1CEWI

The 2.0 angstroms x-ray crystal structure of chicken egg white cystatin and its possible mode of interaction with cysteine proteinases
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN
publication title The 2.0 A X-ray crystal structure of chicken egg white cystatin and its possible mode of interaction with cysteine proteinases.
pubmed rcsb
source organism Gallus gallus
molecule tags Proteinase inhibitor(cysteine)
total genus 22
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cewI00
4N6MA 1IV9A 3IMAB 1FUWA 1EQKA 3K9MC 1YVBI 1G96A 5LC7A 5ELUA 1RN7A 3Q2PA 4N6V0 2KXGA 3KSED 1ROAA 3UL5A 4IT7A 3PS8A 3KFQC 1PFPA 1N5PA 3QRDA 1DVDA 2OCTA 5ELJA 4ZM8A 1LXEA 1IV7A 1CYUA 2W9QA 1CYVA 1CEWI 1WNHA 1NB3I 3S67A 4N6OB 1FA3A 1MOLA 1N9JA 1A67A 1NB5I 5A0OB 4N6TA 2CH9A 2W9PA 4EYCA 4LZIA 1N5HA 2BO9B 1TIJA 4TX4A 4N6NB 3MWZA 1GD4A 3UL6A 3GAXA 1KWIA 1A90A 1DVCA 1STFI 3PYJA 4N6UA 3SVAA 5EQLA 3PXMA 4N6LA 5LC6A 2O9UX 3NX0A 3L0RA 1GD3A 1MNLA 1M9GA 3LH4A 1R4CA 4CCVA
chains in the Genus database with same CATH superfamily
3I0YA 3MKIA 4N6MA 3DGOA 5IF6A 3A76A 2Q07A 2F5MA 2XFSA 3MG1A 4GSPA 4R80A 3N9HA 1YI23 3NM7A 2UUGC 4QWTA 1EQKA 1LNIA 1RGCA 2SARA 1K28A 3EX9A 3OW22 1S723 4HOHA 3DUKA 4O02B 1VQ73 1YJW3 3RGAA 1JBRA 3CCS3 5ELUA 1GY6A 2E2UA 2CHCA 2H0HA 3FF0A 3Q2PA 1X1UA 4HM4B 4N6V0 2KXGA 3HI7A 1RN4A 3D79A 3N54B 1YIT3 9RNTA 1HZ1A 3WHOA 3X3YA 1Q7Y4 2W56B 4HM0B 3WOEB 2BMOB 1TFOA 3DGMA 1N5PA 5BU4A 2OTJ3 1BIRA 4FMBA 4EW5A 1K41A 3CCL3 4XDVA 1QAKA 3MYTA 1LXEA 5KP4A 1JZOA 2GU1A 5DRVA 1CQSA 1K9M4 1CYVA 5AYRB 1VQP3 1CEWI 1UCJA 2OWPA 2KF4A 4BIRA 3HIIA 3PZWA 4EV2A 3HIGA 1MGWA 1TU5A 1RKYA 2LQVA 3BB9A 1B2ZA 3IPTA 4NHFA 1TP6A 3X3ZA 4HZ9B 1I0XA 3FH1A 1BRKA 4WP5A 2CFGA 1W00A 1BSBA 4N6OB 1V58A 3S28A 1FA3A 2B24B 1UW1A 5JBSA 4KT3B 2P0XA 5G1LA 3H3HA 4BL2A 1B27A 1G02A 1UGIA 1N8R4 3GRDA 2CG0A 4N6TA 2RSXA 5G2GA 2RNTA 1QVG2 2P38A 1OF5B 1Z1SA 1JRQA 1S5AA 1U5OA 3KZTA 2KF5A 3GZXB 1QAFA 3KCHA 3NBBA 3K63A 4KFDA 1YIJ3 3DXOA 1W5ZA 5CF1A 2C4BA 1I70A 4HM7B 2AAEA 5IG3A 2Z7AA 5I97A 1TIJA 2OOVC 3EN1B 1OGZA 1VQL3 1B21A 2HOHA 1MWUA 1B2UA 3F14A 3CCJ3 1UI7A 1GY7A 3GZYB 1IVWA 5BXQA 2F99A 3MWZA 3UL6A 1OGXA 2XR8B 3AGOA 4BTWA 1BSAA 5HGRA 5M18A 1BU4A 4ILFA 2KF3A 3B7CA 4MMXB 1RLSA 3OX9A 2FGTA 1EEJA 1W4NA 3AGNA 3JUNA 1DYUA 1MGRA 2ZL8A 1YVSA 3F7XA 1UGHI 1IDPA 2XGLA 3LMLA 2A15A 1JBSA 2BMRB 2CWUA 3HOHA 3PGBA 4OUQA 3ER7A 2I9WA 2P05A 3CU3A 5BIRA 1GS3A 1JB5A 3FF2A 4FCZA 1ZS7A 2GBWB 4XBTA 3FZWA 2XRXB 1N8QA 4HJLB 1D6ZA 3NX0A 3SYUA 1D6UA 3GZBA 3Q1CA 1BNJA 1T5YA 3AHWA 1OCVA 5TGNA 2YFJB 3PCSA 3WOFB 1GOUA 3LH4A 3F9SA 1T2HA 2CWTA 1X1WA 1W02A 4CCVA 1IU7A 3OV4A 4U13A 1F8NA 2GU3A 5CF2A 3E99A 1UCIA 2BU4A 3MG2A 1M904 1FUWA 3K9MC 1B20A 2Y74A 3KKGA 3SLUA 4RNYA 1L5GB 3URPA 1FYSA 5LC7A 3G713 1ZX2A 2STDA 3LYGA 1RN7A 2XEPA 3FCSB 2GBXB 4O8SA 3JUMA 1MWTA 4FMDA 3WA2X 2XGNA 1V57A 1RSNA 3UL5A 1B2MA 2CWVA 4WYKA 3FSDA 3LXUX 3QK9A 4AEQA 1EG9B 4I5QA 4AKZA 2P0MA 2OCTA 1V74A 1TJDA 1HU9A 2IA7A 3G8ZA 3HZPA 5D82A 5IW9A 4FMCA 3BNBA 1JBTA 1BRSA 1GYBA 2XH9A 3A5EA 4ZM8A 3AHSA 4CJNA 2HMKB 5AIIA 1BANA 1GMRA 3SOYA 1D6YA 1LQGC 3NBRA 4KZ1A 5D81A 3UNLA 4LMIA 3LT8A 3V98A 1B2SA 4JRFA 1NDOB 2GXFA 3FG1A 1GMQA 3DGNA 1IQ8A 1HKXA 4Q53A 3EQQB 3M8CA 3HX8A 4DKIA 4CDLA 5KP1A 1SPUA 2CFKA 3EF8A 4LYLB 1UUGB 1BAOA 1UI8A 5IEOA 1VQN3 5EEOA 5A0OB 2SBLA 5EVHA 1WTHA 4K90B 1OHSA 1N5HA 4H3UA 1RRLA 2BO9B 2MF7A 4L7KA 2PZVA 2W6JH 3NV0A 2OQEC 1AQZA 4L8OA 5FW5A 1Q864 1NNVA 1X1YA 1AVLA 1QALA 2JQ5A 1FUTA 1Q40A 3GAXA 1IQYA 2RGQA 1A90A 2GSPA 2R41A 1R4YA 1DVCA 3LT9A 4FR9A 3CC73 3CCQ3 3LOYA 3F7SA 1BRJA 4X2HA 1BRNL 1TRPA 2CX1A 3NM2A 1OACA 3BIRA 5AYSC 3D4AA 2Z77A 1T3BA 4N3VA 1KD14 1LOYA 1VZZA 4HM3B 2RFRA 4G1MB 1IVUA 3I563 1VQQA 3BNEA 2WOHA 5LC6A 4WHAA 3F8XA 2WOFA 2MC8A 1DMNA 1SQWA 1W6YA 4IIAA 4HM6B 1I2FA 1OUNA 5D83A 2F4YA 1VQ63 1YNVX 1RGGA 3LTCA 1QMAA 1YGWA 4HAAA 1W01A 3K7CA 5KP3A 3V92A 1JN5A 2H0IA 1JB4A 3ALAA 1E3RA 1GD3A 3DGYA 1RGKA 4X2OA 5M19A 4HKVB 2BNGA 1MNLA 2P09A 4R4KA 1BRGA 3AMOA 3BNCA 1JJ22 4L8PA 4BTYA 1RGEA 1R4CA 4MEIA 1JB2A 3G0KA 5BVBA 2HMLB 3CD63 2M7OA 1EKMA 1WMOA 1IQXA 1ULJB 3B4OA 4FMAA 3FG3A 1X1XA 4HZBB 1C7HA 3RDEA 1BNSA 2RCDA 4K1VA 1WQLB 3NQZA 3PCRA 1AV4A 3UJMA 3IMAB 1TFKA 3DM8A 3D9RA 3DGLA 3NXJA 5STDA 3WR2A 2UX0A 1YVBI 1OHPA 1O7HB 1OH0A 2XF3A 1RRHA 1US1A 3MPHA 4KFFA 4ORLA 2H0GA 4WYKB 1BNRA 3EN8A 1BUQA 3LTDA 2CKFB 3JUPA 4STDA 2OOVA 1BSEA 3KSPA 1ROAA 1JZDA 1FZUA 2HMOB 1Q7HA 1E3VA 4FCJA 5AEWB 5HOHA 4IPBA 3RNTA 3CC23 2CFWA 4J5KA 1RGLA 3KFQC 1PFPA 3B4PA 4BTXA 1DVDA 5JPUA 4R9LA 2F5WA 2XFTA 1BUJA 1BNFA 2HMJB 5ELJA 1UCLA 2ML6A 1QJGA 2CK3H 3I553 4K1UA 3J7Yd 1IV7A 3Q3FA 1ULIB 3EBTA 3OWUA 4LEHA 1JNQA 4OK0A 8RNTA 3LZAA 3T8NA 3EC9A 3ZG5A 1UDII 4WFOA 5AIGA 1FGMA 5RNTA 1J2BA 1TRQA 1NB3I 3S67A 2Z6BA 3BNDA 4BU4A 1K734 1IVXA 3X41A 1AY7A 1N9JA 3SOAA 3DY5A 3WDGB 3CME3 3CC43 1LOWA 3VF1A 2PNCA 1HYFA 3D3LA 5CXOA 1DMMA 3EBYA 1STDA 1PY3A 1FGRA 2J8XB 2C11A 1RTUA 1SIIA 2YFIB 2W2CA 4OVMA 4HM1B 1MWRA 2KF6A 5M1AA 1IT7A 2W9PA 3NV0B 4EYCA 3FKAA 4NPBA 3CCU3 3S29A 3STDA 4LZIA 8CHOA 5JPPA 1LQMB 1I0VA 1G0TA 7STDA 4JF8A 1Q40B 2IMJA 4H61A 7GSPA 2BT3A 3WODG 4EC6A 1VQ43 2K0MA 3F40A 2RBIA 3ROBA 3LTAA 2K54A 1VQ83 3KN4A 1BVIA 4HM5B 1RDSA 3K5TA 1SIHA 1K8A4 1RNBA 3UB1A 2CFLA 3ECFA 1YJ93 1NU3A 4HM8B 2W03A 3ZFZA 3GWRA 2CFDA 2GEXA 2YX9A 3PYJA 4N6UA 1DE3A 3T8UA 2D1WA 3HK4A 1DETA 3CPOA 5CLKA 5G1KA 4J8TA 2B1XB 3SVAA 4AKYA 2Y73A 3EB8A 3EJVA 3VSYA 3CPW2 3NQYA 4GHOA 2ZDJA 1W2B2 2O3OA 1U8CB 1DMQA 1TTOA 1NJI4 2Z76A 1JN5B 2BHMA 1GY5A 1PU4A 3FGYA 3OWSA 1YGEA 1GMPA 2O9UX 3CMA3 1O7PB 1I2EA 3AMOB 1ZGXA 1O7GB 3KE7A 3X40A 2INXA 2L4VA 1PYLA 2E2VA 1BRIA 1WMPA 2IYJA 5IENA 2JDIH 1QVF2 4HYZA 1M9GA 2CIUA 1JKGA 2ZHXB 1UCKA 1RN1A 3EHCA 1W6GA 1T2IA 2HMMB 3BU4A 2IUJA 3VGNA 4PEJA 6STDA 1FUSA 1E97A 1W2ZA 4XDWA 3MHEA 3SX1A 3CCE3 1VQM3 1RHLA 2IUKA 1RGAA 2OTL3 1CH0A 2WGOA 2WO0A 1IV9A 4GB5A 4MJDA 1SJWA 3CCR3 6RNTA 2KCDA 3FG4A 1VQK3 1O7MB 2KAAA 2R4IA 2XSHB 4O2HA 1G96A 3JUQA 1B2XA 1LRAA 4LSOA 4XB5A 3G16A 1RMSA 1OPYA 3NBJA 4EBGA 7RNTA 1RCLA 3IJEB 3ZG0A 3KSED 1ZO2A 3NHXA 3WA3A 2OQEA 4HBRA 1BOXA 1VQO3 1RGFA 4IT7A 5CK6A 3DH2A 1Q824 3PS8A 4J9AA 4MMZB 1EUIC 3MSOA 3QRDA 5DREA 3SEDA 3DMCA 3FLJA 4EV5A 3U97A 2F56A 1BGSA 2W56A 1CYUA 1A2VA 2BIRA 4RZMA 1YJN3 1A2PA 3S5CA 2W9QA 4RNTA 1A2KA 2UGIA 5IG4A 1LVNA 1RGHA 1WNHA 4R1KA 4BL3A 1IK3A 5AIHA 2LYXA 1ISKA 1Q9EA 2W04A 3OWYA 3V99A 3NUVA 4GL6A 1Y4KA 1BSCA 3LTBA 1TUHA 2HMNB 3G4S3 3JUOA 1FW7A 3CNXA 1RJOA 1MOLA 2WGQA 3JVCA 3H51A 1BNEA 1A67A 1BNGA 2FXTA 3CXC2 2FNQA 1MWSA 4I4KA 5AEUB 6GSPA 1W6CA 4KFEA 1ASKA 3OXAA 3CNMA 3X42A 1I3IA 2CC3A 2CH9A 1NB5I 3GZRA 4XBYA 2ML5A 2YFLB 5IG0A 3TDGA 1BRHA 4EXRA 1C54A 1O7WB 1W7CA 2K3DA 1AR0A 1M1XB 5IG5A 1IT8A 3B8LA 4XBXA 4MMYB 1GSPA 2QEX3 1IYYA 2C10A 4O3VA 1OF5A 1LNHA 3D5GA 3S27A 3RGRA 3X3XA 2BMQB 4TX4A 1AVKA 1ROVA 1NO3A 4N6NB 1O7NB 1UUVB 3MG3A 1M1K4 1GOYA 4KVHA 4XM4A 1B3SA 1UUWB 1GD4A 1I2GA 4RNZA 1VQ53 1KWIA 1YHQ3 2QGUA 1KQS2 5AIFA 3CCM3 3T0UA 4R9KA 1I3FA 1KSIA 1STFI 2ZA4A 2CW9A 1SARA 2XSOB 5IEPA 5IERA 4J5GA 3GSPA 1FGOA 3O8YA 3PXMA 5EQLA 4N6LA 2CG1A 3G6E3 2IY2A 1VQ93 2F98A 1FGQA 1LOXA 2L1SA 3K0ZA 3D5IA 1OHOA 1LOVA 1RNTA 2D42A 2E2TA 3F8HA 3CCV3 4LGQA 2F86B 4NREA 1Q42A 1JV2B 4HVNA 4CPKA 1Q814 3WMDA 5FGOA 1NWWA 4RBNA 1JKGB 3N8BA 1I8VA 4WWUC 3KIIA 3Q90A 1FGTA 1GOVA 2V1LA 3L0RA 4FCMA 1WMNA 1EA2A 1N9EA 2AADA 3DZLA 2W0QA 1BNIA 2CX0A 1BSDA 1IVVA 2QIYA 1RCKA 5GSPA 5AI1A 2KRTA 3BLZA 2GEYA 4HM2B 4K61A 3EE1A 1KC84 3U1WA 3SXXA 2QA43
chains in the Genus database with same CATH topology
3I0YA 3MKIA 4N6MA 3DGOA 5IF6A 3A76A 2Q07A 2XFSA 3MG1A 4R80A 3N9HA 1YI23 3NM7A 4QWTA 1EQKA 3OW22 1K28A 3EX9A 1S723 4O02B 3DUKA 1YJW3 1VQ73 3RGAA 3CCS3 5ELUA 1GY6A 2E2UA 2CHCA 4HM4B 3FF0A 3Q2PA 4N6V0 2KXGA 3HI7A 3N54B 1YIT3 3X3YA 1Q7Y4 2W56B 4HM0B 3WOEB 2BMOB 1TFOA 3DGMA 1N5PA 2OTJ3 4FMBA 1K41A 3CCL3 4XDVA 1QAKA 3MYTA 1LXEA 5KP4A 2GU1A 5DRVA 1CQSA 1K9M4 1CYVA 5AYRB 1VQP3 1CEWI 2OWPA 3HIIA 3PZWA 4EV2A 3HIGA 1TU5A 1RKYA 2LQVA 3BB9A 3IPTA 4NHFA 1TP6A 3X3ZA 4HZ9B 3FH1A 4WP5A 2CFGA 1W00A 4N6OB 3S28A 1FA3A 2B24B 1UW1A 5JBSA 2P0XA 3H3HA 1N8R4 3GRDA 2CG0A 4N6TA 2RSXA 5G2GA 1QVG2 2P38A 1OF5B 1Z1SA 1JRQA 1S5AA 1U5OA 3KZTA 3GZXB 1QAFA 3NBBA 3K63A 4KFDA 1YIJ3 3DXOA 1W5ZA 5CF1A 5IG3A 4HM7B 2Z7AA 5I97A 1TIJA 2OOVC 3EN1B 1OGZA 1VQL3 3F14A 3CCJ3 1UI7A 1GY7A 3GZYB 1IVWA 5BXQA 2F99A 3MWZA 3UL6A 1OGXA 2XR8B 4BTWA 5HGRA 3B7CA 4MMXB 3OX9A 2FGTA 1W4NA 3JUNA 1DYUA 2ZL8A 3F7XA 1IDPA 2XGLA 3LMLA 2A15A 2BMRB 2CWUA 3PGBA 4OUQA 3ER7A 2I9WA 2P05A 3CU3A 1GS3A 1JB5A 3FF2A 4FCZA 2GBWB 4XBTA 3FZWA 2XRXB 1N8QA 4HJLB 1D6ZA 3NX0A 1D6UA 3GZBA 3Q1CA 1T5YA 1OCVA 5TGNA 2YFJB 3PCSA 3WOFB 3LH4A 3F9SA 2CWTA 1W02A 4CCVA 1IU7A 3OV4A 4U13A 1F8NA 2GU3A 5CF2A 3E99A 3MG2A 1M904 1FUWA 3K9MC 2Y74A 3KKGA 3SLUA 4RNYA 1L5GB 5LC7A 3G713 1ZX2A 2STDA 3LYGA 1RN7A 2XEPA 3FCSB 2GBXB 4O8SA 3JUMA 4FMDA 3WA2X 2XGNA 3UL5A 2CWVA 4WYKA 3FSDA 3LXUX 3QK9A 4AEQA 1EG9B 4AKZA 2P0MA 2OCTA 1V74A 2IA7A 1HU9A 3G8ZA 5D82A 3HZPA 5IW9A 4FMCA 3BNBA 1GYBA 2XH9A 4ZM8A 2HMKB 5AIIA 3SOYA 1D6YA 3NBRA 4KZ1A 5D81A 3UNLA 4LMIA 3LT8A 3V98A 4JRFA 1NDOB 2GXFA 3FG1A 3DGNA 1IQ8A 1HKXA 4Q53A 3EQQB 3M8CA 3HX8A 4CDLA 5KP1A 1SPUA 2CFKA 3EF8A 5IEOA 1UI8A 1VQN3 5EEOA 5A0OB 2SBLA 5EVHA 1WTHA 4K90B 1OHSA 1N5HA 4H3UA 1RRLA 2BO9B 2MF7A 4L7KA 2PZVA 2W6JH 3NV0A 2OQEC 4L8OA 5FW5A 1Q864 1AVLA 1QALA 2JQ5A 1Q40A 3GAXA 1IQYA 2RGQA 1A90A 3LT9A 1DVCA 4FR9A 3CC73 3CCQ3 3LOYA 3F7SA 4X2HA 3NM2A 1OACA 5AYSC 2Z77A 4N3VA 1KD14 1VZZA 4HM3B 2RFRA 4G1MB 1IVUA 3I563 3BNEA 2WOHA 5LC6A 4WHAA 3F8XA 2WOFA 2MC8A 1DMNA 1SQWA 1W6YA 4IIAA 4HM6B 1OUNA 5D83A 1VQ63 3LTCA 1QMAA 5KP3A 3V92A 1W01A 3K7CA 1JN5A 1JB4A 3ALAA 1E3RA 1GD3A 4X2OA 4HKVB 2BNGA 1MNLA 2P09A 4R4KA 3AMOA 3BNCA 1JJ22 4L8PA 4BTYA 1R4CA 4MEIA 1JB2A 3G0KA 5BVBA 2HMLB 3CD63 2M7OA 1IQXA 1WMOA 1EKMA 3B4OA 1ULJB 4FMAA 3FG3A 4HZBB 1C7HA 3RDEA 2RCDA 4K1VA 1WQLB 3NQZA 3PCRA 1AV4A 3UJMA 3IMAB 1TFKA 3DM8A 3D9RA 3DGLA 3NXJA 5STDA 2UX0A 1YVBI 1OHPA 1O7HB 1OH0A 2XF3A 1RRHA 1US1A 3MPHA 4KFFA 4ORLA 4WYKB 3EN8A 1BUQA 3LTDA 2CKFB 3JUPA 4STDA 2OOVA 3KSPA 1ROAA 2HMOB 4FCJA 1E3VA 5AEWB 4IPBA 3CC23 2CFWA 3KFQC 1PFPA 3B4PA 4BTXA 1DVDA 5JPUA 4R9LA 2XFTA 2HMJB 5ELJA 2ML6A 1QJGA 2CK3H 3I553 4K1UA 3J7Yd 1IV7A 1ULIB 3EBTA 3OWUA 4LEHA 1JNQA 4OK0A 3LZAA 3T8NA 3EC9A 4WFOA 5AIGA 1FGMA 1J2BA 1NB3I 3S67A 2Z6BA 3BNDA 1K734 1IVXA 3X41A 1N9JA 3SOAA 3DY5A 3WDGB 3CME3 3CC43 3VF1A 2PNCA 3D3LA 5CXOA 1DMMA 3EBYA 1STDA 1FGRA 2C11A 1SIIA 2YFIB 2W2CA 4OVMA 4HM1B 1IT7A 2W9PA 3NV0B 4EYCA 3FKAA 3CCU3 3S29A 3STDA 4LZIA 8CHOA 5JPPA 7STDA 4JF8A 1Q40B 2IMJA 4H61A 2BT3A 3WODG 4EC6A 1VQ43 2K0MA 3F40A 3ROBA 3LTAA 2K54A 1VQ83 3KN4A 4HM5B 3K5TA 1SIHA 1K8A4 3UB1A 2CFLA 3ECFA 1YJ93 1NU3A 4HM8B 2W03A 3GWRA 2CFDA 2GEXA 2YX9A 3PYJA 4N6UA 3T8UA 2D1WA 3HK4A 5CLKA 3CPOA 3SVAA 4J8TA 2B1XB 4AKYA 3CPW2 2Y73A 3EB8A 3EJVA 3VSYA 3NQYA 2ZDJA 1W2B2 2O3OA 1U8CB 1DMQA 1NJI4 2Z76A 1JN5B 2BHMA 1GY5A 1PU4A 3FGYA 3OWSA 1YGEA 2O9UX 3CMA3 1O7PB 3AMOB 1O7GB 3KE7A 3X40A 2INXA 2L4VA 2E2VA 5IENA 1WMPA 2JDIH 1QVF2 4HYZA 1M9GA 2CIUA 1JKGA 3EHCA 2IUJA 3VGNA 1W6GA 2HMMB 6STDA 4PEJA 1E97A 1W2ZA 4XDWA 3MHEA 3SX1A 3CCE3 1VQM3 2IUKA 2OTL3 2WGOA 2WO0A 1IV9A 4GB5A 4MJDA 1SJWA 3CCR3 2KCDA 3FG4A 1VQK3 1O7MB 2R4IA 2XSHB 4O2HA 1G96A 3JUQA 4XB5A 4LSOA 3G16A 1OPYA 3NBJA 4EBGA 3IJEB 3KSED 1ZO2A 3NHXA 3WA3A 2OQEA 4HBRA 1VQO3 4IT7A 5CK6A 1Q824 3PS8A 4J9AA 4MMZB 3MSOA 3QRDA 5DREA 3SEDA 3DMCA 3FLJA 4EV5A 3U97A 2W56A 1CYUA 1A2VA 4RZMA 1YJN3 3S5CA 2W9QA 1A2KA 5IG4A 1LVNA 1WNHA 4R1KA 1IK3A 5AIHA 2LYXA 1ISKA 2W04A 3OWYA 3V99A 3NUVA 4GL6A 1Y4KA 3LTBA 1TUHA 2HMNB 3G4S3 3JUOA 3CNXA 1RJOA 1MOLA 2WGQA 3JVCA 3H51A 1A67A 2FXTA 3CXC2 2FNQA 4I4KA 5AEUB 1W6CA 4KFEA 1ASKA 3OXAA 3CNMA 3X42A 2CC3A 1NB5I 2CH9A 3GZRA 4XBYA 2ML5A 2YFLB 5IG0A 3TDGA 4EXRA 1O7WB 1W7CA 1AR0A 1M1XB 5IG5A 1IT8A 3B8LA 4XBXA 4MMYB 2QEX3 2C10A 4O3VA 1OF5A 1LNHA 3S27A 3RGRA 3X3XA 2BMQB 4TX4A 1AVKA 1ROVA 1NO3A 4N6NB 1O7NB 1UUVB 3MG3A 1M1K4 4KVHA 4XM4A 1GD4A 1UUWB 4RNZA 1VQ53 1KWIA 1YHQ3 2QGUA 1KQS2 5AIFA 3CCM3 3T0UA 4R9KA 1KSIA 1STFI 2CW9A 2XSOB 5IEPA 5IERA 2CG1A 1FGOA 3O8YA 3PXMA 5EQLA 4N6LA 3G6E3 1VQ93 2F98A 1LOXA 1FGQA 3K0ZA 1OHOA 3F8HA 3CCV3 2D42A 2E2TA 4LGQA 2F86B 4NREA 1Q42A 1JV2B 4HVNA 1Q814 3WMDA 5FGOA 1NWWA 4RBNA 1JKGB 3N8BA 4WWUC 3KIIA 3Q90A 1FGTA 2V1LA 3L0RA 4FCMA 1WMNA 1EA2A 1N9EA 3DZLA 2W0QA 1IVVA 2QIYA 5AI1A 2KRTA 3BLZA 2GEYA 4HM2B 4K61A 3EE1A 1KC84 3U1WA 3SXXA 2QA43
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6M A;  1IV9 A;  3IMA B;  1FUW A;  1EQK A;  3K9M C;  1YVB I;  1G96 A;  5LC7 A;  5ELU A;  1RN7 A;  3Q2P A;  4N6V 0;  2KXG A;  3KSE D;  1ROA A;  3UL5 A;  4IT7 A;  3PS8 A;  3KFQ C;  1PFP A;  1N5P A;  3QRD A;  1DVD A;  2OCT A;  5ELJ A;  4ZM8 A;  1LXE A;  1IV7 A;  1CYU A;  2W9Q A;  1CYV A;  1CEW I;  1WNH A;  1NB3 I;  3S67 A;  4N6O B;  1FA3 A;  1MOL A;  1N9J A;  1A67 A;  1NB5 I;  5A0O B;  4N6T A;  2CH9 A;  2W9P A;  4EYC A;  4LZI A;  1N5H A;  2BO9 B;  1TIJ A;  4TX4 A;  4N6N B;  3MWZ A;  1GD4 A;  3UL6 A;  3GAX A;  1KWI A;  1A90 A;  1DVC A;  1STF I;  3PYJ A;  4N6U A;  3SVA A;  5EQL A;  3PXM A;  4N6L A;  5LC6 A;  2O9U X;  3NX0 A;  3L0R A;  1GD3 A;  1MNL A;  1M9G A;  3LH4 A;  1R4C A;  4CCV A; 
#chains in the Genus database with same CATH topology
 3I0Y A;  3MKI A;  4N6M A;  3DGO A;  5IF6 A;  3A76 A;  2Q07 A;  2F5M A;  2XFS A;  3MG1 A;  4GSP A;  4R80 A;  3N9H A;  1YI2 3;  3NM7 A;  2UUG C;  4QWT A;  1EQK A;  1LNI A;  1RGC A;  2SAR A;  1K28 A;  3EX9 A;  3OW2 2;  1S72 3;  4HOH A;  3DUK A;  4O02 B;  1VQ7 3;  1YJW 3;  3RGA A;  1JBR A;  3CCS 3;  5ELU A;  1GY6 A;  2E2U A;  2CHC A;  2H0H A;  3FF0 A;  3Q2P A;  1X1U A;  4HM4 B;  4N6V 0;  2KXG A;  3HI7 A;  1RN4 A;  3D79 A;  3N54 B;  1YIT 3;  9RNT A;  1HZ1 A;  3WHO A;  3X3Y A;  1Q7Y 4;  2W56 B;  4HM0 B;  3WOE B;  2BMO B;  1TFO A;  3DGM A;  1N5P A;  5BU4 A;  2OTJ 3;  1BIR A;  4FMB A;  4EW5 A;  1K41 A;  3CCL 3;  4XDV A;  1QAK A;  3MYT A;  1LXE A;  5KP4 A;  1JZO A;  2GU1 A;  5DRV A;  1CQS A;  1K9M 4;  1CYV A;  5AYR B;  1VQP 3;  1CEW I;  1UCJ A;  2OWP A;  2KF4 A;  4BIR A;  3HII A;  3PZW A;  4EV2 A;  3HIG A;  1MGW A;  1TU5 A;  1RKY A;  2LQV A;  3BB9 A;  1B2Z A;  3IPT A;  4NHF A;  1TP6 A;  3X3Z A;  4HZ9 B;  1I0X A;  3FH1 A;  1BRK A;  4WP5 A;  2CFG A;  1W00 A;  1BSB A;  4N6O B;  1V58 A;  3S28 A;  1FA3 A;  2B24 B;  1UW1 A;  5JBS A;  4KT3 B;  2P0X A;  5G1L A;  3H3H A;  4BL2 A;  1B27 A;  1G02 A;  1UGI A;  1N8R 4;  3GRD A;  2CG0 A;  4N6T A;  2RSX A;  5G2G A;  2RNT A;  1QVG 2;  2P38 A;  1OF5 B;  1Z1S A;  1JRQ A;  1S5A A;  1U5O A;  3KZT A;  2KF5 A;  3GZX B;  1QAF A;  3KCH A;  3NBB A;  3K63 A;  4KFD A;  1YIJ 3;  3DXO A;  1W5Z A;  5CF1 A;  2C4B A;  1I70 A;  4HM7 B;  2AAE A;  5IG3 A;  2Z7A A;  5I97 A;  1TIJ A;  2OOV C;  3EN1 B;  1OGZ A;  1VQL 3;  1B21 A;  2HOH A;  1MWU A;  1B2U A;  3F14 A;  3CCJ 3;  1UI7 A;  1GY7 A;  3GZY B;  1IVW A;  5BXQ A;  2F99 A;  3MWZ A;  3UL6 A;  1OGX A;  2XR8 B;  3AGO A;  4BTW A;  1BSA A;  5HGR A;  5M18 A;  1BU4 A;  4ILF A;  2KF3 A;  3B7C A;  4MMX B;  1RLS A;  3OX9 A;  2FGT A;  1EEJ A;  1W4N A;  3AGN A;  3JUN A;  1DYU A;  1MGR A;  2ZL8 A;  1YVS A;  3F7X A;  1UGH I;  1IDP A;  2XGL A;  3LML A;  2A15 A;  1JBS A;  2BMR B;  2CWU A;  3HOH A;  3PGB A;  4OUQ A;  3ER7 A;  2I9W A;  2P05 A;  3CU3 A;  5BIR A;  1GS3 A;  1JB5 A;  3FF2 A;  4FCZ A;  1ZS7 A;  2GBW B;  4XBT A;  3FZW A;  2XRX B;  1N8Q A;  4HJL B;  1D6Z A;  3NX0 A;  3SYU A;  1D6U A;  3GZB A;  3Q1C A;  1BNJ A;  1T5Y A;  3AHW A;  1OCV A;  5TGN A;  2YFJ B;  3PCS A;  3WOF B;  1GOU A;  3LH4 A;  3F9S A;  1T2H A;  2CWT A;  1X1W A;  1W02 A;  4CCV A;  1IU7 A;  3OV4 A;  4U13 A;  1F8N A;  2GU3 A;  5CF2 A;  3E99 A;  1UCI A;  2BU4 A;  3MG2 A;  1M90 4;  1FUW A;  3K9M C;  1B20 A;  2Y74 A;  3KKG A;  3SLU A;  4RNY A;  1L5G B;  3URP A;  1FYS A;  5LC7 A;  3G71 3;  1ZX2 A;  2STD A;  3LYG A;  1RN7 A;  2XEP A;  3FCS B;  2GBX B;  4O8S A;  3JUM A;  1MWT A;  4FMD A;  3WA2 X;  2XGN A;  1V57 A;  1RSN A;  3UL5 A;  1B2M A;  2CWV A;  4WYK A;  3FSD A;  3LXU X;  3QK9 A;  4AEQ A;  1EG9 B;  4I5Q A;  4AKZ A;  2P0M A;  2OCT A;  1V74 A;  1TJD A;  1HU9 A;  2IA7 A;  3G8Z A;  3HZP A;  5D82 A;  5IW9 A;  4FMC A;  3BNB A;  1JBT A;  1BRS A;  1GYB A;  2XH9 A;  3A5E A;  4ZM8 A;  3AHS A;  4CJN A;  2HMK B;  5AII A;  1BAN A;  1GMR A;  3SOY A;  1D6Y A;  1LQG C;  3NBR A;  4KZ1 A;  5D81 A;  3UNL A;  4LMI A;  3LT8 A;  3V98 A;  1B2S A;  4JRF A;  1NDO B;  2GXF A;  3FG1 A;  1GMQ A;  3DGN A;  1IQ8 A;  1HKX A;  4Q53 A;  3EQQ B;  3M8C A;  3HX8 A;  4DKI A;  4CDL A;  5KP1 A;  1SPU A;  2CFK A;  3EF8 A;  4LYL B;  1UUG B;  1BAO A;  1UI8 A;  5IEO A;  1VQN 3;  5EEO A;  5A0O B;  2SBL A;  5EVH A;  1WTH A;  4K90 B;  1OHS A;  1N5H A;  4H3U A;  1RRL A;  2BO9 B;  2MF7 A;  4L7K A;  2PZV A;  2W6J H;  3NV0 A;  2OQE C;  1AQZ A;  4L8O A;  5FW5 A;  1Q86 4;  1NNV A;  1X1Y A;  1AVL A;  1QAL A;  2JQ5 A;  1FUT A;  1Q40 A;  3GAX A;  1IQY A;  2RGQ A;  1A90 A;  2GSP A;  2R41 A;  1R4Y A;  1DVC A;  3LT9 A;  4FR9 A;  3CC7 3;  3CCQ 3;  3LOY A;  3F7S A;  1BRJ A;  4X2H A;  1BRN L;  1TRP A;  2CX1 A;  3NM2 A;  1OAC A;  3BIR A;  5AYS C;  3D4A A;  2Z77 A;  1T3B A;  4N3V A;  1KD1 4;  1LOY A;  1VZZ A;  4HM3 B;  2RFR A;  4G1M B;  1IVU A;  3I56 3;  1VQQ A;  3BNE A;  2WOH A;  5LC6 A;  4WHA A;  3F8X A;  2WOF A;  2MC8 A;  1DMN A;  1SQW A;  1W6Y A;  4IIA A;  4HM6 B;  1I2F A;  1OUN A;  5D83 A;  2F4Y A;  1VQ6 3;  1YNV X;  1RGG A;  3LTC A;  1QMA A;  1YGW A;  4HAA A;  1W01 A;  3K7C A;  5KP3 A;  3V92 A;  1JN5 A;  2H0I A;  1JB4 A;  3ALA A;  1E3R A;  1GD3 A;  3DGY A;  1RGK A;  4X2O A;  5M19 A;  4HKV B;  2BNG A;  1MNL A;  2P09 A;  4R4K A;  1BRG A;  3AMO A;  3BNC A;  1JJ2 2;  4L8P A;  4BTY A;  1RGE A;  1R4C A;  4MEI A;  1JB2 A;  3G0K A;  5BVB A;  2HML B;  3CD6 3;  2M7O A;  1EKM A;  1WMO A;  1IQX A;  1ULJ B;  3B4O A;  4FMA A;  3FG3 A;  1X1X A;  4HZB B;  1C7H A;  3RDE A;  1BNS A;  2RCD A;  4K1V A;  1WQL B;  3NQZ A;  3PCR A;  1AV4 A;  3UJM A;  3IMA B;  1TFK A;  3DM8 A;  3D9R A;  3DGL A;  3NXJ A;  5STD A;  3WR2 A;  2UX0 A;  1YVB I;  1OHP A;  1O7H B;  1OH0 A;  2XF3 A;  1RRH A;  1US1 A;  3MPH A;  4KFF A;  4ORL A;  2H0G A;  4WYK B;  1BNR A;  3EN8 A;  1BUQ A;  3LTD A;  2CKF B;  3JUP A;  4STD A;  2OOV A;  1BSE A;  3KSP A;  1ROA A;  1JZD A;  1FZU A;  2HMO B;  1Q7H A;  1E3V A;  4FCJ A;  5AEW B;  5HOH A;  4IPB A;  3RNT A;  3CC2 3;  2CFW A;  4J5K A;  1RGL A;  3KFQ C;  1PFP A;  3B4P A;  4BTX A;  1DVD A;  5JPU A;  4R9L A;  2F5W A;  2XFT A;  1BUJ A;  1BNF A;  2HMJ B;  5ELJ A;  1UCL A;  2ML6 A;  1QJG A;  2CK3 H;  3I55 3;  4K1U A;  3J7Y d;  1IV7 A;  3Q3F A;  1ULI B;  3EBT A;  3OWU A;  4LEH A;  1JNQ A;  4OK0 A;  8RNT A;  3LZA A;  3T8N A;  3EC9 A;  3ZG5 A;  1UDI I;  4WFO A;  5AIG A;  1FGM A;  5RNT A;  1J2B A;  1TRQ A;  1NB3 I;  3S67 A;  2Z6B A;  3BND A;  4BU4 A;  1K73 4;  1IVX A;  3X41 A;  1AY7 A;  1N9J A;  3SOA A;  3DY5 A;  3WDG B;  3CME 3;  3CC4 3;  1LOW A;  3VF1 A;  2PNC A;  1HYF A;  3D3L A;  5CXO A;  1DMM A;  3EBY A;  1STD A;  1PY3 A;  1FGR A;  2J8X B;  2C11 A;  1RTU A;  1SII A;  2YFI B;  2W2C A;  4OVM A;  4HM1 B;  1MWR A;  2KF6 A;  5M1A A;  1IT7 A;  2W9P A;  3NV0 B;  4EYC A;  3FKA A;  4NPB A;  3CCU 3;  3S29 A;  3STD A;  4LZI A;  8CHO A;  5JPP A;  1LQM B;  1I0V A;  1G0T A;  7STD A;  4JF8 A;  1Q40 B;  2IMJ A;  4H61 A;  7GSP A;  2BT3 A;  3WOD G;  4EC6 A;  1VQ4 3;  2K0M A;  3F40 A;  2RBI A;  3ROB A;  3LTA A;  2K54 A;  1VQ8 3;  3KN4 A;  1BVI A;  4HM5 B;  1RDS A;  3K5T A;  1SIH A;  1K8A 4;  1RNB A;  3UB1 A;  2CFL A;  3ECF A;  1YJ9 3;  1NU3 A;  4HM8 B;  2W03 A;  3ZFZ A;  3GWR A;  2CFD A;  2GEX A;  2YX9 A;  3PYJ A;  4N6U A;  1DE3 A;  3T8U A;  2D1W A;  3HK4 A;  1DET A;  3CPO A;  5CLK A;  5G1K A;  4J8T A;  2B1X B;  3SVA A;  4AKY A;  2Y73 A;  3EB8 A;  3EJV A;  3VSY A;  3CPW 2;  3NQY A;  4GHO A;  2ZDJ A;  1W2B 2;  2O3O A;  1U8C B;  1DMQ A;  1TTO A;  1NJI 4;  2Z76 A;  1JN5 B;  2BHM A;  1GY5 A;  1PU4 A;  3FGY A;  3OWS A;  1YGE A;  1GMP A;  2O9U X;  3CMA 3;  1O7P B;  1I2E A;  3AMO B;  1ZGX A;  1O7G B;  3KE7 A;  3X40 A;  2INX A;  2L4V A;  1PYL A;  2E2V A;  1BRI A;  1WMP A;  2IYJ A;  5IEN A;  2JDI H;  1QVF 2;  4HYZ A;  1M9G A;  2CIU A;  1JKG A;  2ZHX B;  1UCK A;  1RN1 A;  3EHC A;  1W6G A;  1T2I A;  2HMM B;  3BU4 A;  2IUJ A;  3VGN A;  4PEJ A;  6STD A;  1FUS A;  1E97 A;  1W2Z A;  4XDW A;  3MHE A;  3SX1 A;  3CCE 3;  1VQM 3;  1RHL A;  2IUK A;  1RGA A;  2OTL 3;  1CH0 A;  2WGO A;  2WO0 A;  1IV9 A;  4GB5 A;  4MJD A;  1SJW A;  3CCR 3;  6RNT A;  2KCD A;  3FG4 A;  1VQK 3;  1O7M B;  2KAA A;  2R4I A;  2XSH B;  4O2H A;  1G96 A;  3JUQ A;  1B2X A;  1LRA A;  4LSO A;  4XB5 A;  3G16 A;  1RMS A;  1OPY A;  3NBJ A;  4EBG A;  7RNT A;  1RCL A;  3IJE B;  3ZG0 A;  3KSE D;  1ZO2 A;  3NHX A;  3WA3 A;  2OQE A;  4HBR A;  1BOX A;  1VQO 3;  1RGF A;  4IT7 A;  5CK6 A;  3DH2 A;  1Q82 4;  3PS8 A;  4J9A A;  4MMZ B;  1EUI C;  3MSO A;  3QRD A;  5DRE A;  3SED A;  3DMC A;  3FLJ A;  4EV5 A;  3U97 A;  2F56 A;  1BGS A;  2W56 A;  1CYU A;  1A2V A;  2BIR A;  4RZM A;  1YJN 3;  1A2P A;  3S5C A;  2W9Q A;  4RNT A;  1A2K A;  2UGI A;  5IG4 A;  1LVN A;  1RGH A;  1WNH A;  4R1K A;  4BL3 A;  1IK3 A;  5AIH A;  2LYX A;  1ISK A;  1Q9E A;  2W04 A;  3OWY A;  3V99 A;  3NUV A;  4GL6 A;  1Y4K A;  1BSC A;  3LTB A;  1TUH A;  2HMN B;  3G4S 3;  3JUO A;  1FW7 A;  3CNX A;  1RJO A;  1MOL A;  2WGQ A;  3JVC A;  3H51 A;  1BNE A;  1A67 A;  1BNG A;  2FXT A;  3CXC 2;  2FNQ A;  1MWS A;  4I4K A;  5AEU B;  6GSP A;  1W6C A;  4KFE A;  1ASK A;  3OXA A;  3CNM A;  3X42 A;  1I3I A;  2CC3 A;  2CH9 A;  1NB5 I;  3GZR A;  4XBY A;  2ML5 A;  2YFL B;  5IG0 A;  3TDG A;  1BRH A;  4EXR A;  1C54 A;  1O7W B;  1W7C A;  2K3D A;  1AR0 A;  1M1X B;  5IG5 A;  1IT8 A;  3B8L A;  4XBX A;  4MMY B;  1GSP A;  2QEX 3;  1IYY A;  2C10 A;  4O3V A;  1OF5 A;  1LNH A;  3D5G A;  3S27 A;  3RGR A;  3X3X A;  2BMQ B;  4TX4 A;  1AVK A;  1ROV A;  1NO3 A;  4N6N B;  1O7N B;  1UUV B;  3MG3 A;  1M1K 4;  1GOY A;  4KVH A;  4XM4 A;  1B3S A;  1UUW B;  1GD4 A;  1I2G A;  4RNZ A;  1VQ5 3;  1KWI A;  1YHQ 3;  2QGU A;  1KQS 2;  5AIF A;  3CCM 3;  3T0U A;  4R9K A;  1I3F A;  1KSI A;  1STF I;  2ZA4 A;  2CW9 A;  1SAR A;  2XSO B;  5IEP A;  5IER A;  4J5G A;  3GSP A;  1FGO A;  3O8Y A;  3PXM A;  5EQL A;  4N6L A;  2CG1 A;  3G6E 3;  2IY2 A;  1VQ9 3;  2F98 A;  1FGQ A;  1LOX A;  2L1S A;  3K0Z A;  3D5I A;  1OHO A;  1LOV A;  1RNT A;  2D42 A;  2E2T A;  3F8H A;  3CCV 3;  4LGQ A;  2F86 B;  4NRE A;  1Q42 A;  1JV2 B;  4HVN A;  4CPK A;  1Q81 4;  3WMD A;  5FGO A;  1NWW A;  4RBN A;  1JKG B;  3N8B A;  1I8V A;  4WWU C;  3KII A;  3Q90 A;  1FGT A;  1GOV A;  2V1L A;  3L0R A;  4FCM A;  1WMN A;  1EA2 A;  1N9E A;  2AAD A;  3DZL A;  2W0Q A;  1BNI A;  2CX0 A;  1BSD A;  1IVV A;  2QIY A;  1RCK A;  5GSP A;  5AI1 A;  2KRT A;  3BLZ A;  2GEY A;  4HM2 B;  4K61 A;  3EE1 A;  1KC8 4;  3U1W A;  3SXX A;  2QA4 3; 
#chains in the Genus database with same CATH homology
 3I0Y A;  3MKI A;  4N6M A;  3DGO A;  5IF6 A;  3A76 A;  2Q07 A;  2XFS A;  3MG1 A;  4R80 A;  3N9H A;  1YI2 3;  3NM7 A;  4QWT A;  1EQK A;  3OW2 2;  1K28 A;  3EX9 A;  1S72 3;  4O02 B;  3DUK A;  1YJW 3;  1VQ7 3;  3RGA A;  3CCS 3;  5ELU A;  1GY6 A;  2E2U A;  2CHC A;  4HM4 B;  3FF0 A;  3Q2P A;  4N6V 0;  2KXG A;  3HI7 A;  3N54 B;  1YIT 3;  3X3Y A;  1Q7Y 4;  2W56 B;  4HM0 B;  3WOE B;  2BMO B;  1TFO A;  3DGM A;  1N5P A;  2OTJ 3;  4FMB A;  1K41 A;  3CCL 3;  4XDV A;  1QAK A;  3MYT A;  1LXE A;  5KP4 A;  2GU1 A;  5DRV A;  1CQS A;  1K9M 4;  1CYV A;  5AYR B;  1VQP 3;  1CEW I;  2OWP A;  3HII A;  3PZW A;  4EV2 A;  3HIG A;  1TU5 A;  1RKY A;  2LQV A;  3BB9 A;  3IPT A;  4NHF A;  1TP6 A;  3X3Z A;  4HZ9 B;  3FH1 A;  4WP5 A;  2CFG A;  1W00 A;  4N6O B;  3S28 A;  1FA3 A;  2B24 B;  1UW1 A;  5JBS A;  2P0X A;  3H3H A;  1N8R 4;  3GRD A;  2CG0 A;  4N6T A;  2RSX A;  5G2G A;  1QVG 2;  2P38 A;  1OF5 B;  1Z1S A;  1JRQ A;  1S5A A;  1U5O A;  3KZT A;  3GZX B;  1QAF A;  3NBB A;  3K63 A;  4KFD A;  1YIJ 3;  3DXO A;  1W5Z A;  5CF1 A;  5IG3 A;  4HM7 B;  2Z7A A;  5I97 A;  1TIJ A;  2OOV C;  3EN1 B;  1OGZ A;  1VQL 3;  3F14 A;  3CCJ 3;  1UI7 A;  1GY7 A;  3GZY B;  1IVW A;  5BXQ A;  2F99 A;  3MWZ A;  3UL6 A;  1OGX A;  2XR8 B;  4BTW A;  5HGR A;  3B7C A;  4MMX B;  3OX9 A;  2FGT A;  1W4N A;  3JUN A;  1DYU A;  2ZL8 A;  3F7X A;  1IDP A;  2XGL A;  3LML A;  2A15 A;  2BMR B;  2CWU A;  3PGB A;  4OUQ A;  3ER7 A;  2I9W A;  2P05 A;  3CU3 A;  1GS3 A;  1JB5 A;  3FF2 A;  4FCZ A;  2GBW B;  4XBT A;  3FZW A;  2XRX B;  1N8Q A;  4HJL B;  1D6Z A;  3NX0 A;  1D6U A;  3GZB A;  3Q1C A;  1T5Y A;  1OCV A;  5TGN A;  2YFJ B;  3PCS A;  3WOF B;  3LH4 A;  3F9S A;  2CWT A;  1W02 A;  4CCV A;  1IU7 A;  3OV4 A;  4U13 A;  1F8N A;  2GU3 A;  5CF2 A;  3E99 A;  3MG2 A;  1M90 4;  1FUW A;  3K9M C;  2Y74 A;  3KKG A;  3SLU A;  4RNY A;  1L5G B;  5LC7 A;  3G71 3;  1ZX2 A;  2STD A;  3LYG A;  1RN7 A;  2XEP A;  3FCS B;  2GBX B;  4O8S A;  3JUM A;  4FMD A;  3WA2 X;  2XGN A;  3UL5 A;  2CWV A;  4WYK A;  3FSD A;  3LXU X;  3QK9 A;  4AEQ A;  1EG9 B;  4AKZ A;  2P0M A;  2OCT A;  1V74 A;  2IA7 A;  1HU9 A;  3G8Z A;  5D82 A;  3HZP A;  5IW9 A;  4FMC A;  3BNB A;  1GYB A;  2XH9 A;  4ZM8 A;  2HMK B;  5AII A;  3SOY A;  1D6Y A;  3NBR A;  4KZ1 A;  5D81 A;  3UNL A;  4LMI A;  3LT8 A;  3V98 A;  4JRF A;  1NDO B;  2GXF A;  3FG1 A;  3DGN A;  1IQ8 A;  1HKX A;  4Q53 A;  3EQQ B;  3M8C A;  3HX8 A;  4CDL A;  5KP1 A;  1SPU A;  2CFK A;  3EF8 A;  5IEO A;  1UI8 A;  1VQN 3;  5EEO A;  5A0O B;  2SBL A;  5EVH A;  1WTH A;  4K90 B;  1OHS A;  1N5H A;  4H3U A;  1RRL A;  2BO9 B;  2MF7 A;  4L7K A;  2PZV A;  2W6J H;  3NV0 A;  2OQE C;  4L8O A;  5FW5 A;  1Q86 4;  1AVL A;  1QAL A;  2JQ5 A;  1Q40 A;  3GAX A;  1IQY A;  2RGQ A;  1A90 A;  3LT9 A;  1DVC A;  4FR9 A;  3CC7 3;  3CCQ 3;  3LOY A;  3F7S A;  4X2H A;  3NM2 A;  1OAC A;  5AYS C;  2Z77 A;  4N3V A;  1KD1 4;  1VZZ A;  4HM3 B;  2RFR A;  4G1M B;  1IVU A;  3I56 3;  3BNE A;  2WOH A;  5LC6 A;  4WHA A;  3F8X A;  2WOF A;  2MC8 A;  1DMN A;  1SQW A;  1W6Y A;  4IIA A;  4HM6 B;  1OUN A;  5D83 A;  1VQ6 3;  3LTC A;  1QMA A;  5KP3 A;  3V92 A;  1W01 A;  3K7C A;  1JN5 A;  1JB4 A;  3ALA A;  1E3R A;  1GD3 A;  4X2O A;  4HKV B;  2BNG A;  1MNL A;  2P09 A;  4R4K A;  3AMO A;  3BNC A;  1JJ2 2;  4L8P A;  4BTY A;  1R4C A;  4MEI A;  1JB2 A;  3G0K A;  5BVB A;  2HML B;  3CD6 3;  2M7O A;  1IQX A;  1WMO A;  1EKM A;  3B4O A;  1ULJ B;  4FMA A;  3FG3 A;  4HZB B;  1C7H A;  3RDE A;  2RCD A;  4K1V A;  1WQL B;  3NQZ A;  3PCR A;  1AV4 A;  3UJM A;  3IMA B;  1TFK A;  3DM8 A;  3D9R A;  3DGL A;  3NXJ A;  5STD A;  2UX0 A;  1YVB I;  1OHP A;  1O7H B;  1OH0 A;  2XF3 A;  1RRH A;  1US1 A;  3MPH A;  4KFF A;  4ORL A;  4WYK B;  3EN8 A;  1BUQ A;  3LTD A;  2CKF B;  3JUP A;  4STD A;  2OOV A;  3KSP A;  1ROA A;  2HMO B;  4FCJ A;  1E3V A;  5AEW B;  4IPB A;  3CC2 3;  2CFW A;  3KFQ C;  1PFP A;  3B4P A;  4BTX A;  1DVD A;  5JPU A;  4R9L A;  2XFT A;  2HMJ B;  5ELJ A;  2ML6 A;  1QJG A;  2CK3 H;  3I55 3;  4K1U A;  3J7Y d;  1IV7 A;  1ULI B;  3EBT A;  3OWU A;  4LEH A;  1JNQ A;  4OK0 A;  3LZA A;  3T8N A;  3EC9 A;  4WFO A;  5AIG A;  1FGM A;  1J2B A;  1NB3 I;  3S67 A;  2Z6B A;  3BND A;  1K73 4;  1IVX A;  3X41 A;  1N9J A;  3SOA A;  3DY5 A;  3WDG B;  3CME 3;  3CC4 3;  3VF1 A;  2PNC A;  3D3L A;  5CXO A;  1DMM A;  3EBY A;  1STD A;  1FGR A;  2C11 A;  1SII A;  2YFI B;  2W2C A;  4OVM A;  4HM1 B;  1IT7 A;  2W9P A;  3NV0 B;  4EYC A;  3FKA A;  3CCU 3;  3S29 A;  3STD A;  4LZI A;  8CHO A;  5JPP A;  7STD A;  4JF8 A;  1Q40 B;  2IMJ A;  4H61 A;  2BT3 A;  3WOD G;  4EC6 A;  1VQ4 3;  2K0M A;  3F40 A;  3ROB A;  3LTA A;  2K54 A;  1VQ8 3;  3KN4 A;  4HM5 B;  3K5T A;  1SIH A;  1K8A 4;  3UB1 A;  2CFL A;  3ECF A;  1YJ9 3;  1NU3 A;  4HM8 B;  2W03 A;  3GWR A;  2CFD A;  2GEX A;  2YX9 A;  3PYJ A;  4N6U A;  3T8U A;  2D1W A;  3HK4 A;  5CLK A;  3CPO A;  3SVA A;  4J8T A;  2B1X B;  4AKY A;  3CPW 2;  2Y73 A;  3EB8 A;  3EJV A;  3VSY A;  3NQY A;  2ZDJ A;  1W2B 2;  2O3O A;  1U8C B;  1DMQ A;  1NJI 4;  2Z76 A;  1JN5 B;  2BHM A;  1GY5 A;  1PU4 A;  3FGY A;  3OWS A;  1YGE A;  2O9U X;  3CMA 3;  1O7P B;  3AMO B;  1O7G B;  3KE7 A;  3X40 A;  2INX A;  2L4V A;  2E2V A;  5IEN A;  1WMP A;  2JDI H;  1QVF 2;  4HYZ A;  1M9G A;  2CIU A;  1JKG A;  3EHC A;  2IUJ A;  3VGN A;  1W6G A;  2HMM B;  6STD A;  4PEJ A;  1E97 A;  1W2Z A;  4XDW A;  3MHE A;  3SX1 A;  3CCE 3;  1VQM 3;  2IUK A;  2OTL 3;  2WGO A;  2WO0 A;  1IV9 A;  4GB5 A;  4MJD A;  1SJW A;  3CCR 3;  2KCD A;  3FG4 A;  1VQK 3;  1O7M B;  2R4I A;  2XSH B;  4O2H A;  1G96 A;  3JUQ A;  4XB5 A;  4LSO A;  3G16 A;  1OPY A;  3NBJ A;  4EBG A;  3IJE B;  3KSE D;  1ZO2 A;  3NHX A;  3WA3 A;  2OQE A;  4HBR A;  1VQO 3;  4IT7 A;  5CK6 A;  1Q82 4;  3PS8 A;  4J9A A;  4MMZ B;  3MSO A;  3QRD A;  5DRE A;  3SED A;  3DMC A;  3FLJ A;  4EV5 A;  3U97 A;  2W56 A;  1CYU A;  1A2V A;  4RZM A;  1YJN 3;  3S5C A;  2W9Q A;  1A2K A;  5IG4 A;  1LVN A;  1WNH A;  4R1K A;  1IK3 A;  5AIH A;  2LYX A;  1ISK A;  2W04 A;  3OWY A;  3V99 A;  3NUV A;  4GL6 A;  1Y4K A;  3LTB A;  1TUH A;  2HMN B;  3G4S 3;  3JUO A;  3CNX A;  1RJO A;  1MOL A;  2WGQ A;  3JVC A;  3H51 A;  1A67 A;  2FXT A;  3CXC 2;  2FNQ A;  4I4K A;  5AEU B;  1W6C A;  4KFE A;  1ASK A;  3OXA A;  3CNM A;  3X42 A;  2CC3 A;  1NB5 I;  2CH9 A;  3GZR A;  4XBY A;  2ML5 A;  2YFL B;  5IG0 A;  3TDG A;  4EXR A;  1O7W B;  1W7C A;  1AR0 A;  1M1X B;  5IG5 A;  1IT8 A;  3B8L A;  4XBX A;  4MMY B;  2QEX 3;  2C10 A;  4O3V A;  1OF5 A;  1LNH A;  3S27 A;  3RGR A;  3X3X A;  2BMQ B;  4TX4 A;  1AVK A;  1ROV A;  1NO3 A;  4N6N B;  1O7N B;  1UUV B;  3MG3 A;  1M1K 4;  4KVH A;  4XM4 A;  1GD4 A;  1UUW B;  4RNZ A;  1VQ5 3;  1KWI A;  1YHQ 3;  2QGU A;  1KQS 2;  5AIF A;  3CCM 3;  3T0U A;  4R9K A;  1KSI A;  1STF I;  2CW9 A;  2XSO B;  5IEP A;  5IER A;  2CG1 A;  1FGO A;  3O8Y A;  3PXM A;  5EQL A;  4N6L A;  3G6E 3;  1VQ9 3;  2F98 A;  1LOX A;  1FGQ A;  3K0Z A;  1OHO A;  3F8H A;  3CCV 3;  2D42 A;  2E2T A;  4LGQ A;  2F86 B;  4NRE A;  1Q42 A;  1JV2 B;  4HVN A;  1Q81 4;  3WMD A;  5FGO A;  1NWW A;  4RBN A;  1JKG B;  3N8B A;  4WWU C;  3KII A;  3Q90 A;  1FGT A;  2V1L A;  3L0R A;  4FCM A;  1WMN A;  1EA2 A;  1N9E A;  3DZL A;  2W0Q A;  1IVV A;  2QIY A;  5AI1 A;  2KRT A;  3BLZ A;  2GEY A;  4HM2 B;  4K61 A;  3EE1 A;  1KC8 4;  3U1W A;  3SXX A;  2QA4 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...