBD 5G17A 2VQWG 4IE3A 1XFKA 3MFVA 4IU5A 5G0JA 2VCGA 3MMRA 4LY1A 4MYNA 5RLAA 4Q3RC 3E8QA 4QA6A 1GQ6A 5FUEA 4Q41A 4Q3QA 5JI5A 4A69A 4ZURA 4CQFA 1WOHA 5THVA 1WVAA 3Q9FA 3MENA 3E6KA 1P8SA 2GH6A 4FCIA 1T4SA 3C0YA 4ITYA 3THHA 1CEVA 3MZ6A 3ZNRA 5EENA 3SKKA 4Q42A 3EWFA 4RLAA 1R1OA 2VQQA 4GSVA 3MAXA 4QA1A 4MYLA 4MYFA 3SFHA 1GQ7A 4RN0A 5G13A 3M1RA 4QA2A 4QA0A 3EW8A 2VQJA 3RQDA 3MJLA 1ZPGA 1HQGA 4LXZA 3MZ7A 3THJA 4G3HA 5D1CA 4Q40A 2AEBA 5EF7A 1T67A 1PQ3A 3E6VA 3LHLA 4RN2A 2ZAVA 3Q9EA 5IX0A 2VQVA 1WOGA 4IXVA 1HQXA 3C0ZA 4RN1A 3Q9CA 3F07A 5EEKA 5G11A 4IE1A 4BZ9A 1P8MA 1RLAA
chains in the Genus database with same CATH topology
4RHKA 3RLAA 1D3VA 2PLLA 3SL0A 1WVBA 3TH7A 4CEVA 4DZ4A 3KV2A 1TA1A 4IU4A 4IU1A 4IXUA 1T5GA 4Q3PA 3NIOA 5HJAA 2EF5A 1P8OA 2PHAA 3CEVA 5CEVA 4Q3SA 1HQ5A 2EF4A 4I06A 4FCKA 4GSZA 4GSMA 3TF3A 3THEA 3MFWA 4HXQA 4IE2A 1ZPEA 1HQFA 1WOIA 3SJTA 3LP4A 1P8PA 1TBHA 1HQHA 3PZLA 3NIQA 3LP7A 2EIVA 4HZEA 1P8QA 3NIPA 1T4PA 4Q3UA 1T4RA 5HJ9A 4MYKA 3GN0A 3DJ8A 4Q3VA 4Q3RA 3SL1A 3F80A 1P8NA 2CEVA 4RHLA 1P8RA 4HWWA 1T4TA 1TBLA 4RHIA 4MXRA 4RHQA 2A0MA 1T5FA 2PHOA 4GWDA 2RLAA 4RHJA 4RHMA 3E8ZA 1TBJA 3E9BA 4Q3TA 4GWCA 4IU0A 3GMZA 4IE3A 1XFKA 3MFVA 4IU5A 3MMRA 4MYNA 5RLAA 4Q3RC 3E8QA 1GQ6A 4Q41A 4Q3QA 1WOHA 1WVAA 3E6KA 1P8SA 4FCIA 1T4SA 4ITYA 3THHA 1CEVA 3SKKA 4Q42A 4RLAA 1R1OA 4GSVA 4MYLA 4MYFA 1GQ7A 3M1RA 3MJLA 1ZPGA 1HQGA 3THJA 4G3HA 4Q40A 2AEBA 1PQ3A 3E6VA 3LHLA 2ZAVA 4IXVA 1WOGA 1HQXA 4IE1A 1P8MA 1RLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHK A;  3RLA A;  1D3V A;  2PLL A;  3SL0 A;  1WVB A;  3TH7 A;  4CEV A;  4DZ4 A;  3KV2 A;  1TA1 A;  4IU4 A;  4IU1 A;  4IXU A;  1T5G A;  4Q3P A;  3NIO A;  5HJA A;  2EF5 A;  1P8O A;  2PHA A;  3CEV A;  5CEV A;  4Q3S A;  1HQ5 A;  2EF4 A;  4I06 A;  4FCK A;  4GSZ A;  4GSM A;  3TF3 A;  3THE A;  3MFW A;  4HXQ A;  4IE2 A;  1ZPE A;  1HQF A;  1WOI A;  3SJT A;  3LP4 A;  1P8P A;  1TBH A;  1HQH A;  3PZL A;  3NIQ A;  3LP7 A;  2EIV A;  4HZE A;  1P8Q A;  3NIP A;  1T4P A;  4Q3U A;  1T4R A;  5HJ9 A;  4MYK A;  3GN0 A;  3DJ8 A;  4Q3V A;  4Q3R A;  3SL1 A;  3F80 A;  1P8N A;  2CEV A;  4RHL A;  1P8R A;  4HWW A;  1T4T A;  1TBL A;  4RHI A;  4MXR A;  4RHQ A;  2A0M A;  1T5F A;  2PHO A;  4GWD A;  2RLA A;  4RHJ A;  4RHM A;  3E8Z A;  1TBJ A;  3E9B A;  4Q3T A;  4GWC A;  4IU0 A;  3GMZ A;  4IE3 A;  1XFK A;  3MFV A;  4IU5 A;  3MMR A;  4MYN A;  5RLA A;  4Q3R C;  3E8Q A;  1GQ6 A;  4Q41 A;  4Q3Q A;  1WOH A;  1WVA A;  3E6K A;  1P8S A;  4FCI A;  1T4S A;  4ITY A;  3THH A;  1CEV A;  3SKK A;  4Q42 A;  4RLA A;  1R1O A;  4GSV A;  4MYL A;  4MYF A;  1GQ7 A;  3M1R A;  3MJL A;  1ZPG A;  1HQG A;  3THJ A;  4G3H A;  4Q40 A;  2AEB A;  1PQ3 A;  3E6V A;  3LHL A;  2ZAV A;  4IXV A;  1WOG A;  1HQX A;  4IE1 A;  1P8M A;  1RLA A; 
#chains in the Genus database with same CATH topology
 5THS A;  4RHK A;  5DC8 A;  1D3V A;  2PLL A;  3RLA A;  3SL0 A;  5G0I A;  5DC5 A;  4ZUQ A;  5A2S A;  4ZUN A;  1WVB A;  3TH7 A;  4CEV A;  4DZ4 A;  3KV2 A;  1TA1 A;  4IU4 A;  4IU1 A;  4IXU A;  1T5G A;  4Q3P A;  5G0H A;  3NIO A;  1ZZ3 A;  5HJA A;  2EF5 A;  1P8O A;  2PHA A;  3CEV A;  5G1A A;  5CEV A;  4Q3S A;  5EFG A;  5G0Y A;  3MZ3 A;  1HQ5 A;  5G1C A;  4CBT A;  2EF4 A;  3EZT A;  1T69 A;  5G3W A;  1C3P A;  4I06 A;  2V5X A;  1C3R A;  4ZUM A;  3F0R A;  4QA4 A;  4FCK A;  5EEI A;  5EEM A;  4GSZ A;  4BZ6 A;  3EZP A;  4GSM A;  4BZ7 A;  3THE A;  5EFN A;  3MFW A;  3TF3 A;  1ZZ0 A;  4HXQ A;  4IE2 A;  5EEF A;  5DC6 A;  1ZPE A;  5EFK B;  1T64 A;  1HQF A;  1WOI A;  5G0X A;  3SJT A;  4BKX B;  3LP4 A;  1P8P A;  3MZ4 A;  5G0G A;  1TBH A;  1HQH A;  2VQO A;  3PZL A;  3NIQ A;  3LP7 A;  2EIV A;  4HZE A;  1P8Q A;  5EFJ D;  3NIP A;  4ZUO A;  5LI3 A;  1T4P A;  4QA3 A;  5DC7 A;  4Q3U A;  5G12 A;  5IWG A;  1T4R A;  3F06 A;  5HJ9 A;  4MYK A;  3ZNS A;  3GN0 A;  3DJ8 A;  2VQM A;  4Q3V A;  5G10 A;  4Q3R A;  5D1B A;  3SL1 A;  3F80 A;  1P8N A;  2CEV A;  4RHL A;  1P8R A;  4HWW A;  5EFH A;  1T4T A;  1TBL A;  4ZUP A;  4RHI A;  3C10 A;  4MXR A;  4QA5 A;  4RHQ A;  2A0M A;  1T5F A;  2PHO A;  4GWD A;  3Q9B A;  5EF8 A;  1VKG A;  1W22 A;  2RLA A;  4RHJ A;  5D1D A;  5THT A;  5THU A;  3SFF A;  4BZ8 A;  4RHM A;  4BZ5 A;  1ZZ1 A;  1C3S A;  3E8Z A;  1TBJ A;  2V5W A;  5G1B A;  5BWZ A;  3E9B A;  4Q3T A;  4GWC A;  4IU0 A;  4CBY A;  3GMZ A;  5FCW A;  5ICN B;  4QA7 A;  5EFB D;  5G17 A;  2VQW G;  4IE3 A;  1XFK A;  3MFV A;  4IU5 A;  5G0J A;  2VCG A;  3MMR A;  4LY1 A;  4MYN A;  5RLA A;  4Q3R C;  3E8Q A;  4QA6 A;  1GQ6 A;  5FUE A;  4Q41 A;  4Q3Q A;  5JI5 A;  4A69 A;  4ZUR A;  4CQF A;  1WOH A;  5THV A;  1WVA A;  3Q9F A;  3MEN A;  3E6K A;  1P8S A;  2GH6 A;  4FCI A;  1T4S A;  3C0Y A;  4ITY A;  3THH A;  1CEV A;  3MZ6 A;  3ZNR A;  5EEN A;  3SKK A;  4Q42 A;  3EWF A;  4RLA A;  1R1O A;  2VQQ A;  4GSV A;  3MAX A;  4QA1 A;  4MYL A;  4MYF A;  3SFH A;  1GQ7 A;  4RN0 A;  5G13 A;  3M1R A;  4QA2 A;  4QA0 A;  3EW8 A;  2VQJ A;  3RQD A;  3MJL A;  1ZPG A;  1HQG A;  4LXZ A;  3MZ7 A;  3THJ A;  4G3H A;  5D1C A;  4Q40 A;  2AEB A;  5EF7 A;  1T67 A;  1PQ3 A;  3E6V A;  3LHL A;  4RN2 A;  2ZAV A;  3Q9E A;  5IX0 A;  2VQV A;  1WOG A;  4IXV A;  1HQX A;  3C0Z A;  4RN1 A;  3Q9C A;  3F07 A;  5EEK A;  5G11 A;  4IE1 A;  4BZ9 A;  1P8M A;  1RLA A; 
#chains in the Genus database with same CATH homology
 4RHK A;  3RLA A;  1D3V A;  2PLL A;  3SL0 A;  1WVB A;  3TH7 A;  4CEV A;  4DZ4 A;  3KV2 A;  1TA1 A;  4IU4 A;  4IU1 A;  4IXU A;  1T5G A;  4Q3P A;  3NIO A;  5HJA A;  2EF5 A;  1P8O A;  2PHA A;  3CEV A;  5CEV A;  4Q3S A;  1HQ5 A;  2EF4 A;  4I06 A;  4FCK A;  4GSZ A;  4GSM A;  3TF3 A;  3THE A;  3MFW A;  4HXQ A;  4IE2 A;  1ZPE A;  1HQF A;  1WOI A;  3SJT A;  3LP4 A;  1P8P A;  1TBH A;  1HQH A;  3PZL A;  3NIQ A;  3LP7 A;  2EIV A;  4HZE A;  1P8Q A;  3NIP A;  1T4P A;  4Q3U A;  1T4R A;  5HJ9 A;  4MYK A;  3GN0 A;  3DJ8 A;  4Q3V A;  4Q3R A;  3SL1 A;  3F80 A;  1P8N A;  2CEV A;  4RHL A;  1P8R A;  4HWW A;  1T4T A;  1TBL A;  4RHI A;  4MXR A;  4RHQ A;  2A0M A;  1T5F A;  2PHO A;  4GWD A;  2RLA A;  4RHJ A;  4RHM A;  3E8Z A;  1TBJ A;  3E9B A;  4Q3T A;  4GWC A;  4IU0 A;  3GMZ A;  4IE3 A;  1XFK A;  3MFV A;  4IU5 A;  3MMR A;  4MYN A;  5RLA A;  4Q3R C;  3E8Q A;  1GQ6 A;  4Q41 A;  4Q3Q A;  1WOH A;  1WVA A;  3E6K A;  1P8S A;  4FCI A;  1T4S A;  4ITY A;  3THH A;  1CEV A;  3SKK A;  4Q42 A;  4RLA A;  1R1O A;  4GSV A;  4MYL A;  4MYF A;  1GQ7 A;  3M1R A;  3MJL A;  1ZPG A;  1HQG A;  3THJ A;  4G3H A;  4Q40 A;  2AEB A;  1PQ3 A;  3E6V A;  3LHL A;  2ZAV A;  4IXV A;  1WOG A;  1HQX A;  4IE1 A;  1P8M A;  1RLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...