1CF7A

Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*TP*TP*TP*TP*CP*GP*CP*GP*CP*GP*GP*TP*TP*TP*T)-3
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02319 E2F_TDP E2F/DP family winged-helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cf7A00
3FZVA 4Q48A 4CO8A 2DPUA 5JFRA 1O3SA 1SFXA 2H6CA 4LB6B 1LDKB 3FMQA 3R61A 3BJAA 1ZAOA 1FC3A 4M71A 4MEYF 2H94A 3RKWA 1HW5A 2ESHA 4HQEA 5IT9Z 2XGXA 2L4AA 1SAXA 1GXPA 2ZBKA 1FPQA 2PN6A 1GHCA 5AONA 2HKXA 1P2FA 1R7JA 4PDKA 4HX4A 4ON0A 2COMA 2O8XA 2XROA 1HKSA 1D8KA 2EV6A 4RGRA 1P6RA 3S2WA 1FYLA 4N9HA 4KN4X 2FRHA 5DD8A 2L3DA 1J7KA 2EWNA 2EJRA 4G9YA 4K2EA 1JHHA 4OIQF 1WKMA 4GGGA 2DLLA 1RNLA 5LLQA 3BPVA 1XSXA 3V8KA 3WGGA 1PP7U 2KIUA 1G3TA 5H6QA 3EQLF 1Z91A 4LK0F 5L3DA 1F9NA 4MEXF 4HV6A 2RKHA 1TNTA 5IT3A 5CVRA 1BM9A 1V4RA 2NRAC 3BWGA 1XB4A 1YS6A 4HZFA 2WWYA 3R60A 3U2RA 1QZZA 5E8IA 4CZZA 1BC7C 2IPQX 1MJAA 4RS8A 2HWVA 1BOAA 3HRSA 2PBIA 4LG0B 3DKWA 3RYRA 1FBQA 3C1DA 3P9KA 2DFIA 1SMTA 5J6XA 2EFOA 3VB2A 2EA2A 5D4RA 5ICGA 2XASA 4KYWA 4RB1A 5E1ZB 4UHTA 3V8JA 4UVBA 1LEBA 2BGCA 5DCMB 3V4GA 2ZCWA 4M6YA 1ZN2A 1TW3A 3RPQA 5AIQA 2MLGA 1KQ0A 5ILVA 3LAPA 4A6EA 1IN4A 5FD6A 1ZRCA 2YR2A 5DUIA 4ZYGA 3U9GA 1R22A 3BJ6A 3WODF 1USSA 1G3YA 3G73A 5EEGA 4I01A 2QLZA 3SHFA 2MD5A 2IA1A 2XAFA 4KN7X 3I64A 1I27A 2Q0OA 1FYKA 2GQQA 1PDNC 4PCQA 1HW1A 4YIFA 1SD7A 3W6KB 1IF1A 2FU4A 1R1TA 2QVOA 2Z99A 4XLPF 5TJJA 3K0LA 1ONVA 1XMAA 5CVJA 1O7LA 1T6SA 3IWZA 2ZMEA 2ZKZA 2GA1A 3SXYA 2QUFA 1Z6RA 2HTSA 1W7PD 1JGSA 1KGSA 1SFUA 2EB7A 2ZO4A 2M1BA 5D4SA 2V6CA 4LMYA 2XV4S 3H3ZA 2A07F 1B9MA 5HS9A 2VC0A 1MDMB 5HVQC 3QP6A 1IN5A 4DNCA 4I2OA 2ACJA 1EH6A 5L3EA 3WTVC 2ESNA 3BP8A 3WU1B 1F5TA 5F6FA 4IXAA 1YS7A 4HLXA 3IKTA 2FE3A 2KIFA 2A6EF 1U3EM 1MKMA 4M9XA 3CTAA 2DT5A 5IT9K 2XUBA 4IJAA 1OKRA 3ERED 4HV5A 4UUVA 3RKXA 5LGTA 3KETA 3T8RA 1QGPA 3F23A 1J75A 1HSTA 1I6XA 1LDJA 2Y48A 3JAMZ 1STZA 3GVAA 3WE3A 3WTUC 3KLOA 5FLXK 3GX4X 4OMYA 3QP5A 1Z7UA 5D5WB 5DCMA 1OPCA 5D6FA 2VC1A 1U2WA 4EGZA 2RVCA 2QQ9A 2L4MA 4JQFA 2BEOA 5E20A 3MCZA 4F7ZA 3GO5A 3WTSC 1I1GA 4G7OF 3O2PE 3BDDA 3C7JA 3E6CC 4KFCA 5JVTA 1MD0A 6PAXA 2W85A 1W7PB 3V7CA 4U0YA 3LFKA 5HOOA 4KDPA 3WTZA 5L3GA 1YIOA 4MQ9F 2PQ8A 4HAMA 2E7XA 3VEPA 3QOPA 2GWRA 4UV9A 1LB2A 4RGSA 2LSOA 3HOTA 1U78A 1SFEA 2YSRA 4A5NA 3DQVC 5E18F 4IRGA 1ZGJA 1I1SA 2CWEA 3WG9A 4A0ZA 4H0EA 3DF8A 5HLGA 4GYGA 4YIIA 2MBFA 5ED4A 1J2XA 2FBHA 3ZQ7A 4IRHA 2G7UA 1FBUA 5KVRA 3ULQB 4AVPA 5LEJA 1JHFA 2JSCA 1HW2A 1K7AA 4HOBA 3NRVA 2LF7A 2KKOA 3LWFA 1RIOH 2PI0A 1G3WA 2BYVE 5D5VB 3HRMA 4GCVA 2O0YA 5H6RA 2J5PA 2QM3A 2QQAA 1Z9CA 1W5TA 3F8CA 3GUDA 3HSFA 4EJVA 2NNYA 1LVAA 3ZMTA 1J9IA 2CGPA 2OU2A 4NQWA 2DTRA 3E6MA 3KP5A 1R36A 1XCVA 1PUEE 5D5XB 1XDUA 3J80K 3SZPA 3WTXC 5DV5A 2XAGA 3I59B 4EVIA 5LHIA 1IRGA 4L18B 3JSOA 3HRUA 2PFBA 1U8RA 2Z9OA 4MHGA 1NHAA 3QRFF 3QPTA 1YW8A 3K69A 2VBWA 3R0JA 3GYHX 3B73A 2P5KA 5D5UB 3GFJA 3KEQA 3V7SA 3I54A 4AD9A 4UVAA 1XGOA 1W5SA 1ZH5A 3GZ6A 4WK8F 4FT8A 2JTVA 2EV0A 3L00A 5J8CA 4IVNA 3AAFA 1F4KA 1S29A 1P4XA 5BS6A 4A0YA 2EK5A 2RN7A 2HTJA 2FXAA 2L54A 3D5LA 3BROA 4UXNA 2HOEA 2VN2A 1MZBA 5HLHA 2V79A 2B0LA 4RAZA 3I58A 5L3BA 2Q2EA 2BV6A 3JAMK 4UVCA 2UZKA 1S3JA 2PLYA 2GXBA 4AIHA 5BPIA 3ABTA 2EFWA 1XGMA 3ZN1A 2A3SA 3MEXA 3K1NA 2D2WA 2RNJA 1R5HA 2XIGA 2F5CA 2K86A 4ZYDA 4EV0A 1KYWA 5ICCA 4RB2C 4LK1F 1WRJA 1PP8F 3SZTA 1FWZA 5CVVA 2MC3A 2VBZA 4LFUA 3CUQB 5LHHA 4L5JA 2KIMA 5DDGA 2ZMEB 4HQMA 1OYWA 3KFWX 3ABUA 2OD5A 2EA4A 3E5UA 4MQVA 1R5GA 4ZZLA 5K5QA 4KIGA 1Q1HA 3PQKA 1D5VA 2F5DA 4E70A 3L9FA 2ETHA 3EETA 1KYZA 4ZH4F 4TV7A 3T1BA 1S7OA 2QQBA 2NNNA 3G3ZA 5CVIA 3C18A 1OMIA 3LQQA 2XVCA 4KIFA 4Y13A 4LJZF 4BAYA 1QBJA 3E5QA 1YW9A 4G94A 4JBAA 4KMUX 4OINF 5JHUA 2FNAA 4EJWA 5HDNA 4IHSA 1AOYA 1UFMA 2OAZA 3HRTA 1IN8A 4HX8A 2P4WA 2FOKA 1YLFA 3RYPA 2V1XA 1ZLJA 4LD5A 3REOA 3WE2A 1CF7A 3CJNA 1LNWA 1O7FA 3U1DA 3ZMDA 2XKOA 1UHMA 3NQOA 2F2EA 4NHJA 4U7DA 5HDKA 3FXRA 3KLNA 1ZG5A 2G9WA 1LQ1A 2XKPA 3BJOA 2PEXA 4L5IA 3R0AA 3J81Z 3RPUA 1FP2A 2A68F 3LA7A 1H9TA 3TOAA 4CHUA 1MGTA 3GEZA 1EV7A 4UNOA 3PFIA 1BJAA 2P6SA 4HF2A 1W4MA 1O3RA 2DU9A 1DUXC 2W25A 1L3LA 3TQNA 1IUYA 3MFKA 4Q4ZF 1FLIA 2A6HF 5CYVA 2IJLA 3F22A 3B02A 1O3QA 4D0PA 5HLIA 2R7DA 3FXUA 2IA2A 2H6BA 3VOEA 3CDHA 1Z6TA 1F1ZA 4U0WA 2O03A 3QU3A 3MZYA 3WGIA 5AIPA 5DEQA 1T0FA 4L9JA 1J5YA 5F1RA 1SMYF 4ENJA 2P7CB 4LLGF 1DPUA 4P9FA 1BBYA 1QO0D 3C3WA 2HQNA 1ON2A 3F6VA 4HW0A 3M8FA 4FHTA 4M9SA 3H92A 4WCGA 5E17F 4KT5C 5FD5A 4WXDA 1DPRA 3MWMA 2K4BA 3E3VA 4A12A 2GAUA 2RV8A 1T39A 5L3CA 4ENNA 2ISZA 2TDXA 3O6BB 2HKOA 3LSTA 1Y0UA 4A2UA 2K27A 5LHGA 2CQKA 2A69F 4U88A 1J0RA 2XHKA 4A6DA 5ILUA 5FFZA 1REPC 1HBXG 3FM5A 3F8FA 4BH9A 3BOQA 5HS7A 4BNCA 3F21A 4XSZF 1WWXA 2HYGD 2JPBA 3EYYA 3TOBA 5J8FA 2QBYA 4MTDA 1XN7A 3CUOA 3GF2A 3I59A 1S7AA 3WTTC 4CICA 4BHPA 5A2QK 2P5LC 2PMHA 5FB2A 2ISYA 1JE8A 1OR7A 4WF2A 5CVUA 1B59A 1W7PA 1TBXA 4O5VA 4M9ZA 3L7WA 3HHHA 5H20A 3GLXA 3ISPA 1Z1DA 1BN5A 3PQJA 3ECHA 3JSPA 2FQ3A 3ZN0A 1Z05A 2PMUA 4A5MA 3GFMA 2GXGA 2X0LA 1FNNA 2UXXA 2OQRA 1XGSA 2KJCA 1FBSA 3Q9VA 1FY7A 3ML6A 2GZWA 3M9AA 4I7HA 4ESJA 3F8NA 3KP4A 1I5ZA 4OIPF 2OA4A 3E6DA 1HQCA 2V1UA 1RUOA 3M1EA 5FLXZ 4R79A 3FMRA 2LDUA 2WC2A 1TQIA 1H0MA 1G6NA 4L0YB 3F3XA 1YQAA 1E17A 2STTA 1HSJA 1BIBA 1FZPB 5HDGA 5CJ9A 2GIVA 3T5XA 2VBXA 4S04A 1YYVA 2HDCA 2O6GE 4YFNF 2HZTA 4HX7A 2K02A 2A5YB 5ILSA 3IRRA 1R1VA 5DUKA 3N97A 2W84A 4EJUA 4ESFA 2CG4A 4Q5SF 2HS5A 3Q5FA 4EGYA 1ZG3A 4GXOA 3M8EA 2EFNA 2OZ6A 4RGUA 4HDVA 2OQGA 2BE5F 1T2KA 3D0SA 3HOSA 2ADUA 2QBYB 4I98B 1KQ8A 2PG4A 1EH8A 2YX7A 2VBYA 3L2CA 1E2XA 2JPCA 2DK5A 2RDPA 1YFHA 1B1BA 4PGGA 3FWEA 1WI9A 5LRSA 1DP7P 3ECOA 4KA4A 1TQMA 3J80Z 2VONA 3VODA 3ZMVA 3P9IA 4LGWA 2D1HA 1SD6A 1LEAA 4ZYEA 2M5WA 4DQ2A 4G7HF 1S6LA 3BPXA 4AIJA 3NEUA 1TQPA 3V7RA 5D8KB 4LB5A 3ZMUA 3E5XA 4IPAA 2P8TA 2DQRA 5CLSA 1RZ4A 3ZP5A 3ELKA 3KZZA 3GW2A 3E97A 2MH9A 2QWWA 2IRFG 2QZ8A 5ERIA 1MDMA 1UB9A 4N0BA 4CXFA 1KU3A 2A61A 1FYMA 2QENA 1FT9A 3K1PA 4HLYA 4QWQA 4OIRF 3CO7C 4CYDA 3KEOA 1CF7B 4HDUA 2FBIA 1KQ9A 1BI2A 1UHWA 2J5OA 4BHBA 2LNBA 3DEUA 5A2QZ 2MH2A 1RI7A 2VOPA 3F6OA 2EFQA 4YG2F 4A0XA 3W6JB 5KK1A 1J59A 2F5EA 2FSWA 4HA8A 3TGNA 2YPRA 3DV8A 5JI6A 5E1WA 2HEOA 1K78A 3P9CA 2UWMA 4BXUA 4I02A 3TO6A 1OYIA 3I4PA 3FF5A 1ZG1A 1ZHFA 3QU6A 3TO7A 3R4KA 3TKYA 4G6DA 3N4MA 2CW0F 2MA3A 4HF0A 1ZRDA 3TO9A 2K4JA 1KA8A 4OU0A 3CUQA 2FF4A 5EEHA 2R3SA 2VXZA 5LGNA 4M6XA 5D6EA 1XSVA 4ETSA 2AS5F 4ZYHA 5L3FA 2DPDA 4L9NA 2DI3A 3IKVA 4FX0A 1B6AA 2FA5A 4HF1A 4PZJA 4EJTA 1OYYA 3RJPA 1FSEA 4MNUA 4EJOA 4ENKA 1H9GA 2Y75A 2E1CA 1YW7A 1U5TB 4M74A 3COAC 3T0YA 1XMKA 3KP3A 1WSUA 2OBPA 2XAJA 5DD4A 2HQRA 4EM0B 2MLKA 1SD4A 1ON1A 1FX7A 1VTNC 2ZXJA 1EH7A 2AXLA 1TTYA 3HHGA 3M7GA 4ZZDA 3GFIA 2M30A 3JTHA 1IXSB 4S05A 1WQ2A 2VT2A 3FXQA 2NS0A 4XLNF 4XBFA 3HTUA 2DQLA 2F5FA 4YFKF 4KNYA 3F72A 3KCCA 1IXRC 4EM2A 3CO6C 1SD5A 2HYFA 3ZMZA 3HYIA 4JK1X 2HGCA 2LF8A 2M87A 2KRFA 2P5VA 2FMYA 1IRFA 4ASNA 4P55A 2DAOA 3DPLC 4EMSA 4M72A 5E8GA 2ZFWA 3LA3A 4QLCU 5LBQA 5BQTA 1P4AA 5LGUA 1V3FA 1IN7A 1ZREA 3OV8A 3RDIA 1MJ9A 4MTEA 3I71A 4AWXB 4LG0A 2XRNA 3Q9SA 3FM3A 2G7HA 2ZJ2A 3RI4A 1HXDA 1YG2A 3H3UA 4B09A 3O3KA 3HIFA 2EV5A 5FFXA 3CUQC 5ICFA 3DP7A 4WXCA 2H27A 2IW5A 2Z33A 1O57A 4P9UA 4AIKA 3GFLA 1BI0A 4EM1A 1USTA 2P6TA 4ESBA 3P7NA 4XSXF 4ENMA 4RAYA 2RQPA 3BY6A 5JR3A 1R1UA 1RUNA 2CO5A 1AWCA 1QZYA 4UV8A 1B9NA 4M73A 1D3YA 1GVJA 1ULYA 4I0BA 3EDPA 4N9IA 5K5OA 4WWCA 4LLLA 2O61A 3IC7A 1G4DA 2VODA 2Z3YA 5K1YA 3IL2A 4YFXF 2E7WA 1K6OA 2OZUA 1BC8C 1ZLKA 3VFZA 3IRQA 5FO5A 4Y15A 3KZYA 3J81K 1YTYA 2CFXA 2STWA 4BYYA 4OIOF 3EUHA 1KU2A 3FHZA 3T8TA 1YO5C 2HR3A 2XAQA 2IP2A 1TW2A 3IWFA 3LQRA 3TDZC 2D45A 1R23A 1K78B 3R6SA 2NAZA 3F8BA 2W57A 3WTYC 4G8XA 4BHCA 2V9VA 3K9TA 2W24A 2DW4A 1ZARA 5ICEA 2E1NA 2EFPA 3QPHA 1BI3A 1B4AA 4Y17A 3HUGA 4R8HA 2K7LA 1KU7A 1ZGAA 1HKTA 1IW7F 1G3SA 1KU9A 4G6QA 3I53A 2JRTA 4CGZA 3FMSA 3IHUA 3KP6A 5D8LB 2LKPA 3SQNA 4WXHA 4U7BA 1JXSA 4GO1A 3RTRA 1LDDA 2IA0A 2Y0MA 4R1HA 4IHTA 4HYEA 1XGNA 2IT0A 3WGHA 1P92A 5BOXA 4RB3C 5DCFA 2RC4A 3MZHA 1A04A 2XAHA 3L09A 1T38A 1UCRA 3I5UA 5FGMA 5BPDA 4MGRA 3WU0A 4O3MA 1T98A 4Q47A 1K79A 4L9VA 2FMLA 3KP2A 4B8XA 2UXNA 2ZNYA 2YX4A 1C0WA 4OOIA 4GYIA 4EQQA 4OMZA 4I0AA 2M45A 5HS8A 1ODDA 4BQAA 1U6GA 3HSRA 2VE8A 1S8NA 2JZYA 2RGVA 2H09A 2C6YA 1R00A 2GA2A 2M8EA 4KIBA 1GXQA 1QNTA 1IN6A 2DK8A 2DBBA 3BZ6A 4KICA 3V8LA 4Z2YA 5LEKA 2VOOA 1XCBA 4HBLA 1TLHB 2D1VA 5K5RA 2HFHA 4O6JA 4I09A 2P7VB 2ELHA 2BBYA 2L01A 1CGPA 2NYXA 2IVMA 3ZMSA 1QPMA 2FNPA 4U0VA 3F8MA 3GXOA 4P96A 2VE9A 2WV0A 2Q8KA 4RGXA 4PGHA 5BMZA 5E1XA 2FEZA 4G7ZF 1XDSA 1U5TA 3RIRA 3DXJF 1R58A 3LAJA 4NB5A 3JTGA 4CDGA 3E6BA 3DFGA 3I0TA 2QYOA 3K2ZA 4IF4A 1IZ1A 4RB0A 2WTEA 3MAJA 3ROUA 1FOKA 3CLOA 2KJBA 3FX3A 1U5TC 2R7FA 2JT1A 1BIAA 1LJ9A 3GZ5A 1L0OC 4WX9A 1HKQA 1TNSA 5F64A 1IAWA 3HTSB 3EYIA 3LA2A 4KMFA 4L9TA 4XRFA 1DDNA 3DPTA 4L0ZB 3J7AO 2FBKA 1FSHA 4FX4A 3OOPA 1XSDA 1QQIA 3K1MA 2Z5UA 2ZNZA 4LLNA 2V1DA 3MQ0A 3RKYA 1IXCA 2DO7A 1XD7A 2YU3A 2VT3A 3JW4A 2X4HA 1BI1A 3KE2A 1MJBA 3KP7A 3QAHA 1X3UA 5LRRA 1ZRFA 3ZPLA 1O3TA 4IRIA 1D8JA 4KUMA 3SFZA 3TDUC 1P4WA 4P5OA 2CYYA 3HSEA 3WTWC 1FP1D 2CSOA 2L02A 3GWZA 5TRDA 2PJPA 2O3FA 1ZYRF 5DYMA
chains in the Genus database with same CATH superfamily
4M3EA 3FZVA 4A3EJ 2O7OA 4Q48A 1EKEA 2KPMA 4CO8A 5J1YA 2DPUA 1A6IA 1MBFA 2JN6A 2QCOA 1V54H 2OUMA 5JFRA 3JRGA 1U9OA 3H0DA 1ETKA 4PUSA 1SFXA 1O3SA 2H6CA 2JA6J 4LB6B 1LDKB 3FMQA 3G4SI 3R61A 3BJAA 2CV0A 1X19A 4DBRA 1NTCA 1ZAOA 2DMTA 1FC3A 3WG7H 4M71A 4MEYF 2HOTA 2H94A 3RKWA 1HW5A 2ESHA 4HQEA 5IT9Z 2XGXA 2L4AA 1SAXA 1GXPA 2CW8A 2ZBKA 1FPQA 1E0EA 2PN6A 3TP0A 1GHCA 1LPQA 5AONA 4XLAA 3ZQCA 1N25A 2DA5A 2HKXA 1P2FA 1R7JA 1IG7A 4PDKA 1LUJB 4HX4A 4ON0A 4XIDA 3H9GA 2COBA 3W2WA 2COMA 2O8XA 2XROA 1HKSA 2Q1ZB 4KISA 5E3LA 2QSHX 1D8KA 1RPWA 4PFPA 3U21A 2EV6A 2HDWA 4RGRA 1JT6A 1P6RA 2LH9A 2M9HA 1IV8A 2QKMB 3G1OA 3S2WA 1Y1WJ 1FYLA 3K70D 3FK7A 4N9HA 2LLKA 4XLHA 1R4NB 4KN4X 2FRHA 5DD8A 2K3PA 2L3DA 4RBOA 1J7KA 2EWNA 2EJRA 4G9YA 4K2EA 4II2A 1JHHA 1FMWA 4OIQF 3RQ4A 3DLAA 1WKMA 2YUSA 4GGGA 4AYBN 2OTJI 2DLLA 1RNLA 5LLQA 1UHSA 3CJTB 3BPVA 5IPAA 4CA0A 1XSXA 3V8KA 3WGGA 1PP7U 2KIUA 1G3TA 5H6QA 3QYBA 2KZVA 4CCNA 1SFOJ 3EQLF 1Z91A 3B6AA 4LK0F 5L3DA 1F9NA 4MEXF 2K5CA 4HV6A 1K4SA 4DIQA 2XF6A 2RKHA 1TNTA 3HKZN 5IT3A 3LSJA 4UY8I 3SYTA 5CVRA 1BM9A 1R4MB 1SVLA 1V4RA 3CJQB 2NRAC 3K4NA 4XOTA 1MNEA 4ZTJA 4P1WA 1V5EA 3BWGA 3S16J 1XB4A 5CQEA 2VJ4A 1YS6A 1N77A 3DBLB 2VKHA 1WJAA 2X6WA 4HZFA 3H1CA 2WWYA 4BE2A 3R60A 1P7IA 2R7RA 1W1WE 3U2RA 2HXIA 1D0ZA 3PUBA 2XPWA 1QZZA 5HODA 4PFOA 1MMNA 2TCTA 2HU9A 5E8IA 4CZZA 1BC7C 3FKJA 2IPQX 1MJAA 1S7EA 1XG1A 4RS8A 2HWVA 3BR2A 3ZRGA 1BOAA 4QTRA 3HRSA 2PBIA 1MSEC 3PJRA 4LG0B 3DKWA 3BG7A 3UR3C 3RYRA 1FBQA 3C1DA 3OYCA 3P9KA 2DFIA 4XL9A 1SMTA 5J6XA 3MKLA 1IO2A 1VF9A 1OCOH 2EFOA 4HSRA 2EA2A 3VB2A 4D5FA 5ICGA 5D4RA 2XASA 4KYWA 4RB1A 1Y1VJ 2FUG2 5E1ZB 4UHTA 3V8JA 4UVBA 1Q1VA 4JYKA 3OS2A 2CRGA 2HDDA 1LEBA 4II3A 2VKVA 2CUEA 2DA3A 2BGCA 3HPHA 2CV1A 5DCMB 3V4GA 2ZCWA 4M6YA 2JA7J 3NARA 1ZN2A 1TW3A 3HB9A 3ZQHA 2DDBA 2MC4A 1TP4A 3JRFA 1Z77A 2V9PA 3RPQA 3KZIC 5AIQA 4QSHA 1SVMA 2X51A 2MLGA 3NWTA 3DBRB 3L2UA 1KQ0A 1MBGA 5ILVA 3LAPA 4A6EA 1IN4A 3RZOJ 4A3DJ 1MW7A 1I50J 5FD6A 2DOEA 1NK2P 2YR2A 4NQWB 1ZRCA 3BC8A 5DUIA 4ZYGA 1N78A 4XMYA 3U9GA 1RC9A 1R22A 2ZJQF 3BJ6A 4CSWA 3WODF 1USSA 1G3YA 3G73A 1RR8C 2M7BA 5EEGA 4I01A 5GAEJ 2QLZA 5IOZA 3L2VA 1ERDA 2V7FA 2MD5A 1U0JA 2IA1A 2XAFA 3SHFA 4KN7X 3I64A 3S14J 4S0HB 1I27A 2Q0OA 1FYKA 1OLTA 2GQQA 1YE9A 3VYUB 1PDNC 4PCQA 3F9KA 1V5GA 1HW1A 1MMDA 1ZYRF 4YIFA 1SD7A 3W6KB 2IGMA 4PJLA 3TW7A 1IF1A 2FU4A 2W7NA 1R1TA 2QVOA 2Z16A 2Z99A 4XLPF 2O5RA 5TJJA 3K0LA 3E1SA 1ONVA 3X2QH 1XMAA 1O7LA 5CVJA 3BG5A 1W0UA 4UUSA 5C4JJ 3OL4A 1X3WB 4IQ4A 1T6SA 1TL8A 3KPHA 3IWZA 2ZMEA 2ZKZA 2WB1A 2DTZA 2GA1A 3SXYA 4IZZA 1OQYA 2QUFA 3PFYA 4FTHA 1Z6RA 1WH7A 2HTSA 1W7PD 2AHQA 1JGSA 3HOZJ 1KGSA 1AA7A 2E1MB 3KYDB 1SFUA 5IYDJ 2EB7A 2ZO4A 2M1BA 1DGWY 5D4SA 2V6CA 1X4OA 1I6HJ 2F4MB 3WHBA 4LMYA 1K61A 3OY9A 2XV4S 3H3ZA 2A07F 3CF5F 1B9MA 5HS9A 3M4OJ 2VC0A 4LG3A 2K3FA 1MDMB 5HVQC 3QP6A 2Z1DA 3A0HC 4NDLA 1IN5A 2ECBA 4DNCA 2VJJA 4I2OA 2UV1A 2ACJA 3AG1H 1EH6A 2XB0X 5L3EA 3WTVC 5F04A 2ESNA 3BP8A 3CMMA 2QEXI 1G8XA 2L9RA 3IAS2 5TGTA 3WU1B 2LY9A 1F5TA 5F6FA 4IXAA 3DPUA 2VKDA 1YS7A 4HLXA 2CJJA 2DYSH 3IKTA 2FE3A 2KIFA 2A6EF 4QPQA 1U3EM 1MKMA 4M9XA 4OAZA 3L2WA 3CTAA 2DT5A 1Z3YA 2XUBA 4IJAA 4JP0A 1OKRA 3ERED 5IT9K 4HV5A 5F27A 2QKLB 4UUVA 3RKXA 5LGTA 3KETA 1AKHA 3T8RA 3GTQJ 1QGPA 3F23A 1JTYA 1J75A 2CS3A 1HSTA 2R7QA 3IAM2 1I6XA 3OYBA 3TW6A 1T8IA 1GV2A 1LDJA 1T56A 2E36A 2Y48A 4J01A 4XKCA 3JAMZ 3BQZA 1STZA 3GVAA 1QRYA 3WE3A 3WTUC 2DJNA 3KLOA 4X0GA 1TWCJ 5FLXK 3G71I 3GX4X 3I55I 2DMUA 2PX9A 4OMYA 3QP5A 1Z7UA 5D5WB 4J00A 5DCMA 1OPCA 5D6FA 4EEFG 1H88C 2VC1A 4E7KA 1U2WA 4PJ0C 4XOPA 4EGZA 2RVCA 1RESA 3FXKA 2QQ9A 2L4MA 3MKWB 4JQFA 2BEOA 5E20A 1VQMI 3DKXA 5H2FC 3ZCOA 3BTLA 2XSDC 1LVKA 3MCZA 1OISA 4XRSG 2I5UA 4F7ZA 3GO5A 3BZKA 3WTSC 1I1GA 2WAFA 4G7OF 2NOJB 3O2PE 1T33A 3BDDA 3C7JA 3E6CC 4KFCA 5JVTA 1MD0A 2KIQA 4NNJA 3S1NJ 1QHGA 6PAXA 2W85A 1W7PB 3V7CA 4CCLA 5FLVA 1BOBA 2Z2SB 3K4CA 3PIOF 4U0YA 3GLLA 3LFKA 3CMYA 2WY7Q 5HOOA 4KDPA 4ZTFA 2QF7A 1OCCH 2MYSA 3WTZA 2LVSA 3HZJA 5J47A 5L3GA 3J7ZI 1YIOA 2DOAA 4MQ9F 1K83J 2ZC2A 2PQ8A 4HAMA 5B5EC 1TWAJ 4BXFA 3CDLA 2E7XA 2M3AA 3VEPA 3QOPA 4PSXA 2GWRA 3RSNA 4UV9A 2BZTA 2DOFA 1YRNB 2JRMA 2QSFX 4AVZA 3BQYA 1LB2A 4A3LJ 2CV2A 4RGSA 2LSOA 3V42A 3HOTA 1U78A 1SFEA 2LFBA 2YSRA 4XM3A 1JTXA 4A5NA 3DQVC 5E18F 2K85A 4IRGA 2JA8J 1X1DA 2QGUA 1ZGJA 3CCLI 5GADJ 1I1SA 5GAGJ 2EZKA 4FASD 2CWEA 3WG9A 4A0ZA 4H0EA 1B72A 3OWTA 2L7FP 3DF8A 2VQHA 5HLGA 4GYGA 4YIIA 2MBFA 1VNDA 5ED4A 2KQRA 1J2XA 2FBHA 3ZQ7A 4IRHA 2CMPA 2NXNB 2G7UA 1FBUA 5KVRA 2LD5A 3ULQB 4AVPA 5LEJA 1JHFA 2JSCA 1HW2A 1K7AA 1BA5A 2E60A 1X3ZB 2Y69H 3W3CA 4HOBA 3NRVA 2E71A 2LF7A 1ACIA 2KKOA 2M0CA 3LWFA 2M2EA 1RIOH 2NVXJ 1G3WA 3CESA 4DYCA 2BYVE 2PI0A 3HOUJ 1G2HA 1JKOC 3EUKL 5D5VB 3HRMA 2BY1A 5IY5H 3FHNA 2VJ5A 2MD0A 4GCVA 2O0YA 4BY7J 3TBIA 2GOMA 5H6RA 3OYLA 4RAFA 2B7EA 2EINH 2XGEA 2J5PA 5M5XJ 4B47A 2KRCA 2QM3A 2QQAA 3IUOA 1Z9CA 1W5TA 3F8CA 3GUDA 3PSFA 3HSFA 3LSMA 4EJVA 2NNYA 2Y30A 1LVAA 1ENHA 3ZMTA 1J9IA 2CGPA 4PK4A 2OU2A 1TWFJ 4NQWA 3S1MJ 2DTRA 3E6MA 2XPVA 3KIOA 3KP5A 2R5ZB 5JLWA 2R4GA 1R36A 2R7UA 4X6AJ 3H36A 1QVUA 1XCVA 5IYBJ 1PUEE 1VQ9I 2EIMH 1FEXA 4IEJA 2DA6A 4A3JJ 1WCMJ 5D5XB 1XDUA 3LSHA 4DYQA 3J80K 3SZPA 3WTXC 5J1UA 5DV5A 1Y8QB 2XAGA 3I59B 4EVIA 2CQNA 1HCRA 5EG0B 5CPRB 2DN0A 3CQZJ 5LHIA 1YI2I 2HVRA 2HNHA 2I10A 4BU2A 2XC7A 1AU7A 1IRGA 1R9TJ 4L18B 3BTJA 3JSOA 3HRUA 2PFBA 5GP9A 2ME0A 3OYGA 4IHYA 1U8RA 2Z9OA 1DQUA 2ZXHA 4MHGA 1NHAA 3H5RA 3K4KA 5FLMJ 3QRFF 3ZXSA 4D7MA 4XN3A 3FKIJ 3QPTA 3BR3A 5IOYA 2ZSHB 1YW8A 3L1PA 3IH4A 1MIJA 4D5CA 3K69A 3PUFA 1W36D 2A05A 2VBWA 3R0JA 2R7VA 3GYHX 3B73A 3CCYA 5EEAA 1ORKA 3FK6A 4FE7A 2P5KA 3NWSA 5D5UB 3GFJA 1LKXA 3KEQA 4HEA2 3TEDA 3S3OA 3V7SA 3I54A 4AD9A 1FIPA 4UVAA 1XGOA 3TP3A 1W5SA 3BCBA 3FXLA 2Y9ZA 4GFBA 2E5ZA 2GIZA 1XPXA 2WBMA 3MMYB 1ZH5A 3ZR8X 4J19A 3GZ6A 5B1BH 4B48A 4WK8F 4FT8A 4BEHA 2JTVA 5EZHA 2EV0A 3L00A 2VPRA 4XKVA 4JX5A 5J8CA 2Y0SN 1JKQC 4IVNA 2PMZA 3AAFA 2IS4A 4XKBA 1F4KA 2MFZA 1S29A 2JA2A 1P4XA 3RQIA 3M07A 5BS6A 4A0YA 2EK5A 2G0EA 2RN7A 1U8BA 1D1BA 5C4XJ 2HTJA 2FOWA 2FXAA 1A5JA 4DZPA 4HPQA 2L54A 3D5LA 3P5JA 4HNTA 2EILH 2O8KA 3BROA 4XLFA 1FOXA 4UXNA 2CUZA 3ZQIA 2HOEA 2DDAA 2LBFA 2VN2A 4E6KG 1EJ9A 1MZBA 5HLHA 3VDXA 2V79A 1MMSA 3MN2A 2DFFA 2B0LA 3PIPF 4RAZA 3H9JA 3I58A 5L3BA 2Q2EA 3VYTB 2BV6A 2HOAA 3JAMK 3S3MA 4UVCA 2UZKA 1S3JA 2PLYA 3HM5A 2GXBA 4AIHA 4E7JA 3ABTA 5BPIA 1LFPA 2EFWA 1XGMA 3ZN1A 3PL8A 1A6QA 2A3SA 3G1MA 1H89C 4C3JJ 3HKZA 4ZJZA 3MEXA 5F0CA 3K1NA 1X58A 4QPOA 2D2WA 1Y6IA 2RNJA 2A6TA 1R5HA 2XDVA 2XIGA 1Z0XA 4RM2A 2R5YB 4C9YA 2F5CA 2K86A 4ZYDA 3H9QA 4EV0A 1MNMC 5FKOA 3DTKA 1KYWA 1O4XA 4IHVA 5ICCA 1MSFC 4NC7A 4XQFA 4BBSJ 4RB2C 4LK1F 1WRJA 1VQ6I 1JI8A 1PP8F 2XRLA 1ZKGA 3SZTA 1FWZA 4CCMA 1WJ5A 5CVVA 2BY2A 4BJ6C 4PJNA 1J09A 4MO7A 2GBYA 2MC3A 2VBZA 4LFUA 5FROA 3JRDA 3CUQB 5LHHA 4L5JA 2KIMA 4E7ZA 5DDGA 4I76A 1QA6A 2ZMEB 3I4NJ 4HQMA 1OYWA 1X1PA 2JK3A 2CFOA 4M3BA 3KFWX 3ABUA 2H1KA 2OD5A 2KZGA 2EA4A 2ZFUA 3E5UA 2BHZA 1Z3XA 3RZDJ 4MQVA 2VQLA 3IP4B 1R5GA 3IH3A 4ZZLA 5K5QA 1GV5A 4KIGA 1Q1HA 1H8AC 1QU3A 2L7MP 3PQKA 1T95A 1D5VA 2KLOA 2F5DA 4E70A 2AXTC 5K7HA 2DA7A 3L9FA 2R7ZJ 5J40A 2ETHA 3EETA 4DYRA 2EBIA 2K9SA 1KYZA 4ZH4F 5C44J 4TV7A 3T1BA 5JVGF 1NK3P 1S7OA 2DJIA 2NNNA 2QQBA 3SJMA 2A5WA 3CCMI 1LE8A 3G3ZA 4GRIA 5CVIA 3W2AA 4OAYA 3C18A 1OMIA 3LQQA 4XNFA 1B72B 2XVCA 3QPSA 3BR6A 4KIFA 4Y13A 3TL4X 1BR4A 2IS6A 4LJZF 1K6YA 1SAUA 4BAYA 1YJNI 1QBJA 3E5QA 1YW9A 4G94A 4JBAA 2K9MA 4KMUX 1FOYA 4OINF 2GLOA 5JHUA 4CCJA 2R92J 2K9LA 2KMUA 4B4CA 1R71A 2FNAA 4EJWA 2RAEA 3AG4H 5HDNA 4IHSA 1AOYA 1UFMA 2OAZA 3HRTA 2KDOA 1IN8A 4HX8A 4M3GA 2P4WA 2XF5A 2FOKA 1YLFA 3RYPA 2V1XA 1G59A 2CQ7A 1ZLJA 3OR2C 4LD5A 5CQGA 4F52A 2ZSIB 3ESWB 4CCOA 3REOA 3WE2A 1CF7A 3ABKH 1ETOA 3CJNA 4XKWA 1LNWA 1O7FA 3U1DA 2DCEA 2ID6A 3ZMDA 1GDTA 2XKOA 4BS9A 1UHMA 3NQOA 3CCQI 2F2EA 1IV6A 2RNGA 4NHJA 3OOUA 4U7DA 2L7ZA 5HDKA 3FXRA 2Y2ZA 3KLNA 1ZG5A 1B8IA 2G9WA 1LQ1A 2GXAA 2XKPA 5J1RA 3BJOA 1IGNA 2PEXA 4L5IA 3R0AA 3J81Z 5TISC 3RPUA 1FP2A 2LP0A 3QYFA 2EIKH 3LSPA 5M3FJ 2A68F 3LA7A 3A1YA 1H9TA 3NAUA 5FRNA 3TOAA 4CHUA 1MGTA 3GEZA 1EV7A 4UNOA 3PFIA 1QHHD 1BJAA 1X1AA 3A03A 2P6SA 4HF2A 1W4MA 1O3RA 4G12A 1UMQA 3VYSB 3AL0C 1R6RA 2DU9A 4FCYA 2W25A 1DUXC 1L3LA 3TQNA 1IUYA 3MFKA 3K4BA 4Q4ZF 1FLIA 2A6HF 5CYVA 1E3HA 2IJLA 4XONA 5EG0A 5KHDA 3F22A 3LL7A 4F92B 3CP8A 2LK2A 2ID3A 3B02A 2WADA 2WY8Q 1O3QA 3GTLJ 4XLEA 1TWHJ 4HNUA 4D0PA 4E4HA 5HLIA 2R7DA 4F93B 3RCOA 3FXUA 4LIUA 2IA2A 4CUGA 2H6BA 2ZXWH 4IX7A 3VOEA 2ECCA 3CDHA 4MIMA 1Z6TA 1F1ZA 3UKGA 3S3NA 4U0WA 2O03A 3QU3A 1W5CC 1XTAA 3MZYA 3WGIA 5AIPA 5DEQA 1T0FA 4L9JA 2R93J 1J5YA 2X9DA 3S1QJ 5F1RA 3OR1C 1SMYF 2HQ5A 2L2OA 1OFCX 1FIAA 3SEZA 3SZGA 4FE4A 4ENJA 2P7CB 4LLGF 2XSJC 2WB1N 1Y56A 4H4KC 1DPUA 2EZHA 3BG3A 3OIOA 4P9FA 1BBYA 4BQQA 1QO0D 1MMGA 3C3WA 2HQNA 4W1UA 1ON2A 1PUFB 1IDYA 3A01B 3A02A 2V1NA 4BEHB 3F6VA 4HW0A 1Z7LA 3M8FA 4JOMA 1F43A 2HI3A 3LSKA 1FMVA 4FHTA 1OCTC 4DZJA 4M9SA 5EF6A 3H92A 2MG4A 4WCGA 5E17F 4KT5C 2V6EA 2KT0A 3FBNB 5FD5A 1W36C 4WXDA 1DPRA 2JJ7A 3O8GA 4BUPA 2HVSA 3MWMA 2JSPA 2K4BA 3RKQA 3E3VA 4A12A 3QODA 2GAUA 2RV8A 3OL3A 1T39A 2E1OA 5GPAA 5L3CA 3D5RC 2XB5A 3FXJA 2UUZA 4ENNA 2ISZA 2TDXA 4D7NA 3O6BB 2HKOA 1E3PA 5B66C 1R5ID 3LSTA 5E79C 1Y0UA 4A3CJ 1P7JA 2HXOA 4Y3OA 4A2UA 2K27A 5LHGA 3DTEA 2CQKA 3K70C 2V4JC 2A69F 4U88A 4YELA 1YITI 1J0RA 2XHKA 4A6DA 1AKHB 1LFUP 4BGDA 4F55A 5ILUA 1ZTRA 5FFZA 1REPC 1HBXG 3CJRB 3FM5A 2CH0A 2LR8A 3F8FA 4BH9A 3GTOJ 3BOQA 2HQAA 2FQ4A 3OYNA 4AIDA 4C2MJ 3GTMJ 5HS7A 4BNCA 3F21A 2W4SA 1MBEA 4XSZF 1WWXA 2HYGD 3DU6A 4B1RA 4BE1A 2JPBA 3EYYA 3QYEA 3TOBA 3OYAA 5J8FA 2QBYA 2N8GA 3K4JA 2K9NA 2M4KA 1ZQ3P 4MTDA 1WVRA 2EZIA 1XN7A 3CUOA 3GF2A 4FISA 3I59A 4UB8C 1S7AA 3WTTC 2F5VA 4RMNA 2VB6A 3ONQA 3DCFA 4JX4A 4CICA 4BHPA 5A2QK 2ZJPF 2X48A 3ZQLA 4EATA 2P5LC 2PMHA 3BTIA 5FB2A 2RREA 4G6TB 2ISYA 3FIWA 4Y4RA 3CZ6A 1JE8A 1OR7A 5LD2C 3H0GJ 4WF2A 5CVUA 2W1OA 1B59A 3GCMA 1W7PA 1TBXA 2R7OA 4IQJA 4O5VA 2NVTJ 4M9ZA 2H1LA 3L7WA 2DMNA 3JCUC 3HHHA 4FQGA 5H20A 3GLXA 1Y39A 2VQCA 1D0YA 3ISPA 3BTCA 1WJFA 1JJ8C 3DLLF 1Z1DA 4M3FA 1RRJA 1BN5A 3PQJA 3ECHA 3JSPA 4PJJA 2FQ3A 3ZN0A 1Z05A 2E2IJ 2PMUA 1M1EB 4A5MA 3OYKA 2VJIA 3FBIB 3GFMA 2GXGA 2X0LA 1FNNA 3MZ8A 2UXXA 3EPZA 2X1DA 2OQRA 4AM3A 2LREA 1XGSA 3CCJI 2KJCA 2X1EA 1FBSA 3Q9VA 1FY7A 3ML6A 2LKXA 2GZWA 1VQNI 3M9AA 4I7HA 1JUMA 4ESJA 4IHXA 2JMWA 2F4IA 2LY1A 3F8NA 2VKEA 1JT0A 3KP4A 1I5ZA 2VASA 4OIPF 2OA4A 3E6DA 3S2DJ 1HQCA 2V1UA 1RUOA 2ZXIA 3M1EA 3MKYB 1IC8A 1WJDA 5FLXZ 4R79A 1GLNA 1XX5A 2L0KA 3FMRA 1GUUA 2LDUA 2WC2A 3BZCA 1TQIA 1H0MA 1G6NA 3QOEA 4L0YB 4JX6A 4B43A 3F3XA 3RPUD 1YQAA 2NVYJ 1E17A 1VQ5I 5KAFC 2STTA 1HSJA 1BIBA 3PNYA 1FZPB 2XGCA 2ICWG 1PYVA 2E35A 5HDGA 5CJ9A 2DA2A 3S2HJ 2GIVA 3T5XA 2D5VA 2VBXA 1VQOI 1HF0A 4S04A 1YYVA 3JRCA 1ZR2A 1UZCA 4IL6C 2LRDA 1X4PA 3KEYA 2HDCA 1NH3A 3HPGA 5HNFA 2O6GE 3W2VA 4YFNF 2HZTA 4HX7A 2K02A 1K4TA 3HOVJ 2A5YB 2DT7B 5ILSA 2IAIA 3IRRA 2F4OB 1R1VA 5DUKA 1A36A 3N97A 2W84A 2B63J 4EJUA 4ESFA 2CG4A 4Q5SF 1IRXA 2HS5A 1CQTA 2DMQA 3J7YJ 1BR1A 2WV1A 3Q5FA 4EGYA 1ZG3A 1VQ8I 4GXOA 4Y52J 3M8EA 3IH2A 1YX3A 1IUFA 2EFNA 4PSWA 1Z67A 2OZ6A 4RGUA 4HDVA 2OQGA 2BE5F 4U87A 3VSLA 4XR6A 1SEUA 1T2KA 1S9HA 3D0SA 5K7ZA 3HOSA 1WFXA 3HOWJ 2ADUA 2QBYB 4I98B 1KQ8A 2PG4A 1EH8A 2YX7A 2VBYA 3L2CA 1E2XA 2JPCA 2DK5A 2RDPA 1YFHA 1B1BA 5FRMA 4PGGA 3FWEA 4QIWN 1WI9A 3CMEI 3C2GA 5LRSA 1DP7P 3ECOA 2H8WA 3D1NI 4KA4A 1TQMA 3J80Z 3SDBA 4BY1J 2VONA 3VODA 3ZMVA 4W97A 3CCVI 3FISA 2MSYA 3P9IA 5IP6A 3PNTA 4LGWA 2D1HA 1SD6A 1LEAA 1RKTA 4ZC3A 4ZYEA 2M5WA 4DQ2A 1LE8B 2ZMEC 1QPIA 1XS9A 5DM7F 3JR9A 4G7HF 1S6LA 3L2RA 2M7AA 3PM1A 3BPXA 4AIJA 1EA3A 2M0MA 3N05A 3S15J 3NEUA 1TQPA 3LSIA 3V7RA 1YIJI 3ASOH 4IOAF 5D8KB 4LB5A 1SFKA 4LIVA 2VIXA 3CF2A 3ZMUA 3E5XA 4IPAA 2IS2A 2P8TA 2DQRA 5CLSA 1RZ4A 3ZP5A 1N75A 2RQQA 2EH3A 3ELKA 3KZZA 2NVUB 3GW2A 3BG9A 3E97A 4MFEA 3PO2J 1MH4A 1JKPC 2MH9A 2QWWA 2IRFG 2QZ8A 5ERIA 1MDMA 1UB9A 2KL4A 4N0BA 4CXFA 1KU3A 2A61A 1FYMA 2HOSA 1UG0A 2QENA 1E3OC 1FT9A 3G1LA 3K1PA 3OIPA 3CC2I 3S17J 4HLYA 4QWQA 4OIRF 2OCCH 4HRIA 3CO7C 2ZB9A 4CYDA 1HDDC 3DU5A 3KEOA 1YX5A 2BXYA 2L9SA 2R7SA 3EUHC 2ELJA 4AC0A 5F0FA 1CF7B 3H3VK 4HDUA 2FBIA 3U1KA 2BVLA 1KQ9A 5CKTA 1BI2A 3KYLA 2R5YA 2AQEA 1UHWA 2J5OA 4BHBA 2LNBA 1V5FA 3DEUA 3LFUA 5A2QZ 2MH2A 1RI7A 3FXMA 4I99C 5DM6F 3M1CA 2BW3A 1B8IB 3C2BA 3S93A 3L2QA 2VOPA 2OV7A 1Y8RB 4KT6A 3F6OA 2CW7A 2EFQA 4YG2F 1X2MA 4A0XA 3W6JB 3OS0A 5KK1A 1J59A 1XMXA 2EZLA 5FKMA 1BW6A 3A2KA 2X6YA 2YU9J 2FX0A 2F5EA 2XF7A 2FSWA 1NG6A 3M8JA 4HA8A 3TGNA 2YPRA 3DV8A 3K2AA 5JI6A 4RDUA 5E1WA 2HEOA 1K78A 1W0TA 2L7KA 3P9CA 2UWMA 4BXUA 2X85A 3G2BA 4I02A 3TO6A 3JRIA 1OYIA 3I4PA 3FF5A 1HLVA 1ZG1A 1NG7A 3OYFA 4MFDA 1ZHFA 2BY3A 2LY2A 3QU6A 3TO7A 4IKFA 4BL0B 3R4KA 3H5NA 3TKYA 2LG4A 4G6DA 3N4MA 3HGYA 5F08A 2AQFA 1WGXA 3BR1A 2CW0F 2X6OA 2MA3A 4HF0A 1ZRDA 3TO9A 2K4JA 1KA8A 3SEQA 4OU0A 3Q0VA 3CUQA 3DKYA 2OPTA 4HSTA 1X2NA 1SC7A 2CQXA 3H35A 2FF4A 4XRMA 3B6CA 5EEHA 4HNVA 2FD5A 2R3SA 2VXZA 1RETA 5LGNA 5DTDA 3AKZA 4M6XA 5D6EA 1XSVA 3LSGA 4ETSA 1UJ8A 4BQNA 2I8DA 5C3EJ 4ZYHA 2AS5F 5L3FA 2IEKA 2DPDA 4L9NA 2DI3A 3IKVA 4FX0A 4DOZA 1BR2A 1U9NA 1B6AA 2FA5A 2LYCA 2XGDA 3BR5A 3K4MA 4RA2A 4HF1A 1BL0A 5EJCA 1ITYA 2CU7A 4PZJA 4EJTA 1OYYA 1FTZA 3RJPA 1FSEA 4ANJA 5EGOA 4MLOA 3BR0A 4MNUA 3DBHB 3Q0UA 4EJOA 4ENKA 4A3KJ 1H9GA 1OJLA 2Y75A 5KNLA 1PVEA 2E1CA 4YEJA 1YW7A 1U5TB 3QPLA 2OCEA 1Z21A 4M74A 3COAC 3T0YA 1JJ6C 2EIJH 1XMKA 3KP3A 2XPUA 4DJAA 1WSUA 1DU6A 1S72I 2OBPA 2XAJA 3ERMA 5DD4A 2HQRA 1D1AA 4EM0B 2MLKA 2CUFA 1SD4A 1ON1A 2JUCA 1FX7A 3DTIA 4CH7A 1VTNC 2ZXJA 5GAHJ 3WU2C 1EH7A 5E3MA 1VI0A 2AXLA 1TTYA 3HHGA 4BDZA 3CP2A 1MBKA 4F3QA 2BW3B 3M7GA 4ZZDA 3GFIA 2L9VA 1TC3C 3CCEI 4C2TA 2R7WA 2M30A 3JTHA 1IXSB 1D0XA 3Q3SA 4S05A 3HDDA 4ZDOA 1YOVB 3ASNH 2V26A 1WQ2A 2VT2A 2P81A 4A3FJ 4A3BJ 3FXQA 2NS0A 4XK4A 4XLNF 4XBFA 3HTUA 5KCMA 2DQLA 2F5FA 4YFKF 4KNYA 3F72A 2ME6A 2GM4A 3KCCA 2E5NA 5F1JA 3VSKA 1A31A 1IXRC 4EM2A 3CO6C 4L5EA 2HPMA 1SD5A 2HYFA 3ZMZA 3HYIA 3TMOA 4JK1X 2HGCA 1I3QJ 2LF8A 2M87A 2KRFA 2P5VA 2FMYA 1IRFA 1APLC 4ASNA 1A35A 5J4YA 5FJ8J 1YJWI 4P55A 2F48A 2DAOA 3DPLC 3OYDA 1YRNA 2YS9A 3OSFA 4EMSA 4M72A 5E8GA 1P9QC 2ZFWA 4KJZA 3LA3A 2DODA 4ZDLA 4QLCU 5LBQA 5BQTA 1P4AA 2TRTA 5F0HA 4LITA 5HNHA 3KYCB 1VQ4I 5LGUA 3HC7A 1V3FA 1IN7A 2DMPA 3OYEA 4B3AA 1ZREA 3OV8A 3RDIA 2W82A 4AU7A 1MJ9A 2DXIA 4MTEA 2BY0A 2QSGX 3JRBA 3I71A 4AWXB 4LG0A 2XRNA 3Q9SA 3FM3A 5J3LA 5DS9A 2OF7A 2G7HA 2ZJ2A 3RI4A 3CDIA 1D5YA 5IP7J 4RAGA 1HXDA 1JGGA 1YG2A 3H3UA 1UG2A 1EF4A 3GTGJ 5K7FA 3ABLH 4B09A 4DBQA 4E7SA 1IRZA 3MD2A 4BQOA 5EGOB 1YHQI 2QQ8A 3GBGA 3HUGB 3O3KA 4ZYAA 3HIFA 2EV5A 1T08B 1VZ0A 3SDGA 2HPIA 3CUQC 5FFXA 5ICFA 2VUMJ 3A0BC 3DP7A 3MVPA 4DW6A 4WXCA 1MH3A 5HLTA 2BXZA 2IW5A 4XRSA 2Z33A 1O57A 1OCZH 2H27A 3OYMA 4P9UA 1OCPA 1BJZA 3I56I 4AIKA 3GFLA 1BI0A 4EM1A 1USTA 2IGOA 2P6TA 1WH5A 4ABZA 4ESBA 3P7NA 4XSXF 4C3HJ 3HL2A 3JRHA 2CUJA 2DFHA 4ENMA 4BXXJ 4RAYA 1R49A 3LSRA 4IOCF 3ZQGA 2RQPA 4YRVA 2OC6A 1KZHA 3BY6A 4A3IJ 5JR3A 3A01A 1QZEA 1R1UA 1TT5B 3C2HA 1RUNA 2LMDA 2CO5A 3HGGA 3H5AA 1AWCA 2V9KA 1QZYA 1MNDA 3W6VA 4UV8A 3PSIA 2R7XA 1B9NA 4M73A 1D3YA 1GVJA 1ULYA 4I0BA 1SVOA 2KP6A 1UELB 4A3GJ 3EDPA 4N9IA 2E34A 5K5OA 4WWCA 1Y0NA 3O8HA 4LLLA 2O61A 3GTKJ 2H8RA 2L5QA 2IGKA 3IC7A 4PJMA 5FKNA 4A3MJ 1G4DA 2VODA 2Z3YA 4UB6C 5K1YA 3IL2A 4YFXF 3I4MJ 2E7WA 1K6OA 4V2FA 2OZUA 1BC8C 3HXLA 1ZLKA 3VFZA 3IRQA 3VYRB 3AG2H 5FO5A 2HYJA 4Y15A 3HEFA 3KZYA 2JA5J 3J81K 4AYBA 1YTYA 2CFXA 1WJCA 3EUAA 4BYYA 4AUXA 2HZDA 2STWA 4OIOF 1SANA 3EUHA 4FETA 1KU2A 3FHZA 3HOXJ 2E2HJ 3T8TA 3GTJJ 1HOMA 1YO5C 2NS8A 5FKLA 2HR3A 2W48A 2XAQA 5M5YJ 3PNVA 2IP2A 1ETVA 1I39A 1TZLA 1TW2A 3IWFA 3LQRA 3TDZC 2D45A 4C3IJ 1R23A 4HG2A 4RM3A 1K78B 3R6SA 4Y7NJ 2NAZA 3F8BA 5JHFA 5EDNA 2W57A 2PJRA 4X1EA 1IDZA 2IBDA 3WTYC 2KFDA 1WJEA 5GTIC 4G8XA 1ZGWA 3GMEA 4BHCA 4XLCA 1HDPA 2EQRA 2V9VA 3BT9A 3K9TA 2W24A 2DW4A 1ZARA 5ICEA 3OYIA 1ETQA 9ANTA 2E1NA 2EFPA 3QPHA 1BI3A 1B4AA 4Y17A 1RKWA 3HUGA 4R8HA 4V2GA 2K7LA 2JVHA 1KU7A 3S1RJ 3K10A 1ZGAA 1HKTA 1IW7F 1G3SA 1KU9A 3M3YJ 2NS7A 4G6QA 3I53A 1ZELA 2JRTA 4E7HA 1WI3A 3IV5A 4B44A 4CGZA 1S5LC 3FMSA 4N4NB 3J7AY 3IHUA 2K9QA 1HC8A 3QQAA 3KP6A 5D8LB 4Y33A 4RLFA 3S8PA 1JKRC 3CLQA 4ITVA 2LKPA 3WHCA 3QWLA 5J4VA 2DT6A 2LBFB 1MBJA 2WAQN 3SQNA 3GTPJ 4Z6YA 4LOCA 4WXHA 4NBQA 4U7BA 1JXSA 4GO1A 4M3DA 2X1CA 4BE0A 2PMZN 1LDDA 3RTRA 2IA0A 4XN0A 2Y0MA 4BDYA 5E3OA 2VQGA 4R1HA 4IHTA 4HYEA 1XGNA 2IT0A 3HBLA 3WGHA 3OYHA 1GVDA 1P92A 5BOXA 2K40A 2Y9YA 5GPCA 1RR7A 1F36A 4RB3C 2F6CA 2VI6A 2R0QC 4NC6A 3AL0B 5DCFA 1UAAA 2WAQA 2JQ7A 2RC4A 2MABA 5KAIC 3OYJA 5M3MJ 3MZHA 1A04A 2AO9A 3HOYJ 2MGQA 2XAHA 3BG6A 3L09A 1T38A 1UCRA 5LFAA 3BCAA 2B9SA 3I5UA 5FGMA 5GTHC 2L9NA 4CYCA 5BPDA 2X6XA 4MGRA 5B3SH 3BLYA 3WU0A 4O3MA 1T98A 4Q47A 1K79A 4L9VA 2KHMA 2IS1A 5EZGA 2Q2EB 3AG3H 2FMLA 5EYRA 4I6ZA 3KP2A 4B8XA 3E0JB 2UXNA 2MW8A 3A4CA 2ZNYA 1ETWA 2YX4A 1C0WA 4OOIA 1DP3A 2DYRH 2GOXB 3Q0WA 4CCKA 4GYIA 2BOLA 4EQQA 4OMZA 4I0AA 4C2UA 2M45A 4NC8A 5HS8A 2ZJRF 3FDYA 1DU0A 4IHWA 1ODDA 3PO3J 2PJRB 4BQAA 1U6GA 3HSRA 3CCRI 2VE8A 1S8NA 3FXOA 1IJWC 2JZYA 2RGVA 2VXDA 2E19A 3CC7I 2E2JJ 2H09A 2BVMA 2C6YA 4C30A 1QVTA 1FJLA 2OJED 2IGNA 1R00A 2KISA 2JWTA 2GA2A 3D5SC 2M8EA 4D9JA 1FTTA 2E1MC 4KIBA 1VQLI 1GXQA 1VQPI 1HA8A 1QNTA 1IN6A 2DK8A 1ETXA 2DBBA 3BZ6A 4KICA 4V19K 3V8LA 4Z2YA 5LEKA 4N4OB 4UUSB 3OSGA 2VOOA 1XCBA 3LOCA 4BKXA 4HBLA 3ZQQA 1KONA 2M4GA 1POGA 1TLHB 2D1VA 5K5RA 2P0WA 3UNGC 3AFHA 2HFHA 4E7IA 4O6JA 2VLAA 4I09A 1TT0A 3HJEA 2P7VB 2OTLI 3CCUI 2ELHA 2JVGA 4BJTA 2BBYA 2L01A 4CZCA 1X1CA 1CGPA 2NYXA 2WAEA 4NUBA 1ETYA 1MMAA 2KDZA 1D1CA 2IVMA 2W00A 3LNQA 5M5WJ 3ZMSA 3VWBA 1QPMA 1X1BA 1OR7C 2FNPA 4U0VA 1WJBA 1LFBA 3F8MA 1PJRA 2DFEA 3GXOA 2HVQA 4D1QA 1PUFA 2O9LA 4F91B 3DEWA 4P96A 2LTPA 4RLQA 2VE9A 1OCRH 3LMMA 4YIRX 2WV0A 2Q8KA 4RGXA 4PGHA 2R7TA 5E3NA 5BMZA 5E1XA 3K6GA 3JRAA 2FEZA 1YJ9I 2WA0A 3VPRA 4G7ZF 1XDSA 1U5TA 5FKKA 3RIRA 4UUTA 3DXJF 4DGWB 2VL8A 1R58A 3LAJA 2DA1A 4NB5A 1ZK8A 3JTGA 3E6BA 4CDGA 2LOOA 3DFGA 4OWRB 3ZQFA 3I3LA 4XICA 4XORA 2LKSA 3I0TA 2QYOA 3K2ZA 2EPFA 2NOGA 4IF4A 1JUSA 2KRHA 1IZ1A 2M8GX 4RB0A 3CMAI 2WTEA 3MAJA 3ROUA 4ZDPA 2ELKA 3CLOA 1FOKA 2KJBA 3FX3A 1U5TC 3ABMH 3OS1A 3G6EI 2R7FA 2VPLA 2IXSA 2JT1A 2M34A 2QA4I 3OMYA 1BIAA 4M6VA 1LJ9A 3GZ5A 1MBHA 1L0OC 4WX9A 3GZNB 1HKQA 1TNSA 4KITB 5F64A 1AHDP 1IAWA 3K4LA 3HTSB 3EYIA 3LA2A 4BACA 4KMFA 3DWLE 4L9TA 4XRFA 5JLXA 3OIQA 1DDNA 3DPTA 4L0ZB 3J7AO 3ZGKA 2FBKA 4B3XA 1FSHA 4A69C 3OOPA 4FX4A 1XSDA 2NVQJ 1QQIA 3K1MA 2Z5UA 4CYCB 2ZNZA 4LLNA 3MKZA 2V1DA 3S32A 3MQ0A 1V55H 2XAUA 3RKYA 1GT0C 5B1AH 1IXCA 3JREA 1T0FC 2DO7A 3F0CA 1FOWA 2R5ZA 1XD7A 2YU3A 4E7LA 3KX2A 3CD6I 1WZ2A 2VT3A 3JW4A 4BJ5C 2BHYA 2X4HA 1DGRM 5BNGA 5IYCJ 1ZR4A 3ZOBA 5IP9J 3CCSI 1BI1A 3HG9A 3SFIA 3K7AJ 4GDFA 2FJ1A 3CC4I 3KE2A 1TWGJ 1MJBA 3KP7A 4A93J 1WPKA 3QAHA 1VQKI 1X3UA 5LRRA 2DA4A 1ZRFA 3ZPLA 3DEEA 1O3TA 1BW5A 4IRIA 2LC2A 1JUPA 1D8JA 2Y31A 4KUMA 1XC5A 3SFZA 2Y0SA 3TDUC 4BBRJ 1P4WA 4P5OA 1VFCA 2CYYA 3HSEA 4IO9F 3WTWC 2CQQA 2JUGA 1FP1D 2CSOA 2L02A 3GWZA 5TRDA 1VQ7I 3E7LA 2PJPA 2O3FA 1WHUA 5DYMA 1I3AA 3I9V2
chains in the Genus database with same CATH topology
3FZVA 4Q48A 4CO8A 2DPUA 5JFRA 1O3SA 1SFXA 2H6CA 4LB6B 1LDKB 3FMQA 3R61A 3BJAA 1ZAOA 1FC3A 4M71A 4MEYF 2H94A 3RKWA 1HW5A 2ESHA 4HQEA 5IT9Z 2XGXA 2L4AA 1SAXA 1GXPA 2ZBKA 1FPQA 2PN6A 1GHCA 5AONA 2HKXA 1P2FA 1R7JA 4PDKA 4HX4A 4ON0A 2COMA 2O8XA 2XROA 1HKSA 1D8KA 2EV6A 4RGRA 1P6RA 3S2WA 1FYLA 4N9HA 4KN4X 2FRHA 5DD8A 2L3DA 1J7KA 2EWNA 2EJRA 4G9YA 4K2EA 1JHHA 4OIQF 1WKMA 4GGGA 2DLLA 1RNLA 5LLQA 3BPVA 1XSXA 3V8KA 3WGGA 1PP7U 2KIUA 1G3TA 5H6QA 3EQLF 1Z91A 4LK0F 5L3DA 1F9NA 4MEXF 4HV6A 2RKHA 1TNTA 5IT3A 5CVRA 1BM9A 1V4RA 2NRAC 3BWGA 1XB4A 1YS6A 4HZFA 2WWYA 3R60A 3U2RA 1QZZA 5E8IA 4CZZA 1BC7C 2IPQX 1MJAA 4RS8A 2HWVA 1BOAA 3HRSA 2PBIA 4LG0B 3DKWA 3RYRA 1FBQA 3C1DA 3P9KA 2DFIA 1SMTA 5J6XA 2EFOA 3VB2A 2EA2A 5D4RA 5ICGA 2XASA 4KYWA 4RB1A 5E1ZB 4UHTA 3V8JA 4UVBA 1LEBA 2BGCA 5DCMB 3V4GA 2ZCWA 4M6YA 1ZN2A 1TW3A 3RPQA 5AIQA 2MLGA 1KQ0A 5ILVA 3LAPA 4A6EA 1IN4A 5FD6A 1ZRCA 2YR2A 5DUIA 4ZYGA 3U9GA 1R22A 3BJ6A 3WODF 1USSA 1G3YA 3G73A 5EEGA 4I01A 2QLZA 3SHFA 2MD5A 2IA1A 2XAFA 4KN7X 3I64A 1I27A 2Q0OA 1FYKA 2GQQA 1PDNC 4PCQA 1HW1A 4YIFA 1SD7A 3W6KB 1IF1A 2FU4A 1R1TA 2QVOA 2Z99A 4XLPF 5TJJA 3K0LA 1ONVA 1XMAA 5CVJA 1O7LA 1T6SA 3IWZA 2ZMEA 2ZKZA 2GA1A 3SXYA 2QUFA 1Z6RA 2HTSA 1W7PD 1JGSA 1KGSA 1SFUA 2EB7A 2ZO4A 2M1BA 5D4SA 2V6CA 4LMYA 2XV4S 3H3ZA 2A07F 1B9MA 5HS9A 2VC0A 1MDMB 5HVQC 3QP6A 1IN5A 4DNCA 4I2OA 2ACJA 1EH6A 5L3EA 3WTVC 2ESNA 3BP8A 3WU1B 1F5TA 5F6FA 4IXAA 1YS7A 4HLXA 3IKTA 2FE3A 2KIFA 2A6EF 1U3EM 1MKMA 4M9XA 3CTAA 2DT5A 5IT9K 2XUBA 4IJAA 1OKRA 3ERED 4HV5A 4UUVA 3RKXA 5LGTA 3KETA 3T8RA 1QGPA 3F23A 1J75A 1HSTA 1I6XA 1LDJA 2Y48A 3JAMZ 1STZA 3GVAA 3WE3A 3WTUC 3KLOA 5FLXK 3GX4X 4OMYA 3QP5A 1Z7UA 5D5WB 5DCMA 1OPCA 5D6FA 2VC1A 1U2WA 4EGZA 2RVCA 2QQ9A 2L4MA 4JQFA 2BEOA 5E20A 3MCZA 4F7ZA 3GO5A 3WTSC 1I1GA 4G7OF 3O2PE 3BDDA 3C7JA 3E6CC 4KFCA 5JVTA 1MD0A 6PAXA 2W85A 1W7PB 3V7CA 4U0YA 3LFKA 5HOOA 4KDPA 3WTZA 5L3GA 1YIOA 4MQ9F 2PQ8A 4HAMA 2E7XA 3VEPA 3QOPA 2GWRA 4UV9A 1LB2A 4RGSA 2LSOA 3HOTA 1U78A 1SFEA 2YSRA 4A5NA 3DQVC 5E18F 4IRGA 1ZGJA 1I1SA 2CWEA 3WG9A 4A0ZA 4H0EA 3DF8A 5HLGA 4GYGA 4YIIA 2MBFA 5ED4A 1J2XA 2FBHA 3ZQ7A 4IRHA 2G7UA 1FBUA 5KVRA 3ULQB 4AVPA 5LEJA 1JHFA 2JSCA 1HW2A 1K7AA 4HOBA 3NRVA 2LF7A 2KKOA 3LWFA 1RIOH 2PI0A 1G3WA 2BYVE 5D5VB 3HRMA 4GCVA 2O0YA 5H6RA 2J5PA 2QM3A 2QQAA 1Z9CA 1W5TA 3F8CA 3GUDA 3HSFA 4EJVA 2NNYA 1LVAA 3ZMTA 1J9IA 2CGPA 2OU2A 4NQWA 2DTRA 3E6MA 3KP5A 1R36A 1XCVA 1PUEE 5D5XB 1XDUA 3J80K 3SZPA 3WTXC 5DV5A 2XAGA 3I59B 4EVIA 5LHIA 1IRGA 4L18B 3JSOA 3HRUA 2PFBA 1U8RA 2Z9OA 4MHGA 1NHAA 3QRFF 3QPTA 1YW8A 3K69A 2VBWA 3R0JA 3GYHX 3B73A 2P5KA 5D5UB 3GFJA 3KEQA 3V7SA 3I54A 4AD9A 4UVAA 1XGOA 1W5SA 1ZH5A 3GZ6A 4WK8F 4FT8A 2JTVA 2EV0A 3L00A 5J8CA 4IVNA 3AAFA 1F4KA 1S29A 1P4XA 5BS6A 4A0YA 2EK5A 2RN7A 2HTJA 2FXAA 2L54A 3D5LA 3BROA 4UXNA 2HOEA 2VN2A 1MZBA 5HLHA 2V79A 2B0LA 4RAZA 3I58A 5L3BA 2Q2EA 2BV6A 3JAMK 4UVCA 2UZKA 1S3JA 2PLYA 2GXBA 4AIHA 5BPIA 3ABTA 2EFWA 1XGMA 3ZN1A 2A3SA 3MEXA 3K1NA 2D2WA 2RNJA 1R5HA 2XIGA 2F5CA 2K86A 4ZYDA 4EV0A 1KYWA 5ICCA 4RB2C 4LK1F 1WRJA 1PP8F 3SZTA 1FWZA 5CVVA 2MC3A 2VBZA 4LFUA 3CUQB 5LHHA 4L5JA 2KIMA 5DDGA 2ZMEB 4HQMA 1OYWA 3KFWX 3ABUA 2OD5A 2EA4A 3E5UA 4MQVA 1R5GA 4ZZLA 5K5QA 4KIGA 1Q1HA 3PQKA 1D5VA 2F5DA 4E70A 3L9FA 2ETHA 3EETA 1KYZA 4ZH4F 4TV7A 3T1BA 1S7OA 2QQBA 2NNNA 3G3ZA 5CVIA 3C18A 1OMIA 3LQQA 2XVCA 4KIFA 4Y13A 4LJZF 4BAYA 1QBJA 3E5QA 1YW9A 4G94A 4JBAA 4KMUX 4OINF 5JHUA 2FNAA 4EJWA 5HDNA 4IHSA 1AOYA 1UFMA 2OAZA 3HRTA 1IN8A 4HX8A 2P4WA 2FOKA 1YLFA 3RYPA 2V1XA 1ZLJA 4LD5A 3REOA 3WE2A 1CF7A 3CJNA 1LNWA 1O7FA 3U1DA 3ZMDA 2XKOA 1UHMA 3NQOA 2F2EA 4NHJA 4U7DA 5HDKA 3FXRA 3KLNA 1ZG5A 2G9WA 1LQ1A 2XKPA 3BJOA 2PEXA 4L5IA 3R0AA 3J81Z 3RPUA 1FP2A 2A68F 3LA7A 1H9TA 3TOAA 4CHUA 1MGTA 3GEZA 1EV7A 4UNOA 3PFIA 1BJAA 2P6SA 4HF2A 1W4MA 1O3RA 2DU9A 1DUXC 2W25A 1L3LA 3TQNA 1IUYA 3MFKA 4Q4ZF 1FLIA 2A6HF 5CYVA 2IJLA 3F22A 3B02A 1O3QA 4D0PA 5HLIA 2R7DA 3FXUA 2IA2A 2H6BA 3VOEA 3CDHA 1Z6TA 1F1ZA 4U0WA 2O03A 3QU3A 3MZYA 3WGIA 5AIPA 5DEQA 1T0FA 4L9JA 1J5YA 5F1RA 1SMYF 4ENJA 2P7CB 4LLGF 1DPUA 4P9FA 1BBYA 1QO0D 3C3WA 2HQNA 1ON2A 3F6VA 4HW0A 3M8FA 4FHTA 4M9SA 3H92A 4WCGA 5E17F 4KT5C 5FD5A 4WXDA 1DPRA 3MWMA 2K4BA 3E3VA 4A12A 2GAUA 2RV8A 1T39A 5L3CA 4ENNA 2ISZA 2TDXA 3O6BB 2HKOA 3LSTA 1Y0UA 4A2UA 2K27A 5LHGA 2CQKA 2A69F 4U88A 1J0RA 2XHKA 4A6DA 5ILUA 5FFZA 1REPC 1HBXG 3FM5A 3F8FA 4BH9A 3BOQA 5HS7A 4BNCA 3F21A 4XSZF 1WWXA 2HYGD 2JPBA 3EYYA 3TOBA 5J8FA 2QBYA 4MTDA 1XN7A 3CUOA 3GF2A 3I59A 1S7AA 3WTTC 4CICA 4BHPA 5A2QK 2P5LC 2PMHA 5FB2A 2ISYA 1JE8A 1OR7A 4WF2A 5CVUA 1B59A 1W7PA 1TBXA 4O5VA 4M9ZA 3L7WA 3HHHA 5H20A 3GLXA 3ISPA 1Z1DA 1BN5A 3PQJA 3ECHA 3JSPA 2FQ3A 3ZN0A 1Z05A 2PMUA 4A5MA 3GFMA 2GXGA 2X0LA 1FNNA 2UXXA 2OQRA 1XGSA 2KJCA 1FBSA 3Q9VA 1FY7A 3ML6A 2GZWA 3M9AA 4I7HA 4ESJA 3F8NA 3KP4A 1I5ZA 4OIPF 2OA4A 3E6DA 1HQCA 2V1UA 1RUOA 3M1EA 5FLXZ 4R79A 3FMRA 2LDUA 2WC2A 1TQIA 1H0MA 1G6NA 4L0YB 3F3XA 1YQAA 1E17A 2STTA 1HSJA 1BIBA 1FZPB 5HDGA 5CJ9A 2GIVA 3T5XA 2VBXA 4S04A 1YYVA 2HDCA 2O6GE 4YFNF 2HZTA 4HX7A 2K02A 2A5YB 5ILSA 3IRRA 1R1VA 5DUKA 3N97A 2W84A 4EJUA 4ESFA 2CG4A 4Q5SF 2HS5A 3Q5FA 4EGYA 1ZG3A 4GXOA 3M8EA 2EFNA 2OZ6A 4RGUA 4HDVA 2OQGA 2BE5F 1T2KA 3D0SA 3HOSA 2ADUA 2QBYB 4I98B 1KQ8A 2PG4A 1EH8A 2YX7A 2VBYA 3L2CA 1E2XA 2JPCA 2DK5A 2RDPA 1YFHA 1B1BA 4PGGA 3FWEA 1WI9A 5LRSA 1DP7P 3ECOA 4KA4A 1TQMA 3J80Z 2VONA 3VODA 3ZMVA 3P9IA 4LGWA 2D1HA 1SD6A 1LEAA 4ZYEA 2M5WA 4DQ2A 4G7HF 1S6LA 3BPXA 4AIJA 3NEUA 1TQPA 3V7RA 5D8KB 4LB5A 3ZMUA 3E5XA 4IPAA 2P8TA 2DQRA 5CLSA 1RZ4A 3ZP5A 3ELKA 3KZZA 3GW2A 3E97A 2MH9A 2QWWA 2IRFG 2QZ8A 5ERIA 1MDMA 1UB9A 4N0BA 4CXFA 1KU3A 2A61A 1FYMA 2QENA 1FT9A 3K1PA 4HLYA 4QWQA 4OIRF 3CO7C 4CYDA 3KEOA 1CF7B 4HDUA 2FBIA 1KQ9A 1BI2A 1UHWA 2J5OA 4BHBA 2LNBA 3DEUA 5A2QZ 2MH2A 1RI7A 2VOPA 3F6OA 2EFQA 4YG2F 4A0XA 3W6JB 5KK1A 1J59A 2F5EA 2FSWA 4HA8A 3TGNA 2YPRA 3DV8A 5JI6A 5E1WA 2HEOA 1K78A 3P9CA 2UWMA 4BXUA 4I02A 3TO6A 1OYIA 3I4PA 3FF5A 1ZG1A 1ZHFA 3QU6A 3TO7A 3R4KA 3TKYA 4G6DA 3N4MA 2CW0F 2MA3A 4HF0A 1ZRDA 3TO9A 2K4JA 1KA8A 4OU0A 3CUQA 2FF4A 5EEHA 2R3SA 2VXZA 5LGNA 4M6XA 5D6EA 1XSVA 4ETSA 2AS5F 4ZYHA 5L3FA 2DPDA 4L9NA 2DI3A 3IKVA 4FX0A 1B6AA 2FA5A 4HF1A 4PZJA 4EJTA 1OYYA 3RJPA 1FSEA 4MNUA 4EJOA 4ENKA 1H9GA 2Y75A 2E1CA 1YW7A 1U5TB 4M74A 3COAC 3T0YA 1XMKA 3KP3A 1WSUA 2OBPA 2XAJA 5DD4A 2HQRA 4EM0B 2MLKA 1SD4A 1ON1A 1FX7A 1VTNC 2ZXJA 1EH7A 2AXLA 1TTYA 3HHGA 3M7GA 4ZZDA 3GFIA 2M30A 3JTHA 1IXSB 4S05A 1WQ2A 2VT2A 3FXQA 2NS0A 4XLNF 4XBFA 3HTUA 2DQLA 2F5FA 4YFKF 4KNYA 3F72A 3KCCA 1IXRC 4EM2A 3CO6C 1SD5A 2HYFA 3ZMZA 3HYIA 4JK1X 2HGCA 2LF8A 2M87A 2KRFA 2P5VA 2FMYA 1IRFA 4ASNA 4P55A 2DAOA 3DPLC 4EMSA 4M72A 5E8GA 2ZFWA 3LA3A 4QLCU 5LBQA 5BQTA 1P4AA 5LGUA 1V3FA 1IN7A 1ZREA 3OV8A 3RDIA 1MJ9A 4MTEA 3I71A 4AWXB 4LG0A 2XRNA 3Q9SA 3FM3A 2G7HA 2ZJ2A 3RI4A 1HXDA 1YG2A 3H3UA 4B09A 3O3KA 3HIFA 2EV5A 5FFXA 3CUQC 5ICFA 3DP7A 4WXCA 2H27A 2IW5A 2Z33A 1O57A 4P9UA 4AIKA 3GFLA 1BI0A 4EM1A 1USTA 2P6TA 4ESBA 3P7NA 4XSXF 4ENMA 4RAYA 2RQPA 3BY6A 5JR3A 1R1UA 1RUNA 2CO5A 1AWCA 1QZYA 4UV8A 1B9NA 4M73A 1D3YA 1GVJA 1ULYA 4I0BA 3EDPA 4N9IA 5K5OA 4WWCA 4LLLA 2O61A 3IC7A 1G4DA 2VODA 2Z3YA 5K1YA 3IL2A 4YFXF 2E7WA 1K6OA 2OZUA 1BC8C 1ZLKA 3VFZA 3IRQA 5FO5A 4Y15A 3KZYA 3J81K 1YTYA 2CFXA 2STWA 4BYYA 4OIOF 3EUHA 1KU2A 3FHZA 3T8TA 1YO5C 2HR3A 2XAQA 2IP2A 1TW2A 3IWFA 3LQRA 3TDZC 2D45A 1R23A 1K78B 3R6SA 2NAZA 3F8BA 2W57A 3WTYC 4G8XA 4BHCA 2V9VA 3K9TA 2W24A 2DW4A 1ZARA 5ICEA 2E1NA 2EFPA 3QPHA 1BI3A 1B4AA 4Y17A 3HUGA 4R8HA 2K7LA 1KU7A 1ZGAA 1HKTA 1IW7F 1G3SA 1KU9A 4G6QA 3I53A 2JRTA 4CGZA 3FMSA 3IHUA 3KP6A 5D8LB 2LKPA 3SQNA 4WXHA 4U7BA 1JXSA 4GO1A 3RTRA 1LDDA 2IA0A 2Y0MA 4R1HA 4IHTA 4HYEA 1XGNA 2IT0A 3WGHA 1P92A 5BOXA 4RB3C 5DCFA 2RC4A 3MZHA 1A04A 2XAHA 3L09A 1T38A 1UCRA 3I5UA 5FGMA 5BPDA 4MGRA 3WU0A 4O3MA 1T98A 4Q47A 1K79A 4L9VA 2FMLA 3KP2A 4B8XA 2UXNA 2ZNYA 2YX4A 1C0WA 4OOIA 4GYIA 4EQQA 4OMZA 4I0AA 2M45A 5HS8A 1ODDA 4BQAA 1U6GA 3HSRA 2VE8A 1S8NA 2JZYA 2RGVA 2H09A 2C6YA 1R00A 2GA2A 2M8EA 4KIBA 1GXQA 1QNTA 1IN6A 2DK8A 2DBBA 3BZ6A 4KICA 3V8LA 4Z2YA 5LEKA 2VOOA 1XCBA 4HBLA 1TLHB 2D1VA 5K5RA 2HFHA 4O6JA 4I09A 2P7VB 2ELHA 2BBYA 2L01A 1CGPA 2NYXA 2IVMA 3ZMSA 1QPMA 2FNPA 4U0VA 3F8MA 3GXOA 4P96A 2VE9A 2WV0A 2Q8KA 4RGXA 4PGHA 5BMZA 5E1XA 2FEZA 4G7ZF 1XDSA 1U5TA 3RIRA 3DXJF 1R58A 3LAJA 4NB5A 3JTGA 4CDGA 3E6BA 3DFGA 3I0TA 2QYOA 3K2ZA 4IF4A 1IZ1A 4RB0A 2WTEA 3MAJA 3ROUA 1FOKA 3CLOA 2KJBA 3FX3A 1U5TC 2R7FA 2JT1A 1BIAA 1LJ9A 3GZ5A 1L0OC 4WX9A 1HKQA 1TNSA 5F64A 1IAWA 3HTSB 3EYIA 3LA2A 4KMFA 4L9TA 4XRFA 1DDNA 3DPTA 4L0ZB 3J7AO 2FBKA 1FSHA 4FX4A 3OOPA 1XSDA 1QQIA 3K1MA 2Z5UA 2ZNZA 4LLNA 2V1DA 3MQ0A 3RKYA 1IXCA 2DO7A 1XD7A 2YU3A 2VT3A 3JW4A 2X4HA 1BI1A 3KE2A 1MJBA 3KP7A 3QAHA 1X3UA 5LRRA 1ZRFA 3ZPLA 1O3TA 4IRIA 1D8JA 4KUMA 3SFZA 3TDUC 1P4WA 4P5OA 2CYYA 3HSEA 3WTWC 1FP1D 2CSOA 2L02A 3GWZA 5TRDA 2PJPA 2O3FA 1ZYRF 5DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZV A;  4Q48 A;  4CO8 A;  2DPU A;  5JFR A;  1O3S A;  1SFX A;  2H6C A;  4LB6 B;  1LDK B;  3FMQ A;  3R61 A;  3BJA A;  1ZAO A;  1FC3 A;  4M71 A;  4MEY F;  2H94 A;  3RKW A;  1HW5 A;  2ESH A;  4HQE A;  5IT9 Z;  2XGX A;  2L4A A;  1SAX A;  1GXP A;  2ZBK A;  1FPQ A;  2PN6 A;  1GHC A;  5AON A;  2HKX A;  1P2F A;  1R7J A;  4PDK A;  4HX4 A;  4ON0 A;  2COM A;  2O8X A;  2XRO A;  1HKS A;  1D8K A;  2EV6 A;  4RGR A;  1P6R A;  3S2W A;  1FYL A;  4N9H A;  4KN4 X;  2FRH A;  5DD8 A;  2L3D A;  1J7K A;  2EWN A;  2EJR A;  4G9Y A;  4K2E A;  1JHH A;  4OIQ F;  1WKM A;  4GGG A;  2DLL A;  1RNL A;  5LLQ A;  3BPV A;  1XSX A;  3V8K A;  3WGG A;  1PP7 U;  2KIU A;  1G3T A;  5H6Q A;  3EQL F;  1Z91 A;  4LK0 F;  5L3D A;  1F9N A;  4MEX F;  4HV6 A;  2RKH A;  1TNT A;  5IT3 A;  5CVR A;  1BM9 A;  1V4R A;  2NRA C;  3BWG A;  1XB4 A;  1YS6 A;  4HZF A;  2WWY A;  3R60 A;  3U2R A;  1QZZ A;  5E8I A;  4CZZ A;  1BC7 C;  2IPQ X;  1MJA A;  4RS8 A;  2HWV A;  1BOA A;  3HRS A;  2PBI A;  4LG0 B;  3DKW A;  3RYR A;  1FBQ A;  3C1D A;  3P9K A;  2DFI A;  1SMT A;  5J6X A;  2EFO A;  3VB2 A;  2EA2 A;  5D4R A;  5ICG A;  2XAS A;  4KYW A;  4RB1 A;  5E1Z B;  4UHT A;  3V8J A;  4UVB A;  1LEB A;  2BGC A;  5DCM B;  3V4G A;  2ZCW A;  4M6Y A;  1ZN2 A;  1TW3 A;  3RPQ A;  5AIQ A;  2MLG A;  1KQ0 A;  5ILV A;  3LAP A;  4A6E A;  1IN4 A;  5FD6 A;  1ZRC A;  2YR2 A;  5DUI A;  4ZYG A;  3U9G A;  1R22 A;  3BJ6 A;  3WOD F;  1USS A;  1G3Y A;  3G73 A;  5EEG A;  4I01 A;  2QLZ A;  3SHF A;  2MD5 A;  2IA1 A;  2XAF A;  4KN7 X;  3I64 A;  1I27 A;  2Q0O A;  1FYK A;  2GQQ A;  1PDN C;  4PCQ A;  1HW1 A;  4YIF A;  1SD7 A;  3W6K B;  1IF1 A;  2FU4 A;  1R1T A;  2QVO A;  2Z99 A;  4XLP F;  5TJJ A;  3K0L A;  1ONV A;  1XMA A;  5CVJ A;  1O7L A;  1T6S A;  3IWZ A;  2ZME A;  2ZKZ A;  2GA1 A;  3SXY A;  2QUF A;  1Z6R A;  2HTS A;  1W7P D;  1JGS A;  1KGS A;  1SFU A;  2EB7 A;  2ZO4 A;  2M1B A;  5D4S A;  2V6C A;  4LMY A;  2XV4 S;  3H3Z A;  2A07 F;  1B9M A;  5HS9 A;  2VC0 A;  1MDM B;  5HVQ C;  3QP6 A;  1IN5 A;  4DNC A;  4I2O A;  2ACJ A;  1EH6 A;  5L3E A;  3WTV C;  2ESN A;  3BP8 A;  3WU1 B;  1F5T A;  5F6F A;  4IXA A;  1YS7 A;  4HLX A;  3IKT A;  2FE3 A;  2KIF A;  2A6E F;  1U3E M;  1MKM A;  4M9X A;  3CTA A;  2DT5 A;  5IT9 K;  2XUB A;  4IJA A;  1OKR A;  3ERE D;  4HV5 A;  4UUV A;  3RKX A;  5LGT A;  3KET A;  3T8R A;  1QGP A;  3F23 A;  1J75 A;  1HST A;  1I6X A;  1LDJ A;  2Y48 A;  3JAM Z;  1STZ A;  3GVA A;  3WE3 A;  3WTU C;  3KLO A;  5FLX K;  3GX4 X;  4OMY A;  3QP5 A;  1Z7U A;  5D5W B;  5DCM A;  1OPC A;  5D6F A;  2VC1 A;  1U2W A;  4EGZ A;  2RVC A;  2QQ9 A;  2L4M A;  4JQF A;  2BEO A;  5E20 A;  3MCZ A;  4F7Z A;  3GO5 A;  3WTS C;  1I1G A;  4G7O F;  3O2P E;  3BDD A;  3C7J A;  3E6C C;  4KFC A;  5JVT A;  1MD0 A;  6PAX A;  2W85 A;  1W7P B;  3V7C A;  4U0Y A;  3LFK A;  5HOO A;  4KDP A;  3WTZ A;  5L3G A;  1YIO A;  4MQ9 F;  2PQ8 A;  4HAM A;  2E7X A;  3VEP A;  3QOP A;  2GWR A;  4UV9 A;  1LB2 A;  4RGS A;  2LSO A;  3HOT A;  1U78 A;  1SFE A;  2YSR A;  4A5N A;  3DQV C;  5E18 F;  4IRG A;  1ZGJ A;  1I1S A;  2CWE A;  3WG9 A;  4A0Z A;  4H0E A;  3DF8 A;  5HLG A;  4GYG A;  4YII A;  2MBF A;  5ED4 A;  1J2X A;  2FBH A;  3ZQ7 A;  4IRH A;  2G7U A;  1FBU A;  5KVR A;  3ULQ B;  4AVP A;  5LEJ A;  1JHF A;  2JSC A;  1HW2 A;  1K7A A;  4HOB A;  3NRV A;  2LF7 A;  2KKO A;  3LWF A;  1RIO H;  2PI0 A;  1G3W A;  2BYV E;  5D5V B;  3HRM A;  4GCV A;  2O0Y A;  5H6R A;  2J5P A;  2QM3 A;  2QQA A;  1Z9C A;  1W5T A;  3F8C A;  3GUD A;  3HSF A;  4EJV A;  2NNY A;  1LVA A;  3ZMT A;  1J9I A;  2CGP A;  2OU2 A;  4NQW A;  2DTR A;  3E6M A;  3KP5 A;  1R36 A;  1XCV A;  1PUE E;  5D5X B;  1XDU A;  3J80 K;  3SZP A;  3WTX C;  5DV5 A;  2XAG A;  3I59 B;  4EVI A;  5LHI A;  1IRG A;  4L18 B;  3JSO A;  3HRU A;  2PFB A;  1U8R A;  2Z9O A;  4MHG A;  1NHA A;  3QRF F;  3QPT A;  1YW8 A;  3K69 A;  2VBW A;  3R0J A;  3GYH X;  3B73 A;  2P5K A;  5D5U B;  3GFJ A;  3KEQ A;  3V7S A;  3I54 A;  4AD9 A;  4UVA A;  1XGO A;  1W5S A;  1ZH5 A;  3GZ6 A;  4WK8 F;  4FT8 A;  2JTV A;  2EV0 A;  3L00 A;  5J8C A;  4IVN A;  3AAF A;  1F4K A;  1S29 A;  1P4X A;  5BS6 A;  4A0Y A;  2EK5 A;  2RN7 A;  2HTJ A;  2FXA A;  2L54 A;  3D5L A;  3BRO A;  4UXN A;  2HOE A;  2VN2 A;  1MZB A;  5HLH A;  2V79 A;  2B0L A;  4RAZ A;  3I58 A;  5L3B A;  2Q2E A;  2BV6 A;  3JAM K;  4UVC A;  2UZK A;  1S3J A;  2PLY A;  2GXB A;  4AIH A;  5BPI A;  3ABT A;  2EFW A;  1XGM A;  3ZN1 A;  2A3S A;  3MEX A;  3K1N A;  2D2W A;  2RNJ A;  1R5H A;  2XIG A;  2F5C A;  2K86 A;  4ZYD A;  4EV0 A;  1KYW A;  5ICC A;  4RB2 C;  4LK1 F;  1WRJ A;  1PP8 F;  3SZT A;  1FWZ A;  5CVV A;  2MC3 A;  2VBZ A;  4LFU A;  3CUQ B;  5LHH A;  4L5J A;  2KIM A;  5DDG A;  2ZME B;  4HQM A;  1OYW A;  3KFW X;  3ABU A;  2OD5 A;  2EA4 A;  3E5U A;  4MQV A;  1R5G A;  4ZZL A;  5K5Q A;  4KIG A;  1Q1H A;  3PQK A;  1D5V A;  2F5D A;  4E70 A;  3L9F A;  2ETH A;  3EET A;  1KYZ A;  4ZH4 F;  4TV7 A;  3T1B A;  1S7O A;  2QQB A;  2NNN A;  3G3Z A;  5CVI A;  3C18 A;  1OMI A;  3LQQ A;  2XVC A;  4KIF A;  4Y13 A;  4LJZ F;  4BAY A;  1QBJ A;  3E5Q A;  1YW9 A;  4G94 A;  4JBA A;  4KMU X;  4OIN F;  5JHU A;  2FNA A;  4EJW A;  5HDN A;  4IHS A;  1AOY A;  1UFM A;  2OAZ A;  3HRT A;  1IN8 A;  4HX8 A;  2P4W A;  2FOK A;  1YLF A;  3RYP A;  2V1X A;  1ZLJ A;  4LD5 A;  3REO A;  3WE2 A;  1CF7 A;  3CJN A;  1LNW A;  1O7F A;  3U1D A;  3ZMD A;  2XKO A;  1UHM A;  3NQO A;  2F2E A;  4NHJ A;  4U7D A;  5HDK A;  3FXR A;  3KLN A;  1ZG5 A;  2G9W A;  1LQ1 A;  2XKP A;  3BJO A;  2PEX A;  4L5I A;  3R0A A;  3J81 Z;  3RPU A;  1FP2 A;  2A68 F;  3LA7 A;  1H9T A;  3TOA A;  4CHU A;  1MGT A;  3GEZ A;  1EV7 A;  4UNO A;  3PFI A;  1BJA A;  2P6S A;  4HF2 A;  1W4M A;  1O3R A;  2DU9 A;  1DUX C;  2W25 A;  1L3L A;  3TQN A;  1IUY A;  3MFK A;  4Q4Z F;  1FLI A;  2A6H F;  5CYV A;  2IJL A;  3F22 A;  3B02 A;  1O3Q A;  4D0P A;  5HLI A;  2R7D A;  3FXU A;  2IA2 A;  2H6B A;  3VOE A;  3CDH A;  1Z6T A;  1F1Z A;  4U0W A;  2O03 A;  3QU3 A;  3MZY A;  3WGI A;  5AIP A;  5DEQ A;  1T0F A;  4L9J A;  1J5Y A;  5F1R A;  1SMY F;  4ENJ A;  2P7C B;  4LLG F;  1DPU A;  4P9F A;  1BBY A;  1QO0 D;  3C3W A;  2HQN A;  1ON2 A;  3F6V A;  4HW0 A;  3M8F A;  4FHT A;  4M9S A;  3H92 A;  4WCG A;  5E17 F;  4KT5 C;  5FD5 A;  4WXD A;  1DPR A;  3MWM A;  2K4B A;  3E3V A;  4A12 A;  2GAU A;  2RV8 A;  1T39 A;  5L3C A;  4ENN A;  2ISZ A;  2TDX A;  3O6B B;  2HKO A;  3LST A;  1Y0U A;  4A2U A;  2K27 A;  5LHG A;  2CQK A;  2A69 F;  4U88 A;  1J0R A;  2XHK A;  4A6D A;  5ILU A;  5FFZ A;  1REP C;  1HBX G;  3FM5 A;  3F8F A;  4BH9 A;  3BOQ A;  5HS7 A;  4BNC A;  3F21 A;  4XSZ F;  1WWX A;  2HYG D;  2JPB A;  3EYY A;  3TOB A;  5J8F A;  2QBY A;  4MTD A;  1XN7 A;  3CUO A;  3GF2 A;  3I59 A;  1S7A A;  3WTT C;  4CIC A;  4BHP A;  5A2Q K;  2P5L C;  2PMH A;  5FB2 A;  2ISY A;  1JE8 A;  1OR7 A;  4WF2 A;  5CVU A;  1B59 A;  1W7P A;  1TBX A;  4O5V A;  4M9Z A;  3L7W A;  3HHH A;  5H20 A;  3GLX A;  3ISP A;  1Z1D A;  1BN5 A;  3PQJ A;  3ECH A;  3JSP A;  2FQ3 A;  3ZN0 A;  1Z05 A;  2PMU A;  4A5M A;  3GFM A;  2GXG A;  2X0L A;  1FNN A;  2UXX A;  2OQR A;  1XGS A;  2KJC A;  1FBS A;  3Q9V A;  1FY7 A;  3ML6 A;  2GZW A;  3M9A A;  4I7H A;  4ESJ A;  3F8N A;  3KP4 A;  1I5Z A;  4OIP F;  2OA4 A;  3E6D A;  1HQC A;  2V1U A;  1RUO A;  3M1E A;  5FLX Z;  4R79 A;  3FMR A;  2LDU A;  2WC2 A;  1TQI A;  1H0M A;  1G6N A;  4L0Y B;  3F3X A;  1YQA A;  1E17 A;  2STT A;  1HSJ A;  1BIB A;  1FZP B;  5HDG A;  5CJ9 A;  2GIV A;  3T5X A;  2VBX A;  4S04 A;  1YYV A;  2HDC A;  2O6G E;  4YFN F;  2HZT A;  4HX7 A;  2K02 A;  2A5Y B;  5ILS A;  3IRR A;  1R1V A;  5DUK A;  3N97 A;  2W84 A;  4EJU A;  4ESF A;  2CG4 A;  4Q5S F;  2HS5 A;  3Q5F A;  4EGY A;  1ZG3 A;  4GXO A;  3M8E A;  2EFN A;  2OZ6 A;  4RGU A;  4HDV A;  2OQG A;  2BE5 F;  1T2K A;  3D0S A;  3HOS A;  2ADU A;  2QBY B;  4I98 B;  1KQ8 A;  2PG4 A;  1EH8 A;  2YX7 A;  2VBY A;  3L2C A;  1E2X A;  2JPC A;  2DK5 A;  2RDP A;  1YFH A;  1B1B A;  4PGG A;  3FWE A;  1WI9 A;  5LRS A;  1DP7 P;  3ECO A;  4KA4 A;  1TQM A;  3J80 Z;  2VON A;  3VOD A;  3ZMV A;  3P9I A;  4LGW A;  2D1H A;  1SD6 A;  1LEA A;  4ZYE A;  2M5W A;  4DQ2 A;  4G7H F;  1S6L A;  3BPX A;  4AIJ A;  3NEU A;  1TQP A;  3V7R A;  5D8K B;  4LB5 A;  3ZMU A;  3E5X A;  4IPA A;  2P8T A;  2DQR A;  5CLS A;  1RZ4 A;  3ZP5 A;  3ELK A;  3KZZ A;  3GW2 A;  3E97 A;  2MH9 A;  2QWW A;  2IRF G;  2QZ8 A;  5ERI A;  1MDM A;  1UB9 A;  4N0B A;  4CXF A;  1KU3 A;  2A61 A;  1FYM A;  2QEN A;  1FT9 A;  3K1P A;  4HLY A;  4QWQ A;  4OIR F;  3CO7 C;  4CYD A;  3KEO A;  1CF7 B;  4HDU A;  2FBI A;  1KQ9 A;  1BI2 A;  1UHW A;  2J5O A;  4BHB A;  2LNB A;  3DEU A;  5A2Q Z;  2MH2 A;  1RI7 A;  2VOP A;  3F6O A;  2EFQ A;  4YG2 F;  4A0X A;  3W6J B;  5KK1 A;  1J59 A;  2F5E A;  2FSW A;  4HA8 A;  3TGN A;  2YPR A;  3DV8 A;  5JI6 A;  5E1W A;  2HEO A;  1K78 A;  3P9C A;  2UWM A;  4BXU A;  4I02 A;  3TO6 A;  1OYI A;  3I4P A;  3FF5 A;  1ZG1 A;  1ZHF A;  3QU6 A;  3TO7 A;  3R4K A;  3TKY A;  4G6D A;  3N4M A;  2CW0 F;  2MA3 A;  4HF0 A;  1ZRD A;  3TO9 A;  2K4J A;  1KA8 A;  4OU0 A;  3CUQ A;  2FF4 A;  5EEH A;  2R3S A;  2VXZ A;  5LGN A;  4M6X A;  5D6E A;  1XSV A;  4ETS A;  2AS5 F;  4ZYH A;  5L3F A;  2DPD A;  4L9N A;  2DI3 A;  3IKV A;  4FX0 A;  1B6A A;  2FA5 A;  4HF1 A;  4PZJ A;  4EJT A;  1OYY A;  3RJP A;  1FSE A;  4MNU A;  4EJO A;  4ENK A;  1H9G A;  2Y75 A;  2E1C A;  1YW7 A;  1U5T B;  4M74 A;  3COA C;  3T0Y A;  1XMK A;  3KP3 A;  1WSU A;  2OBP A;  2XAJ A;  5DD4 A;  2HQR A;  4EM0 B;  2MLK A;  1SD4 A;  1ON1 A;  1FX7 A;  1VTN C;  2ZXJ A;  1EH7 A;  2AXL A;  1TTY A;  3HHG A;  3M7G A;  4ZZD A;  3GFI A;  2M30 A;  3JTH A;  1IXS B;  4S05 A;  1WQ2 A;  2VT2 A;  3FXQ A;  2NS0 A;  4XLN F;  4XBF A;  3HTU A;  2DQL A;  2F5F A;  4YFK F;  4KNY A;  3F72 A;  3KCC A;  1IXR C;  4EM2 A;  3CO6 C;  1SD5 A;  2HYF A;  3ZMZ A;  3HYI A;  4JK1 X;  2HGC A;  2LF8 A;  2M87 A;  2KRF A;  2P5V A;  2FMY A;  1IRF A;  4ASN A;  4P55 A;  2DAO A;  3DPL C;  4EMS A;  4M72 A;  5E8G A;  2ZFW A;  3LA3 A;  4QLC U;  5LBQ A;  5BQT A;  1P4A A;  5LGU A;  1V3F A;  1IN7 A;  1ZRE A;  3OV8 A;  3RDI A;  1MJ9 A;  4MTE A;  3I71 A;  4AWX B;  4LG0 A;  2XRN A;  3Q9S A;  3FM3 A;  2G7H A;  2ZJ2 A;  3RI4 A;  1HXD A;  1YG2 A;  3H3U A;  4B09 A;  3O3K A;  3HIF A;  2EV5 A;  5FFX A;  3CUQ C;  5ICF A;  3DP7 A;  4WXC A;  2H27 A;  2IW5 A;  2Z33 A;  1O57 A;  4P9U A;  4AIK A;  3GFL A;  1BI0 A;  4EM1 A;  1UST A;  2P6T A;  4ESB A;  3P7N A;  4XSX F;  4ENM A;  4RAY A;  2RQP A;  3BY6 A;  5JR3 A;  1R1U A;  1RUN A;  2CO5 A;  1AWC A;  1QZY A;  4UV8 A;  1B9N A;  4M73 A;  1D3Y A;  1GVJ A;  1ULY A;  4I0B A;  3EDP A;  4N9I A;  5K5O A;  4WWC A;  4LLL A;  2O61 A;  3IC7 A;  1G4D A;  2VOD A;  2Z3Y A;  5K1Y A;  3IL2 A;  4YFX F;  2E7W A;  1K6O A;  2OZU A;  1BC8 C;  1ZLK A;  3VFZ A;  3IRQ A;  5FO5 A;  4Y15 A;  3KZY A;  3J81 K;  1YTY A;  2CFX A;  2STW A;  4BYY A;  4OIO F;  3EUH A;  1KU2 A;  3FHZ A;  3T8T A;  1YO5 C;  2HR3 A;  2XAQ A;  2IP2 A;  1TW2 A;  3IWF A;  3LQR A;  3TDZ C;  2D45 A;  1R23 A;  1K78 B;  3R6S A;  2NAZ A;  3F8B A;  2W57 A;  3WTY C;  4G8X A;  4BHC A;  2V9V A;  3K9T A;  2W24 A;  2DW4 A;  1ZAR A;  5ICE A;  2E1N A;  2EFP A;  3QPH A;  1BI3 A;  1B4A A;  4Y17 A;  3HUG A;  4R8H A;  2K7L A;  1KU7 A;  1ZGA A;  1HKT A;  1IW7 F;  1G3S A;  1KU9 A;  4G6Q A;  3I53 A;  2JRT A;  4CGZ A;  3FMS A;  3IHU A;  3KP6 A;  5D8L B;  2LKP A;  3SQN A;  4WXH A;  4U7B A;  1JXS A;  4GO1 A;  3RTR A;  1LDD A;  2IA0 A;  2Y0M A;  4R1H A;  4IHT A;  4HYE A;  1XGN A;  2IT0 A;  3WGH A;  1P92 A;  5BOX A;  4RB3 C;  5DCF A;  2RC4 A;  3MZH A;  1A04 A;  2XAH A;  3L09 A;  1T38 A;  1UCR A;  3I5U A;  5FGM A;  5BPD A;  4MGR A;  3WU0 A;  4O3M A;  1T98 A;  4Q47 A;  1K79 A;  4L9V A;  2FML A;  3KP2 A;  4B8X A;  2UXN A;  2ZNY A;  2YX4 A;  1C0W A;  4OOI A;  4GYI A;  4EQQ A;  4OMZ A;  4I0A A;  2M45 A;  5HS8 A;  1ODD A;  4BQA A;  1U6G A;  3HSR A;  2VE8 A;  1S8N A;  2JZY A;  2RGV A;  2H09 A;  2C6Y A;  1R00 A;  2GA2 A;  2M8E A;  4KIB A;  1GXQ A;  1QNT A;  1IN6 A;  2DK8 A;  2DBB A;  3BZ6 A;  4KIC A;  3V8L A;  4Z2Y A;  5LEK A;  2VOO A;  1XCB A;  4HBL A;  1TLH B;  2D1V A;  5K5R A;  2HFH A;  4O6J A;  4I09 A;  2P7V B;  2ELH A;  2BBY A;  2L01 A;  1CGP A;  2NYX A;  2IVM A;  3ZMS A;  1QPM A;  2FNP A;  4U0V A;  3F8M A;  3GXO A;  4P96 A;  2VE9 A;  2WV0 A;  2Q8K A;  4RGX A;  4PGH A;  5BMZ A;  5E1X A;  2FEZ A;  4G7Z F;  1XDS A;  1U5T A;  3RIR A;  3DXJ F;  1R58 A;  3LAJ A;  4NB5 A;  3JTG A;  4CDG A;  3E6B A;  3DFG A;  3I0T A;  2QYO A;  3K2Z A;  4IF4 A;  1IZ1 A;  4RB0 A;  2WTE A;  3MAJ A;  3ROU A;  1FOK A;  3CLO A;  2KJB A;  3FX3 A;  1U5T C;  2R7F A;  2JT1 A;  1BIA A;  1LJ9 A;  3GZ5 A;  1L0O C;  4WX9 A;  1HKQ A;  1TNS A;  5F64 A;  1IAW A;  3HTS B;  3EYI A;  3LA2 A;  4KMF A;  4L9T A;  4XRF A;  1DDN A;  3DPT A;  4L0Z B;  3J7A O;  2FBK A;  1FSH A;  4FX4 A;  3OOP A;  1XSD A;  1QQI A;  3K1M A;  2Z5U A;  2ZNZ A;  4LLN A;  2V1D A;  3MQ0 A;  3RKY A;  1IXC A;  2DO7 A;  1XD7 A;  2YU3 A;  2VT3 A;  3JW4 A;  2X4H A;  1BI1 A;  3KE2 A;  1MJB A;  3KP7 A;  3QAH A;  1X3U A;  5LRR A;  1ZRF A;  3ZPL A;  1O3T A;  4IRI A;  1D8J A;  4KUM A;  3SFZ A;  3TDU C;  1P4W A;  4P5O A;  2CYY A;  3HSE A;  3WTW C;  1FP1 D;  2CSO A;  2L02 A;  3GWZ A;  5TRD A;  2PJP A;  2O3F A;  1ZYR F;  5DYM A; 
#chains in the Genus database with same CATH topology
 4M3E A;  3FZV A;  4A3E J;  2O7O A;  4Q48 A;  1EKE A;  2KPM A;  4CO8 A;  5J1Y A;  2DPU A;  1A6I A;  1MBF A;  2JN6 A;  2QCO A;  1V54 H;  2OUM A;  5JFR A;  3JRG A;  1U9O A;  3H0D A;  1ETK A;  4PUS A;  1SFX A;  1O3S A;  2H6C A;  2JA6 J;  4LB6 B;  1LDK B;  3FMQ A;  3G4S I;  3R61 A;  3BJA A;  2CV0 A;  1X19 A;  4DBR A;  1NTC A;  1ZAO A;  2DMT A;  1FC3 A;  3WG7 H;  4M71 A;  4MEY F;  2HOT A;  2H94 A;  3RKW A;  1HW5 A;  2ESH A;  4HQE A;  5IT9 Z;  2XGX A;  2L4A A;  1SAX A;  1GXP A;  2CW8 A;  2ZBK A;  1FPQ A;  1E0E A;  2PN6 A;  3TP0 A;  1GHC A;  1LPQ A;  5AON A;  4XLA A;  3ZQC A;  1N25 A;  2DA5 A;  2HKX A;  1P2F A;  1R7J A;  1IG7 A;  4PDK A;  1LUJ B;  4HX4 A;  4ON0 A;  4XID A;  3H9G A;  2COB A;  3W2W A;  2COM A;  2O8X A;  2XRO A;  1HKS A;  2Q1Z B;  4KIS A;  5E3L A;  2QSH X;  1D8K A;  1RPW A;  4PFP A;  3U21 A;  2EV6 A;  2HDW A;  4RGR A;  1JT6 A;  1P6R A;  2LH9 A;  2M9H A;  1IV8 A;  2QKM B;  3G1O A;  3S2W A;  1Y1W J;  1FYL A;  3K70 D;  3FK7 A;  4N9H A;  2LLK A;  4XLH A;  1R4N B;  4KN4 X;  2FRH A;  5DD8 A;  2K3P A;  2L3D A;  4RBO A;  1J7K A;  2EWN A;  2EJR A;  4G9Y A;  4K2E A;  4II2 A;  1JHH A;  1FMW A;  4OIQ F;  3RQ4 A;  3DLA A;  1WKM A;  2YUS A;  4GGG A;  4AYB N;  2OTJ I;  2DLL A;  1RNL A;  5LLQ A;  1UHS A;  3CJT B;  3BPV A;  5IPA A;  4CA0 A;  1XSX A;  3V8K A;  3WGG A;  1PP7 U;  2KIU A;  1G3T A;  5H6Q A;  3QYB A;  2KZV A;  4CCN A;  1SFO J;  3EQL F;  1Z91 A;  3B6A A;  4LK0 F;  5L3D A;  1F9N A;  4MEX F;  2K5C A;  4HV6 A;  1K4S A;  4DIQ A;  2XF6 A;  2RKH A;  1TNT A;  3HKZ N;  5IT3 A;  3LSJ A;  4UY8 I;  3SYT A;  5CVR A;  1BM9 A;  1R4M B;  1SVL A;  1V4R A;  3CJQ B;  2NRA C;  3K4N A;  4XOT A;  1MNE A;  4ZTJ A;  4P1W A;  1V5E A;  3BWG A;  3S16 J;  1XB4 A;  5CQE A;  2VJ4 A;  1YS6 A;  1N77 A;  3DBL B;  2VKH A;  1WJA A;  2X6W A;  4HZF A;  3H1C A;  2WWY A;  4BE2 A;  3R60 A;  1P7I A;  2R7R A;  1W1W E;  3U2R A;  2HXI A;  1D0Z A;  3PUB A;  2XPW A;  1QZZ A;  5HOD A;  4PFO A;  1MMN A;  2TCT A;  2HU9 A;  5E8I A;  4CZZ A;  1BC7 C;  3FKJ A;  2IPQ X;  1MJA A;  1S7E A;  1XG1 A;  4RS8 A;  2HWV A;  3BR2 A;  3ZRG A;  1BOA A;  4QTR A;  3HRS A;  2PBI A;  1MSE C;  3PJR A;  4LG0 B;  3DKW A;  3BG7 A;  3UR3 C;  3RYR A;  1FBQ A;  3C1D A;  3OYC A;  3P9K A;  2DFI A;  4XL9 A;  1SMT A;  5J6X A;  3MKL A;  1IO2 A;  1VF9 A;  1OCO H;  2EFO A;  4HSR A;  2EA2 A;  3VB2 A;  4D5F A;  5ICG A;  5D4R A;  2XAS A;  4KYW A;  4RB1 A;  1Y1V J;  2FUG 2;  5E1Z B;  4UHT A;  3V8J A;  4UVB A;  1Q1V A;  4JYK A;  3OS2 A;  2CRG A;  2HDD A;  1LEB A;  4II3 A;  2VKV A;  2CUE A;  2DA3 A;  2BGC A;  3HPH A;  2CV1 A;  5DCM B;  3V4G A;  2ZCW A;  4M6Y A;  2JA7 J;  3NAR A;  1ZN2 A;  1TW3 A;  3HB9 A;  3ZQH A;  2DDB A;  2MC4 A;  1TP4 A;  3JRF A;  1Z77 A;  2V9P A;  3RPQ A;  3KZI C;  5AIQ A;  4QSH A;  1SVM A;  2X51 A;  2MLG A;  3NWT A;  3DBR B;  3L2U A;  1KQ0 A;  1MBG A;  5ILV A;  3LAP A;  4A6E A;  1IN4 A;  3RZO J;  4A3D J;  1MW7 A;  1I50 J;  5FD6 A;  2DOE A;  1NK2 P;  2YR2 A;  4NQW B;  1ZRC A;  3BC8 A;  5DUI A;  4ZYG A;  1N78 A;  4XMY A;  3U9G A;  1RC9 A;  1R22 A;  2ZJQ F;  3BJ6 A;  4CSW A;  3WOD F;  1USS A;  1G3Y A;  3G73 A;  1RR8 C;  2M7B A;  5EEG A;  4I01 A;  5GAE J;  2QLZ A;  5IOZ A;  3L2V A;  1ERD A;  2V7F A;  2MD5 A;  1U0J A;  2IA1 A;  2XAF A;  3SHF A;  4KN7 X;  3I64 A;  3S14 J;  4S0H B;  1I27 A;  2Q0O A;  1FYK A;  1OLT A;  2GQQ A;  1YE9 A;  3VYU B;  1PDN C;  4PCQ A;  3F9K A;  1V5G A;  1HW1 A;  1MMD A;  1ZYR F;  4YIF A;  1SD7 A;  3W6K B;  2IGM A;  4PJL A;  3TW7 A;  1IF1 A;  2FU4 A;  2W7N A;  1R1T A;  2QVO A;  2Z16 A;  2Z99 A;  4XLP F;  2O5R A;  5TJJ A;  3K0L A;  3E1S A;  1ONV A;  3X2Q H;  1XMA A;  1O7L A;  5CVJ A;  3BG5 A;  1W0U A;  4UUS A;  5C4J J;  3OL4 A;  1X3W B;  4IQ4 A;  1T6S A;  1TL8 A;  3KPH A;  3IWZ A;  2ZME A;  2ZKZ A;  2WB1 A;  2DTZ A;  2GA1 A;  3SXY A;  4IZZ A;  1OQY A;  2QUF A;  3PFY A;  4FTH A;  1Z6R A;  1WH7 A;  2HTS A;  1W7P D;  2AHQ A;  1JGS A;  3HOZ J;  1KGS A;  1AA7 A;  2E1M B;  3KYD B;  1SFU A;  5IYD J;  2EB7 A;  2ZO4 A;  2M1B A;  1DGW Y;  5D4S A;  2V6C A;  1X4O A;  1I6H J;  2F4M B;  3WHB A;  4LMY A;  1K61 A;  3OY9 A;  2XV4 S;  3H3Z A;  2A07 F;  3CF5 F;  1B9M A;  5HS9 A;  3M4O J;  2VC0 A;  4LG3 A;  2K3F A;  1MDM B;  5HVQ C;  3QP6 A;  2Z1D A;  3A0H C;  4NDL A;  1IN5 A;  2ECB A;  4DNC A;  2VJJ A;  4I2O A;  2UV1 A;  2ACJ A;  3AG1 H;  1EH6 A;  2XB0 X;  5L3E A;  3WTV C;  5F04 A;  2ESN A;  3BP8 A;  3CMM A;  2QEX I;  1G8X A;  2L9R A;  3IAS 2;  5TGT A;  3WU1 B;  2LY9 A;  1F5T A;  5F6F A;  4IXA A;  3DPU A;  2VKD A;  1YS7 A;  4HLX A;  2CJJ A;  2DYS H;  3IKT A;  2FE3 A;  2KIF A;  2A6E F;  4QPQ A;  1U3E M;  1MKM A;  4M9X A;  4OAZ A;  3L2W A;  3CTA A;  2DT5 A;  1Z3Y A;  2XUB A;  4IJA A;  4JP0 A;  1OKR A;  3ERE D;  5IT9 K;  4HV5 A;  5F27 A;  2QKL B;  4UUV A;  3RKX A;  5LGT A;  3KET A;  1AKH A;  3T8R A;  3GTQ J;  1QGP A;  3F23 A;  1JTY A;  1J75 A;  2CS3 A;  1HST A;  2R7Q A;  3IAM 2;  1I6X A;  3OYB A;  3TW6 A;  1T8I A;  1GV2 A;  1LDJ A;  1T56 A;  2E36 A;  2Y48 A;  4J01 A;  4XKC A;  3JAM Z;  3BQZ A;  1STZ A;  3GVA A;  1QRY A;  3WE3 A;  3WTU C;  2DJN A;  3KLO A;  4X0G A;  1TWC J;  5FLX K;  3G71 I;  3GX4 X;  3I55 I;  2DMU A;  2PX9 A;  4OMY A;  3QP5 A;  1Z7U A;  5D5W B;  4J00 A;  5DCM A;  1OPC A;  5D6F A;  4EEF G;  1H88 C;  2VC1 A;  4E7K A;  1U2W A;  4PJ0 C;  4XOP A;  4EGZ A;  2RVC A;  1RES A;  3FXK A;  2QQ9 A;  2L4M A;  3MKW B;  4JQF A;  2BEO A;  5E20 A;  1VQM I;  3DKX A;  5H2F C;  3ZCO A;  3BTL A;  2XSD C;  1LVK A;  3MCZ A;  1OIS A;  4XRS G;  2I5U A;  4F7Z A;  3GO5 A;  3BZK A;  3WTS C;  1I1G A;  2WAF A;  4G7O F;  2NOJ B;  3O2P E;  1T33 A;  3BDD A;  3C7J A;  3E6C C;  4KFC A;  5JVT A;  1MD0 A;  2KIQ A;  4NNJ A;  3S1N J;  1QHG A;  6PAX A;  2W85 A;  1W7P B;  3V7C A;  4CCL A;  5FLV A;  1BOB A;  2Z2S B;  3K4C A;  3PIO F;  4U0Y A;  3GLL A;  3LFK A;  3CMY A;  2WY7 Q;  5HOO A;  4KDP A;  4ZTF A;  2QF7 A;  1OCC H;  2MYS A;  3WTZ A;  2LVS A;  3HZJ A;  5J47 A;  5L3G A;  3J7Z I;  1YIO A;  2DOA A;  4MQ9 F;  1K83 J;  2ZC2 A;  2PQ8 A;  4HAM A;  5B5E C;  1TWA J;  4BXF A;  3CDL A;  2E7X A;  2M3A A;  3VEP A;  3QOP A;  4PSX A;  2GWR A;  3RSN A;  4UV9 A;  2BZT A;  2DOF A;  1YRN B;  2JRM A;  2QSF X;  4AVZ A;  3BQY A;  1LB2 A;  4A3L J;  2CV2 A;  4RGS A;  2LSO A;  3V42 A;  3HOT A;  1U78 A;  1SFE A;  2LFB A;  2YSR A;  4XM3 A;  1JTX A;  4A5N A;  3DQV C;  5E18 F;  2K85 A;  4IRG A;  2JA8 J;  1X1D A;  2QGU A;  1ZGJ A;  3CCL I;  5GAD J;  1I1S A;  5GAG J;  2EZK A;  4FAS D;  2CWE A;  3WG9 A;  4A0Z A;  4H0E A;  1B72 A;  3OWT A;  2L7F P;  3DF8 A;  2VQH A;  5HLG A;  4GYG A;  4YII A;  2MBF A;  1VND A;  5ED4 A;  2KQR A;  1J2X A;  2FBH A;  3ZQ7 A;  4IRH A;  2CMP A;  2NXN B;  2G7U A;  1FBU A;  5KVR A;  2LD5 A;  3ULQ B;  4AVP A;  5LEJ A;  1JHF A;  2JSC A;  1HW2 A;  1K7A A;  1BA5 A;  2E60 A;  1X3Z B;  2Y69 H;  3W3C A;  4HOB A;  3NRV A;  2E71 A;  2LF7 A;  1ACI A;  2KKO A;  2M0C A;  3LWF A;  2M2E A;  1RIO H;  2NVX J;  1G3W A;  3CES A;  4DYC A;  2BYV E;  2PI0 A;  3HOU J;  1G2H A;  1JKO C;  3EUK L;  5D5V B;  3HRM A;  2BY1 A;  5IY5 H;  3FHN A;  2VJ5 A;  2MD0 A;  4GCV A;  2O0Y A;  4BY7 J;  3TBI A;  2GOM A;  5H6R A;  3OYL A;  4RAF A;  2B7E A;  2EIN H;  2XGE A;  2J5P A;  5M5X J;  4B47 A;  2KRC A;  2QM3 A;  2QQA A;  3IUO A;  1Z9C A;  1W5T A;  3F8C A;  3GUD A;  3PSF A;  3HSF A;  3LSM A;  4EJV A;  2NNY A;  2Y30 A;  1LVA A;  1ENH A;  3ZMT A;  1J9I A;  2CGP A;  4PK4 A;  2OU2 A;  1TWF J;  4NQW A;  3S1M J;  2DTR A;  3E6M A;  2XPV A;  3KIO A;  3KP5 A;  2R5Z B;  5JLW A;  2R4G A;  1R36 A;  2R7U A;  4X6A J;  3H36 A;  1QVU A;  1XCV A;  5IYB J;  1PUE E;  1VQ9 I;  2EIM H;  1FEX A;  4IEJ A;  2DA6 A;  4A3J J;  1WCM J;  5D5X B;  1XDU A;  3LSH A;  4DYQ A;  3J80 K;  3SZP A;  3WTX C;  5J1U A;  5DV5 A;  1Y8Q B;  2XAG A;  3I59 B;  4EVI A;  2CQN A;  1HCR A;  5EG0 B;  5CPR B;  2DN0 A;  3CQZ J;  5LHI A;  1YI2 I;  2HVR A;  2HNH A;  2I10 A;  4BU2 A;  2XC7 A;  1AU7 A;  1IRG A;  1R9T J;  4L18 B;  3BTJ A;  3JSO A;  3HRU A;  2PFB A;  5GP9 A;  2ME0 A;  3OYG A;  4IHY A;  1U8R A;  2Z9O A;  1DQU A;  2ZXH A;  4MHG A;  1NHA A;  3H5R A;  3K4K A;  5FLM J;  3QRF F;  3ZXS A;  4D7M A;  4XN3 A;  3FKI J;  3QPT A;  3BR3 A;  5IOY A;  2ZSH B;  1YW8 A;  3L1P A;  3IH4 A;  1MIJ A;  4D5C A;  3K69 A;  3PUF A;  1W36 D;  2A05 A;  2VBW A;  3R0J A;  2R7V A;  3GYH X;  3B73 A;  3CCY A;  5EEA A;  1ORK A;  3FK6 A;  4FE7 A;  2P5K A;  3NWS A;  5D5U B;  3GFJ A;  1LKX A;  3KEQ A;  4HEA 2;  3TED A;  3S3O A;  3V7S A;  3I54 A;  4AD9 A;  1FIP A;  4UVA A;  1XGO A;  3TP3 A;  1W5S A;  3BCB A;  3FXL A;  2Y9Z A;  4GFB A;  2E5Z A;  2GIZ A;  1XPX A;  2WBM A;  3MMY B;  1ZH5 A;  3ZR8 X;  4J19 A;  3GZ6 A;  5B1B H;  4B48 A;  4WK8 F;  4FT8 A;  4BEH A;  2JTV A;  5EZH A;  2EV0 A;  3L00 A;  2VPR A;  4XKV A;  4JX5 A;  5J8C A;  2Y0S N;  1JKQ C;  4IVN A;  2PMZ A;  3AAF A;  2IS4 A;  4XKB A;  1F4K A;  2MFZ A;  1S29 A;  2JA2 A;  1P4X A;  3RQI A;  3M07 A;  5BS6 A;  4A0Y A;  2EK5 A;  2G0E A;  2RN7 A;  1U8B A;  1D1B A;  5C4X J;  2HTJ A;  2FOW A;  2FXA A;  1A5J A;  4DZP A;  4HPQ A;  2L54 A;  3D5L A;  3P5J A;  4HNT A;  2EIL H;  2O8K A;  3BRO A;  4XLF A;  1FOX A;  4UXN A;  2CUZ A;  3ZQI A;  2HOE A;  2DDA A;  2LBF A;  2VN2 A;  4E6K G;  1EJ9 A;  1MZB A;  5HLH A;  3VDX A;  2V79 A;  1MMS A;  3MN2 A;  2DFF A;  2B0L A;  3PIP F;  4RAZ A;  3H9J A;  3I58 A;  5L3B A;  2Q2E A;  3VYT B;  2BV6 A;  2HOA A;  3JAM K;  3S3M A;  4UVC A;  2UZK A;  1S3J A;  2PLY A;  3HM5 A;  2GXB A;  4AIH A;  4E7J A;  3ABT A;  5BPI A;  1LFP A;  2EFW A;  1XGM A;  3ZN1 A;  3PL8 A;  1A6Q A;  2A3S A;  3G1M A;  1H89 C;  4C3J J;  3HKZ A;  4ZJZ A;  3MEX A;  5F0C A;  3K1N A;  1X58 A;  4QPO A;  2D2W A;  1Y6I A;  2RNJ A;  2A6T A;  1R5H A;  2XDV A;  2XIG A;  1Z0X A;  4RM2 A;  2R5Y B;  4C9Y A;  2F5C A;  2K86 A;  4ZYD A;  3H9Q A;  4EV0 A;  1MNM C;  5FKO A;  3DTK A;  1KYW A;  1O4X A;  4IHV A;  5ICC A;  1MSF C;  4NC7 A;  4XQF A;  4BBS J;  4RB2 C;  4LK1 F;  1WRJ A;  1VQ6 I;  1JI8 A;  1PP8 F;  2XRL A;  1ZKG A;  3SZT A;  1FWZ A;  4CCM A;  1WJ5 A;  5CVV A;  2BY2 A;  4BJ6 C;  4PJN A;  1J09 A;  4MO7 A;  2GBY A;  2MC3 A;  2VBZ A;  4LFU A;  5FRO A;  3JRD A;  3CUQ B;  5LHH A;  4L5J A;  2KIM A;  4E7Z A;  5DDG A;  4I76 A;  1QA6 A;  2ZME B;  3I4N J;  4HQM A;  1OYW A;  1X1P A;  2JK3 A;  2CFO A;  4M3B A;  3KFW X;  3ABU A;  2H1K A;  2OD5 A;  2KZG A;  2EA4 A;  2ZFU A;  3E5U A;  2BHZ A;  1Z3X A;  3RZD J;  4MQV A;  2VQL A;  3IP4 B;  1R5G A;  3IH3 A;  4ZZL A;  5K5Q A;  1GV5 A;  4KIG A;  1Q1H A;  1H8A C;  1QU3 A;  2L7M P;  3PQK A;  1T95 A;  1D5V A;  2KLO A;  2F5D A;  4E70 A;  2AXT C;  5K7H A;  2DA7 A;  3L9F A;  2R7Z J;  5J40 A;  2ETH A;  3EET A;  4DYR A;  2EBI A;  2K9S A;  1KYZ A;  4ZH4 F;  5C44 J;  4TV7 A;  3T1B A;  5JVG F;  1NK3 P;  1S7O A;  2DJI A;  2NNN A;  2QQB A;  3SJM A;  2A5W A;  3CCM I;  1LE8 A;  3G3Z A;  4GRI A;  5CVI A;  3W2A A;  4OAY A;  3C18 A;  1OMI A;  3LQQ A;  4XNF A;  1B72 B;  2XVC A;  3QPS A;  3BR6 A;  4KIF A;  4Y13 A;  3TL4 X;  1BR4 A;  2IS6 A;  4LJZ F;  1K6Y A;  1SAU A;  4BAY A;  1YJN I;  1QBJ A;  3E5Q A;  1YW9 A;  4G94 A;  4JBA A;  2K9M A;  4KMU X;  1FOY A;  4OIN F;  2GLO A;  5JHU A;  4CCJ A;  2R92 J;  2K9L A;  2KMU A;  4B4C A;  1R71 A;  2FNA A;  4EJW A;  2RAE A;  3AG4 H;  5HDN A;  4IHS A;  1AOY A;  1UFM A;  2OAZ A;  3HRT A;  2KDO A;  1IN8 A;  4HX8 A;  4M3G A;  2P4W A;  2XF5 A;  2FOK A;  1YLF A;  3RYP A;  2V1X A;  1G59 A;  2CQ7 A;  1ZLJ A;  3OR2 C;  4LD5 A;  5CQG A;  4F52 A;  2ZSI B;  3ESW B;  4CCO A;  3REO A;  3WE2 A;  1CF7 A;  3ABK H;  1ETO A;  3CJN A;  4XKW A;  1LNW A;  1O7F A;  3U1D A;  2DCE A;  2ID6 A;  3ZMD A;  1GDT A;  2XKO A;  4BS9 A;  1UHM A;  3NQO A;  3CCQ I;  2F2E A;  1IV6 A;  2RNG A;  4NHJ A;  3OOU A;  4U7D A;  2L7Z A;  5HDK A;  3FXR A;  2Y2Z A;  3KLN A;  1ZG5 A;  1B8I A;  2G9W A;  1LQ1 A;  2GXA A;  2XKP A;  5J1R A;  3BJO A;  1IGN A;  2PEX A;  4L5I A;  3R0A A;  3J81 Z;  5TIS C;  3RPU A;  1FP2 A;  2LP0 A;  3QYF A;  2EIK H;  3LSP A;  5M3F J;  2A68 F;  3LA7 A;  3A1Y A;  1H9T A;  3NAU A;  5FRN A;  3TOA A;  4CHU A;  1MGT A;  3GEZ A;  1EV7 A;  4UNO A;  3PFI A;  1QHH D;  1BJA A;  1X1A A;  3A03 A;  2P6S A;  4HF2 A;  1W4M A;  1O3R A;  4G12 A;  1UMQ A;  3VYS B;  3AL0 C;  1R6R A;  2DU9 A;  4FCY A;  2W25 A;  1DUX C;  1L3L A;  3TQN A;  1IUY A;  3MFK A;  3K4B A;  4Q4Z F;  1FLI A;  2A6H F;  5CYV A;  1E3H A;  2IJL A;  4XON A;  5EG0 A;  5KHD A;  3F22 A;  3LL7 A;  4F92 B;  3CP8 A;  2LK2 A;  2ID3 A;  3B02 A;  2WAD A;  2WY8 Q;  1O3Q A;  3GTL J;  4XLE A;  1TWH J;  4HNU A;  4D0P A;  4E4H A;  5HLI A;  2R7D A;  4F93 B;  3RCO A;  3FXU A;  4LIU A;  2IA2 A;  4CUG A;  2H6B A;  2ZXW H;  4IX7 A;  3VOE A;  2ECC A;  3CDH A;  4MIM A;  1Z6T A;  1F1Z A;  3UKG A;  3S3N A;  4U0W A;  2O03 A;  3QU3 A;  1W5C C;  1XTA A;  3MZY A;  3WGI A;  5AIP A;  5DEQ A;  1T0F A;  4L9J A;  2R93 J;  1J5Y A;  2X9D A;  3S1Q J;  5F1R A;  3OR1 C;  1SMY F;  2HQ5 A;  2L2O A;  1OFC X;  1FIA A;  3SEZ A;  3SZG A;  4FE4 A;  4ENJ A;  2P7C B;  4LLG F;  2XSJ C;  2WB1 N;  1Y56 A;  4H4K C;  1DPU A;  2EZH A;  3BG3 A;  3OIO A;  4P9F A;  1BBY A;  4BQQ A;  1QO0 D;  1MMG A;  3C3W A;  2HQN A;  4W1U A;  1ON2 A;  1PUF B;  1IDY A;  3A01 B;  3A02 A;  2V1N A;  4BEH B;  3F6V A;  4HW0 A;  1Z7L A;  3M8F A;  4JOM A;  1F43 A;  2HI3 A;  3LSK A;  1FMV A;  4FHT A;  1OCT C;  4DZJ A;  4M9S A;  5EF6 A;  3H92 A;  2MG4 A;  4WCG A;  5E17 F;  4KT5 C;  2V6E A;  2KT0 A;  3FBN B;  5FD5 A;  1W36 C;  4WXD A;  1DPR A;  2JJ7 A;  3O8G A;  4BUP A;  2HVS A;  3MWM A;  2JSP A;  2K4B A;  3RKQ A;  3E3V A;  4A12 A;  3QOD A;  2GAU A;  2RV8 A;  3OL3 A;  1T39 A;  2E1O A;  5GPA A;  5L3C A;  3D5R C;  2XB5 A;  3FXJ A;  2UUZ A;  4ENN A;  2ISZ A;  2TDX A;  4D7N A;  3O6B B;  2HKO A;  1E3P A;  5B66 C;  1R5I D;  3LST A;  5E79 C;  1Y0U A;  4A3C J;  1P7J A;  2HXO A;  4Y3O A;  4A2U A;  2K27 A;  5LHG A;  3DTE A;  2CQK A;  3K70 C;  2V4J C;  2A69 F;  4U88 A;  4YEL A;  1YIT I;  1J0R A;  2XHK A;  4A6D A;  1AKH B;  1LFU P;  4BGD A;  4F55 A;  5ILU A;  1ZTR A;  5FFZ A;  1REP C;  1HBX G;  3CJR B;  3FM5 A;  2CH0 A;  2LR8 A;  3F8F A;  4BH9 A;  3GTO J;  3BOQ A;  2HQA A;  2FQ4 A;  3OYN A;  4AID A;  4C2M J;  3GTM J;  5HS7 A;  4BNC A;  3F21 A;  2W4S A;  1MBE A;  4XSZ F;  1WWX A;  2HYG D;  3DU6 A;  4B1R A;  4BE1 A;  2JPB A;  3EYY A;  3QYE A;  3TOB A;  3OYA A;  5J8F A;  2QBY A;  2N8G A;  3K4J A;  2K9N A;  2M4K A;  1ZQ3 P;  4MTD A;  1WVR A;  2EZI A;  1XN7 A;  3CUO A;  3GF2 A;  4FIS A;  3I59 A;  4UB8 C;  1S7A A;  3WTT C;  2F5V A;  4RMN A;  2VB6 A;  3ONQ A;  3DCF A;  4JX4 A;  4CIC A;  4BHP A;  5A2Q K;  2ZJP F;  2X48 A;  3ZQL A;  4EAT A;  2P5L C;  2PMH A;  3BTI A;  5FB2 A;  2RRE A;  4G6T B;  2ISY A;  3FIW A;  4Y4R A;  3CZ6 A;  1JE8 A;  1OR7 A;  5LD2 C;  3H0G J;  4WF2 A;  5CVU A;  2W1O A;  1B59 A;  3GCM A;  1W7P A;  1TBX A;  2R7O A;  4IQJ A;  4O5V A;  2NVT J;  4M9Z A;  2H1L A;  3L7W A;  2DMN A;  3JCU C;  3HHH A;  4FQG A;  5H20 A;  3GLX A;  1Y39 A;  2VQC A;  1D0Y A;  3ISP A;  3BTC A;  1WJF A;  1JJ8 C;  3DLL F;  1Z1D A;  4M3F A;  1RRJ A;  1BN5 A;  3PQJ A;  3ECH A;  3JSP A;  4PJJ A;  2FQ3 A;  3ZN0 A;  1Z05 A;  2E2I J;  2PMU A;  1M1E B;  4A5M A;  3OYK A;  2VJI A;  3FBI B;  3GFM A;  2GXG A;  2X0L A;  1FNN A;  3MZ8 A;  2UXX A;  3EPZ A;  2X1D A;  2OQR A;  4AM3 A;  2LRE A;  1XGS A;  3CCJ I;  2KJC A;  2X1E A;  1FBS A;  3Q9V A;  1FY7 A;  3ML6 A;  2LKX A;  2GZW A;  1VQN I;  3M9A A;  4I7H A;  1JUM A;  4ESJ A;  4IHX A;  2JMW A;  2F4I A;  2LY1 A;  3F8N A;  2VKE A;  1JT0 A;  3KP4 A;  1I5Z A;  2VAS A;  4OIP F;  2OA4 A;  3E6D A;  3S2D J;  1HQC A;  2V1U A;  1RUO A;  2ZXI A;  3M1E A;  3MKY B;  1IC8 A;  1WJD A;  5FLX Z;  4R79 A;  1GLN A;  1XX5 A;  2L0K A;  3FMR A;  1GUU A;  2LDU A;  2WC2 A;  3BZC A;  1TQI A;  1H0M A;  1G6N A;  3QOE A;  4L0Y B;  4JX6 A;  4B43 A;  3F3X A;  3RPU D;  1YQA A;  2NVY J;  1E17 A;  1VQ5 I;  5KAF C;  2STT A;  1HSJ A;  1BIB A;  3PNY A;  1FZP B;  2XGC A;  2ICW G;  1PYV A;  2E35 A;  5HDG A;  5CJ9 A;  2DA2 A;  3S2H J;  2GIV A;  3T5X A;  2D5V A;  2VBX A;  1VQO I;  1HF0 A;  4S04 A;  1YYV A;  3JRC A;  1ZR2 A;  1UZC A;  4IL6 C;  2LRD A;  1X4P A;  3KEY A;  2HDC A;  1NH3 A;  3HPG A;  5HNF A;  2O6G E;  3W2V A;  4YFN F;  2HZT A;  4HX7 A;  2K02 A;  1K4T A;  3HOV J;  2A5Y B;  2DT7 B;  5ILS A;  2IAI A;  3IRR A;  2F4O B;  1R1V A;  5DUK A;  1A36 A;  3N97 A;  2W84 A;  2B63 J;  4EJU A;  4ESF A;  2CG4 A;  4Q5S F;  1IRX A;  2HS5 A;  1CQT A;  2DMQ A;  3J7Y J;  1BR1 A;  2WV1 A;  3Q5F A;  4EGY A;  1ZG3 A;  1VQ8 I;  4GXO A;  4Y52 J;  3M8E A;  3IH2 A;  1YX3 A;  1IUF A;  2EFN A;  4PSW A;  1Z67 A;  2OZ6 A;  4RGU A;  4HDV A;  2OQG A;  2BE5 F;  4U87 A;  3VSL A;  4XR6 A;  1SEU A;  1T2K A;  1S9H A;  3D0S A;  5K7Z A;  3HOS A;  1WFX A;  3HOW J;  2ADU A;  2QBY B;  4I98 B;  1KQ8 A;  2PG4 A;  1EH8 A;  2YX7 A;  2VBY A;  3L2C A;  1E2X A;  2JPC A;  2DK5 A;  2RDP A;  1YFH A;  1B1B A;  5FRM A;  4PGG A;  3FWE A;  4QIW N;  1WI9 A;  3CME I;  3C2G A;  5LRS A;  1DP7 P;  3ECO A;  2H8W A;  3D1N I;  4KA4 A;  1TQM A;  3J80 Z;  3SDB A;  4BY1 J;  2VON A;  3VOD A;  3ZMV A;  4W97 A;  3CCV I;  3FIS A;  2MSY A;  3P9I A;  5IP6 A;  3PNT A;  4LGW A;  2D1H A;  1SD6 A;  1LEA A;  1RKT A;  4ZC3 A;  4ZYE A;  2M5W A;  4DQ2 A;  1LE8 B;  2ZME C;  1QPI A;  1XS9 A;  5DM7 F;  3JR9 A;  4G7H F;  1S6L A;  3L2R A;  2M7A A;  3PM1 A;  3BPX A;  4AIJ A;  1EA3 A;  2M0M A;  3N05 A;  3S15 J;  3NEU A;  1TQP A;  3LSI A;  3V7R A;  1YIJ I;  3ASO H;  4IOA F;  5D8K B;  4LB5 A;  1SFK A;  4LIV A;  2VIX A;  3CF2 A;  3ZMU A;  3E5X A;  4IPA A;  2IS2 A;  2P8T A;  2DQR A;  5CLS A;  1RZ4 A;  3ZP5 A;  1N75 A;  2RQQ A;  2EH3 A;  3ELK A;  3KZZ A;  2NVU B;  3GW2 A;  3BG9 A;  3E97 A;  4MFE A;  3PO2 J;  1MH4 A;  1JKP C;  2MH9 A;  2QWW A;  2IRF G;  2QZ8 A;  5ERI A;  1MDM A;  1UB9 A;  2KL4 A;  4N0B A;  4CXF A;  1KU3 A;  2A61 A;  1FYM A;  2HOS A;  1UG0 A;  2QEN A;  1E3O C;  1FT9 A;  3G1L A;  3K1P A;  3OIP A;  3CC2 I;  3S17 J;  4HLY A;  4QWQ A;  4OIR F;  2OCC H;  4HRI A;  3CO7 C;  2ZB9 A;  4CYD A;  1HDD C;  3DU5 A;  3KEO A;  1YX5 A;  2BXY A;  2L9S A;  2R7S A;  3EUH C;  2ELJ A;  4AC0 A;  5F0F A;  1CF7 B;  3H3V K;  4HDU A;  2FBI A;  3U1K A;  2BVL A;  1KQ9 A;  5CKT A;  1BI2 A;  3KYL A;  2R5Y A;  2AQE A;  1UHW A;  2J5O A;  4BHB A;  2LNB A;  1V5F A;  3DEU A;  3LFU A;  5A2Q Z;  2MH2 A;  1RI7 A;  3FXM A;  4I99 C;  5DM6 F;  3M1C A;  2BW3 A;  1B8I B;  3C2B A;  3S93 A;  3L2Q A;  2VOP A;  2OV7 A;  1Y8R B;  4KT6 A;  3F6O A;  2CW7 A;  2EFQ A;  4YG2 F;  1X2M A;  4A0X A;  3W6J B;  3OS0 A;  5KK1 A;  1J59 A;  1XMX A;  2EZL A;  5FKM A;  1BW6 A;  3A2K A;  2X6Y A;  2YU9 J;  2FX0 A;  2F5E A;  2XF7 A;  2FSW A;  1NG6 A;  3M8J A;  4HA8 A;  3TGN A;  2YPR A;  3DV8 A;  3K2A A;  5JI6 A;  4RDU A;  5E1W A;  2HEO A;  1K78 A;  1W0T A;  2L7K A;  3P9C A;  2UWM A;  4BXU A;  2X85 A;  3G2B A;  4I02 A;  3TO6 A;  3JRI A;  1OYI A;  3I4P A;  3FF5 A;  1HLV A;  1ZG1 A;  1NG7 A;  3OYF A;  4MFD A;  1ZHF A;  2BY3 A;  2LY2 A;  3QU6 A;  3TO7 A;  4IKF A;  4BL0 B;  3R4K A;  3H5N A;  3TKY A;  2LG4 A;  4G6D A;  3N4M A;  3HGY A;  5F08 A;  2AQF A;  1WGX A;  3BR1 A;  2CW0 F;  2X6O A;  2MA3 A;  4HF0 A;  1ZRD A;  3TO9 A;  2K4J A;  1KA8 A;  3SEQ A;  4OU0 A;  3Q0V A;  3CUQ A;  3DKY A;  2OPT A;  4HST A;  1X2N A;  1SC7 A;  2CQX A;  3H35 A;  2FF4 A;  4XRM A;  3B6C A;  5EEH A;  4HNV A;  2FD5 A;  2R3S A;  2VXZ A;  1RET A;  5LGN A;  5DTD A;  3AKZ A;  4M6X A;  5D6E A;  1XSV A;  3LSG A;  4ETS A;  1UJ8 A;  4BQN A;  2I8D A;  5C3E J;  4ZYH A;  2AS5 F;  5L3F A;  2IEK A;  2DPD A;  4L9N A;  2DI3 A;  3IKV A;  4FX0 A;  4DOZ A;  1BR2 A;  1U9N A;  1B6A A;  2FA5 A;  2LYC A;  2XGD A;  3BR5 A;  3K4M A;  4RA2 A;  4HF1 A;  1BL0 A;  5EJC A;  1ITY A;  2CU7 A;  4PZJ A;  4EJT A;  1OYY A;  1FTZ A;  3RJP A;  1FSE A;  4ANJ A;  5EGO A;  4MLO A;  3BR0 A;  4MNU A;  3DBH B;  3Q0U A;  4EJO A;  4ENK A;  4A3K J;  1H9G A;  1OJL A;  2Y75 A;  5KNL A;  1PVE A;  2E1C A;  4YEJ A;  1YW7 A;  1U5T B;  3QPL A;  2OCE A;  1Z21 A;  4M74 A;  3COA C;  3T0Y A;  1JJ6 C;  2EIJ H;  1XMK A;  3KP3 A;  2XPU A;  4DJA A;  1WSU A;  1DU6 A;  1S72 I;  2OBP A;  2XAJ A;  3ERM A;  5DD4 A;  2HQR A;  1D1A A;  4EM0 B;  2MLK A;  2CUF A;  1SD4 A;  1ON1 A;  2JUC A;  1FX7 A;  3DTI A;  4CH7 A;  1VTN C;  2ZXJ A;  5GAH J;  3WU2 C;  1EH7 A;  5E3M A;  1VI0 A;  2AXL A;  1TTY A;  3HHG A;  4BDZ A;  3CP2 A;  1MBK A;  4F3Q A;  2BW3 B;  3M7G A;  4ZZD A;  3GFI A;  2L9V A;  1TC3 C;  3CCE I;  4C2T A;  2R7W A;  2M30 A;  3JTH A;  1IXS B;  1D0X A;  3Q3S A;  4S05 A;  3HDD A;  4ZDO A;  1YOV B;  3ASN H;  2V26 A;  1WQ2 A;  2VT2 A;  2P81 A;  4A3F J;  4A3B J;  3FXQ A;  2NS0 A;  4XK4 A;  4XLN F;  4XBF A;  3HTU A;  5KCM A;  2DQL A;  2F5F A;  4YFK F;  4KNY A;  3F72 A;  2ME6 A;  2GM4 A;  3KCC A;  2E5N A;  5F1J A;  3VSK A;  1A31 A;  1IXR C;  4EM2 A;  3CO6 C;  4L5E A;  2HPM A;  1SD5 A;  2HYF A;  3ZMZ A;  3HYI A;  3TMO A;  4JK1 X;  2HGC A;  1I3Q J;  2LF8 A;  2M87 A;  2KRF A;  2P5V A;  2FMY A;  1IRF A;  1APL C;  4ASN A;  1A35 A;  5J4Y A;  5FJ8 J;  1YJW I;  4P55 A;  2F48 A;  2DAO A;  3DPL C;  3OYD A;  1YRN A;  2YS9 A;  3OSF A;  4EMS A;  4M72 A;  5E8G A;  1P9Q C;  2ZFW A;  4KJZ A;  3LA3 A;  2DOD A;  4ZDL A;  4QLC U;  5LBQ A;  5BQT A;  1P4A A;  2TRT A;  5F0H A;  4LIT A;  5HNH A;  3KYC B;  1VQ4 I;  5LGU A;  3HC7 A;  1V3F A;  1IN7 A;  2DMP A;  3OYE A;  4B3A A;  1ZRE A;  3OV8 A;  3RDI A;  2W82 A;  4AU7 A;  1MJ9 A;  2DXI A;  4MTE A;  2BY0 A;  2QSG X;  3JRB A;  3I71 A;  4AWX B;  4LG0 A;  2XRN A;  3Q9S A;  3FM3 A;  5J3L A;  5DS9 A;  2OF7 A;  2G7H A;  2ZJ2 A;  3RI4 A;  3CDI A;  1D5Y A;  5IP7 J;  4RAG A;  1HXD A;  1JGG A;  1YG2 A;  3H3U A;  1UG2 A;  1EF4 A;  3GTG J;  5K7F A;  3ABL H;  4B09 A;  4DBQ A;  4E7S A;  1IRZ A;  3MD2 A;  4BQO A;  5EGO B;  1YHQ I;  2QQ8 A;  3GBG A;  3HUG B;  3O3K A;  4ZYA A;  3HIF A;  2EV5 A;  1T08 B;  1VZ0 A;  3SDG A;  2HPI A;  3CUQ C;  5FFX A;  5ICF A;  2VUM J;  3A0B C;  3DP7 A;  3MVP A;  4DW6 A;  4WXC A;  1MH3 A;  5HLT A;  2BXZ A;  2IW5 A;  4XRS A;  2Z33 A;  1O57 A;  1OCZ H;  2H27 A;  3OYM A;  4P9U A;  1OCP A;  1BJZ A;  3I56 I;  4AIK A;  3GFL A;  1BI0 A;  4EM1 A;  1UST A;  2IGO A;  2P6T A;  1WH5 A;  4ABZ A;  4ESB A;  3P7N A;  4XSX F;  4C3H J;  3HL2 A;  3JRH A;  2CUJ A;  2DFH A;  4ENM A;  4BXX J;  4RAY A;  1R49 A;  3LSR A;  4IOC F;  3ZQG A;  2RQP A;  4YRV A;  2OC6 A;  1KZH A;  3BY6 A;  4A3I J;  5JR3 A;  3A01 A;  1QZE A;  1R1U A;  1TT5 B;  3C2H A;  1RUN A;  2LMD A;  2CO5 A;  3HGG A;  3H5A A;  1AWC A;  2V9K A;  1QZY A;  1MND A;  3W6V A;  4UV8 A;  3PSI A;  2R7X A;  1B9N A;  4M73 A;  1D3Y A;  1GVJ A;  1ULY A;  4I0B A;  1SVO A;  2KP6 A;  1UEL B;  4A3G J;  3EDP A;  4N9I A;  2E34 A;  5K5O A;  4WWC A;  1Y0N A;  3O8H A;  4LLL A;  2O61 A;  3GTK J;  2H8R A;  2L5Q A;  2IGK A;  3IC7 A;  4PJM A;  5FKN A;  4A3M J;  1G4D A;  2VOD A;  2Z3Y A;  4UB6 C;  5K1Y A;  3IL2 A;  4YFX F;  3I4M J;  2E7W A;  1K6O A;  4V2F A;  2OZU A;  1BC8 C;  3HXL A;  1ZLK A;  3VFZ A;  3IRQ A;  3VYR B;  3AG2 H;  5FO5 A;  2HYJ A;  4Y15 A;  3HEF A;  3KZY A;  2JA5 J;  3J81 K;  4AYB A;  1YTY A;  2CFX A;  1WJC A;  3EUA A;  4BYY A;  4AUX A;  2HZD A;  2STW A;  4OIO F;  1SAN A;  3EUH A;  4FET A;  1KU2 A;  3FHZ A;  3HOX J;  2E2H J;  3T8T A;  3GTJ J;  1HOM A;  1YO5 C;  2NS8 A;  5FKL A;  2HR3 A;  2W48 A;  2XAQ A;  5M5Y J;  3PNV A;  2IP2 A;  1ETV A;  1I39 A;  1TZL A;  1TW2 A;  3IWF A;  3LQR A;  3TDZ C;  2D45 A;  4C3I J;  1R23 A;  4HG2 A;  4RM3 A;  1K78 B;  3R6S A;  4Y7N J;  2NAZ A;  3F8B A;  5JHF A;  5EDN A;  2W57 A;  2PJR A;  4X1E A;  1IDZ A;  2IBD A;  3WTY C;  2KFD A;  1WJE A;  5GTI C;  4G8X A;  1ZGW A;  3GME A;  4BHC A;  4XLC A;  1HDP A;  2EQR A;  2V9V A;  3BT9 A;  3K9T A;  2W24 A;  2DW4 A;  1ZAR A;  5ICE A;  3OYI A;  1ETQ A;  9ANT A;  2E1N A;  2EFP A;  3QPH A;  1BI3 A;  1B4A A;  4Y17 A;  1RKW A;  3HUG A;  4R8H A;  4V2G A;  2K7L A;  2JVH A;  1KU7 A;  3S1R J;  3K10 A;  1ZGA A;  1HKT A;  1IW7 F;  1G3S A;  1KU9 A;  3M3Y J;  2NS7 A;  4G6Q A;  3I53 A;  1ZEL A;  2JRT A;  4E7H A;  1WI3 A;  3IV5 A;  4B44 A;  4CGZ A;  1S5L C;  3FMS A;  4N4N B;  3J7A Y;  3IHU A;  2K9Q A;  1HC8 A;  3QQA A;  3KP6 A;  5D8L B;  4Y33 A;  4RLF A;  3S8P A;  1JKR C;  3CLQ A;  4ITV A;  2LKP A;  3WHC A;  3QWL A;  5J4V A;  2DT6 A;  2LBF B;  1MBJ A;  2WAQ N;  3SQN A;  3GTP J;  4Z6Y A;  4LOC A;  4WXH A;  4NBQ A;  4U7B A;  1JXS A;  4GO1 A;  4M3D A;  2X1C A;  4BE0 A;  2PMZ N;  1LDD A;  3RTR A;  2IA0 A;  4XN0 A;  2Y0M A;  4BDY A;  5E3O A;  2VQG A;  4R1H A;  4IHT A;  4HYE A;  1XGN A;  2IT0 A;  3HBL A;  3WGH A;  3OYH A;  1GVD A;  1P92 A;  5BOX A;  2K40 A;  2Y9Y A;  5GPC A;  1RR7 A;  1F36 A;  4RB3 C;  2F6C A;  2VI6 A;  2R0Q C;  4NC6 A;  3AL0 B;  5DCF A;  1UAA A;  2WAQ A;  2JQ7 A;  2RC4 A;  2MAB A;  5KAI C;  3OYJ A;  5M3M J;  3MZH A;  1A04 A;  2AO9 A;  3HOY J;  2MGQ A;  2XAH A;  3BG6 A;  3L09 A;  1T38 A;  1UCR A;  5LFA A;  3BCA A;  2B9S A;  3I5U A;  5FGM A;  5GTH C;  2L9N A;  4CYC A;  5BPD A;  2X6X A;  4MGR A;  5B3S H;  3BLY A;  3WU0 A;  4O3M A;  1T98 A;  4Q47 A;  1K79 A;  4L9V A;  2KHM A;  2IS1 A;  5EZG A;  2Q2E B;  3AG3 H;  2FML A;  5EYR A;  4I6Z A;  3KP2 A;  4B8X A;  3E0J B;  2UXN A;  2MW8 A;  3A4C A;  2ZNY A;  1ETW A;  2YX4 A;  1C0W A;  4OOI A;  1DP3 A;  2DYR H;  2GOX B;  3Q0W A;  4CCK A;  4GYI A;  2BOL A;  4EQQ A;  4OMZ A;  4I0A A;  4C2U A;  2M45 A;  4NC8 A;  5HS8 A;  2ZJR F;  3FDY A;  1DU0 A;  4IHW A;  1ODD A;  3PO3 J;  2PJR B;  4BQA A;  1U6G A;  3HSR A;  3CCR I;  2VE8 A;  1S8N A;  3FXO A;  1IJW C;  2JZY A;  2RGV A;  2VXD A;  2E19 A;  3CC7 I;  2E2J J;  2H09 A;  2BVM A;  2C6Y A;  4C30 A;  1QVT A;  1FJL A;  2OJE D;  2IGN A;  1R00 A;  2KIS A;  2JWT A;  2GA2 A;  3D5S C;  2M8E A;  4D9J A;  1FTT A;  2E1M C;  4KIB A;  1VQL I;  1GXQ A;  1VQP I;  1HA8 A;  1QNT A;  1IN6 A;  2DK8 A;  1ETX A;  2DBB A;  3BZ6 A;  4KIC A;  4V19 K;  3V8L A;  4Z2Y A;  5LEK A;  4N4O B;  4UUS B;  3OSG A;  2VOO A;  1XCB A;  3LOC A;  4BKX A;  4HBL A;  3ZQQ A;  1KON A;  2M4G A;  1POG A;  1TLH B;  2D1V A;  5K5R A;  2P0W A;  3UNG C;  3AFH A;  2HFH A;  4E7I A;  4O6J A;  2VLA A;  4I09 A;  1TT0 A;  3HJE A;  2P7V B;  2OTL I;  3CCU I;  2ELH A;  2JVG A;  4BJT A;  2BBY A;  2L01 A;  4CZC A;  1X1C A;  1CGP A;  2NYX A;  2WAE A;  4NUB A;  1ETY A;  1MMA A;  2KDZ A;  1D1C A;  2IVM A;  2W00 A;  3LNQ A;  5M5W J;  3ZMS A;  3VWB A;  1QPM A;  1X1B A;  1OR7 C;  2FNP A;  4U0V A;  1WJB A;  1LFB A;  3F8M A;  1PJR A;  2DFE A;  3GXO A;  2HVQ A;  4D1Q A;  1PUF A;  2O9L A;  4F91 B;  3DEW A;  4P96 A;  2LTP A;  4RLQ A;  2VE9 A;  1OCR H;  3LMM A;  4YIR X;  2WV0 A;  2Q8K A;  4RGX A;  4PGH A;  2R7T A;  5E3N A;  5BMZ A;  5E1X A;  3K6G A;  3JRA A;  2FEZ A;  1YJ9 I;  2WA0 A;  3VPR A;  4G7Z F;  1XDS A;  1U5T A;  5FKK A;  3RIR A;  4UUT A;  3DXJ F;  4DGW B;  2VL8 A;  1R58 A;  3LAJ A;  2DA1 A;  4NB5 A;  1ZK8 A;  3JTG A;  3E6B A;  4CDG A;  2LOO A;  3DFG A;  4OWR B;  3ZQF A;  3I3L A;  4XIC A;  4XOR A;  2LKS A;  3I0T A;  2QYO A;  3K2Z A;  2EPF A;  2NOG A;  4IF4 A;  1JUS A;  2KRH A;  1IZ1 A;  2M8G X;  4RB0 A;  3CMA I;  2WTE A;  3MAJ A;  3ROU A;  4ZDP A;  2ELK A;  3CLO A;  1FOK A;  2KJB A;  3FX3 A;  1U5T C;  3ABM H;  3OS1 A;  3G6E I;  2R7F A;  2VPL A;  2IXS A;  2JT1 A;  2M34 A;  2QA4 I;  3OMY A;  1BIA A;  4M6V A;  1LJ9 A;  3GZ5 A;  1MBH A;  1L0O C;  4WX9 A;  3GZN B;  1HKQ A;  1TNS A;  4KIT B;  5F64 A;  1AHD P;  1IAW A;  3K4L A;  3HTS B;  3EYI A;  3LA2 A;  4BAC A;  4KMF A;  3DWL E;  4L9T A;  4XRF A;  5JLX A;  3OIQ A;  1DDN A;  3DPT A;  4L0Z B;  3J7A O;  3ZGK A;  2FBK A;  4B3X A;  1FSH A;  4A69 C;  3OOP A;  4FX4 A;  1XSD A;  2NVQ J;  1QQI A;  3K1M A;  2Z5U A;  4CYC B;  2ZNZ A;  4LLN A;  3MKZ A;  2V1D A;  3S32 A;  3MQ0 A;  1V55 H;  2XAU A;  3RKY A;  1GT0 C;  5B1A H;  1IXC A;  3JRE A;  1T0F C;  2DO7 A;  3F0C A;  1FOW A;  2R5Z A;  1XD7 A;  2YU3 A;  4E7L A;  3KX2 A;  3CD6 I;  1WZ2 A;  2VT3 A;  3JW4 A;  4BJ5 C;  2BHY A;  2X4H A;  1DGR M;  5BNG A;  5IYC J;  1ZR4 A;  3ZOB A;  5IP9 J;  3CCS I;  1BI1 A;  3HG9 A;  3SFI A;  3K7A J;  4GDF A;  2FJ1 A;  3CC4 I;  3KE2 A;  1TWG J;  1MJB A;  3KP7 A;  4A93 J;  1WPK A;  3QAH A;  1VQK I;  1X3U A;  5LRR A;  2DA4 A;  1ZRF A;  3ZPL A;  3DEE A;  1O3T A;  1BW5 A;  4IRI A;  2LC2 A;  1JUP A;  1D8J A;  2Y31 A;  4KUM A;  1XC5 A;  3SFZ A;  2Y0S A;  3TDU C;  4BBR J;  1P4W A;  4P5O A;  1VFC A;  2CYY A;  3HSE A;  4IO9 F;  3WTW C;  2CQQ A;  2JUG A;  1FP1 D;  2CSO A;  2L02 A;  3GWZ A;  5TRD A;  1VQ7 I;  3E7L A;  2PJP A;  2O3F A;  1WHU A;  5DYM A;  1I3A A;  3I9V 2; 
#chains in the Genus database with same CATH homology
 3FZV A;  4Q48 A;  4CO8 A;  2DPU A;  5JFR A;  1O3S A;  1SFX A;  2H6C A;  4LB6 B;  1LDK B;  3FMQ A;  3R61 A;  3BJA A;  1ZAO A;  1FC3 A;  4M71 A;  4MEY F;  2H94 A;  3RKW A;  1HW5 A;  2ESH A;  4HQE A;  5IT9 Z;  2XGX A;  2L4A A;  1SAX A;  1GXP A;  2ZBK A;  1FPQ A;  2PN6 A;  1GHC A;  5AON A;  2HKX A;  1P2F A;  1R7J A;  4PDK A;  4HX4 A;  4ON0 A;  2COM A;  2O8X A;  2XRO A;  1HKS A;  1D8K A;  2EV6 A;  4RGR A;  1P6R A;  3S2W A;  1FYL A;  4N9H A;  4KN4 X;  2FRH A;  5DD8 A;  2L3D A;  1J7K A;  2EWN A;  2EJR A;  4G9Y A;  4K2E A;  1JHH A;  4OIQ F;  1WKM A;  4GGG A;  2DLL A;  1RNL A;  5LLQ A;  3BPV A;  1XSX A;  3V8K A;  3WGG A;  1PP7 U;  2KIU A;  1G3T A;  5H6Q A;  3EQL F;  1Z91 A;  4LK0 F;  5L3D A;  1F9N A;  4MEX F;  4HV6 A;  2RKH A;  1TNT A;  5IT3 A;  5CVR A;  1BM9 A;  1V4R A;  2NRA C;  3BWG A;  1XB4 A;  1YS6 A;  4HZF A;  2WWY A;  3R60 A;  3U2R A;  1QZZ A;  5E8I A;  4CZZ A;  1BC7 C;  2IPQ X;  1MJA A;  4RS8 A;  2HWV A;  1BOA A;  3HRS A;  2PBI A;  4LG0 B;  3DKW A;  3RYR A;  1FBQ A;  3C1D A;  3P9K A;  2DFI A;  1SMT A;  5J6X A;  2EFO A;  3VB2 A;  2EA2 A;  5D4R A;  5ICG A;  2XAS A;  4KYW A;  4RB1 A;  5E1Z B;  4UHT A;  3V8J A;  4UVB A;  1LEB A;  2BGC A;  5DCM B;  3V4G A;  2ZCW A;  4M6Y A;  1ZN2 A;  1TW3 A;  3RPQ A;  5AIQ A;  2MLG A;  1KQ0 A;  5ILV A;  3LAP A;  4A6E A;  1IN4 A;  5FD6 A;  1ZRC A;  2YR2 A;  5DUI A;  4ZYG A;  3U9G A;  1R22 A;  3BJ6 A;  3WOD F;  1USS A;  1G3Y A;  3G73 A;  5EEG A;  4I01 A;  2QLZ A;  3SHF A;  2MD5 A;  2IA1 A;  2XAF A;  4KN7 X;  3I64 A;  1I27 A;  2Q0O A;  1FYK A;  2GQQ A;  1PDN C;  4PCQ A;  1HW1 A;  4YIF A;  1SD7 A;  3W6K B;  1IF1 A;  2FU4 A;  1R1T A;  2QVO A;  2Z99 A;  4XLP F;  5TJJ A;  3K0L A;  1ONV A;  1XMA A;  5CVJ A;  1O7L A;  1T6S A;  3IWZ A;  2ZME A;  2ZKZ A;  2GA1 A;  3SXY A;  2QUF A;  1Z6R A;  2HTS A;  1W7P D;  1JGS A;  1KGS A;  1SFU A;  2EB7 A;  2ZO4 A;  2M1B A;  5D4S A;  2V6C A;  4LMY A;  2XV4 S;  3H3Z A;  2A07 F;  1B9M A;  5HS9 A;  2VC0 A;  1MDM B;  5HVQ C;  3QP6 A;  1IN5 A;  4DNC A;  4I2O A;  2ACJ A;  1EH6 A;  5L3E A;  3WTV C;  2ESN A;  3BP8 A;  3WU1 B;  1F5T A;  5F6F A;  4IXA A;  1YS7 A;  4HLX A;  3IKT A;  2FE3 A;  2KIF A;  2A6E F;  1U3E M;  1MKM A;  4M9X A;  3CTA A;  2DT5 A;  5IT9 K;  2XUB A;  4IJA A;  1OKR A;  3ERE D;  4HV5 A;  4UUV A;  3RKX A;  5LGT A;  3KET A;  3T8R A;  1QGP A;  3F23 A;  1J75 A;  1HST A;  1I6X A;  1LDJ A;  2Y48 A;  3JAM Z;  1STZ A;  3GVA A;  3WE3 A;  3WTU C;  3KLO A;  5FLX K;  3GX4 X;  4OMY A;  3QP5 A;  1Z7U A;  5D5W B;  5DCM A;  1OPC A;  5D6F A;  2VC1 A;  1U2W A;  4EGZ A;  2RVC A;  2QQ9 A;  2L4M A;  4JQF A;  2BEO A;  5E20 A;  3MCZ A;  4F7Z A;  3GO5 A;  3WTS C;  1I1G A;  4G7O F;  3O2P E;  3BDD A;  3C7J A;  3E6C C;  4KFC A;  5JVT A;  1MD0 A;  6PAX A;  2W85 A;  1W7P B;  3V7C A;  4U0Y A;  3LFK A;  5HOO A;  4KDP A;  3WTZ A;  5L3G A;  1YIO A;  4MQ9 F;  2PQ8 A;  4HAM A;  2E7X A;  3VEP A;  3QOP A;  2GWR A;  4UV9 A;  1LB2 A;  4RGS A;  2LSO A;  3HOT A;  1U78 A;  1SFE A;  2YSR A;  4A5N A;  3DQV C;  5E18 F;  4IRG A;  1ZGJ A;  1I1S A;  2CWE A;  3WG9 A;  4A0Z A;  4H0E A;  3DF8 A;  5HLG A;  4GYG A;  4YII A;  2MBF A;  5ED4 A;  1J2X A;  2FBH A;  3ZQ7 A;  4IRH A;  2G7U A;  1FBU A;  5KVR A;  3ULQ B;  4AVP A;  5LEJ A;  1JHF A;  2JSC A;  1HW2 A;  1K7A A;  4HOB A;  3NRV A;  2LF7 A;  2KKO A;  3LWF A;  1RIO H;  2PI0 A;  1G3W A;  2BYV E;  5D5V B;  3HRM A;  4GCV A;  2O0Y A;  5H6R A;  2J5P A;  2QM3 A;  2QQA A;  1Z9C A;  1W5T A;  3F8C A;  3GUD A;  3HSF A;  4EJV A;  2NNY A;  1LVA A;  3ZMT A;  1J9I A;  2CGP A;  2OU2 A;  4NQW A;  2DTR A;  3E6M A;  3KP5 A;  1R36 A;  1XCV A;  1PUE E;  5D5X B;  1XDU A;  3J80 K;  3SZP A;  3WTX C;  5DV5 A;  2XAG A;  3I59 B;  4EVI A;  5LHI A;  1IRG A;  4L18 B;  3JSO A;  3HRU A;  2PFB A;  1U8R A;  2Z9O A;  4MHG A;  1NHA A;  3QRF F;  3QPT A;  1YW8 A;  3K69 A;  2VBW A;  3R0J A;  3GYH X;  3B73 A;  2P5K A;  5D5U B;  3GFJ A;  3KEQ A;  3V7S A;  3I54 A;  4AD9 A;  4UVA A;  1XGO A;  1W5S A;  1ZH5 A;  3GZ6 A;  4WK8 F;  4FT8 A;  2JTV A;  2EV0 A;  3L00 A;  5J8C A;  4IVN A;  3AAF A;  1F4K A;  1S29 A;  1P4X A;  5BS6 A;  4A0Y A;  2EK5 A;  2RN7 A;  2HTJ A;  2FXA A;  2L54 A;  3D5L A;  3BRO A;  4UXN A;  2HOE A;  2VN2 A;  1MZB A;  5HLH A;  2V79 A;  2B0L A;  4RAZ A;  3I58 A;  5L3B A;  2Q2E A;  2BV6 A;  3JAM K;  4UVC A;  2UZK A;  1S3J A;  2PLY A;  2GXB A;  4AIH A;  5BPI A;  3ABT A;  2EFW A;  1XGM A;  3ZN1 A;  2A3S A;  3MEX A;  3K1N A;  2D2W A;  2RNJ A;  1R5H A;  2XIG A;  2F5C A;  2K86 A;  4ZYD A;  4EV0 A;  1KYW A;  5ICC A;  4RB2 C;  4LK1 F;  1WRJ A;  1PP8 F;  3SZT A;  1FWZ A;  5CVV A;  2MC3 A;  2VBZ A;  4LFU A;  3CUQ B;  5LHH A;  4L5J A;  2KIM A;  5DDG A;  2ZME B;  4HQM A;  1OYW A;  3KFW X;  3ABU A;  2OD5 A;  2EA4 A;  3E5U A;  4MQV A;  1R5G A;  4ZZL A;  5K5Q A;  4KIG A;  1Q1H A;  3PQK A;  1D5V A;  2F5D A;  4E70 A;  3L9F A;  2ETH A;  3EET A;  1KYZ A;  4ZH4 F;  4TV7 A;  3T1B A;  1S7O A;  2QQB A;  2NNN A;  3G3Z A;  5CVI A;  3C18 A;  1OMI A;  3LQQ A;  2XVC A;  4KIF A;  4Y13 A;  4LJZ F;  4BAY A;  1QBJ A;  3E5Q A;  1YW9 A;  4G94 A;  4JBA A;  4KMU X;  4OIN F;  5JHU A;  2FNA A;  4EJW A;  5HDN A;  4IHS A;  1AOY A;  1UFM A;  2OAZ A;  3HRT A;  1IN8 A;  4HX8 A;  2P4W A;  2FOK A;  1YLF A;  3RYP A;  2V1X A;  1ZLJ A;  4LD5 A;  3REO A;  3WE2 A;  1CF7 A;  3CJN A;  1LNW A;  1O7F A;  3U1D A;  3ZMD A;  2XKO A;  1UHM A;  3NQO A;  2F2E A;  4NHJ A;  4U7D A;  5HDK A;  3FXR A;  3KLN A;  1ZG5 A;  2G9W A;  1LQ1 A;  2XKP A;  3BJO A;  2PEX A;  4L5I A;  3R0A A;  3J81 Z;  3RPU A;  1FP2 A;  2A68 F;  3LA7 A;  1H9T A;  3TOA A;  4CHU A;  1MGT A;  3GEZ A;  1EV7 A;  4UNO A;  3PFI A;  1BJA A;  2P6S A;  4HF2 A;  1W4M A;  1O3R A;  2DU9 A;  1DUX C;  2W25 A;  1L3L A;  3TQN A;  1IUY A;  3MFK A;  4Q4Z F;  1FLI A;  2A6H F;  5CYV A;  2IJL A;  3F22 A;  3B02 A;  1O3Q A;  4D0P A;  5HLI A;  2R7D A;  3FXU A;  2IA2 A;  2H6B A;  3VOE A;  3CDH A;  1Z6T A;  1F1Z A;  4U0W A;  2O03 A;  3QU3 A;  3MZY A;  3WGI A;  5AIP A;  5DEQ A;  1T0F A;  4L9J A;  1J5Y A;  5F1R A;  1SMY F;  4ENJ A;  2P7C B;  4LLG F;  1DPU A;  4P9F A;  1BBY A;  1QO0 D;  3C3W A;  2HQN A;  1ON2 A;  3F6V A;  4HW0 A;  3M8F A;  4FHT A;  4M9S A;  3H92 A;  4WCG A;  5E17 F;  4KT5 C;  5FD5 A;  4WXD A;  1DPR A;  3MWM A;  2K4B A;  3E3V A;  4A12 A;  2GAU A;  2RV8 A;  1T39 A;  5L3C A;  4ENN A;  2ISZ A;  2TDX A;  3O6B B;  2HKO A;  3LST A;  1Y0U A;  4A2U A;  2K27 A;  5LHG A;  2CQK A;  2A69 F;  4U88 A;  1J0R A;  2XHK A;  4A6D A;  5ILU A;  5FFZ A;  1REP C;  1HBX G;  3FM5 A;  3F8F A;  4BH9 A;  3BOQ A;  5HS7 A;  4BNC A;  3F21 A;  4XSZ F;  1WWX A;  2HYG D;  2JPB A;  3EYY A;  3TOB A;  5J8F A;  2QBY A;  4MTD A;  1XN7 A;  3CUO A;  3GF2 A;  3I59 A;  1S7A A;  3WTT C;  4CIC A;  4BHP A;  5A2Q K;  2P5L C;  2PMH A;  5FB2 A;  2ISY A;  1JE8 A;  1OR7 A;  4WF2 A;  5CVU A;  1B59 A;  1W7P A;  1TBX A;  4O5V A;  4M9Z A;  3L7W A;  3HHH A;  5H20 A;  3GLX A;  3ISP A;  1Z1D A;  1BN5 A;  3PQJ A;  3ECH A;  3JSP A;  2FQ3 A;  3ZN0 A;  1Z05 A;  2PMU A;  4A5M A;  3GFM A;  2GXG A;  2X0L A;  1FNN A;  2UXX A;  2OQR A;  1XGS A;  2KJC A;  1FBS A;  3Q9V A;  1FY7 A;  3ML6 A;  2GZW A;  3M9A A;  4I7H A;  4ESJ A;  3F8N A;  3KP4 A;  1I5Z A;  4OIP F;  2OA4 A;  3E6D A;  1HQC A;  2V1U A;  1RUO A;  3M1E A;  5FLX Z;  4R79 A;  3FMR A;  2LDU A;  2WC2 A;  1TQI A;  1H0M A;  1G6N A;  4L0Y B;  3F3X A;  1YQA A;  1E17 A;  2STT A;  1HSJ A;  1BIB A;  1FZP B;  5HDG A;  5CJ9 A;  2GIV A;  3T5X A;  2VBX A;  4S04 A;  1YYV A;  2HDC A;  2O6G E;  4YFN F;  2HZT A;  4HX7 A;  2K02 A;  2A5Y B;  5ILS A;  3IRR A;  1R1V A;  5DUK A;  3N97 A;  2W84 A;  4EJU A;  4ESF A;  2CG4 A;  4Q5S F;  2HS5 A;  3Q5F A;  4EGY A;  1ZG3 A;  4GXO A;  3M8E A;  2EFN A;  2OZ6 A;  4RGU A;  4HDV A;  2OQG A;  2BE5 F;  1T2K A;  3D0S A;  3HOS A;  2ADU A;  2QBY B;  4I98 B;  1KQ8 A;  2PG4 A;  1EH8 A;  2YX7 A;  2VBY A;  3L2C A;  1E2X A;  2JPC A;  2DK5 A;  2RDP A;  1YFH A;  1B1B A;  4PGG A;  3FWE A;  1WI9 A;  5LRS A;  1DP7 P;  3ECO A;  4KA4 A;  1TQM A;  3J80 Z;  2VON A;  3VOD A;  3ZMV A;  3P9I A;  4LGW A;  2D1H A;  1SD6 A;  1LEA A;  4ZYE A;  2M5W A;  4DQ2 A;  4G7H F;  1S6L A;  3BPX A;  4AIJ A;  3NEU A;  1TQP A;  3V7R A;  5D8K B;  4LB5 A;  3ZMU A;  3E5X A;  4IPA A;  2P8T A;  2DQR A;  5CLS A;  1RZ4 A;  3ZP5 A;  3ELK A;  3KZZ A;  3GW2 A;  3E97 A;  2MH9 A;  2QWW A;  2IRF G;  2QZ8 A;  5ERI A;  1MDM A;  1UB9 A;  4N0B A;  4CXF A;  1KU3 A;  2A61 A;  1FYM A;  2QEN A;  1FT9 A;  3K1P A;  4HLY A;  4QWQ A;  4OIR F;  3CO7 C;  4CYD A;  3KEO A;  1CF7 B;  4HDU A;  2FBI A;  1KQ9 A;  1BI2 A;  1UHW A;  2J5O A;  4BHB A;  2LNB A;  3DEU A;  5A2Q Z;  2MH2 A;  1RI7 A;  2VOP A;  3F6O A;  2EFQ A;  4YG2 F;  4A0X A;  3W6J B;  5KK1 A;  1J59 A;  2F5E A;  2FSW A;  4HA8 A;  3TGN A;  2YPR A;  3DV8 A;  5JI6 A;  5E1W A;  2HEO A;  1K78 A;  3P9C A;  2UWM A;  4BXU A;  4I02 A;  3TO6 A;  1OYI A;  3I4P A;  3FF5 A;  1ZG1 A;  1ZHF A;  3QU6 A;  3TO7 A;  3R4K A;  3TKY A;  4G6D A;  3N4M A;  2CW0 F;  2MA3 A;  4HF0 A;  1ZRD A;  3TO9 A;  2K4J A;  1KA8 A;  4OU0 A;  3CUQ A;  2FF4 A;  5EEH A;  2R3S A;  2VXZ A;  5LGN A;  4M6X A;  5D6E A;  1XSV A;  4ETS A;  2AS5 F;  4ZYH A;  5L3F A;  2DPD A;  4L9N A;  2DI3 A;  3IKV A;  4FX0 A;  1B6A A;  2FA5 A;  4HF1 A;  4PZJ A;  4EJT A;  1OYY A;  3RJP A;  1FSE A;  4MNU A;  4EJO A;  4ENK A;  1H9G A;  2Y75 A;  2E1C A;  1YW7 A;  1U5T B;  4M74 A;  3COA C;  3T0Y A;  1XMK A;  3KP3 A;  1WSU A;  2OBP A;  2XAJ A;  5DD4 A;  2HQR A;  4EM0 B;  2MLK A;  1SD4 A;  1ON1 A;  1FX7 A;  1VTN C;  2ZXJ A;  1EH7 A;  2AXL A;  1TTY A;  3HHG A;  3M7G A;  4ZZD A;  3GFI A;  2M30 A;  3JTH A;  1IXS B;  4S05 A;  1WQ2 A;  2VT2 A;  3FXQ A;  2NS0 A;  4XLN F;  4XBF A;  3HTU A;  2DQL A;  2F5F A;  4YFK F;  4KNY A;  3F72 A;  3KCC A;  1IXR C;  4EM2 A;  3CO6 C;  1SD5 A;  2HYF A;  3ZMZ A;  3HYI A;  4JK1 X;  2HGC A;  2LF8 A;  2M87 A;  2KRF A;  2P5V A;  2FMY A;  1IRF A;  4ASN A;  4P55 A;  2DAO A;  3DPL C;  4EMS A;  4M72 A;  5E8G A;  2ZFW A;  3LA3 A;  4QLC U;  5LBQ A;  5BQT A;  1P4A A;  5LGU A;  1V3F A;  1IN7 A;  1ZRE A;  3OV8 A;  3RDI A;  1MJ9 A;  4MTE A;  3I71 A;  4AWX B;  4LG0 A;  2XRN A;  3Q9S A;  3FM3 A;  2G7H A;  2ZJ2 A;  3RI4 A;  1HXD A;  1YG2 A;  3H3U A;  4B09 A;  3O3K A;  3HIF A;  2EV5 A;  5FFX A;  3CUQ C;  5ICF A;  3DP7 A;  4WXC A;  2H27 A;  2IW5 A;  2Z33 A;  1O57 A;  4P9U A;  4AIK A;  3GFL A;  1BI0 A;  4EM1 A;  1UST A;  2P6T A;  4ESB A;  3P7N A;  4XSX F;  4ENM A;  4RAY A;  2RQP A;  3BY6 A;  5JR3 A;  1R1U A;  1RUN A;  2CO5 A;  1AWC A;  1QZY A;  4UV8 A;  1B9N A;  4M73 A;  1D3Y A;  1GVJ A;  1ULY A;  4I0B A;  3EDP A;  4N9I A;  5K5O A;  4WWC A;  4LLL A;  2O61 A;  3IC7 A;  1G4D A;  2VOD A;  2Z3Y A;  5K1Y A;  3IL2 A;  4YFX F;  2E7W A;  1K6O A;  2OZU A;  1BC8 C;  1ZLK A;  3VFZ A;  3IRQ A;  5FO5 A;  4Y15 A;  3KZY A;  3J81 K;  1YTY A;  2CFX A;  2STW A;  4BYY A;  4OIO F;  3EUH A;  1KU2 A;  3FHZ A;  3T8T A;  1YO5 C;  2HR3 A;  2XAQ A;  2IP2 A;  1TW2 A;  3IWF A;  3LQR A;  3TDZ C;  2D45 A;  1R23 A;  1K78 B;  3R6S A;  2NAZ A;  3F8B A;  2W57 A;  3WTY C;  4G8X A;  4BHC A;  2V9V A;  3K9T A;  2W24 A;  2DW4 A;  1ZAR A;  5ICE A;  2E1N A;  2EFP A;  3QPH A;  1BI3 A;  1B4A A;  4Y17 A;  3HUG A;  4R8H A;  2K7L A;  1KU7 A;  1ZGA A;  1HKT A;  1IW7 F;  1G3S A;  1KU9 A;  4G6Q A;  3I53 A;  2JRT A;  4CGZ A;  3FMS A;  3IHU A;  3KP6 A;  5D8L B;  2LKP A;  3SQN A;  4WXH A;  4U7B A;  1JXS A;  4GO1 A;  3RTR A;  1LDD A;  2IA0 A;  2Y0M A;  4R1H A;  4IHT A;  4HYE A;  1XGN A;  2IT0 A;  3WGH A;  1P92 A;  5BOX A;  4RB3 C;  5DCF A;  2RC4 A;  3MZH A;  1A04 A;  2XAH A;  3L09 A;  1T38 A;  1UCR A;  3I5U A;  5FGM A;  5BPD A;  4MGR A;  3WU0 A;  4O3M A;  1T98 A;  4Q47 A;  1K79 A;  4L9V A;  2FML A;  3KP2 A;  4B8X A;  2UXN A;  2ZNY A;  2YX4 A;  1C0W A;  4OOI A;  4GYI A;  4EQQ A;  4OMZ A;  4I0A A;  2M45 A;  5HS8 A;  1ODD A;  4BQA A;  1U6G A;  3HSR A;  2VE8 A;  1S8N A;  2JZY A;  2RGV A;  2H09 A;  2C6Y A;  1R00 A;  2GA2 A;  2M8E A;  4KIB A;  1GXQ A;  1QNT A;  1IN6 A;  2DK8 A;  2DBB A;  3BZ6 A;  4KIC A;  3V8L A;  4Z2Y A;  5LEK A;  2VOO A;  1XCB A;  4HBL A;  1TLH B;  2D1V A;  5K5R A;  2HFH A;  4O6J A;  4I09 A;  2P7V B;  2ELH A;  2BBY A;  2L01 A;  1CGP A;  2NYX A;  2IVM A;  3ZMS A;  1QPM A;  2FNP A;  4U0V A;  3F8M A;  3GXO A;  4P96 A;  2VE9 A;  2WV0 A;  2Q8K A;  4RGX A;  4PGH A;  5BMZ A;  5E1X A;  2FEZ A;  4G7Z F;  1XDS A;  1U5T A;  3RIR A;  3DXJ F;  1R58 A;  3LAJ A;  4NB5 A;  3JTG A;  4CDG A;  3E6B A;  3DFG A;  3I0T A;  2QYO A;  3K2Z A;  4IF4 A;  1IZ1 A;  4RB0 A;  2WTE A;  3MAJ A;  3ROU A;  1FOK A;  3CLO A;  2KJB A;  3FX3 A;  1U5T C;  2R7F A;  2JT1 A;  1BIA A;  1LJ9 A;  3GZ5 A;  1L0O C;  4WX9 A;  1HKQ A;  1TNS A;  5F64 A;  1IAW A;  3HTS B;  3EYI A;  3LA2 A;  4KMF A;  4L9T A;  4XRF A;  1DDN A;  3DPT A;  4L0Z B;  3J7A O;  2FBK A;  1FSH A;  4FX4 A;  3OOP A;  1XSD A;  1QQI A;  3K1M A;  2Z5U A;  2ZNZ A;  4LLN A;  2V1D A;  3MQ0 A;  3RKY A;  1IXC A;  2DO7 A;  1XD7 A;  2YU3 A;  2VT3 A;  3JW4 A;  2X4H A;  1BI1 A;  3KE2 A;  1MJB A;  3KP7 A;  3QAH A;  1X3U A;  5LRR A;  1ZRF A;  3ZPL A;  1O3T A;  4IRI A;  1D8J A;  4KUM A;  3SFZ A;  3TDU C;  1P4W A;  4P5O A;  2CYY A;  3HSE A;  3WTW C;  1FP1 D;  2CSO A;  2L02 A;  3GWZ A;  5TRD A;  2PJP A;  2O3F A;  1ZYR F;  5DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...