1CEWI

The 2.0 angstroms x-ray crystal structure of chicken egg white cystatin and its possible mode of interaction with cysteine proteinases
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A X-ray crystal structure of chicken egg white cystatin and its possible mode of interaction with cysteine proteinases.
pubmed rcsb
molecule keywords CYSTATIN
source organism Gallus gallus
molecule tags Proteinase inhibitor(cysteine)
total genus 22
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cewI00
2W9QA 3K9MC 4N6MA 3SVAA 1M9GA 3IMAB 1WNHA 3S67A 1DVDA 1CYUA 4N6V0 1N5PA 1PFPA 3KFQC 1NB5I 1DVCA 4IT7A 4CCVA 5LC7A 1R4CA 3L0RA 2O9UX 1YVBI 1N9JA 4N6LA 1LXEA 1EQKA 1FUWA 1RN7A 3PXMA 1GD4A 3LH4A 3PYJA 1G96A 1N5HA 1ROAA 2CH9A 3KSED 1TIJA 1MOLA 1CEWI 4TX4A 1NB3I 1A90A 4N6NB 1GD3A 4LZIA 3PS8A 4EYCA 3UL6A 3QRDA 1STFI 1CYVA 3MWZA 2OCTA 4N6UA 1IV7A 2W9PA 5LC6A 1MNLA 4N6TA 5ELUA 1A67A 4N6OB 1KWIA 1IV9A 3NX0A 5EQLA 3Q2PA 2KXGA 5A0OB 3GAXA 2BO9B 4ZM8A 5ELJA 1FA3A 3UL5A
chains in the Genus database with same CATH superfamily
4BIRA 3AMOB 3CMA3 2CFGA 1ISKA 5I97A 2GBXB 3ER7A 2B1XB 2V1LA 3BIRA 3NBJA 3SVAA 3A76A 3U1WA 1BSCA 3AGNA 3WDGB 1M9GA 2CIUA 1SJWA 5M18A 4H3UA 2W03A 3F8XA 3HIGA 3LTDA 4O2HA 2O3OA 3Q90A 3BNEA 3UB1A 3V92A 4BTWA 1WNHA 1O7NB 3S67A 1JB4A 1DMNA 4I5QA 3CCQ3 4L8PA 5HOHA 4EV2A 1VQQA 2XSOB 3NBRA 1SIHA 4WYKB 1JV2B 1MWUA 1BSAA 1N5PA 4XDWA 3CD63 1PFPA 3KFQC 3OWYA 1B21A 1QALA 1DVCA 4EV5A 7GSPA 3CC23 3UJMA 3CCE3 3URPA 5LC7A 2K3DA 3AHWA 3L0RA 1B2SA 1RMSA 2O9UX 2BIRA 4RBNA 2CC3A 3BNDA 4MMYB 3Q3FA 1O7WB 4N6LA 3U97A 1RGCA 1FUWA 1AQZA 4WP5A 1RN7A 5GSPA 3LYGA 2GEXA 1UUGB 1IT7A 3IJEB 3X3XA 1Q40B 3E99A 2CX0A 3LH4A 1FUSA 2RCDA 2XFTA 2JDIH 4XB5A 1NDOB 1B2ZA 1TRPA 3QK9A 2BU4A 3A5EA 3BU4A 3PYJA 3ROBA 3B4OA 3GSPA 2CFKA 1MGWA 1IVUA 1JN5A 1YJW3 2ZA4A 1BRSA 3KE7A 1M1XB 4KFEA 2W0QA 3X3ZA 4DKIA 1B2UA 5CXOA 1QVG2 1FUTA 3AMOA 3ALAA 3HZPA 4GSPA 1TIJA 3RDEA 3UNLA 2XF3A 3K63A 3FCSB 3WMDA 4RNYA 1X1YA 3D3LA 3EC9A 3OXAA 4TX4A 1DYUA 2BMRB 2HMLB 5KP3A 1GD3A 4KVHA 1SARA 3CCU3 3MPHA 3PS8A 1VQP3 4HAAA 4J8TA 5DREA 1WMNA 3LOYA 3QRDA 1GOVA 4KFDA 4XBYA 1FGOA 1EUIC 4N6UA 2ML6A 1IV7A 4LMIA 1GOYA 1EEJA 2XSHB 3LT9A 4WYKA 5M19A 4Q53A 3SEDA 4OVMA 4XM4A 1HYFA 3TDGA 2IY2A 1DMQA 3DH2A 3H51A 5ELUA 3CCR3 4FR9A 5AIGA 2UX0A 1CH0A 2XGNA 3N54B 3CC73 2WOFA 3T8NA 1I3FA 1AY7A 1GY5A 3DMCA 3DGMA 1PYLA 1BOXA 1I2GA 1D6ZA 1NNVA 3NX0A 4OK0A 3MSOA 3G0KA 1Q824 3N8BA 2WO0A 3DM8A 1Q40A 2RBIA 4BL2A 5BXQA 1I8VA 1RN4A 1IYYA 1W01A 3OV4A 5AYSC 1BSDA 2KXGA 1W00A 3LZAA 4LEHA 1OF5B 4HM8B 2MC8A 2ZL8A 5A0OB 1TRQA 3BNCA 4L8OA 1Q42A 1BNSA 2QA43 3I0YA 5M1AA 4GB5A 2XR8B 1GY7A 3DGYA 2LYXA 1GMPA 1W7CA 2PNCA 4NPBA 2YX9A 5STDA 3UL5A 3GZXB 2OTL3 1VQN3 1N8R4 1AVKA 1JB2A 4U13A 5EEOA 3FKAA 3K9MC 4N6MA 1LRAA 2L4VA 5RNTA 2CG0A 3EQQB 2QIYA 4RZMA 1BANA 1I2EA 3EE1A 1BGSA 3JUPA 3IMAB 3DUKA 3SYUA 4R80A 3LTAA 1DVDA 2INXA 1RGGA 3LMLA 1BSEA 4N6V0 2CHCA 4MJDA 3KCHA 2K0MA 2I9WA 3T8UA 3CNXA 4IT7A 1YIT3 1STDA 2GSPA 3RGRA 1RCKA 2UGIA 5AIIA 1V58A 3K7CA 3WHOA 1VQL3 2CWVA 4ILFA 1PU4A 2KF5A 3SOAA 1N9JA 1N9EA 3JUMA 1J2BA 2GXFA 3DY5A 3FG1A 1IDPA 5CF1A 1RLSA 1Q9EA 1R4YA 1BU4A 3NBBA 1I0VA 3NM2A 4RNZA 3EN1B 4CPKA 1JZOA 2IUKA 1FGMA 2IMJA 1OF5A 3WOEB 4HVNA 4GHOA 2C10A 2CG1A 1OHSA 3G713 1YGEA 5FGOA 1BNIA 2CWTA 3FGYA 1YNVX 1G96A 1N5HA 2H0IA 1O7MB 2JQ5A 1ROVA 1V57A 8RNTA 1FW7A 1ROAA 1BRHA 4JRFA 1BRIA 2KF3A 1LOXA 5D83A 3V98A 3KSED 2B24B 1LQGC 1QMAA 1LOWA 5IERA 4KFFA 1TP6A 1IU7A 1ULIB 3F14A 5DRVA 5IF6A 1RNBA 1VQO3 2WGOA 4HM3B 5AYRB 4K1UA 1A90A 3F8HA 3NM7A 5D82A 4FMBA 2CW9A 2Z7AA 4LSOA 4HKVB 1UI7A 1G02A 1VQK3 3LTBA 2D1WA 2AADA 1CYVA 1ZO2A 4MEIA 3GWRA 3JVCA 1K28A 3FSDA 3CCS3 2GU3A 4J9AA 1W5ZA 3O8YA 3EJVA 1RJOA 1OPYA 2QEX3 2J8XB 1MNLA 2STDA 2ZDJA 3FF2A 1Q864 4N6TA 3EBYA 4KT3B 2OQEA 3X42A 1OCVA 3S29A 3DGOA 1IVWA 4K1VA 7STDA 5IENA 3EN8A 4N6OB 3KN4A 4O3VA 1YJN3 2BMOB 2F99A 3N9HA 3B7CA 3CPW2 1RNTA 1W2ZA 1I2FA 1NO3A 3OWSA 1UI8A 4AKZA 3J7Yd 3GZYB 3EF8A 1YJ93 2P09A 3DGLA 1LQMB 4X2HA 3VSYA 3CCM3 1W6CA 2KRTA 2XEPA 1EKMA 1RHLA 1BRJA 3IPTA 2P0XA 4HM5B 2R4IA 4CJNA 3BNBA 2BT3A 1RSNA 2IYJA 4R4KA 4ZM8A 3BLZA 4X2OA 9RNTA 1VQ73 3ECFA 2CX1A 2GBWB 1ASKA 1WMOA 1KSIA 1W6GA 1QJGA 1JBRA 1C7HA 2F5WA 2W9QA 2HMNB 5IW9A 3K5TA 3D5GA 2M7OA 3X41A 1NJI4 3NV0B 1T2HA 1UUWB 2E2VA 3JUQA 4NREA 4XDVA 1B20A 3CCL3 2FNQA 2Y73A 1VQ43 5AEWB 5JBSA 1OHPA 1YHQ3 4FMCA 1TFKA 2Z6BA 3HK4A 2AAEA 3D5IA 3JUOA 1IVXA 1VQM3 4HYZA 3FLJA 2OOVC 2W6JH 4O02B 4PEJA 3SX1A 1LNHA 2F56A 1VZZA 2Z76A 3HX8A 5KP1A 2F4YA 4H61A 1YGWA 2CFLA 1A2PA 4WHAA 4RNTA 3S28A 3CC43 2ZHXB 3B8LA 1YVBI 2HOHA 2W56B 2W2CA 1S723 1G0TA 1RN1A 3OX9A 1L5GB 1SPUA 1EQKA 1T2IA 3I553 1I0XA 1S5AA 1GD4A 1C54A 3T0UA 1BUJA 5AEUB 5BU4A 4HZ9B 1OGXA 5CF2A 1FGRA 2WGQA 1VQ93 1JKGB 2IA7A 3WR2A 1LNIA 2BHMA 2XGLA 3NQYA 3WOFB 4EXRA 4FCMA 4CDLA 1GOUA 1OHOA 4AKYA 4G1MB 2CH9A 1WQLB 4K90B 1VQ63 3SXXA 1E3VA 1US1A 2BNGA 4ORLA 1JJ22 1AR0A 4KZ1A 3WA3A 3MYTA 1Z1SA 2KCDA 2R41A 1CEWI 1GS3A 1NWWA 5JPUA 3FZWA 3NV0A 1IQXA 4WFOA 5IG0A 1M904 5AIHA 1EG9B 4LZIA 2WOHA 3PGBA 4WWUC 3UL6A 1K734 1HZ1A 2E2TA 3AHSA 1KQS2 1STFI 2C11A 1DETA 1KD14 3I563 2OCTA 4HM2B 5G2GA 1VQ83 1EA2A 4FMDA 2W9PA 4R9LA 5LC6A 6GSPA 1TTOA 1AV4A 3BB9A 2Y74A 3G16A 4FCJA 4XBTA 2E2UA 2F5MA 4HM1B 2YFJB 1IQ8A 1DMMA 2HMOB 2OTJ3 1A67A 5CLKA 5FW5A 1KWIA 1UW1A 1QAKA 2W56A 2UUGC 5IG3A 1JRQA 4HM7B 1B2XA 3GRDA 5BVBA 1OACA 2C4BA 3STDA 1E3RA 6RNTA 5CK6A 3Q2PA 3DXOA 2H0HA 3FG3A 2L1SA 4EW5A 1WMPA 1UCLA 3OW22 3D9RA 1X1UA 3SOYA 2OOVA 2D42A 1JZDA 1MGRA 4BU4A 1BSBA 1JKGA 2PZVA 3LTCA 5G1KA 1D6YA 3EB8A 4HBRA 5TGNA 4BTXA 5BIRA 1FGQA 1LOYA 1RGLA 1T3BA 3GZRA 5IEPA 1T5YA 2BO9B 1TFOA 1TUHA 3F40A 1O7GB 1MWSA 1FA3A 1Y4KA 1OH0A 2XRXB 3V99A 1BNJA 1O7HB 1RGFA 4OUQA 1ULJB 2HMKB 4QWTA 5EVHA 1RRHA 1K9M4 2CWUA 4FMAA 1FGTA 1GY6A 2LQVA 1V74A 1WTHA 3LT8A 3MG3A 1MWTA 5KP4A 4GL6A 3OWUA 1RDSA 2SBLA 3F7SA 1OUNA 1RRLA 2A15A 3NXJA 3FG4A 1D6UA 3S5CA 1TJDA 3F7XA 5AI1A 1BAOA 2W04A 1GMRA 1U5OA 1AVLA 4AEQA 1M1K4 1CYUA 1RCLA 3NHXA 1OGZA 4I4KA 1BUQA 3SLUA 1NB5I 3ZG0A 4HM6B 3JUNA 4CCVA 5JPPA 3RGAA 1UUVB 2KF4A 2KF6A 3X40A 4J5GA 1JBSA 4EC6A 3KSPA 4K61A 1BIRA 1R4CA 1Q814 4FCZA 1UCKA 1PY3A 1BRGA 4IIAA 5AIFA 3ZFZA 1QAFA 2H0GA 4NHFA 1IVVA 2CKFB 2OQEC 7RNTA 1QVF2 2RGQA 1ZX2A 1LXEA 1RKYA 2XH9A 1I70A 3B4PA 3CNMA 3PCRA 1W2B2 2ML5A 3G8ZA 3NQZA 3PXMA 3CXC2 2YFLB 1K41A 5HGRA 2F98A 1E97A 1GMQA 1W02A 2RFRA 4HM0B 1YI23 4R9KA 1O7PB 3DGNA 1JNQA 1BRKA 1UDII 1Q7HA 2P38A 1U8CB 3EBTA 3CCJ3 1Q7Y4 1X1XA 1YVSA 2F86B 3K0ZA 1TU5A 1GYBA 1UGHI 1F8NA 3AGOA 2SARA 3D79A 2IUJA 4BL3A 1KC84 3M8CA 3G4S3 4HM4B 3CCV3 2GEYA 1BNEA 2BMQB 1A2VA 3EHCA 3NUVA 1SQWA 6STDA 1VQ53 3CPOA 1N8QA 4LGQA 3CME3 3Q1CA 3DZLA 2XFSA 3HIIA 1YIJ3 2RNTA 1MOLA 1JB5A 2KAAA 2MF7A 3MHEA 2HMJB 2K54A 1NB3I 1K8A4 1B2MA 4N6NB 2Z77A 1JBTA 3KKGA 4L7KA 3PZWA 3HI7A 3S27A 4EYCA 1FYSA 8CHOA 3MG2A 1RGAA 1BVIA 5G1LA 3VF1A 1IQYA 5IG5A 1BNFA 4STDA 1A2KA 1ZS7A 4MMZB 3MWZA 1MWRA 3ZG5A 2Q07A 1DE3A 4J5KA 1CQSA 4IPBA 3WODG 3D4AA 4O8SA 3CU3A 1IT8A 3RNTA 3F9SA 1W6YA 3PCSA 1IK3A 1BRNL 1RTUA 4MMXB 1B3SA 1UCIA 5IG4A 2CFDA 1BNRA 3WA2X 4JF8A 1X1WA 2GU1A 2RSXA 3GZBA 1IV9A 3MKIA 3LXUX 1HU9A 1HKXA 1UGIA 5IEOA 3KZTA 4EBGA 2YFIB 1B27A 1SIIA 4HJLB 2P05A 4LYLB 1BNGA 5EQLA 3G6E3 2FXTA 4BTYA 1LOVA 2QGUA 4R1KA 3VGNA 1I3IA 1UCJA 5D81A 2OWPA 3EX9A 2P0MA 2FGTA 4HOHA 1GSPA 1ZGXA 3FH1A 1RGKA 1JN5B 1LVNA 3HOHA 2CK3H 3GAXA 1RGEA 3X3YA 2CFWA 1RGHA 3H3HA 3KIIA 4N3VA 1FZUA 2HMMB 4HZBB 4XBXA 1W4NA 1NU3A 3FF0A 5ELJA 3MG1A
chains in the Genus database with same CATH topology
3AMOB 3CMA3 2CFGA 1ISKA 5I97A 2GBXB 3ER7A 2B1XB 2V1LA 3NBJA 3SVAA 3A76A 3U1WA 3WDGB 1M9GA 1SJWA 4H3UA 2W03A 3F8XA 3HIGA 3LTDA 4O2HA 2O3OA 3Q90A 3BNEA 3UB1A 3V92A 4BTWA 1WNHA 1O7NB 3S67A 1JB4A 1DMNA 3CCQ3 4L8PA 4EV2A 2XSOB 3NBRA 1SIHA 4WYKB 1JV2B 3CD63 4XDWA 1N5PA 1PFPA 3KFQC 3OWYA 1QALA 1DVCA 4EV5A 3CC23 3CCE3 3UJMA 5LC7A 3L0RA 2O9UX 4RBNA 2CC3A 3BNDA 4MMYB 1O7WB 4N6LA 3U97A 1FUWA 4WP5A 1RN7A 3LYGA 2GEXA 1IT7A 3IJEB 3X3XA 1Q40B 3E99A 3LH4A 2RCDA 2XFTA 2JDIH 4XB5A 1NDOB 3ROBA 3QK9A 3PYJA 3B4OA 2CFKA 1IVUA 1JN5A 1YJW3 3KE7A 1M1XB 4KFEA 2W0QA 3X3ZA 5CXOA 1QVG2 3ALAA 3AMOA 3HZPA 3RDEA 1TIJA 3UNLA 2XF3A 3K63A 3FCSB 3WMDA 4RNYA 3D3LA 3EC9A 3OXAA 4TX4A 1DYUA 2BMRB 2HMLB 5KP3A 1GD3A 4KVHA 3CCU3 3MPHA 3PS8A 1VQP3 5DREA 4J8TA 1WMNA 3LOYA 3QRDA 4XBYA 4KFDA 1FGOA 4N6UA 2ML6A 1IV7A 4LMIA 2XSHB 3LT9A 4WYKA 4Q53A 3SEDA 4OVMA 4XM4A 3TDGA 1DMQA 3H51A 5ELUA 3CCR3 4FR9A 5AIGA 2UX0A 3N54B 2XGNA 3CC73 2WOFA 3T8NA 1GY5A 3DMCA 3DGMA 1D6ZA 4OK0A 3NX0A 3MSOA 3G0KA 1Q824 3N8BA 2WO0A 3DM8A 1Q40A 5BXQA 1W01A 3OV4A 5AYSC 2KXGA 1W00A 3LZAA 4LEHA 1OF5B 4HM8B 2MC8A 2ZL8A 5A0OB 3BNCA 4L8OA 1Q42A 2QA43 3I0YA 4GB5A 2XR8B 1GY7A 2LYXA 1W7CA 2PNCA 2YX9A 5STDA 3UL5A 3GZXB 2OTL3 1VQN3 1N8R4 1AVKA 1JB2A 4U13A 5EEOA 3FKAA 3K9MC 4N6MA 2L4VA 2CG0A 3EQQB 2QIYA 4RZMA 3EE1A 3JUPA 3IMAB 3DUKA 4R80A 3LTAA 1DVDA 2INXA 3LMLA 4N6V0 2CHCA 4MJDA 2K0MA 2I9WA 3T8UA 3CNXA 4IT7A 1YIT3 1STDA 3RGRA 5AIIA 3K7CA 1VQL3 2CWVA 1PU4A 3SOAA 1N9JA 1N9EA 3JUMA 1J2BA 2GXFA 3DY5A 3FG1A 1IDPA 5CF1A 3NBBA 3NM2A 4RNZA 3EN1B 2IUKA 1FGMA 2IMJA 1OF5A 3WOEB 4HVNA 2CG1A 2C10A 1OHSA 3G713 1YGEA 5FGOA 2CWTA 3FGYA 1G96A 1N5HA 1O7MB 2JQ5A 1ROVA 1ROAA 4JRFA 1LOXA 5D83A 3V98A 3KSED 2B24B 1QMAA 5IERA 5IF6A 4KFFA 1TP6A 1IU7A 1ULIB 3F14A 5DRVA 1VQO3 2WGOA 4HM3B 5AYRB 4K1UA 1A90A 3F8HA 3NM7A 5D82A 4FMBA 2CW9A 2Z7AA 4LSOA 4HKVB 1UI7A 1VQK3 3LTBA 2D1WA 1CYVA 1ZO2A 4MEIA 3GWRA 3JVCA 1K28A 3FSDA 3CCS3 2GU3A 4J9AA 1W5ZA 3O8YA 3EJVA 1RJOA 1OPYA 2QEX3 1W4NA 1MNLA 2STDA 2ZDJA 3FF2A 1Q864 4N6TA 3EBYA 2OQEA 3X42A 1OCVA 3S29A 3DGOA 1IVWA 4K1VA 7STDA 5IENA 3EN8A 4N6OB 3KN4A 4O3VA 1YJN3 2BMOB 2F99A 3N9HA 3B7CA 3CPW2 1W2ZA 1NO3A 3OWSA 1UI8A 4AKZA 3J7Yd 3GZYB 3EF8A 1YJ93 2P09A 3DGLA 4X2HA 3VSYA 3CCM3 1W6CA 2KRTA 2XEPA 1EKMA 3IPTA 2P0XA 4HM5B 2R4IA 3BNBA 2BT3A 4R4KA 4ZM8A 3BLZA 4X2OA 1VQ73 3ECFA 2GBWB 1ASKA 1WMOA 1KSIA 1W6GA 1QJGA 1C7HA 2W9QA 2HMNB 5IW9A 3K5TA 2M7OA 3X41A 1NJI4 3NV0B 4NREA 1UUWB 2E2VA 3JUQA 4XDVA 3CCL3 2FNQA 2Y73A 1VQ43 5AEWB 5JBSA 1OHPA 1YHQ3 4FMCA 1TFKA 2Z6BA 3HK4A 3JUOA 1VQM3 1IVXA 4HYZA 3FLJA 2OOVC 2W6JH 4O02B 4PEJA 3SX1A 1LNHA 1VZZA 2Z76A 3HX8A 5KP1A 4H61A 2CFLA 4WHAA 3CC43 3S28A 3B8LA 1YVBI 2W56B 2W2CA 1S723 1L5GB 3OX9A 1EQKA 1SPUA 3I553 1S5AA 1GD4A 3T0UA 5AEUB 4HZ9B 1OGXA 5CF2A 1FGRA 2WGQA 1VQ93 1JKGB 2IA7A 2XGLA 2BHMA 3NQYA 3WOFB 4EXRA 4FCMA 4CDLA 1OHOA 4AKYA 4G1MB 2CH9A 1WQLB 4K90B 1VQ63 3SXXA 1E3VA 1US1A 2BNGA 4ORLA 1JJ22 1AR0A 4KZ1A 3WA3A 3MYTA 1Z1SA 2KCDA 1CEWI 1GS3A 1NWWA 5JPUA 3FZWA 3NV0A 1IQXA 4WFOA 5IG0A 1M904 5AIHA 1EG9B 4LZIA 2WOHA 3PGBA 4WWUC 3UL6A 1K734 2E2TA 1KQS2 1STFI 2C11A 1KD14 3I563 2OCTA 4HM2B 5G2GA 1VQ83 1EA2A 4FMDA 2W9PA 4R9LA 5LC6A 1AV4A 3BB9A 2Y74A 3G16A 4FCJA 4XBTA 2E2UA 4HM1B 2YFJB 1IQ8A 1DMMA 2HMOB 2OTJ3 1A67A 5CLKA 5FW5A 1KWIA 1UW1A 1QAKA 2W56A 5IG3A 1JRQA 4HM7B 3GRDA 5BVBA 1OACA 3STDA 1E3RA 5CK6A 3Q2PA 3DXOA 3FG3A 1WMPA 3OW22 3D9RA 3SOYA 2OOVA 2D42A 1JKGA 2PZVA 3LTCA 1D6YA 3EB8A 4HBRA 5TGNA 4BTXA 1FGQA 3GZRA 5IEPA 1T5YA 2BO9B 1TFOA 1TUHA 3F40A 1O7GB 1FA3A 1Y4KA 1OH0A 2XRXB 3V99A 1O7HB 4OUQA 1ULJB 2HMKB 4QWTA 5EVHA 1RRHA 1K9M4 2CWUA 4FMAA 1FGTA 1GY6A 2LQVA 1V74A 1WTHA 3LT8A 3MG3A 5KP4A 4GL6A 3OWUA 2SBLA 3F7SA 1OUNA 1RRLA 2A15A 3NXJA 3FG4A 1D6UA 3S5CA 3F7XA 5AI1A 2W04A 4AEQA 1U5OA 1M1K4 1AVLA 1CYUA 3NHXA 1OGZA 4I4KA 1BUQA 3SLUA 1NB5I 4HM6B 3JUNA 4CCVA 5JPPA 3RGAA 1UUVB 3X40A 4EC6A 3KSPA 4K61A 1R4CA 1Q814 4FCZA 5AIFA 4IIAA 1QAFA 4NHFA 1IVVA 2CKFB 2OQEC 1QVF2 2RGQA 1ZX2A 1LXEA 1RKYA 2XH9A 3B4PA 3CNMA 3PCRA 1W2B2 2ML5A 3G8ZA 3NQZA 3PXMA 3CXC2 2YFLB 1K41A 5HGRA 2F98A 1E97A 1W02A 2RFRA 4HM0B 1YI23 4R9KA 1O7PB 3DGNA 1JNQA 2P38A 3EBTA 3CCJ3 1U8CB 1Q7Y4 2F86B 3K0ZA 1TU5A 1GYBA 1F8NA 2IUJA 1KC84 3M8CA 3G4S3 4HM4B 3CCV3 2GEYA 2BMQB 1A2VA 3EHCA 3NUVA 1SQWA 6STDA 1VQ53 3CPOA 1N8QA 4LGQA 3CME3 3Q1CA 3DZLA 2XFSA 3HIIA 1YIJ3 1MOLA 1JB5A 2MF7A 3MHEA 2HMJB 2K54A 1NB3I 1K8A4 4N6NB 2Z77A 3KKGA 4L7KA 3PZWA 3HI7A 3S27A 4EYCA 8CHOA 3MG2A 5IG5A 3VF1A 1IQYA 4STDA 1A2KA 4MMZB 3MWZA 2Q07A 1CQSA 4IPBA 3WODG 4O8SA 3CU3A 1IT8A 3F9SA 1W6YA 3PCSA 1IK3A 4MMXB 5IG4A 2CFDA 3WA2X 4JF8A 2GU1A 2RSXA 3GZBA 1IV9A 3MKIA 3LXUX 1HU9A 1HKXA 5IEOA 3KZTA 4EBGA 2YFIB 4HJLB 1SIIA 2P05A 5EQLA 3G6E3 2FXTA 4BTYA 2QGUA 4R1KA 3VGNA 5D81A 2OWPA 3EX9A 2P0MA 2FGTA 3FH1A 1JN5B 1LVNA 2CK3H 3GAXA 3X3YA 2CFWA 3H3HA 3KIIA 4N3VA 4HZBB 2HMMB 4XBXA 5ELJA 2CIUA 1NU3A 3FF0A 3MG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9Q A;  3K9M C;  4N6M A;  3SVA A;  1M9G A;  3IMA B;  1WNH A;  3S67 A;  1DVD A;  1CYU A;  4N6V 0;  1N5P A;  1PFP A;  3KFQ C;  1NB5 I;  1DVC A;  4IT7 A;  4CCV A;  5LC7 A;  1R4C A;  3L0R A;  2O9U X;  1YVB I;  1N9J A;  4N6L A;  1LXE A;  1EQK A;  1FUW A;  1RN7 A;  3PXM A;  1GD4 A;  3LH4 A;  3PYJ A;  1G96 A;  1N5H A;  1ROA A;  2CH9 A;  3KSE D;  1TIJ A;  1MOL A;  1CEW I;  4TX4 A;  1NB3 I;  1A90 A;  4N6N B;  1GD3 A;  4LZI A;  3PS8 A;  4EYC A;  3UL6 A;  3QRD A;  1STF I;  1CYV A;  3MWZ A;  2OCT A;  4N6U A;  1IV7 A;  2W9P A;  5LC6 A;  1MNL A;  4N6T A;  5ELU A;  1A67 A;  4N6O B;  1KWI A;  1IV9 A;  3NX0 A;  5EQL A;  3Q2P A;  2KXG A;  5A0O B;  3GAX A;  2BO9 B;  4ZM8 A;  5ELJ A;  1FA3 A;  3UL5 A; 
#chains in the Genus database with same CATH topology
 4BIR A;  3AMO B;  3CMA 3;  2CFG A;  1ISK A;  5I97 A;  2GBX B;  3ER7 A;  2B1X B;  2V1L A;  3BIR A;  3NBJ A;  3SVA A;  3A76 A;  3U1W A;  1BSC A;  3AGN A;  3WDG B;  1M9G A;  2CIU A;  1SJW A;  5M18 A;  4H3U A;  2W03 A;  3F8X A;  3HIG A;  3LTD A;  4O2H A;  2O3O A;  3Q90 A;  3BNE A;  3UB1 A;  3V92 A;  4BTW A;  1WNH A;  1O7N B;  3S67 A;  1JB4 A;  1DMN A;  4I5Q A;  3CCQ 3;  4L8P A;  5HOH A;  4EV2 A;  1VQQ A;  2XSO B;  3NBR A;  1SIH A;  4WYK B;  1JV2 B;  1MWU A;  1BSA A;  1N5P A;  4XDW A;  3CD6 3;  1PFP A;  3KFQ C;  3OWY A;  1B21 A;  1QAL A;  1DVC A;  4EV5 A;  7GSP A;  3CC2 3;  3UJM A;  3CCE 3;  3URP A;  5LC7 A;  2K3D A;  3AHW A;  3L0R A;  1B2S A;  1RMS A;  2O9U X;  2BIR A;  4RBN A;  2CC3 A;  3BND A;  4MMY B;  3Q3F A;  1O7W B;  4N6L A;  3U97 A;  1RGC A;  1FUW A;  1AQZ A;  4WP5 A;  1RN7 A;  5GSP A;  3LYG A;  2GEX A;  1UUG B;  1IT7 A;  3IJE B;  3X3X A;  1Q40 B;  3E99 A;  2CX0 A;  3LH4 A;  1FUS A;  2RCD A;  2XFT A;  2JDI H;  4XB5 A;  1NDO B;  1B2Z A;  1TRP A;  3QK9 A;  2BU4 A;  3A5E A;  3BU4 A;  3PYJ A;  3ROB A;  3B4O A;  3GSP A;  2CFK A;  1MGW A;  1IVU A;  1JN5 A;  1YJW 3;  2ZA4 A;  1BRS A;  3KE7 A;  1M1X B;  4KFE A;  2W0Q A;  3X3Z A;  4DKI A;  1B2U A;  5CXO A;  1QVG 2;  1FUT A;  3AMO A;  3ALA A;  3HZP A;  4GSP A;  1TIJ A;  3RDE A;  3UNL A;  2XF3 A;  3K63 A;  3FCS B;  3WMD A;  4RNY A;  1X1Y A;  3D3L A;  3EC9 A;  3OXA A;  4TX4 A;  1DYU A;  2BMR B;  2HML B;  5KP3 A;  1GD3 A;  4KVH A;  1SAR A;  3CCU 3;  3MPH A;  3PS8 A;  1VQP 3;  4HAA A;  4J8T A;  5DRE A;  1WMN A;  3LOY A;  3QRD A;  1GOV A;  4KFD A;  4XBY A;  1FGO A;  1EUI C;  4N6U A;  2ML6 A;  1IV7 A;  4LMI A;  1GOY A;  1EEJ A;  2XSH B;  3LT9 A;  4WYK A;  5M19 A;  4Q53 A;  3SED A;  4OVM A;  4XM4 A;  1HYF A;  3TDG A;  2IY2 A;  1DMQ A;  3DH2 A;  3H51 A;  5ELU A;  3CCR 3;  4FR9 A;  5AIG A;  2UX0 A;  1CH0 A;  2XGN A;  3N54 B;  3CC7 3;  2WOF A;  3T8N A;  1I3F A;  1AY7 A;  1GY5 A;  3DMC A;  3DGM A;  1PYL A;  1BOX A;  1I2G A;  1D6Z A;  1NNV A;  3NX0 A;  4OK0 A;  3MSO A;  3G0K A;  1Q82 4;  3N8B A;  2WO0 A;  3DM8 A;  1Q40 A;  2RBI A;  4BL2 A;  5BXQ A;  1I8V A;  1RN4 A;  1IYY A;  1W01 A;  3OV4 A;  5AYS C;  1BSD A;  2KXG A;  1W00 A;  3LZA A;  4LEH A;  1OF5 B;  4HM8 B;  2MC8 A;  2ZL8 A;  5A0O B;  1TRQ A;  3BNC A;  4L8O A;  1Q42 A;  1BNS A;  2QA4 3;  3I0Y A;  5M1A A;  4GB5 A;  2XR8 B;  1GY7 A;  3DGY A;  2LYX A;  1GMP A;  1W7C A;  2PNC A;  4NPB A;  2YX9 A;  5STD A;  3UL5 A;  3GZX B;  2OTL 3;  1VQN 3;  1N8R 4;  1AVK A;  1JB2 A;  4U13 A;  5EEO A;  3FKA A;  3K9M C;  4N6M A;  1LRA A;  2L4V A;  5RNT A;  2CG0 A;  3EQQ B;  2QIY A;  4RZM A;  1BAN A;  1I2E A;  3EE1 A;  1BGS A;  3JUP A;  3IMA B;  3DUK A;  3SYU A;  4R80 A;  3LTA A;  1DVD A;  2INX A;  1RGG A;  3LML A;  1BSE A;  4N6V 0;  2CHC A;  4MJD A;  3KCH A;  2K0M A;  2I9W A;  3T8U A;  3CNX A;  4IT7 A;  1YIT 3;  1STD A;  2GSP A;  3RGR A;  1RCK A;  2UGI A;  5AII A;  1V58 A;  3K7C A;  3WHO A;  1VQL 3;  2CWV A;  4ILF A;  1PU4 A;  2KF5 A;  3SOA A;  1N9J A;  1N9E A;  3JUM A;  1J2B A;  2GXF A;  3DY5 A;  3FG1 A;  1IDP A;  5CF1 A;  1RLS A;  1Q9E A;  1R4Y A;  1BU4 A;  3NBB A;  1I0V A;  3NM2 A;  4RNZ A;  3EN1 B;  4CPK A;  1JZO A;  2IUK A;  1FGM A;  2IMJ A;  1OF5 A;  3WOE B;  4HVN A;  4GHO A;  2C10 A;  2CG1 A;  1OHS A;  3G71 3;  1YGE A;  5FGO A;  1BNI A;  2CWT A;  3FGY A;  1YNV X;  1G96 A;  1N5H A;  2H0I A;  1O7M B;  2JQ5 A;  1ROV A;  1V57 A;  8RNT A;  1FW7 A;  1ROA A;  1BRH A;  4JRF A;  1BRI A;  2KF3 A;  1LOX A;  5D83 A;  3V98 A;  3KSE D;  2B24 B;  1LQG C;  1QMA A;  1LOW A;  5IER A;  4KFF A;  1TP6 A;  1IU7 A;  1ULI B;  3F14 A;  5DRV A;  5IF6 A;  1RNB A;  1VQO 3;  2WGO A;  4HM3 B;  5AYR B;  4K1U A;  1A90 A;  3F8H A;  3NM7 A;  5D82 A;  4FMB A;  2CW9 A;  2Z7A A;  4LSO A;  4HKV B;  1UI7 A;  1G02 A;  1VQK 3;  3LTB A;  2D1W A;  2AAD A;  1CYV A;  1ZO2 A;  4MEI A;  3GWR A;  3JVC A;  1K28 A;  3FSD A;  3CCS 3;  2GU3 A;  4J9A A;  1W5Z A;  3O8Y A;  3EJV A;  1RJO A;  1OPY A;  2QEX 3;  2J8X B;  1MNL A;  2STD A;  2ZDJ A;  3FF2 A;  1Q86 4;  4N6T A;  3EBY A;  4KT3 B;  2OQE A;  3X42 A;  1OCV A;  3S29 A;  3DGO A;  1IVW A;  4K1V A;  7STD A;  5IEN A;  3EN8 A;  4N6O B;  3KN4 A;  4O3V A;  1YJN 3;  2BMO B;  2F99 A;  3N9H A;  3B7C A;  3CPW 2;  1RNT A;  1W2Z A;  1I2F A;  1NO3 A;  3OWS A;  1UI8 A;  4AKZ A;  3J7Y d;  3GZY B;  3EF8 A;  1YJ9 3;  2P09 A;  3DGL A;  1LQM B;  4X2H A;  3VSY A;  3CCM 3;  1W6C A;  2KRT A;  2XEP A;  1EKM A;  1RHL A;  1BRJ A;  3IPT A;  2P0X A;  4HM5 B;  2R4I A;  4CJN A;  3BNB A;  2BT3 A;  1RSN A;  2IYJ A;  4R4K A;  4ZM8 A;  3BLZ A;  4X2O A;  9RNT A;  1VQ7 3;  3ECF A;  2CX1 A;  2GBW B;  1ASK A;  1WMO A;  1KSI A;  1W6G A;  1QJG A;  1JBR A;  1C7H A;  2F5W A;  2W9Q A;  2HMN B;  5IW9 A;  3K5T A;  3D5G A;  2M7O A;  3X41 A;  1NJI 4;  3NV0 B;  1T2H A;  1UUW B;  2E2V A;  3JUQ A;  4NRE A;  4XDV A;  1B20 A;  3CCL 3;  2FNQ A;  2Y73 A;  1VQ4 3;  5AEW B;  5JBS A;  1OHP A;  1YHQ 3;  4FMC A;  1TFK A;  2Z6B A;  3HK4 A;  2AAE A;  3D5I A;  3JUO A;  1IVX A;  1VQM 3;  4HYZ A;  3FLJ A;  2OOV C;  2W6J H;  4O02 B;  4PEJ A;  3SX1 A;  1LNH A;  2F56 A;  1VZZ A;  2Z76 A;  3HX8 A;  5KP1 A;  2F4Y A;  4H61 A;  1YGW A;  2CFL A;  1A2P A;  4WHA A;  4RNT A;  3S28 A;  3CC4 3;  2ZHX B;  3B8L A;  1YVB I;  2HOH A;  2W56 B;  2W2C A;  1S72 3;  1G0T A;  1RN1 A;  3OX9 A;  1L5G B;  1SPU A;  1EQK A;  1T2I A;  3I55 3;  1I0X A;  1S5A A;  1GD4 A;  1C54 A;  3T0U A;  1BUJ A;  5AEU B;  5BU4 A;  4HZ9 B;  1OGX A;  5CF2 A;  1FGR A;  2WGQ A;  1VQ9 3;  1JKG B;  2IA7 A;  3WR2 A;  1LNI A;  2BHM A;  2XGL A;  3NQY A;  3WOF B;  4EXR A;  4FCM A;  4CDL A;  1GOU A;  1OHO A;  4AKY A;  4G1M B;  2CH9 A;  1WQL B;  4K90 B;  1VQ6 3;  3SXX A;  1E3V A;  1US1 A;  2BNG A;  4ORL A;  1JJ2 2;  1AR0 A;  4KZ1 A;  3WA3 A;  3MYT A;  1Z1S A;  2KCD A;  2R41 A;  1CEW I;  1GS3 A;  1NWW A;  5JPU A;  3FZW A;  3NV0 A;  1IQX A;  4WFO A;  5IG0 A;  1M90 4;  5AIH A;  1EG9 B;  4LZI A;  2WOH A;  3PGB A;  4WWU C;  3UL6 A;  1K73 4;  1HZ1 A;  2E2T A;  3AHS A;  1KQS 2;  1STF I;  2C11 A;  1DET A;  1KD1 4;  3I56 3;  2OCT A;  4HM2 B;  5G2G A;  1VQ8 3;  1EA2 A;  4FMD A;  2W9P A;  4R9L A;  5LC6 A;  6GSP A;  1TTO A;  1AV4 A;  3BB9 A;  2Y74 A;  3G16 A;  4FCJ A;  4XBT A;  2E2U A;  2F5M A;  4HM1 B;  2YFJ B;  1IQ8 A;  1DMM A;  2HMO B;  2OTJ 3;  1A67 A;  5CLK A;  5FW5 A;  1KWI A;  1UW1 A;  1QAK A;  2W56 A;  2UUG C;  5IG3 A;  1JRQ A;  4HM7 B;  1B2X A;  3GRD A;  5BVB A;  1OAC A;  2C4B A;  3STD A;  1E3R A;  6RNT A;  5CK6 A;  3Q2P A;  3DXO A;  2H0H A;  3FG3 A;  2L1S A;  4EW5 A;  1WMP A;  1UCL A;  3OW2 2;  3D9R A;  1X1U A;  3SOY A;  2OOV A;  2D42 A;  1JZD A;  1MGR A;  4BU4 A;  1BSB A;  1JKG A;  2PZV A;  3LTC A;  5G1K A;  1D6Y A;  3EB8 A;  4HBR A;  5TGN A;  4BTX A;  5BIR A;  1FGQ A;  1LOY A;  1RGL A;  1T3B A;  3GZR A;  5IEP A;  1T5Y A;  2BO9 B;  1TFO A;  1TUH A;  3F40 A;  1O7G B;  1MWS A;  1FA3 A;  1Y4K A;  1OH0 A;  2XRX B;  3V99 A;  1BNJ A;  1O7H B;  1RGF A;  4OUQ A;  1ULJ B;  2HMK B;  4QWT A;  5EVH A;  1RRH A;  1K9M 4;  2CWU A;  4FMA A;  1FGT A;  1GY6 A;  2LQV A;  1V74 A;  1WTH A;  3LT8 A;  3MG3 A;  1MWT A;  5KP4 A;  4GL6 A;  3OWU A;  1RDS A;  2SBL A;  3F7S A;  1OUN A;  1RRL A;  2A15 A;  3NXJ A;  3FG4 A;  1D6U A;  3S5C A;  1TJD A;  3F7X A;  5AI1 A;  1BAO A;  2W04 A;  1GMR A;  1U5O A;  1AVL A;  4AEQ A;  1M1K 4;  1CYU A;  1RCL A;  3NHX A;  1OGZ A;  4I4K A;  1BUQ A;  3SLU A;  1NB5 I;  3ZG0 A;  4HM6 B;  3JUN A;  4CCV A;  5JPP A;  3RGA A;  1UUV B;  2KF4 A;  2KF6 A;  3X40 A;  4J5G A;  1JBS A;  4EC6 A;  3KSP A;  4K61 A;  1BIR A;  1R4C A;  1Q81 4;  4FCZ A;  1UCK A;  1PY3 A;  1BRG A;  4IIA A;  5AIF A;  3ZFZ A;  1QAF A;  2H0G A;  4NHF A;  1IVV A;  2CKF B;  2OQE C;  7RNT A;  1QVF 2;  2RGQ A;  1ZX2 A;  1LXE A;  1RKY A;  2XH9 A;  1I70 A;  3B4P A;  3CNM A;  3PCR A;  1W2B 2;  2ML5 A;  3G8Z A;  3NQZ A;  3PXM A;  3CXC 2;  2YFL B;  1K41 A;  5HGR A;  2F98 A;  1E97 A;  1GMQ A;  1W02 A;  2RFR A;  4HM0 B;  1YI2 3;  4R9K A;  1O7P B;  3DGN A;  1JNQ A;  1BRK A;  1UDI I;  1Q7H A;  2P38 A;  1U8C B;  3EBT A;  3CCJ 3;  1Q7Y 4;  1X1X A;  1YVS A;  2F86 B;  3K0Z A;  1TU5 A;  1GYB A;  1UGH I;  1F8N A;  3AGO A;  2SAR A;  3D79 A;  2IUJ A;  4BL3 A;  1KC8 4;  3M8C A;  3G4S 3;  4HM4 B;  3CCV 3;  2GEY A;  1BNE A;  2BMQ B;  1A2V A;  3EHC A;  3NUV A;  1SQW A;  6STD A;  1VQ5 3;  3CPO A;  1N8Q A;  4LGQ A;  3CME 3;  3Q1C A;  3DZL A;  2XFS A;  3HII A;  1YIJ 3;  2RNT A;  1MOL A;  1JB5 A;  2KAA A;  2MF7 A;  3MHE A;  2HMJ B;  2K54 A;  1NB3 I;  1K8A 4;  1B2M A;  4N6N B;  2Z77 A;  1JBT A;  3KKG A;  4L7K A;  3PZW A;  3HI7 A;  3S27 A;  4EYC A;  1FYS A;  8CHO A;  3MG2 A;  1RGA A;  1BVI A;  5G1L A;  3VF1 A;  1IQY A;  5IG5 A;  1BNF A;  4STD A;  1A2K A;  1ZS7 A;  4MMZ B;  3MWZ A;  1MWR A;  3ZG5 A;  2Q07 A;  1DE3 A;  4J5K A;  1CQS A;  4IPB A;  3WOD G;  3D4A A;  4O8S A;  3CU3 A;  1IT8 A;  3RNT A;  3F9S A;  1W6Y A;  3PCS A;  1IK3 A;  1BRN L;  1RTU A;  4MMX B;  1B3S A;  1UCI A;  5IG4 A;  2CFD A;  1BNR A;  3WA2 X;  4JF8 A;  1X1W A;  2GU1 A;  2RSX A;  3GZB A;  1IV9 A;  3MKI A;  3LXU X;  1HU9 A;  1HKX A;  1UGI A;  5IEO A;  3KZT A;  4EBG A;  2YFI B;  1B27 A;  1SII A;  4HJL B;  2P05 A;  4LYL B;  1BNG A;  5EQL A;  3G6E 3;  2FXT A;  4BTY A;  1LOV A;  2QGU A;  4R1K A;  3VGN A;  1I3I A;  1UCJ A;  5D81 A;  2OWP A;  3EX9 A;  2P0M A;  2FGT A;  4HOH A;  1GSP A;  1ZGX A;  3FH1 A;  1RGK A;  1JN5 B;  1LVN A;  3HOH A;  2CK3 H;  3GAX A;  1RGE A;  3X3Y A;  2CFW A;  1RGH A;  3H3H A;  3KII A;  4N3V A;  1FZU A;  2HMM B;  4HZB B;  4XBX A;  1W4N A;  1NU3 A;  3FF0 A;  5ELJ A;  3MG1 A; 
#chains in the Genus database with same CATH homology
 3AMO B;  3CMA 3;  2CFG A;  1ISK A;  5I97 A;  2GBX B;  3ER7 A;  2B1X B;  2V1L A;  3NBJ A;  3SVA A;  3A76 A;  3U1W A;  3WDG B;  1M9G A;  1SJW A;  4H3U A;  2W03 A;  3F8X A;  3HIG A;  3LTD A;  4O2H A;  2O3O A;  3Q90 A;  3BNE A;  3UB1 A;  3V92 A;  4BTW A;  1WNH A;  1O7N B;  3S67 A;  1JB4 A;  1DMN A;  3CCQ 3;  4L8P A;  4EV2 A;  2XSO B;  3NBR A;  1SIH A;  4WYK B;  1JV2 B;  3CD6 3;  4XDW A;  1N5P A;  1PFP A;  3KFQ C;  3OWY A;  1QAL A;  1DVC A;  4EV5 A;  3CC2 3;  3CCE 3;  3UJM A;  5LC7 A;  3L0R A;  2O9U X;  4RBN A;  2CC3 A;  3BND A;  4MMY B;  1O7W B;  4N6L A;  3U97 A;  1FUW A;  4WP5 A;  1RN7 A;  3LYG A;  2GEX A;  1IT7 A;  3IJE B;  3X3X A;  1Q40 B;  3E99 A;  3LH4 A;  2RCD A;  2XFT A;  2JDI H;  4XB5 A;  1NDO B;  3ROB A;  3QK9 A;  3PYJ A;  3B4O A;  2CFK A;  1IVU A;  1JN5 A;  1YJW 3;  3KE7 A;  1M1X B;  4KFE A;  2W0Q A;  3X3Z A;  5CXO A;  1QVG 2;  3ALA A;  3AMO A;  3HZP A;  3RDE A;  1TIJ A;  3UNL A;  2XF3 A;  3K63 A;  3FCS B;  3WMD A;  4RNY A;  3D3L A;  3EC9 A;  3OXA A;  4TX4 A;  1DYU A;  2BMR B;  2HML B;  5KP3 A;  1GD3 A;  4KVH A;  3CCU 3;  3MPH A;  3PS8 A;  1VQP 3;  5DRE A;  4J8T A;  1WMN A;  3LOY A;  3QRD A;  4XBY A;  4KFD A;  1FGO A;  4N6U A;  2ML6 A;  1IV7 A;  4LMI A;  2XSH B;  3LT9 A;  4WYK A;  4Q53 A;  3SED A;  4OVM A;  4XM4 A;  3TDG A;  1DMQ A;  3H51 A;  5ELU A;  3CCR 3;  4FR9 A;  5AIG A;  2UX0 A;  3N54 B;  2XGN A;  3CC7 3;  2WOF A;  3T8N A;  1GY5 A;  3DMC A;  3DGM A;  1D6Z A;  4OK0 A;  3NX0 A;  3MSO A;  3G0K A;  1Q82 4;  3N8B A;  2WO0 A;  3DM8 A;  1Q40 A;  5BXQ A;  1W01 A;  3OV4 A;  5AYS C;  2KXG A;  1W00 A;  3LZA A;  4LEH A;  1OF5 B;  4HM8 B;  2MC8 A;  2ZL8 A;  5A0O B;  3BNC A;  4L8O A;  1Q42 A;  2QA4 3;  3I0Y A;  4GB5 A;  2XR8 B;  1GY7 A;  2LYX A;  1W7C A;  2PNC A;  2YX9 A;  5STD A;  3UL5 A;  3GZX B;  2OTL 3;  1VQN 3;  1N8R 4;  1AVK A;  1JB2 A;  4U13 A;  5EEO A;  3FKA A;  3K9M C;  4N6M A;  2L4V A;  2CG0 A;  3EQQ B;  2QIY A;  4RZM A;  3EE1 A;  3JUP A;  3IMA B;  3DUK A;  4R80 A;  3LTA A;  1DVD A;  2INX A;  3LML A;  4N6V 0;  2CHC A;  4MJD A;  2K0M A;  2I9W A;  3T8U A;  3CNX A;  4IT7 A;  1YIT 3;  1STD A;  3RGR A;  5AII A;  3K7C A;  1VQL 3;  2CWV A;  1PU4 A;  3SOA A;  1N9J A;  1N9E A;  3JUM A;  1J2B A;  2GXF A;  3DY5 A;  3FG1 A;  1IDP A;  5CF1 A;  3NBB A;  3NM2 A;  4RNZ A;  3EN1 B;  2IUK A;  1FGM A;  2IMJ A;  1OF5 A;  3WOE B;  4HVN A;  2CG1 A;  2C10 A;  1OHS A;  3G71 3;  1YGE A;  5FGO A;  2CWT A;  3FGY A;  1G96 A;  1N5H A;  1O7M B;  2JQ5 A;  1ROV A;  1ROA A;  4JRF A;  1LOX A;  5D83 A;  3V98 A;  3KSE D;  2B24 B;  1QMA A;  5IER A;  5IF6 A;  4KFF A;  1TP6 A;  1IU7 A;  1ULI B;  3F14 A;  5DRV A;  1VQO 3;  2WGO A;  4HM3 B;  5AYR B;  4K1U A;  1A90 A;  3F8H A;  3NM7 A;  5D82 A;  4FMB A;  2CW9 A;  2Z7A A;  4LSO A;  4HKV B;  1UI7 A;  1VQK 3;  3LTB A;  2D1W A;  1CYV A;  1ZO2 A;  4MEI A;  3GWR A;  3JVC A;  1K28 A;  3FSD A;  3CCS 3;  2GU3 A;  4J9A A;  1W5Z A;  3O8Y A;  3EJV A;  1RJO A;  1OPY A;  2QEX 3;  1W4N A;  1MNL A;  2STD A;  2ZDJ A;  3FF2 A;  1Q86 4;  4N6T A;  3EBY A;  2OQE A;  3X42 A;  1OCV A;  3S29 A;  3DGO A;  1IVW A;  4K1V A;  7STD A;  5IEN A;  3EN8 A;  4N6O B;  3KN4 A;  4O3V A;  1YJN 3;  2BMO B;  2F99 A;  3N9H A;  3B7C A;  3CPW 2;  1W2Z A;  1NO3 A;  3OWS A;  1UI8 A;  4AKZ A;  3J7Y d;  3GZY B;  3EF8 A;  1YJ9 3;  2P09 A;  3DGL A;  4X2H A;  3VSY A;  3CCM 3;  1W6C A;  2KRT A;  2XEP A;  1EKM A;  3IPT A;  2P0X A;  4HM5 B;  2R4I A;  3BNB A;  2BT3 A;  4R4K A;  4ZM8 A;  3BLZ A;  4X2O A;  1VQ7 3;  3ECF A;  2GBW B;  1ASK A;  1WMO A;  1KSI A;  1W6G A;  1QJG A;  1C7H A;  2W9Q A;  2HMN B;  5IW9 A;  3K5T A;  2M7O A;  3X41 A;  1NJI 4;  3NV0 B;  4NRE A;  1UUW B;  2E2V A;  3JUQ A;  4XDV A;  3CCL 3;  2FNQ A;  2Y73 A;  1VQ4 3;  5AEW B;  5JBS A;  1OHP A;  1YHQ 3;  4FMC A;  1TFK A;  2Z6B A;  3HK4 A;  3JUO A;  1VQM 3;  1IVX A;  4HYZ A;  3FLJ A;  2OOV C;  2W6J H;  4O02 B;  4PEJ A;  3SX1 A;  1LNH A;  1VZZ A;  2Z76 A;  3HX8 A;  5KP1 A;  4H61 A;  2CFL A;  4WHA A;  3CC4 3;  3S28 A;  3B8L A;  1YVB I;  2W56 B;  2W2C A;  1S72 3;  1L5G B;  3OX9 A;  1EQK A;  1SPU A;  3I55 3;  1S5A A;  1GD4 A;  3T0U A;  5AEU B;  4HZ9 B;  1OGX A;  5CF2 A;  1FGR A;  2WGQ A;  1VQ9 3;  1JKG B;  2IA7 A;  2XGL A;  2BHM A;  3NQY A;  3WOF B;  4EXR A;  4FCM A;  4CDL A;  1OHO A;  4AKY A;  4G1M B;  2CH9 A;  1WQL B;  4K90 B;  1VQ6 3;  3SXX A;  1E3V A;  1US1 A;  2BNG A;  4ORL A;  1JJ2 2;  1AR0 A;  4KZ1 A;  3WA3 A;  3MYT A;  1Z1S A;  2KCD A;  1CEW I;  1GS3 A;  1NWW A;  5JPU A;  3FZW A;  3NV0 A;  1IQX A;  4WFO A;  5IG0 A;  1M90 4;  5AIH A;  1EG9 B;  4LZI A;  2WOH A;  3PGB A;  4WWU C;  3UL6 A;  1K73 4;  2E2T A;  1KQS 2;  1STF I;  2C11 A;  1KD1 4;  3I56 3;  2OCT A;  4HM2 B;  5G2G A;  1VQ8 3;  1EA2 A;  4FMD A;  2W9P A;  4R9L A;  5LC6 A;  1AV4 A;  3BB9 A;  2Y74 A;  3G16 A;  4FCJ A;  4XBT A;  2E2U A;  4HM1 B;  2YFJ B;  1IQ8 A;  1DMM A;  2HMO B;  2OTJ 3;  1A67 A;  5CLK A;  5FW5 A;  1KWI A;  1UW1 A;  1QAK A;  2W56 A;  5IG3 A;  1JRQ A;  4HM7 B;  3GRD A;  5BVB A;  1OAC A;  3STD A;  1E3R A;  5CK6 A;  3Q2P A;  3DXO A;  3FG3 A;  1WMP A;  3OW2 2;  3D9R A;  3SOY A;  2OOV A;  2D42 A;  1JKG A;  2PZV A;  3LTC A;  1D6Y A;  3EB8 A;  4HBR A;  5TGN A;  4BTX A;  1FGQ A;  3GZR A;  5IEP A;  1T5Y A;  2BO9 B;  1TFO A;  1TUH A;  3F40 A;  1O7G B;  1FA3 A;  1Y4K A;  1OH0 A;  2XRX B;  3V99 A;  1O7H B;  4OUQ A;  1ULJ B;  2HMK B;  4QWT A;  5EVH A;  1RRH A;  1K9M 4;  2CWU A;  4FMA A;  1FGT A;  1GY6 A;  2LQV A;  1V74 A;  1WTH A;  3LT8 A;  3MG3 A;  5KP4 A;  4GL6 A;  3OWU A;  2SBL A;  3F7S A;  1OUN A;  1RRL A;  2A15 A;  3NXJ A;  3FG4 A;  1D6U A;  3S5C A;  3F7X A;  5AI1 A;  2W04 A;  4AEQ A;  1U5O A;  1M1K 4;  1AVL A;  1CYU A;  3NHX A;  1OGZ A;  4I4K A;  1BUQ A;  3SLU A;  1NB5 I;  4HM6 B;  3JUN A;  4CCV A;  5JPP A;  3RGA A;  1UUV B;  3X40 A;  4EC6 A;  3KSP A;  4K61 A;  1R4C A;  1Q81 4;  4FCZ A;  5AIF A;  4IIA A;  1QAF A;  4NHF A;  1IVV A;  2CKF B;  2OQE C;  1QVF 2;  2RGQ A;  1ZX2 A;  1LXE A;  1RKY A;  2XH9 A;  3B4P A;  3CNM A;  3PCR A;  1W2B 2;  2ML5 A;  3G8Z A;  3NQZ A;  3PXM A;  3CXC 2;  2YFL B;  1K41 A;  5HGR A;  2F98 A;  1E97 A;  1W02 A;  2RFR A;  4HM0 B;  1YI2 3;  4R9K A;  1O7P B;  3DGN A;  1JNQ A;  2P38 A;  3EBT A;  3CCJ 3;  1U8C B;  1Q7Y 4;  2F86 B;  3K0Z A;  1TU5 A;  1GYB A;  1F8N A;  2IUJ A;  1KC8 4;  3M8C A;  3G4S 3;  4HM4 B;  3CCV 3;  2GEY A;  2BMQ B;  1A2V A;  3EHC A;  3NUV A;  1SQW A;  6STD A;  1VQ5 3;  3CPO A;  1N8Q A;  4LGQ A;  3CME 3;  3Q1C A;  3DZL A;  2XFS A;  3HII A;  1YIJ 3;  1MOL A;  1JB5 A;  2MF7 A;  3MHE A;  2HMJ B;  2K54 A;  1NB3 I;  1K8A 4;  4N6N B;  2Z77 A;  3KKG A;  4L7K A;  3PZW A;  3HI7 A;  3S27 A;  4EYC A;  8CHO A;  3MG2 A;  5IG5 A;  3VF1 A;  1IQY A;  4STD A;  1A2K A;  4MMZ B;  3MWZ A;  2Q07 A;  1CQS A;  4IPB A;  3WOD G;  4O8S A;  3CU3 A;  1IT8 A;  3F9S A;  1W6Y A;  3PCS A;  1IK3 A;  4MMX B;  5IG4 A;  2CFD A;  3WA2 X;  4JF8 A;  2GU1 A;  2RSX A;  3GZB A;  1IV9 A;  3MKI A;  3LXU X;  1HU9 A;  1HKX A;  5IEO A;  3KZT A;  4EBG A;  2YFI B;  4HJL B;  1SII A;  2P05 A;  5EQL A;  3G6E 3;  2FXT A;  4BTY A;  2QGU A;  4R1K A;  3VGN A;  5D81 A;  2OWP A;  3EX9 A;  2P0M A;  2FGT A;  3FH1 A;  1JN5 B;  1LVN A;  2CK3 H;  3GAX A;  3X3Y A;  2CFW A;  3H3H A;  3KII A;  4N3V A;  4HZB B;  2HMM B;  4XBX A;  5ELJ A;  2CIU A;  1NU3 A;  3FF0 A;  3MG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...