1CF7A

Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*TP*TP*TP*TP*CP*GP*CP*GP*CP*GP*GP*TP*TP*TP*T)-3
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02319 E2F_TDP E2F/DP family winged-helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cf7A00
3JSPA 3R60A 1XMKA 3QU3A 4L9VA 3I58A 3HYIA 4IRGA 1P4WA 4UV9A 5BS6A 2PQ8A 1YO5C 4EJVA 4P55A 1K78A 3HSEA 1U5TB 1MDMB 3H3ZA 1B1BA 3G3ZA 2QENA 1BJAA 3CUQC 2PMUA 3JTGA 2L01A 1PUEE 3QPHA 5LHHA 2OAZA 1T2KA 1QPMA 2UXXA 5KVRA 2HOEA 1ZREA 2RV8A 3KFWX 3GF2A 2GWRA 5HLGA 4G6QA 1HW1A 1U78A 2K27A 2EWNA 3BJ6A 3ULQB 4R1HA 3RPQA 1I1GA 1OR7A 1T39A 4KMFA 2EFQA 1Z05A 3P9KA 2EV5A 4M6YA 1WSUA 2VBXA 2XAFA 4BAYA 1XB4A 4LGWA 3JAMZ 1C0WA 1GHCA 1XD7A 3DQVC 1FBSA 3MZHA 1T98A 4RB3C 2Z9OA 5LGUA 2FBHA 3ECOA 3MZYA 1IN4A 3HHHA 3KP5A 3HHGA 2O6GE 1S7OA 1P2FA 4UVCA 5ILUA 4HBLA 3HTSB 3QPTA 2RKHA 4MHGA 2MBFA 1RI7A 3P9CA 3H92A 2VODA 2ZO4A 1SD7A 3F23A 1PP7U 3GX4X 2XAJA 3L2CA 3F22A 2LF8A 2KIMA 3EUHA 4HZFA 1BI0A 2HKXA 2FOKA 3KP3A 2A6HF 2WV0A 4G9YA 3EYIA 2YSRA 1L0OC 2TDXA 2X0LA 3NQOA 2ZCWA 4MEXF 4WXHA 3M8FA 2ESNA 3QP6A 4EV0A 4RGUA 2EFOA 4P9UA 1EH8A 3WTWC 4YIFA 4E70A 4GCVA 1AOYA 3P7NA 1T0FA 4PGHA 1H0MA 1SD5A 3E97A 4CYDA 2DW4A 3OV8A 4EQQA 1JE8A 3BY6A 2RDPA 2QQBA 1ZHFA 2IA1A 5KK1A 3MCZA 2XRNA 3FMQA 3SFZA 1HBXG 1H9GA 5HS8A 3O6BB 2H6CA 4HX8A 2CW0F 5CVRA 2GXBA 3P9IA 2Y0MA 4CICA 2B0LA 1B59A 5J8FA 4B8XA 1MJAA 3F72A 1XDSA 1D8JA 3COAC 3TDUC 5D8LB 2FBKA 1ZRFA 1ZN2A 1XSXA 1QZZA 1E2XA 2XIGA 2IW5A 1I1SA 1MJBA 2RGVA 3I71A 5FFXA 3U2RA 4AIJA 3IWZA 2NNYA 2EJRA 4I02A 4ZH4F 3GZ6A 2KIUA 1IW7F 4UUVA 4ASNA 4G7OF 4L5IA 3GLXA 3TGNA 2Z33A 1F5TA 1FWZA 2EK5A 1T38A 4CO8A 5F64A 5TRDA 1J0RA 1FYMA 5JVTA 3WTTC 5LEJA 1LNWA 5ED4A 3TKYA 3KLOA 4HDVA 2E7XA 4BXUA 3BJAA 1HXDA 1TBXA 2G7UA 5LHIA 4A5NA 3IKVA 3FM3A 4ZYDA 5DV5A 2L3DA 3BPVA 3MWMA 1YG2A 2DLLA 2Q0OA 3ERED 2GAUA 2XROA 3E5QA 1IXRC 5LEKA 3RDIA 2X4HA 4KIFA 2DQLA 5JFRA 2BV6A 2QM3A 5IT3A 1W4MA 5BMZA 1VTNC 1Z7UA 4ETSA 4L18B 4KYWA 3WG9A 3L9FA 2QVOA 3ELKA 2HKOA 3IHUA 2R7DA 4F7ZA 5K5RA 3ECHA 1PDNC 3QAHA 3HOTA 1JXSA 3M8EA 1UCRA 1BOAA 2VBWA 4KNYA 2XKPA 1WWXA 3C7JA 5FLXZ 1LB2A 2H94A 1ON1A 1XSDA 2A61A 1YFHA 1BBYA 1YLFA 2LKPA 4PZJA 4RGRA 1JHHA 1FYKA 1HKSA 5H6RA 1ZG5A 1L3LA 3ZN0A 3BJOA 1P4AA 3K1PA 3AAFA 1BN5A 1Z6RA 4BQAA 1SFEA 2XASA 1BC8C 5L3DA 2PN6A 4XSZF 4LFUA 2IT0A 2ZMEA 1R7JA 4NHJA 1T6SA 2RQPA 1ULYA 1H9TA 2P8TA 4CDGA 5HLIA 5CYVA 1Z9CA 1BI3A 2J5PA 2E1NA 4UHTA 5HLHA 5F1RA 5LLQA 2H6BA 3ZMVA 4YG2F 3REOA 2PJPA 3LAPA 3WGIA 2VE9A 3O3KA 3JW4A 4YFXF 5ERIA 5L3GA 1TNTA 1GXPA 4MTDA 3BOQA 4BHPA 1I6XA 4EJWA 3J80Z 3HOSA 3WE3A 5CVJA 2JT1A 5DCMA 1SMTA 5D5WB 4GGGA 2K4JA 2XGXA 5CJ9A 3D0SA 3RKYA 4RS8A 4BHCA 4O6JA 4YFNF 3HIFA 1U6GA 1RUNA 3E5XA 3ZPLA 2BGCA 2M87A 1UHMA 4ENJA 1D8KA 3C3WA 4MQ9F 3WGHA 2A6EF 1ZG3A 4WXDA 5LBQA 2MA3A 1RNLA 4FT8A 1KA8A 5E8IA 2L54A 3FXQA 2V1XA 4WWCA 1Y0UA 3LA3A 1SD4A 2QQ9A 5H20A 2BYVE 1O57A 4G7HF 2OU2A 3BP8A 1GXQA 4B09A 3SZPA 1XDUA 3HSFA 3LA2A 3FMSA 2MH9A 1R5HA 4MNUA 3V8LA 1ZLJA 4WXCA 1BI2A 4EM1A 5HDGA 3O2PE 1MKMA 1EH6A 1TW2A 1BIAA 2JZYA 4LK0F 5J6XA 5FGMA 3RKXA 3EYYA 5A2QZ 2JSCA 3R6SA 1HW5A 2AXLA 3VODA 3K2ZA 5JR3A 1ZG1A 3FF5A 1K7AA 1RZ4A 4HV5A 4N9HA 4ZZLA 4PGGA 2KIFA 3RYPA 2O03A 5TJJA 3E6CC 1I27A 5DUIA 4FHTA 1YIOA 2Z3YA 1CF7B 1UHWA 3CO6C 2RC4A 1EV7A 4YIIA 1FSHA 1FBUA 1J5YA 3VOEA 4FX0A 3DFGA 4U7BA 2D1VA 2CGPA 4U7DA 1IN8A 5HDKA 2M1BA 1XGOA 2STWA 2EFPA 1MDMA 2JPBA 4WCGA 2GIVA 2CFXA 1IUYA 2QUFA 5DYMA 4M9SA 1U2WA 3IWFA 3QRFF 4LLNA 4OIQF 5D4SA 2DU9A 1J59A 3KP2A 4NB5A 2M8EA 5LRSA 1KQ8A 3I5UA 4LB6B 2M30A 2WTEA 1K79A 1LQ1A 5BPIA 2A69F 5FB2A 3L7WA 4QWQA 1RUOA 1TQMA 4EJUA 4EM0B 3LAJA 1U5TA 4EVIA 4XLPF 2A3SA 3DXJF 3KE2A 2RVCA 1MZBA 2F5FA 3ZQ7A 1O3QA 1W7PB 4KIBA 5BPDA 2UXNA 2EFNA 4TV7A 1IZ1A 4N0BA 2VOOA 1R5GA 1FP2A 5D6FA 5E1ZB 3WE2A 2HQRA 1XMAA 4CZZA 5DUKA 1FYLA 4I0BA 2UWMA 1QQIA 2R3SA 2O8XA 2OQGA 2QQAA 5EEGA 1OYWA 2CQKA 4JK1X 2OA4A 3ISPA 3Q5FA 4CHUA 3WGGA 4EMSA 3KP6A 4UNOA 1B4AA 1SFUA 1B6AA 2DK8A 3EDPA 2P6TA 4WF2A 1BC7C 3BROA 2V1UA 5AIQA 3ABTA 1DUXC 3L09A 1Z1DA 1QGPA 2RN7A 5ICCA 2FXAA 2Z5UA 5E18F 4KMUX 1LVAA 1V4RA 3V4GA 1YYVA 4GYIA 4G94A 3WTZA 1SAXA 3I59B 2GXGA 1J9IA 1DPRA 4EM2A 4OIRF 1S29A 3FXRA 3RYRA 1BIBA 3KLNA 2VT3A 3GXOA 1PP8F 1I5ZA 5E8GA 1YW8A 3E3VA 1IXSB 2EB7A 1ZAOA 2OBPA 2VONA 1E17A 2VE8A 1G6NA 4P5OA 4RGXA 3Q9SA 1B9MA 4A0XA 1QO0D 4DNCA 2NNNA 3K0LA 3R61A 2FRHA 1JGSA 1K78B 4UV8A 4RGSA 4Z2YA 3F21A 1U3EM 4AVPA 4G6DA 3QOPA 3VEPA 5ICFA 2W25A 4N9IA 4IF4A 2YX4A 4PCQA 4Y15A 2IJLA 3WTVC 2YX7A 4MEYF 4HF2A 1O3SA 2EA4A 3B02A 2FMYA 2RNJA 1P6RA 3ZMUA 2KKOA 1W7PD 4GYGA 3EETA 1IN6A 1G4DA 2FA5A 5D5XB 2XVCA 3GFMA 4OIPF 3F3XA 3GZ5A 3ZP5A 3LQRA 3J81Z 5DEQA 1W7PA 3I53A 1W5TA 5E1WA 4XLNF 2ZFWA 3HRMA 4CXFA 3GFJA 1S8NA 5IT9K 4L9JA 4UVAA 2ISZA 5HVQC 1YS7A 3PQKA 2BBYA 5LGNA 2KJBA 1IRGA 3PQJA 4IJAA 5BQTA 4RAYA 3CUQA 1AWCA 2NYXA 1J75A 3RTRA 3V7SA 4PDKA 3ROUA 5F6FA 4NQWA 1S3JA 1OMIA 4IRIA 2G7HA 3HRUA 1QNTA 3FHZA 2A5YB 2IRFG 3BWGA 4HX7A 4LG0A 5E17F 4KICA 1TNSA 4M6XA 3E6BA 3SZTA 4KA4A 3TDZC 2R7FA 4A12A 4LLLA 1IN7A 4Y17A 2WC2A 3CO7C 4CGZA 2FF4A 4M72A 3K1NA 1OPCA 4HLXA 3CUQB 3SQNA 1G3SA 3HRTA 3OOPA 5JHUA 2DO7A 2CSOA 1R23A 1XCVA 4MTEA 3ZMSA 3HUGA 3GFIA 3WTXC 4ZYHA 2GA1A 2HTJA 3NRVA 4OINF 1ZH5A 4WK8F 2PI0A 5D5VB 2PEXA 1B9NA 1TW3A 5A2QK 2JRTA 1FLIA 2Y48A 2DK5A 2HR3A 1TTYA 3GVAA 5HDNA 2QYOA 1X3UA 4HYEA 2PBIA 1MD0A 2H27A 2ZNZA 4O5VA 4IHTA 3BPXA 1TLHB 2HEOA 3E5UA 1KGSA 2EV6A 3Q9VA 1LEBA 2P7CB 1YTYA 4KN7X 1O3TA 2CO5A 4S04A 3V7RA 4L5JA 1A04A 1R1VA 2HYGD 4A6DA 3GWZA 3LQQA 4UXNA 1XSVA 5ICGA 3LSTA 4HF1A 3FMRA 2FQ3A 3T5XA 1OYYA 2DAOA 2YR2A 3RI4A 4KN4X 2BEOA 2K02A 3GO5A 1O7LA 4MQVA 1FP1D 3T8TA 3V7CA 3IRQA 2ISYA 2EV0A 1FT9A 2VC0A 2F5CA 3M7GA 1P92A 4BH9A 1LDJA 5HS7A 2O3FA 3JAMK 3FWEA 2E7WA 1V3FA 5ICEA 3KETA 1KU9A 3CUOA 3R0AA 4G8XA 3KZZA 4M71A 1FNNA 3F6OA 2G9WA 2Z99A 5ILVA 1XN7A 1KYWA 4ZYGA 2A07F 3BZ6A 1ZRCA 4LLGF 1QZYA 1O3RA 3F8MA 3F8BA 1CF7A 4EGYA 4EJOA 2L4AA 4ESJA 1LJ9A 1ZGAA 6PAXA 4ENKA 1P4XA 4HOBA 4XRFA 1R1TA 3VFZA 4U0VA 5DD8A 3J81K 3T1BA 2HGCA 4RB2C 2FBIA 4RB1A 3ZMDA 4P9FA 3K9TA 4KDPA 1HQCA 4GO1A 1OYIA 3CLOA 1FZPB 4P96A 2F5DA 5CVUA 3CDHA 2XUBA 5JI6A 2ETHA 2OZUA 3TO7A 3B73A 2VBYA 3WTSC 2GA2A 5IT9Z 1FBQA 3VB2A 2ACJA 3RKWA 2WWYA 4YFKF 3ABUA 1GVJA 4I09A 4JBAA 3GW2A 5J8CA 3CJNA 2D1HA 4Q47A 3GFLA 3CTAA 2DTRA 4EJTA 2K4BA 3T0YA 5CLSA 1J2XA 2DQRA 3R0JA 4KT5C 3SHFA 2YU3A 3D5LA 2P5LC 2DPDA 1Q1HA 3BDDA 4A5MA 4G7ZF 1R1UA 3RIRA 2QBYA 3T8RA 1W5SA 2YPRA 4OU0A 3KEOA 2V9VA 4HA8A 2MH2A 2PFBA 1R58A 2FU4A 1LDKB 1J7KA 5FD5A 1USTA 4KFCA 1YW7A 3I54A 2QWWA 3U1DA 2L4MA 3I4PA 1BM9A 3W6JB 1LEAA 2W84A 2ELHA 2DI3A 1G3TA 1SMYF 2F5EA 4BNCA 1TQIA 3G73A 4IHSA 2HTSA 2XAQA 4HDUA 3EQLF 3WU0A 4GXOA 4ZZDA 3F8CA 3F8NA 4HX4A 2PLYA 4M74A 3FXUA 2P5VA 3RPUA 2COMA 1XGMA 1F4KA 3JTHA 2F2EA 3DKWA 2IPQX 1IAWA 4UVBA 1F1ZA 2GZWA 5K5QA 3ML6A 3W6KB 5LGTA 2IVMA 4LG0B 2HS5A 3GEZA 3IRRA 1HKQA 3MQ0A 3ZMZA 2MLKA 2ZNYA 4L0ZB 5FLXK 3ZN1A 5K5OA 5E1XA 1ON2A 2EA2A 2VBZA 2DFIA 3IL2A 1DPUA 1XGNA 2ZKZA 4LMYA 2D2WA 1DP7P 5H6QA 4FX4A 1U8RA 1K6OA 3ZMTA 2Q8KA 2XAHA 2O61A 2FNPA 3HRSA 3I64A 4XSXF 1YW9A 4I01A 3TQNA 1SFXA 3QP5A 3WTYC 1KU7A 2DPUA 5CVVA 4K2EA 1R22A 2W85A 3WODF 3M9AA 2Y75A 5CVIA 3V8KA 2JTVA 2W57A 5AONA 2NS0A 1STZA 2M45A 4WX9A 4MGRA 4M9XA 2W24A 3E6DA 1USSA 1KU2A 3DV8A 2CWEA 2A68F 2MC3A 1IN5A 1FSEA 1QBJA 3FM5A 1KU3A 3MEXA 1HW2A 3HTUA 1U5TC 4A0ZA 3KP7A 2KJCA 4IRHA 3H3UA 4U0YA 4Y13A 1S6LA 2ZJ2A 1ZGJA 1FPQA 1R00A 5L3EA 5D8KB 1HSJA 1BI1A 1S7AA 3V8JA 2K86A 4ESBA 3KZYA 2P6SA 4OMZA 2QZ8A 5FO5A 3KCCA 3J7AO 5DCMB 4KIGA 2GQQA 1XCBA 4M9ZA 3DPTA 1FOKA 5BOXA 5E20A 3C18A 4ENNA 3I59A 3J80K 2LNBA 4L9TA 4S05A 5L3CA 4U88A 2ZBKA 4O3MA 3LFKA 1FY7A 4AD9A 3TO6A 1RIOH 2OZ6A 3K1MA 4IVNA 2XHKA 4ON0A 4ZYEA 2FSWA 2UZKA 2QLZA 3KEQA 2ADUA 2STTA 3DP7A 3MFKA 3PFIA 2V79A 4AIHA 1KQ9A 4HQMA 2FNAA 3F8FA 1HSTA 1NHAA 1TQPA 1G3YA 3U9GA 2HDCA 4OIOF 2XAGA 3MAJA 3FX3A 2AS5F 1YS6A 1G3WA 4LJZF 2CYYA 2L02A 1ZYRF 1EH7A 3WTUC 1ONVA 2LSOA 3IC7A 5K1YA 2EFWA 2C6YA 2DT5A 2P5KA 3GUDA 3LA7A 4U0WA 2FMLA 4BYYA 4ESFA 4LD5A 5FD6A 5L3FA 4HLYA 1FC3A 2VC1A 2LDUA 3C1DA 1DDNA 1OKRA 2ESHA 3DF8A 2ZMEB 1O7FA 3JSOA 2IP2A 1ZRDA 2FEZA 2PG4A 2QBYB 2NAZA 1YQAA 3DPLC 4I98B 4HV6A 4R8HA 4L0YB 4IXAA 3I0TA 1D3YA 4I0AA 1UB9A 2VN2A 1IXCA 3SXYA 3S2WA 2HYFA 2VXZA 3RJPA 4DQ2A 3TOAA 4M73A 4OMYA 3HSRA 3QU6A 1WI9A 3K69A 2PMHA 1KYZA 2HWVA 2V1DA 2NRAC 2HFHA 1FX7A 1KQ0A 5LHGA 2OD5A 5L3BA 4QLCU 5FFZA 4R79A 2BE5F 5D4RA 3F6VA 3LWFA 1REPC 4Q5SF 2M5WA 4A2UA 1WQ2A 3M1EA 1F9NA 3FZVA 4AIKA 2IA2A 1MJ9A 1D5VA 1ZLKA 2MD5A 1IF1A 3E6MA 1LDDA 4HF0A 2K7LA 1JHFA 2H09A 2E1CA 1MGTA 5D5UB 1ZARA 2CG4A 4KUMA 1R36A 4JQFA 4A6EA 1UFMA 4RAZA 5AIPA 4H0EA 5DCFA 1SD6A 3DEUA 2Q2EA 3N97A 2JPCA 4LK1F 2D45A 3NEUA 4Q4ZF 4BHBA 4A0YA 2VOPA 2O0YA 3KP4A 2XKOA 5DDGA 3WU1B 4IPAA 3L00A 2OQRA 1WRJA 4HAMA 2IA0A 4LB5A 3GYHX 4AWXB 5DD4A 2P7VB 1WKMA 1Z91A 4HW0A 4ENMA 4EGZA 4L9NA 2VT2A 2HZTA 1HKTA 3TOBA 4Q48A 5HS9A 2FE3A 5HOOA 3N4MA 2KRFA 4D0PA 5ILSA 3TO9A 3R4KA 5D6EA 2LF7A 2MLGA 2P4WA 4I2OA 1CGPA 4XBFA 1XGSA 4RB0A 2DBBA 4I7HA 2XV4S 2ZXJA 5LRRA 2J5OA 4HQEA 1IRFA 3IKTA 2HQNA 4OOIA 1ODDA 5EEHA 1Z6TA 2V6CA
chains in the Genus database with same CATH superfamily
3JSPA 1RKTA 1YJNI 3R60A 1XMKA 3QU3A 4L9VA 3I58A 4A93J 2Q2EB 3S8PA 4PUSA 5B1AH 3I55I 3HYIA 5J40A 2V26A 3OIQA 4IRGA 3FXLA 4AVZA 1P4WA 4UV9A 5BS6A 2PQ8A 1YO5C 4BJ5C 5FKMA 4EJVA 5FKKA 4B1RA 3K2AA 4BXFA 5GPAA 4P55A 3FXMA 1K78A 3HSEA 9ANTA 2KRCA 1U5TB 1MDMB 3H3ZA 1B1BA 3ZQQA 3G3ZA 2QENA 1BJAA 1D1CA 3CUQC 2PMUA 3JTGA 2QEXI 2CS3A 1HLVA 2L01A 1PUEE 1DQUA 3QPHA 1XG1A 5LHHA 2OAZA 4XORA 1A35A 1T2KA 2R5ZB 3HKZN 1R5ID 1QPMA 3IH2A 1N77A 5F1JA 1FIAA 1SVMA 2AO9A 3LSPA 3KZIC 4ZJZA 2UV1A 3A0HC 4B47A 3NARA 2UXXA 1TC3C 5KVRA 2HOEA 1ZREA 2RV8A 3KFWX 2AQEA 1F43A 2BY2A 3GF2A 4FISA 1E0EA 3TW7A 2KZVA 2FQ4A 2GWRA 2DOFA 4Y7NJ 2R7WA 5K7FA 3SDBA 5HLGA 4G6QA 1HW1A 1U78A 3GBGA 2K27A 4AC0A 2N8GA 1JKQC 2EWNA 2LD5A 3BJ6A 4V2GA 3KPHA 3ULQB 1FMVA 2DFFA 3FDYA 3LSMA 4R1HA 3RPQA 2M0MA 1I1GA 1OR7A 1T39A 4KMFA 2EFQA 1FTTA 2EZKA 4AYBA 1Z05A 1ACIA 3P9KA 2EV5A 2O5RA 4M6YA 4GDFA 1J09A 1WSUA 1WGXA 2VBXA 2Y9YA 1I39A 3M4OJ 2XAFA 2L7MP 1XB4A 4LGWA 4BAYA 2DA2A 3JAMZ 5C4JJ 1C0WA 1GHCA 3OS2A 1XD7A 3DQVC 1FBSA 2MW8A 2XDVA 2BY3A 3MZHA 1FOXA 1T98A 4RB3C 2Z9OA 2R93J 1UMQA 5LGUA 4FETA 2VXDA 2FBHA 5E79C 3ECOA 3MZYA 1IN4A 4IHYA 4QPOA 3HHHA 2XGCA 3KP5A 3ESWB 1E3HA 3HHGA 2ME0A 2KDZA 1S7OA 1P2FA 2O6GE 4UVCA 1BR1A 5ILUA 4HBLA 3HTSB 1XX5A 2VQHA 3QPTA 2RKHA 4MHGA 2K9QA 2MBFA 2HPIA 3ABLH 2HOTA 1RI7A 3Q0VA 1TWHJ 3P9CA 2QSGX 3H92A 2XSDC 2VODA 2ZO4A 1EKEA 1SD7A 3F23A 3B6AA 1PP7U 3GX4X 1AKHB 2XAJA 2M7AA 2E2JJ 3L2CA 2X48A 2JA8J 3FISA 4YELA 1D0XA 3BTJA 3FXKA 3F22A 3VSKA 1IV6A 2LF8A 2KIMA 3EUHA 1XPXA 4HZFA 1BI0A 2HKXA 3GCMA 4BGDA 2FOKA 2KISA 3KP3A 2A6HF 2WV0A 1ETOA 2ICWG 4G9YA 2YSRA 5LFAA 1G59A 3EYIA 2B63J 1L0OC 2TDXA 2KDOA 3EUHC 3OYIA 2X0LA 3NQOA 2ZCWA 4MEXF 4WXHA 4PJ0C 3M8FA 3CMMA 3OYMA 2F4IA 2ESNA 4E7LA 3QP6A 4EV0A 3AKZA 2RNGA 2X9DA 2LVSA 4RGUA 2EFOA 1TWCJ 4P9UA 3CCEI 1OLTA 4XIDA 1RETA 1EH8A 3W2WA 3WTWC 4DZPA 4YIFA 1YJ9I 4QPQA 1B8IB 2GOMA 4E70A 1WI3A 3SZGA 3HDDA 2D5VA 2I10A 4PJJA 4GCVA 1PYVA 4IHXA 1AOYA 3CDLA 3P7NA 4BU2A 1T0FA 4PGHA 3H9GA 1H0MA 2LRDA 2Y31A 2K9LA 1MNMC 3RZDJ 1SD5A 1X2MA 3E97A 4EEFG 4FTHA 1JKOC 4CYDA 2DW4A 3OV8A 2R7UA 4EQQA 1Y8QB 1JE8A 2P0WA 2Z16A 3BY6A 2RDPA 1HF0A 4QTRA 2QQBA 3GTMJ 1ZHFA 2IA1A 5KK1A 5DS9A 3MCZA 1ETKA 1YIJI 2XRNA 3FMQA 2M4GA 4BY7J 3SFZA 1HBXG 1H9GA 5HS8A 3O6BB 2H6CA 4HX8A 1SAUA 2W4SA 2CW0F 3W6VA 4LIUA 4KISA 1JT6A 4HNTA 2LKXA 5CVRA 1NG7A 2GXBA 4BEHA 4AYBN 4A3EJ 3P9IA 5EG0A 2Y0MA 4EATA 3DLAA 4CICA 4BY1J 2B0LA 1BW6A 3CDIA 5GTIC 1B59A 5J8FA 4B8XA 1MJAA 2L5QA 3F72A 4KT6A 2LOOA 2IS2A 2K5CA 2XF7A 5DTDA 1XDSA 1D8JA 3IUOA 3COAC 2XRLA 5IP9J 4DYRA 3HPGA 3TDUC 2QCOA 4XRMA 1ZR2A 5D8LB 2FBKA 1ZRFA 2VPRA 4LIVA 4DJAA 3HC7A 1ZN2A 4NC8A 1XSXA 1QZZA 1E2XA 3BTIA 2XIGA 2DA3A 3S1RJ 2IW5A 1I1SA 5JHFA 3OL3A 1MJBA 2RGVA 3I71A 1SFKA 4DYQA 1K83J 5FFXA 3U2RA 2KZGA 5K7ZA 4AIJA 2BVMA 3IWZA 1K6YA 2EJRA 2NNYA 1Y56A 4I02A 3E0JB 3M1CA 4ZH4F 3CCYA 3JREA 3GZ6A 2MABA 3HBLA 2QF7A 3OR1C 2KIUA 1LPQA 3IV5A 3G1MA 1GDTA 1IW7F 4UUVA 2W48A 4D7NA 4ASNA 4G7OF 4L5IA 3GLXA 4IEJA 1T56A 4C9YA 3TGNA 3VYUB 5F0HA 2Z33A 1F5TA 1FWZA 2EK5A 1T38A 3LSIA 5J1YA 1FOWA 4CO8A 2XAUA 5F64A 2JWTA 5TRDA 1W0UA 1J0RA 2BVLA 1FYMA 2EQRA 4B48A 2XGEA 1ZQ3P 3QYFA 5JVTA 1GUUA 1ENHA 3WTTC 3KYLA 5IOYA 3PNTA 1RR8C 2L9RA 5LEJA 1LNWA 3OIOA 4IQ4A 5ED4A 3TKYA 3KLOA 4HDVA 2E7XA 3VSLA 4BXUA 3BJAA 1HXDA 1TBXA 2Y0SA 4CCOA 1UJ8A 2G7UA 5LHIA 4A5NA 3IKVA 2EZHA 3FM3A 4RMNA 4ZYDA 4OWRB 2CUFA 1MBGA 5DV5A 4ANJA 3HL2A 2L3DA 5EZGA 4M3EA 3BPVA 3MWMA 3LSJA 2WAQN 1YG2A 2DLLA 2Q0OA 2GAUA 2XROA 3ERED 2CQNA 3ZCOA 3L2QA 2LH9A 3E5QA 1IXRC 3UR3C 5LEKA 3RDIA 2CQXA 1V54H 2X4HA 2LREA 2OPTA 4BE0A 4KIFA 2DQLA 4CYCB 5JFRA 2BV6A 2MSYA 1BOBA 2QM3A 2Y69H 3DWLE 4PFOA 4M3FA 2ECBA 5IT3A 4HSRA 1W4MA 2XGDA 5BMZA 1MSEC 3K7AJ 2E1MB 1VTNC 1Z7UA 4ETSA 4L18B 1ETVA 1VQ8I 4KYWA 2IS4A 3WG9A 4IHWA 3L9FA 3RSNA 2QVOA 3ELKA 2A05A 2HKOA 3IHUA 4N4NB 1UAAA 2R7DA 5KHDA 4MIMA 4B4CA 2KT0A 2JA2A 4F7ZA 3GMEA 5K5RA 3ECHA 2W7NA 3BR5A 2ELJA 3QAHA 1PDNC 3OMYA 3HOTA 1JXSA 2CFOA 2VKEA 3M8EA 4PJMA 2LY9A 1UCRA 1BOAA 2VBWA 4ZYAA 2R7QA 4KNYA 2XKPA 1WWXA 3C7JA 5FLXZ 1LB2A 5EZHA 2H94A 1ON1A 1YOVB 1XSDA 2A61A 1YFHA 1BBYA 1YLFA 1IJWC 5E3NA 2L7FP 4BUPA 2NS8A 2LKPA 4PZJA 4RGRA 1VQOI 1JHHA 3OYGA 5GPCA 4C2TA 1IDZA 1X58A 4FE4A 1HKSA 1FYKA 5H6RA 1ZG5A 1L3LA 3ZN0A 3MKWB 3BJOA 3OL4A 4X0GA 4X6AJ 4XL9A 1P4AA 3K1PA 3AAFA 1WJDA 1BN5A 1VF9A 1Z6RA 4BQAA 2M2EA 1SFEA 2XASA 1IO2A 1BC8C 3H36A 5L3DA 2PN6A 1X1AA 3DTKA 2HDWA 4XSZF 1PJRA 3WU2C 4LFUA 2IT0A 2ZMEA 1R7JA 1EF4A 4NHJA 1T6SA 2RQPA 1ULYA 1TWFJ 1H9TA 2P8TA 3CQZJ 4XONA 4CDGA 4DBRA 5HLIA 5CYVA 5C44J 1A36A 3A01B 2IBDA 3BCBA 4QSHA 1Z9CA 1SEUA 1BI3A 1HOMA 2J5PA 2E1NA 4JX6A 4UHTA 5HLHA 5F1RA 5LLQA 2H6BA 3ZMVA 4YG2F 1RR7A 3REOA 4HPQA 3BR0A 4XICA 2PJPA 3LAPA 3WGIA 2VE9A 3O3KA 3JW4A 1QRYA 4YFXF 5ERIA 3A4CA 3K4BA 5L3GA 1TNTA 3CCMI 1VZ0A 4MTDA 1GXPA 2GXAA 4XLAA 3BOQA 2NVYJ 4CYCA 4C2MJ 1LE8A 2ZJPF 4BHPA 1WJEA 5J3LA 3FXOA 4BJTA 3DCFA 5GAHJ 1E3PA 3H0DA 1OCCH 1TP4A 1I6XA 4C30A 4EJWA 4BEHB 3J80Z 2RREA 4C3HJ 3WE3A 3HOSA 5CVJA 2JT1A 5DCMA 1SMTA 3HPHA 3FXJA 2LLKA 4ZDOA 5D5WB 1BL0A 4HG2A 4GGGA 1JUSA 3MZ8A 2K4JA 2Z2SB 2XGXA 5CJ9A 3D0SA 5CPRB 4RS8A 3RKYA 4BHCA 4O6JA 2X6WA 3A1YA 5JVGF 4YFNF 3BTLA 2ME6A 3HIFA 2DOEA 1W0TA 4F92B 1N25A 1U6GA 1RUNA 3E5XA 3ZPLA 1YHQI 2BGCA 2M87A 3ZQFA 3W3CA 3J7ZI 1UHMA 2CH0A 4ENJA 3HGYA 1D8KA 2LBFA 3C3WA 4MQ9F 3WGHA 4XKCA 2I8DA 3CP8A 1ZGWA 5C4XJ 4F93B 1LE8B 5TISC 1BR4A 2ZFUA 2A6EF 1Y1WJ 3CMAI 2H8RA 1ZG3A 3BT9A 1B72B 1QVTA 2I5UA 4WXDA 1HC8A 1W36C 4D1QA 3QODA 4XN3A 5LBQA 4A3GJ 4E7SA 5IY5H 4XLFA 2MA3A 2OJED 3QWLA 3J7YJ 1RNLA 3BG5A 4FT8A 1KA8A 2CQQA 4FQGA 5E8IA 2DMUA 1DGRM 5FKOA 1Q1VA 2L54A 3FXQA 3DKYA 4IL6C 2V1XA 3S1MJ 2ELKA 2ID3A 4D7MA 4WWCA 1Y0UA 2HXOA 3LA3A 1SD4A 2JA6J 2QQ9A 5H20A 2BYVE 1O57A 4XKBA 3PIPF 4G7HF 2OU2A 1X3WB 3Q3SA 3BP8A 1GXQA 4B09A 3SZPA 2VJ5A 1XDUA 3HSFA 3LA2A 3FMSA 2LFBA 2MH9A 2F4OB 2DXIA 1RC9A 3AL0C 2NVUB 1R5HA 4MNUA 3V8LA 1ZLJA 1SFOJ 2XC7A 4G6TB 4WXCA 1BI2A 4EM1A 5HDGA 3O2PE 2AQFA 4F52A 2K85A 1MNEA 1MKMA 1EH6A 1TW2A 3FK7A 2IGNA 3RPUD 2UUZA 4IX7A 1BIAA 2JUCA 1X1CA 2VQCA 2Y0SN 2JZYA 4LK0F 5J6XA 3KYCB 5FGMA 3NWSA 3RKXA 3EYYA 5A2QZ 4L5EA 2JSCA 3R6SA 1HW5A 3OWTA 1F36A 3S2DJ 5EJCA 4DOZA 2AXLA 1KZHA 3VODA 5HLTA 2NVXJ 1WH5A 3K2ZA 5JR3A 1V55H 4NC6A 1WPKA 2V9PA 3A01A 1JJ8C 3S1QJ 5M5YJ 1ZG1A 2DA6A 3FF5A 2DA4A 5GADJ 1K7AA 2JA7J 1GLNA 1RZ4A 3CJTB 4HV5A 4GFBA 2FX0A 4N9HA 4ZZLA 3DTIA 4PGGA 2KIFA 3Q0WA 4JOMA 1K61A 3D5RC 4PJNA 4NDLA 2B7EA 2K40A 4BKXA 2HQ5A 4CCNA 1Z77A 4OAZA 1R6RA 3RYPA 2XB5A 2O03A 1G2HA 3X2QH 2JVHA 2WY8Q 4BS9A 5TJJA 3U21A 3E6CC 5J47A 1I27A 3CMYA 2MD0A 5DUIA 4FHTA 3JRAA 1YIOA 2OV7A 2ZB9A 4V2FA 2Z3YA 1CF7B 3GZNB 2KLOA 2K9SA 1UHWA 1TWGJ 3BR2A 3CO6C 4JP0A 2RC4A 1B72A 2O7OA 3LFUA 1H88C 1RPWA 1EV7A 4YIIA 1FSHA 2LG4A 1FBUA 1J5YA 3VOEA 4FX0A 3DFGA 1XS9A 1NH3A 2Y30A 4U7BA 3K4LA 2D1VA 4NQWB 2CGPA 4U7DA 1WJ5A 3BCAA 3OYAA 1IN8A 3CF2A 3O8GA 4PSWA 2R7XA 5HDKA 2M1BA 2XPWA 2LYCA 2DFEA 2Y2ZA 1XGOA 4XRSA 3HUGB 3GTKJ 2NOJB 2STWA 1ZR4A 2EFPA 1MDMA 1VQ7I 2JPBA 2E36A 4WCGA 3PNVA 3HOVJ 1BR2A 2L0KA 2DJNA 2WB1A 3ABMH 2CFXA 2GIVA 1IUYA 3SEZA 3C2BA 3DEEA 3SDGA 3V42A 2QUFA 4ITVA 5DYMA 4FCYA 4M9SA 1U2WA 1DU6A 3IWFA 3QRFF 2JVGA 2DYSH 2F48A 4LLNA 4OIQF 5D4SA 2DU9A 5HODA 1J59A 3LOCA 2LC2A 3BZCA 2JUGA 2FJ1A 3KP2A 1IV8A 4NB5A 3OY9A 2NVTJ 2M8EA 2XPVA 5LRSA 1KQ8A 1YX3A 3RZOJ 3I5UA 4LB6B 2M30A 4V19K 2WTEA 3QYBA 2R5ZA 2VKDA 2MFZA 5HNHA 2E2IJ 2QQ8A 1K79A 2HQAA 1YI2I 1PUFB 1LQ1A 2X1DA 2BOLA 1SVOA 2VKVA 5IOZA 3K4CA 5BPIA 2A69F 5FB2A 3L7WA 4QWQA 4E7IA 1TQMA 3H9QA 4EJUA 1RUOA 4EM0B 3LAJA 2VLAA 1U5TA 1MMDA 4EVIA 4XLPF 4J01A 2A3SA 3AG4H 3DXJF 3KE2A 3OR2C 3S17J 2RVCA 3I3LA 4D5CA 1MZBA 2F5FA 5DM7F 1MBEA 2ZMEC 5TGTA 1A6QA 3ZQ7A 1O3QA 1W7PB 2OCEA 4KIBA 1DP3A 2LR8A 5BPDA 2UXNA 2EFNA 2IS1A 3ZR8X 4TV7A 1IZ1A 4N0BA 2VOOA 1R5GA 2LBFB 1FP2A 5D6FA 3KEYA 5E1ZB 3WE2A 2HQRA 3LNQA 1XMAA 3G1LA 4CZZA 3K4MA 5DUKA 2ZXIA 2ZSHB 3MVPA 2DA7A 1FYLA 4I0BA 1EJ9A 2VQLA 2UWMA 4KITB 4HNVA 1QQIA 2R3SA 3I4NJ 2O8XA 2OQGA 2QQAA 3I4MJ 1T08B 5EEGA 5J4VA 1OYWA 2CQKA 1SC7A 3L2WA 3ASNH 2QSFX 3QYEA 4JK1X 3OYLA 3ZQIA 2OA4A 3ISPA 3Q5FA 4CHUA 2VJJA 2TCTA 4HEA2 3WGGA 4EMSA 3KP6A 4F55A 4AM3A 4UNOA 3GTPJ 1B4AA 1SFUA 1B6AA 2DK8A 4AU7A 3EDPA 1IDYA 1X19A 2P6TA 4WF2A 4XLCA 2V6EA 1YX5A 3UNGC 3LSHA 1BC7C 3E1SA 3NWTA 3JRGA 3BROA 2V1UA 5AIQA 4UUSB 3ABTA 1DUXC 3L09A 1Z1DA 2EINH 2CUZA 1QHGA 1QGPA 2RN7A 3PIOF 1UG2A 2DMPA 2CQ7A 1YITI 4PFPA 5ICCA 2ZC2A 1NG6A 2FXAA 1AHDP 2Z5UA 5E18F 4KMUX 4RLQA 1LVAA 3K4JA 1V4RA 4GYIA 1YYVA 4XK4A 4G94A 3E7LA 3V4GA 3WTZA 3CCLI 1SAXA 3I59B 1IRZA 3CC4I 2VB6A 2R5YB 2R7VA 3OYHA 1H8AC 1ZKGA 2GXGA 2WAQA 1J9IA 2HI3A 1DPRA 4EM2A 3S15J 5BNGA 4OIRF 1S29A 3FXRA 4M3BA 4XQFA 3HOXJ 3RYRA 1BIBA 3KLNA 2VT3A 3GXOA 3S93A 3PUFA 3MMYB 1PP8F 1HDDC 1I5ZA 2H1KA 2E2HJ 5E8GA 1IRXA 2LTPA 3IAS2 2GBYA 1YW8A 3E3VA 1IXSB 2EB7A 2R4GA 3A02A 1ZAOA 2QGUA 2OBPA 1VQNI 1Z7LA 3S3NA 4NBQA 1GVDA 4BE2A 1XMXA 3PFYA 2VONA 1E17A 2VE8A 2DTZA 1UZCA 1G6NA 4P5OA 4XLEA 4RGXA 2VASA 4IZZA 3Q9SA 5LD2C 5F04A 1B9MA 4XMYA 4A0XA 1QO0D 4DNCA 2NNNA 3K0LA 5M3MJ 3R61A 2FRHA 1JGSA 3L2UA 1MIJA 1OCTC 1ETWA 1K78B 3K70D 4UV8A 4RGSA 1QPIA 4Z2YA 3F21A 3QOEA 1T33A 1U3EM 4A3MJ 3W2AA 4AVPA 3KYDB 4G6DA 3FBNB 2YUSA 3LSGA 3QOPA 3VEPA 3PO2J 5ICFA 2WAFA 3OYKA 3JRHA 2W25A 4N9IA 4IF4A 2YX4A 4PCQA 2Z1DA 3PNYA 4Y15A 2IJLA 1DU0A 3S3MA 1TZLA 4Y33A 4B44A 3WTVC 1MW7A 2L9VA 2YX7A 4MEYF 3ZQGA 4HF2A 1O3SA 1R9TJ 3LL7A 2EA4A 3B02A 2E5NA 2FMYA 2KQRA 2RNJA 1P6RA 2P81A 3ZMUA 1TWAJ 1WJAA 5F0CA 4BDZA 2KKOA 1W7PD 3VDXA 4W1UA 4GYGA 5B5EC 4Y3OA 5B1BH 3EETA 1Z21A 1IN6A 4J19A 4DYCA 1G4DA 1YJWI 4G12A 2FA5A 5D5XB 3BG3A 3DEWA 2XVCA 4RBOA 3ZGKA 3GFMA 4OIPF 3F3XA 3GZ5A 3LSKA 4BE1A 3ZP5A 1M1EB 3LQRA 3J81Z 4CUGA 4A3CJ 3H9JA 5DEQA 1W7PA 3I53A 1W5TA 5E1WA 2DDBA 2M4KA 4XLNF 2ZFWA 3HRMA 1WJBA 4CXFA 2H8WA 3GFJA 3BG9A 3M8JA 1S8NA 5F08A 3WHBA 5EGOB 1FJLA 4BBSJ 3HEFA 4L9JA 1GV5A 3QQAA 4UVAA 2ISZA 2BY1A 3LSRA 5HVQC 5EG0B 3S14J 1OFCX 2IGMA 1YS7A 1W1WE 3PQKA 2MG4A 2BBYA 5LGNA 2KJBA 3EPZA 3JRDA 3PQJA 5J1RA 4IJAA 4BQQA 1IRGA 5BQTA 4RAYA 3DBHB 3CUQA 1AWCA 2NYXA 2K9NA 4I76A 1X4OA 3S32A 1J75A 3RTRA 2ZSIB 3V7SA 1OCRH 4PDKA 1NTCA 4LITA 3ROUA 5F6FA 4NQWA 2XB0X 1S3JA 1OMIA 1PVEA 5E3OA 2DODA 4IRIA 2E1OA 2G7HA 3HRUA 5GP9A 1T8IA 1QNTA 3PM1A 3FHZA 2HOAA 3BG6A 2A5YB 2IRFG 1NK2P 2CUJA 2QA4I 3BWGA 2QKMB 2G0EA 4HX7A 1VI0A 3K70C 3FIWA 4LG0A 5E17F 1T0FC 2FD5A 4KICA 1TNSA 4BQNA 4JX4A 5IP6A 4CH7A 1POGA 3E6BA 4M6XA 3SZTA 4KA4A 2KMUA 3TDZC 4DW6A 2R7FA 4A12A 4LLLA 3OYEA 1IN7A 1U9NA 3D1NI 2X1CA 3BQYA 1JI8A 4Y17A 2WC2A 3OS0A 3CO7C 1BA5A 4CGZA 3G6EI 2FF4A 2BY0A 4M72A 5M3FJ 3K1NA 2BHZA 1OPCA 2DMNA 4HLXA 2W82A 3CUQB 1CQTA 3SQNA 3B6CA 4M3GA 2DJIA 1G3SA 3HRTA 3OOPA 5JHUA 2DO7A 2CSOA 1R23A 1XCVA 4MTEA 5J4YA 1ZK8A 3HUGA 3ZMSA 3WTXC 3GFIA 1VQ6I 5FROA 4ZYHA 3CCRI 3OS1A 2AHQA 4W97A 4MO7A 4XOPA 4E7JA 4ZDLA 5FRNA 2GA1A 4II3A 1XC5A 2HTJA 3NRVA 4OINF 1ZH5A 4WK8F 2PI0A 2HPMA 3DKXA 4ZDPA 3MKZA 2A6TA 3AG3H 5D5VB 2PEXA 1B9NA 3ZXSA 1TW3A 5A2QK 2JRTA 4C2UA 2LK2A 2M8GX 2VJ4A 1FLIA 1P7JA 2F6CA 2Y48A 1OJLA 2KRHA 2DK5A 2KIQA 2HR3A 3ZQHA 1TTYA 2AXTC 1MBHA 3S3OA 3GVAA 5HDNA 4XM3A 2QYOA 1X3UA 4HYEA 2PBIA 1MD0A 2H27A 2EPFA 2ZNZA 3HG9A 3SYTA 5H2FC 3P5JA 4O5VA 3HXLA 1I3QJ 4IHTA 2JN6A 2R7TA 3DBLB 4QIWN 1R4NB 3BPXA 1TLHB 2HEOA 3E5UA 1KGSA 1ORKA 1IGNA 3RQ4A 1V5FA 1MMSA 2CV0A 2EV6A 3Q9VA 1LEBA 2P7CB 2QSHX 1YTYA 2WY7Q 4KN7X 1O3TA 2CO5A 4ZTFA 4S04A 3V7RA 4L5JA 1A04A 3SJMA 2L2OA 1R1VA 2HYGD 4A6DA 1QZEA 3GWZA 3LQQA 2ECCA 4UXNA 1XSVA 5E3LA 2OUMA 2IS6A 5ICGA 5EF6A 4H4KC 4U87A 2LY2A 3LSTA 4HF1A 2KP6A 1S9HA 3ERMA 3FMRA 2FQ3A 3T5XA 1WJCA 1OYYA 2DAOA 3H5RA 2YR2A 3IP4B 1LFUP 4F3QA 4J00A 2TRTA 3RI4A 1HCRA 4LG3A 4KN4X 2BEOA 2K02A 5EGOA 3GO5A 1O7LA 4MQVA 1FP1D 3H5NA 3T8TA 1VQMI 3V7CA 3IRQA 2ISYA 3HJEA 1N75A 2EV0A 4LOCA 4PK4A 5GAGJ 3CMEI 3H3VK 4BJ6C 1FT9A 2VC0A 1DGWY 1SANA 2F5CA 3M7GA 1P92A 4BH9A 1LDJA 3OYBA 1U8BA 1Z67A 1ZTRA 5HS7A 2WB1N 3JRIA 2GM4A 2O3FA 1WCMJ 4II2A 5B3SH 2BW3B 3JAMK 2HYJA 3FWEA 2HOSA 2E7WA 2LMDA 1V3FA 2NS7A 3OSFA 5ICEA 1Y39A 3KETA 1KU9A 3CUOA 4YEJA 2DN0A 3R0AA 1U0JA 2VJIA 4G8XA 3KZZA 4M71A 3BQZA 3FKIJ 4E4HA 3OYCA 1FNNA 3F6OA 2G9WA 2Z99A 1OISA 5ILVA 2PJRB 1XN7A 2ZXWH 1KYWA 4ZYGA 3OIPA 2EILH 2A07F 3BZ6A 1ZRCA 1JUMA 1FIPA 1NK3P 4LLGF 1QZYA 2M0CA 3BR1A 1O3RA 4UB6C 3VWBA 4IQJA 3F8MA 3JRFA 3PSIA 2X51A 5F0FA 3F8BA 2IXSA 1CF7A 4EGYA 3VYTB 4EJOA 2L4AA 4ESJA 2DT7B 1LJ9A 1ZGAA 2W1OA 6PAXA 4ENKA 1K4TA 2GLOA 3MKYB 1P4XA 3I56I 4HOBA 4XRFA 1R1TA 4C3JJ 5IT9K 3BG7A 3VFZA 4U0VA 5DD8A 3J81K 3T1BA 2HGCA 4RB2C 1IG7A 2FBIA 4RB1A 1HA8A 3ZMDA 2M34A 4P9FA 3K9TA 4NC7A 4KDPA 2BW3A 1HQCA 4GO1A 1OYIA 4PJLA 3CLOA 3CP2A 1FZPB 3CCQI 4P96A 4ABZA 4BXXJ 4CCMA 4A69C 2R7OA 1FMWA 2F5DA 3G4SI 5CVUA 3CDHA 1JGGA 2X1EA 2XUBA 2ETHA 5JI6A 2OZUA 5JLWA 4AIDA 5DM6F 2JJ7A 1VNDA 4MFEA 3TO7A 1AU7A 3B73A 2VBYA 2QKLB 4JYKA 3WTSC 2GA2A 5IT9Z 1FBQA 3VB2A 4RDUA 2ACJA 3RKWA 3H0GJ 2WWYA 4YFKF 1S72I 3N05A 1MBFA 5HNFA 3ABUA 1GVJA 4I09A 4JBAA 3ZQLA 2E1MC 3HZJA 3GW2A 1Z3YA 2K9MA 3H35A 3CJNA 5J8CA 2D1HA 4GRIA 4Q47A 3GFLA 3CTAA 4YRVA 1H89C 2DTRA 2M9HA 2DMQA 3QPSA 4EJTA 2GIZA 3K4NA 2K4BA 4MFDA 3T0YA 5CLSA 1J2XA 2DOAA 3CZ6A 1VQ5I 2DQRA 3R0JA 4KT5C 3SHFA 2YU3A 2HDDA 3D5LA 1UELB 2P5LC 2DPDA 2E19A 1YE9A 1Q1HA 3BDDA 4A5MA 2XSJC 2YU9J 4G7ZF 1R1UA 3SFIA 3S1NJ 3RIRA 2KHMA 3ONQA 1WHUA 2QBYA 3T8RA 1W5SA 2YPRA 4OU0A 3KEOA 1D0YA 2V9VA 3BR6A 3HGGA 4HA8A 1IC8A 2MH2A 2PFBA 2JK3A 1R58A 1Y1VJ 2PMZA 2L9NA 2FU4A 1LDKB 3K6GA 3JRBA 1J7KA 3CLQA 5FD5A 1USTA 2Y9ZA 4KFCA 1YW7A 3F0CA 2QWWA 3I54A 1Y8RB 3U1DA 1VQPI 2L4MA 4D5FA 3I4PA 1BM9A 2VUMJ 3W6JB 1LEAA 3HB9A 5KAFC 4M3DA 2W84A 2ELHA 1Y6IA 2R7SA 2DI3A 1G3TA 3PL8A 3HM5A 1QU3A 1SMYF 2F5EA 3JCUC 4BNCA 4S0HB 1TQIA 3G73A 4IHSA 2HTSA 4XNFA 2HVQA 2BZTA 3DU6A 2F4MB 1P7IA 5B66C 1I50J 2XAQA 1IUFA 4HDUA 2NVQJ 3EQLF 3WU0A 4BQOA 4GXOA 2CMPA 2X85A 4ZZDA 3F8CA 3F8NA 3LMMA 4HX4A 2VL8A 2PLYA 4M74A 4A3IJ 2HVRA 2OCCH 3FXUA 2P5VA 3RPUA 4Y52J 2COMA 1OR7C 4BDYA 4E6KG 1XGMA 1F4KA 2PJRA 3JTHA 2F2EA 3G1OA 3DKWA 2R0QC 2IPQX 3TW6A 1IAWA 3MN2A 4UVBA 1F1ZA 3K4KA 3GLLA 3ZRGA 2GZWA 5K5QA 3ML6A 3W6KB 1D0ZA 5LGTA 2IVMA 3RQIA 2HXIA 4LG0B 2HS5A 3GEZA 3IRRA 3BTCA 1VFCA 3FK6A 1HKQA 3MQ0A 3ZMZA 2MLKA 1EA3A 4CSWA 2CJJA 2ZNYA 4XLHA 5E3MA 4L0ZB 5FLXK 3HOWJ 3ZN1A 1O4XA 4JX5A 5K5OA 1FEXA 2A5WA 5E1XA 2KPMA 1ON2A 4RM3A 2EA2A 1S7EA 2VBZA 2DFIA 3IL2A 1DPUA 3MD2A 1XGNA 2JMWA 3J7AY 3S2HJ 2VKHA 1SVLA 3PSFA 1LVKA 2ZKZA 3VPRA 4LMYA 2D2WA 1DP7P 1A31A 5H6QA 4FX4A 5FLVA 1U8RA 2V1NA 1FOYA 1UHSA 3IAM2 4FE7A 1K6OA 1WJFA 3ZMTA 3H1CA 2Q8KA 2XAHA 5EDNA 5FJ8J 2O61A 2FNPA 2PMZN 3EUAA 2E71A 3HRSA 3I64A 4XSXF 2DMTA 1Y0NA 1YW9A 2L9SA 4I01A 3TQNA 1SFXA 1JKPC 2WAEA 3GTQJ 3QP5A 3M07A 3WTYC 1KU7A 2DPUA 4A3LJ 5CVVA 4K2EA 3DU5A 1R22A 2W85A 2VIXA 1A6IA 4UB8C 5CQGA 3C2GA 3DTEA 3M9AA 3WODF 5J1UA 3L2VA 2ZXHA 4AUXA 4B43A 1T95A 4E7KA 2B9SA 2Y75A 5CVIA 1TT0A 3V8KA 2JTVA 2W57A 3VYRB 5AONA 1X1PA 2FOWA 2NS0A 1STZA 2M45A 4WX9A 2COBA 1D1AA 4M9XA 4MGRA 2W24A 3E6DA 1USSA 5C3EJ 1OCOH 1KU2A 3DV8A 2CWEA 2A68F 2EZIA 5M5WJ 2MC3A 1IN5A 1FSEA 1QBJA 1RRJA 4IKFA 1OCZH 4XN0A 3FM5A 1KU3A 1MMAA 3MEXA 1HW2A 3GTJJ 4MLOA 3HTUA 1U5TC 1P9QC 4A0ZA 3KP7A 2XPUA 3ZOBA 2KJCA 4IRHA 4DBQA 3VYSB 3H3UA 4U0YA 1JT0A 4A3BJ 4A3DJ 1MSFC 3S16J 1TT5B 4Y13A 1S6LA 2ZJRF 3RKQA 2ZJ2A 1ZGJA 1FPQA 1R00A 5L3EA 5JLXA 4I6ZA 1LKXA 1U9OA 5D8KB 1WH7A 2CU7A 3H5AA 3CD6I 4DIQA 3M3YJ 1HSJA 1BI1A 1MMGA 1ITYA 5KCMA 1S7AA 3V8JA 2V7FA 2K86A 4BL0B 1VQ9I 4ESBA 4E7HA 2BXZA 2P6SA 3KZYA 4OMZA 2H1LA 2QZ8A 5CQEA 4ZTJA 5FO5A 3GTGJ 1JTYA 5EYRA 1AKHA 3KCCA 3J7AO 1E3OC 5DCMB 1G8XA 2XF6A 5M5XJ 3PUBA 4KIGA 4X1EA 4F91B 2BXYA 2GQQA 3OYFA 1XCBA 4PSXA 2E5ZA 4M9ZA 3DBRB 4NNJA 3DPTA 1FOKA 2JQ7A 2DA5A 5EEAA 4IOCF 5E20A 5BOXA 1K4SA 3C18A 1BW5A 1XTAA 4ENNA 3CF5F 5FRMA 1JKRC 1X1DA 3I59A 3J80K 3CJRB 1N78A 3DLLF 2LNBA 4L9TA 4S05A 5L3CA 2GOXB 3IH3A 4U88A 2ZBKA 1APLC 2BHYA 4O3MA 3LFKA 1FY7A 4IO9F 1VQLI 4AD9A 4A3FJ 3TO6A 4HNUA 5GAEJ 3WHCA 1ERDA 2X6OA 1RIOH 2OZ6A 3K1MA 1OCPA 4XRSG 3AL0B 2DFHA 4IVNA 3TMOA 2XHKA 2OTJI 1A5JA 4ON0A 2EIMH 4CA0A 1MBKA 4ZYEA 1MH4A 3ASOH 3HOYJ 2FSWA 2UZKA 1D5YA 2QLZA 2CUEA 3KEQA 2ADUA 2WV1A 2STTA 2VPLA 3DP7A 3MFKA 3PFIA 3TP0A 2V79A 1X3ZB 2ID6A 4AIHA 1KQ9A 4HQMA 1KONA 2FNAA 3F8FA 1HSTA 5IPAA 1NHAA 1TQPA 3K10A 1G3YA 3U9GA 2HDCA 4NUBA 4OIOF 2XAGA 3MAJA 2MC4A 3FX3A 3UKGA 2AS5F 1YS6A 3U1KA 2MYSA 2DCEA 3AG1H 2M3AA 2Q1ZB 3BC8A 1G3WA 4LJZF 1FTZA 2CYYA 5IP7J 2IAIA 4Y4RA 3HKZA 3A0BC 1RKWA 4RAGA 2M7BA 2L02A 2YS9A 1ZYRF 1EH7A 3WTUC 1ONVA 2LSOA 3C2HA 3OOUA 3PJRA 3IC7A 3F9KA 5K1YA 2EFWA 1S5LC 2C6YA 2DT5A 2P5KA 3GUDA 3LA7A 2O8KA 4UY8I 4RM2A 4IOAF 4U0WA 2OC6A 2FMLA 4BYYA 1PUFA 4ESFA 4LD5A 5FD6A 3CCUI 2KL4A 5L3FA 4HLYA 4IHVA 1FC3A 2VC1A 2LDUA 3C1DA 4CCJA 1TL8A 1DDNA 1ETYA 1OKRA 2ESHA 3DF8A 2V4JC 2ZMEB 1V5GA 1O7FA 3OYDA 3W2VA 3JSOA 2IP2A 4RLFA 1ZRDA 2HNHA 3DPUA 2MGQA 3GTLJ 1D1BA 2FEZA 2PG4A 3EUKL 5FLMJ 2QBYB 1Z3XA 2NAZA 4FASD 1YQAA 5FKLA 3KX2A 4HRIA 1X2NA 2VQGA 3JR9A 2LKSA 1R4MB 2HZDA 3DPLC 3FHNA 4HV6A 4I98B 4R8HA 4P1WA 4L0YB 4IXAA 3I0TA 1R71A 4Z6YA 3QPLA 2WBMA 2DYRH 4XKWA 1D3YA 2ZJQF 4I0AA 1UB9A 1X4PA 2IEKA 2VN2A 1IXCA 2JSPA 3SXYA 3S2WA 2HYFA 2O9LA 2VXZA 3RJPA 1GV2A 4DQ2A 3AFHA 3TOAA 3BZKA 1MNDA 1GT0C 2X6XA 2DT6A 2EH3A 4M73A 4A3JJ 3HSRA 1W36D 4OMYA 2E60A 3HOUJ 3QU6A 1WI9A 3KIOA 1QA6A 2JA5J 3FBIB 3K69A 3CCVI 2PMHA 1KYZA 2HWVA 5K7HA 2V1DA 2NRAC 2HFHA 3PO3J 2CW7A 1FX7A 1KQ0A 5LHGA 5KNLA 2OD5A 5L3BA 4QLCU 5FFZA 4R79A 2BE5F 5D4RA 3F6VA 3L1PA 3D5SC 3LWFA 1REPC 1I6HJ 4Q5SF 2M5WA 3WG7H 4B3XA 1ETQA 2KFDA 2WA0A 4CCLA 1HDPA 4A2UA 1WQ2A 3M1EA 1F9NA 1R49A 3FZVA 4AIKA 3G2BA 2IA2A 1MJ9A 1D5VA 1ZLKA 1Z0XA 4DGWB 3OSGA 2VI6A 2MD5A 1I3AA 1IF1A 3IH4A 3E6MA 1LDDA 4HF0A 2EIJH 2K7LA 3Q0UA 1JHFA 2H09A 2DDAA 2WADA 1WVRA 3CJQB 2E1CA 1MGTA 4ZC3A 3RCOA 1WFXA 5D5UB 2L7ZA 1BJZA 4I99C 1ZARA 2CG4A 2LP0A 1MBJA 3G71I 4KUMA 1R36A 4D9JA 1VQKI 4JQFA 1B8IA 4A6EA 1UFMA 4KJZA 4RAZA 2LY1A 5AIPA 3ZQCA 2W00A 1LFPA 3AG2H 3CC2I 3CCJI 5DCFA 4H0EA 1UG0A 1SD6A 2OF7A 3DEUA 1AA7A 3TL4X 4XOTA 2Q2EA 3N97A 2JPCA 4LK1F 1W5CC 5IYBJ 3NAUA 5FKNA 2R92J 2D45A 3NEUA 2F5VA 1JJ6C 4Q4ZF 2RAEA 2HU9A 2DA1A 3FKJA 4BHBA 4E7ZA 1YRNA 3TP3A 4A0YA 3CC7I 3BR3A 2VOPA 2O0YA 3KP4A 2XKOA 5DDGA 3HOZJ 3WU1B 3CCSI 4YIRX 3I9V2 4IPAA 2CV1A 3GTOJ 1QVUA 3L00A 4OAYA 2OQRA 1WRJA 1LFBA 3ABKH 4HAMA 2IA0A 1YRNB 4XR6A 4RAFA 4RA2A 1MH3A 4LB5A 3CESA 3GYHX 2R7RA 4AWXB 5DD4A 2P7VB 2RQQA 1WKMA 1Z91A 4M6VA 4HW0A 4DZJA 1JTXA 4ENMA 4EGZA 4L9NA 2VT2A 2R5YA 4XKVA 2HZTA 1HKTA 3A03A 3TOBA 2XF5A 4Q48A 2L7KA 2NOGA 1V5EA 2FE3A 5HS9A 2PX9A 2HVSA 2NXNB 5IYDJ 2CRGA 5HOOA 2IGKA 3N4MA 2KRFA 2IGOA 4D0PA 5ILSA 4A3KJ 2JRMA 3TO9A 4B3AA 1LUJB 3R4KA 5D6EA 2K3PA 2LF7A 2MLGA 2P4WA 3BLYA 2CW8A 2E35A 1RESA 1X1BA 2EIKH 3MKLA 2EBIA 1JUPA 4I2OA 1CGPA 3SEQA 3TBIA 2FUG2 4XBFA 2EZLA 1XGSA 4UUSA 4RB0A 4CZCA 3OYJA 1ZELA 4HSTA 3L2RA 2R7ZJ 3OYNA 2E34A 1ETXA 2DBBA 5KAIC 3TEDA 4I7HA 2XV4S 2ZXJA 2CV2A 3A2KA 2X6YA 4BACA 2V9KA 5LRRA 4N4OB 2J5OA 1VQ4I 2OTLI 1OQYA 4HQEA 1MMNA 4BBRJ 1IRFA 5CKTA 1QHHD 4UUTA 3O8HA 5GTHC 3IKTA 5F27A 2HQNA 4C3IJ 4OOIA 1ODDA 3JRCA 5IYCJ 1WZ2A 5EEHA 1Z6TA 2K3FA 2V6CA 4CCKA
chains in the Genus database with same CATH topology
3JSPA 3R60A 1XMKA 3QU3A 4L9VA 3I58A 3HYIA 4IRGA 1P4WA 4UV9A 5BS6A 2PQ8A 1YO5C 4EJVA 4P55A 1K78A 3HSEA 1U5TB 1MDMB 3H3ZA 1B1BA 3G3ZA 2QENA 1BJAA 3CUQC 2PMUA 3JTGA 2L01A 1PUEE 3QPHA 5LHHA 2OAZA 1T2KA 1QPMA 2UXXA 5KVRA 2HOEA 1ZREA 2RV8A 3KFWX 3GF2A 2GWRA 5HLGA 4G6QA 1HW1A 1U78A 2K27A 2EWNA 3BJ6A 3ULQB 4R1HA 3RPQA 1I1GA 1OR7A 1T39A 4KMFA 2EFQA 1Z05A 3P9KA 2EV5A 4M6YA 1WSUA 2VBXA 2XAFA 4BAYA 1XB4A 4LGWA 3JAMZ 1C0WA 1GHCA 1XD7A 3DQVC 1FBSA 3MZHA 1T98A 4RB3C 2Z9OA 5LGUA 2FBHA 3ECOA 3MZYA 1IN4A 3HHHA 3KP5A 3HHGA 2O6GE 1S7OA 1P2FA 4UVCA 5ILUA 4HBLA 3HTSB 3QPTA 2RKHA 4MHGA 2MBFA 1RI7A 3P9CA 3H92A 2VODA 2ZO4A 1SD7A 3F23A 1PP7U 3GX4X 2XAJA 3L2CA 3F22A 2LF8A 2KIMA 3EUHA 4HZFA 1BI0A 2HKXA 2FOKA 3KP3A 2A6HF 2WV0A 4G9YA 3EYIA 2YSRA 1L0OC 2TDXA 2X0LA 3NQOA 2ZCWA 4MEXF 4WXHA 3M8FA 2ESNA 3QP6A 4EV0A 4RGUA 2EFOA 4P9UA 1EH8A 3WTWC 4YIFA 4E70A 4GCVA 1AOYA 3P7NA 1T0FA 4PGHA 1H0MA 1SD5A 3E97A 4CYDA 2DW4A 3OV8A 4EQQA 1JE8A 3BY6A 2RDPA 2QQBA 1ZHFA 2IA1A 5KK1A 3MCZA 2XRNA 3FMQA 3SFZA 1HBXG 1H9GA 5HS8A 3O6BB 2H6CA 4HX8A 2CW0F 5CVRA 2GXBA 3P9IA 2Y0MA 4CICA 2B0LA 1B59A 5J8FA 4B8XA 1MJAA 3F72A 1XDSA 1D8JA 3COAC 3TDUC 5D8LB 2FBKA 1ZRFA 1ZN2A 1XSXA 1QZZA 1E2XA 2XIGA 2IW5A 1I1SA 1MJBA 2RGVA 3I71A 5FFXA 3U2RA 4AIJA 3IWZA 2NNYA 2EJRA 4I02A 4ZH4F 3GZ6A 2KIUA 1IW7F 4UUVA 4ASNA 4G7OF 4L5IA 3GLXA 3TGNA 2Z33A 1F5TA 1FWZA 2EK5A 1T38A 4CO8A 5F64A 5TRDA 1J0RA 1FYMA 5JVTA 3WTTC 5LEJA 1LNWA 5ED4A 3TKYA 3KLOA 4HDVA 2E7XA 4BXUA 3BJAA 1HXDA 1TBXA 2G7UA 5LHIA 4A5NA 3IKVA 3FM3A 4ZYDA 5DV5A 2L3DA 3BPVA 3MWMA 1YG2A 2DLLA 2Q0OA 3ERED 2GAUA 2XROA 3E5QA 1IXRC 5LEKA 3RDIA 2X4HA 4KIFA 2DQLA 5JFRA 2BV6A 2QM3A 5IT3A 1W4MA 5BMZA 1VTNC 1Z7UA 4ETSA 4L18B 4KYWA 3WG9A 3L9FA 2QVOA 3ELKA 2HKOA 3IHUA 2R7DA 4F7ZA 5K5RA 3ECHA 1PDNC 3QAHA 3HOTA 1JXSA 3M8EA 1UCRA 1BOAA 2VBWA 4KNYA 2XKPA 1WWXA 3C7JA 5FLXZ 1LB2A 2H94A 1ON1A 1XSDA 2A61A 1YFHA 1BBYA 1YLFA 2LKPA 4PZJA 4RGRA 1JHHA 1FYKA 1HKSA 5H6RA 1ZG5A 1L3LA 3ZN0A 3BJOA 1P4AA 3K1PA 3AAFA 1BN5A 1Z6RA 4BQAA 1SFEA 2XASA 1BC8C 5L3DA 2PN6A 4XSZF 4LFUA 2IT0A 2ZMEA 1R7JA 4NHJA 1T6SA 2RQPA 1ULYA 1H9TA 2P8TA 4CDGA 5HLIA 5CYVA 1Z9CA 1BI3A 2J5PA 2E1NA 4UHTA 5HLHA 5F1RA 5LLQA 2H6BA 3ZMVA 4YG2F 3REOA 2PJPA 3LAPA 3WGIA 2VE9A 3O3KA 3JW4A 4YFXF 5ERIA 5L3GA 1TNTA 1GXPA 4MTDA 3BOQA 4BHPA 1I6XA 4EJWA 3J80Z 3HOSA 3WE3A 5CVJA 2JT1A 5DCMA 1SMTA 5D5WB 4GGGA 2K4JA 2XGXA 5CJ9A 3D0SA 3RKYA 4RS8A 4BHCA 4O6JA 4YFNF 3HIFA 1U6GA 1RUNA 3E5XA 3ZPLA 2BGCA 2M87A 1UHMA 4ENJA 1D8KA 3C3WA 4MQ9F 3WGHA 2A6EF 1ZG3A 4WXDA 5LBQA 2MA3A 1RNLA 4FT8A 1KA8A 5E8IA 2L54A 3FXQA 2V1XA 4WWCA 1Y0UA 3LA3A 1SD4A 2QQ9A 5H20A 2BYVE 1O57A 4G7HF 2OU2A 3BP8A 1GXQA 4B09A 3SZPA 1XDUA 3HSFA 3LA2A 3FMSA 2MH9A 1R5HA 4MNUA 3V8LA 1ZLJA 4WXCA 1BI2A 4EM1A 5HDGA 3O2PE 1MKMA 1EH6A 1TW2A 1BIAA 2JZYA 4LK0F 5J6XA 5FGMA 3RKXA 3EYYA 5A2QZ 2JSCA 3R6SA 1HW5A 2AXLA 3VODA 3K2ZA 5JR3A 1ZG1A 3FF5A 1K7AA 1RZ4A 4HV5A 4N9HA 4ZZLA 4PGGA 2KIFA 3RYPA 2O03A 5TJJA 3E6CC 1I27A 5DUIA 4FHTA 1YIOA 2Z3YA 1CF7B 1UHWA 3CO6C 2RC4A 1EV7A 4YIIA 1FSHA 1FBUA 1J5YA 3VOEA 4FX0A 3DFGA 4U7BA 2D1VA 2CGPA 4U7DA 1IN8A 5HDKA 2M1BA 1XGOA 2STWA 2EFPA 1MDMA 2JPBA 4WCGA 2GIVA 2CFXA 1IUYA 2QUFA 5DYMA 4M9SA 1U2WA 3IWFA 3QRFF 4LLNA 4OIQF 5D4SA 2DU9A 1J59A 3KP2A 4NB5A 2M8EA 5LRSA 1KQ8A 3I5UA 4LB6B 2M30A 2WTEA 1K79A 1LQ1A 5BPIA 2A69F 5FB2A 3L7WA 4QWQA 1RUOA 1TQMA 4EJUA 4EM0B 3LAJA 1U5TA 4EVIA 4XLPF 2A3SA 3DXJF 3KE2A 2RVCA 1MZBA 2F5FA 3ZQ7A 1O3QA 1W7PB 4KIBA 5BPDA 2UXNA 2EFNA 4TV7A 1IZ1A 4N0BA 2VOOA 1R5GA 1FP2A 5D6FA 5E1ZB 3WE2A 2HQRA 1XMAA 4CZZA 5DUKA 1FYLA 4I0BA 2UWMA 1QQIA 2R3SA 2O8XA 2OQGA 2QQAA 5EEGA 1OYWA 2CQKA 4JK1X 2OA4A 3ISPA 3Q5FA 4CHUA 3WGGA 4EMSA 3KP6A 4UNOA 1B4AA 1SFUA 1B6AA 2DK8A 3EDPA 2P6TA 4WF2A 1BC7C 3BROA 2V1UA 5AIQA 3ABTA 1DUXC 3L09A 1Z1DA 1QGPA 2RN7A 5ICCA 2FXAA 2Z5UA 5E18F 4KMUX 1LVAA 1V4RA 3V4GA 1YYVA 4GYIA 4G94A 3WTZA 1SAXA 3I59B 2GXGA 1J9IA 1DPRA 4EM2A 4OIRF 1S29A 3FXRA 3RYRA 1BIBA 3KLNA 2VT3A 3GXOA 1PP8F 1I5ZA 5E8GA 1YW8A 3E3VA 1IXSB 2EB7A 1ZAOA 2OBPA 2VONA 1E17A 2VE8A 1G6NA 4P5OA 4RGXA 3Q9SA 1B9MA 4A0XA 1QO0D 4DNCA 2NNNA 3K0LA 3R61A 2FRHA 1JGSA 1K78B 4UV8A 4RGSA 4Z2YA 3F21A 1U3EM 4AVPA 4G6DA 3QOPA 3VEPA 5ICFA 2W25A 4N9IA 4IF4A 2YX4A 4PCQA 4Y15A 2IJLA 3WTVC 2YX7A 4MEYF 4HF2A 1O3SA 2EA4A 3B02A 2FMYA 2RNJA 1P6RA 3ZMUA 2KKOA 1W7PD 4GYGA 3EETA 1IN6A 1G4DA 2FA5A 5D5XB 2XVCA 3GFMA 4OIPF 3F3XA 3GZ5A 3ZP5A 3LQRA 3J81Z 5DEQA 1W7PA 3I53A 1W5TA 5E1WA 4XLNF 2ZFWA 3HRMA 4CXFA 3GFJA 1S8NA 5IT9K 4L9JA 4UVAA 2ISZA 5HVQC 1YS7A 3PQKA 2BBYA 5LGNA 2KJBA 1IRGA 3PQJA 4IJAA 5BQTA 4RAYA 3CUQA 1AWCA 2NYXA 1J75A 3RTRA 3V7SA 4PDKA 3ROUA 5F6FA 4NQWA 1S3JA 1OMIA 4IRIA 2G7HA 3HRUA 1QNTA 3FHZA 2A5YB 2IRFG 3BWGA 4HX7A 4LG0A 5E17F 4KICA 1TNSA 4M6XA 3E6BA 3SZTA 4KA4A 3TDZC 2R7FA 4A12A 4LLLA 1IN7A 4Y17A 2WC2A 3CO7C 4CGZA 2FF4A 4M72A 3K1NA 1OPCA 4HLXA 3CUQB 3SQNA 1G3SA 3HRTA 3OOPA 5JHUA 2DO7A 2CSOA 1R23A 1XCVA 4MTEA 3ZMSA 3HUGA 3GFIA 3WTXC 4ZYHA 2GA1A 2HTJA 3NRVA 4OINF 1ZH5A 4WK8F 2PI0A 5D5VB 2PEXA 1B9NA 1TW3A 5A2QK 2JRTA 1FLIA 2Y48A 2DK5A 2HR3A 1TTYA 3GVAA 5HDNA 2QYOA 1X3UA 4HYEA 2PBIA 1MD0A 2H27A 2ZNZA 4O5VA 4IHTA 3BPXA 1TLHB 2HEOA 3E5UA 1KGSA 2EV6A 3Q9VA 1LEBA 2P7CB 1YTYA 4KN7X 1O3TA 2CO5A 4S04A 3V7RA 4L5JA 1A04A 1R1VA 2HYGD 4A6DA 3GWZA 3LQQA 4UXNA 1XSVA 5ICGA 3LSTA 4HF1A 3FMRA 2FQ3A 3T5XA 1OYYA 2DAOA 2YR2A 3RI4A 4KN4X 2BEOA 2K02A 3GO5A 1O7LA 4MQVA 1FP1D 3T8TA 3V7CA 3IRQA 2ISYA 2EV0A 1FT9A 2VC0A 2F5CA 3M7GA 1P92A 4BH9A 1LDJA 5HS7A 2O3FA 3JAMK 3FWEA 2E7WA 1V3FA 5ICEA 3KETA 1KU9A 3CUOA 3R0AA 4G8XA 3KZZA 4M71A 1FNNA 3F6OA 2G9WA 2Z99A 5ILVA 1XN7A 1KYWA 4ZYGA 2A07F 3BZ6A 1ZRCA 4LLGF 1QZYA 1O3RA 3F8MA 3F8BA 1CF7A 4EGYA 4EJOA 2L4AA 4ESJA 1LJ9A 1ZGAA 6PAXA 4ENKA 1P4XA 4HOBA 4XRFA 1R1TA 3VFZA 4U0VA 5DD8A 3J81K 3T1BA 2HGCA 4RB2C 2FBIA 4RB1A 3ZMDA 4P9FA 3K9TA 4KDPA 1HQCA 4GO1A 1OYIA 3CLOA 1FZPB 4P96A 2F5DA 5CVUA 3CDHA 2XUBA 5JI6A 2ETHA 2OZUA 3TO7A 3B73A 2VBYA 3WTSC 2GA2A 5IT9Z 1FBQA 3VB2A 2ACJA 3RKWA 2WWYA 4YFKF 3ABUA 1GVJA 4I09A 4JBAA 3GW2A 5J8CA 3CJNA 2D1HA 4Q47A 3GFLA 3CTAA 2DTRA 4EJTA 2K4BA 3T0YA 5CLSA 1J2XA 2DQRA 3R0JA 4KT5C 3SHFA 2YU3A 3D5LA 2P5LC 2DPDA 1Q1HA 3BDDA 4A5MA 4G7ZF 1R1UA 3RIRA 2QBYA 3T8RA 1W5SA 2YPRA 4OU0A 3KEOA 2V9VA 4HA8A 2MH2A 2PFBA 1R58A 2FU4A 1LDKB 1J7KA 5FD5A 1USTA 4KFCA 1YW7A 3I54A 2QWWA 3U1DA 2L4MA 3I4PA 1BM9A 3W6JB 1LEAA 2W84A 2ELHA 2DI3A 1G3TA 1SMYF 2F5EA 4BNCA 1TQIA 3G73A 4IHSA 2HTSA 2XAQA 4HDUA 3EQLF 3WU0A 4GXOA 4ZZDA 3F8CA 3F8NA 4HX4A 2PLYA 4M74A 3FXUA 2P5VA 3RPUA 2COMA 1XGMA 1F4KA 3JTHA 2F2EA 3DKWA 2IPQX 1IAWA 4UVBA 1F1ZA 2GZWA 5K5QA 3ML6A 3W6KB 5LGTA 2IVMA 4LG0B 2HS5A 3GEZA 3IRRA 1HKQA 3MQ0A 3ZMZA 2MLKA 2ZNYA 4L0ZB 5FLXK 3ZN1A 5K5OA 5E1XA 1ON2A 2EA2A 2VBZA 2DFIA 3IL2A 1DPUA 1XGNA 2ZKZA 4LMYA 2D2WA 1DP7P 5H6QA 4FX4A 1U8RA 1K6OA 3ZMTA 2Q8KA 2XAHA 2O61A 2FNPA 3HRSA 3I64A 4XSXF 1YW9A 4I01A 3TQNA 1SFXA 3QP5A 3WTYC 1KU7A 2DPUA 5CVVA 4K2EA 1R22A 2W85A 3WODF 3M9AA 2Y75A 5CVIA 3V8KA 2JTVA 2W57A 5AONA 2NS0A 1STZA 2M45A 4WX9A 4MGRA 4M9XA 2W24A 3E6DA 1USSA 1KU2A 3DV8A 2CWEA 2A68F 2MC3A 1IN5A 1FSEA 1QBJA 3FM5A 1KU3A 3MEXA 1HW2A 3HTUA 1U5TC 4A0ZA 3KP7A 2KJCA 4IRHA 3H3UA 4U0YA 4Y13A 1S6LA 2ZJ2A 1ZGJA 1FPQA 1R00A 5L3EA 5D8KB 1HSJA 1BI1A 1S7AA 3V8JA 2K86A 4ESBA 3KZYA 2P6SA 4OMZA 2QZ8A 5FO5A 3KCCA 3J7AO 5DCMB 4KIGA 2GQQA 1XCBA 4M9ZA 3DPTA 1FOKA 5BOXA 5E20A 3C18A 4ENNA 3I59A 3J80K 2LNBA 4L9TA 4S05A 5L3CA 4U88A 2ZBKA 4O3MA 3LFKA 1FY7A 4AD9A 3TO6A 1RIOH 2OZ6A 3K1MA 4IVNA 2XHKA 4ON0A 4ZYEA 2FSWA 2UZKA 2QLZA 3KEQA 2ADUA 2STTA 3DP7A 3MFKA 3PFIA 2V79A 4AIHA 1KQ9A 4HQMA 2FNAA 3F8FA 1HSTA 1NHAA 1TQPA 1G3YA 3U9GA 2HDCA 4OIOF 2XAGA 3MAJA 3FX3A 2AS5F 1YS6A 1G3WA 4LJZF 2CYYA 2L02A 1ZYRF 1EH7A 3WTUC 1ONVA 2LSOA 3IC7A 5K1YA 2EFWA 2C6YA 2DT5A 2P5KA 3GUDA 3LA7A 4U0WA 2FMLA 4BYYA 4ESFA 4LD5A 5FD6A 5L3FA 4HLYA 1FC3A 2VC1A 2LDUA 3C1DA 1DDNA 1OKRA 2ESHA 3DF8A 2ZMEB 1O7FA 3JSOA 2IP2A 1ZRDA 2FEZA 2PG4A 2QBYB 2NAZA 1YQAA 3DPLC 4I98B 4HV6A 4R8HA 4L0YB 4IXAA 3I0TA 1D3YA 4I0AA 1UB9A 2VN2A 1IXCA 3SXYA 3S2WA 2HYFA 2VXZA 3RJPA 4DQ2A 3TOAA 4M73A 4OMYA 3HSRA 3QU6A 1WI9A 3K69A 2PMHA 1KYZA 2HWVA 2V1DA 2NRAC 2HFHA 1FX7A 1KQ0A 5LHGA 2OD5A 5L3BA 4QLCU 5FFZA 4R79A 2BE5F 5D4RA 3F6VA 3LWFA 1REPC 4Q5SF 2M5WA 4A2UA 1WQ2A 3M1EA 1F9NA 3FZVA 4AIKA 2IA2A 1MJ9A 1D5VA 1ZLKA 2MD5A 1IF1A 3E6MA 1LDDA 4HF0A 2K7LA 1JHFA 2H09A 2E1CA 1MGTA 5D5UB 1ZARA 2CG4A 4KUMA 1R36A 4JQFA 4A6EA 1UFMA 4RAZA 5AIPA 4H0EA 5DCFA 1SD6A 3DEUA 2Q2EA 3N97A 2JPCA 4LK1F 2D45A 3NEUA 4Q4ZF 4BHBA 4A0YA 2VOPA 2O0YA 3KP4A 2XKOA 5DDGA 3WU1B 4IPAA 3L00A 2OQRA 1WRJA 4HAMA 2IA0A 4LB5A 3GYHX 4AWXB 5DD4A 2P7VB 1WKMA 1Z91A 4HW0A 4ENMA 4EGZA 4L9NA 2VT2A 2HZTA 1HKTA 3TOBA 4Q48A 5HS9A 2FE3A 5HOOA 3N4MA 2KRFA 4D0PA 5ILSA 3TO9A 3R4KA 5D6EA 2LF7A 2MLGA 2P4WA 4I2OA 1CGPA 4XBFA 1XGSA 4RB0A 2DBBA 4I7HA 2XV4S 2ZXJA 5LRRA 2J5OA 4HQEA 1IRFA 3IKTA 2HQNA 4OOIA 1ODDA 5EEHA 1Z6TA 2V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSP A;  3R60 A;  1XMK A;  3QU3 A;  4L9V A;  3I58 A;  3HYI A;  4IRG A;  1P4W A;  4UV9 A;  5BS6 A;  2PQ8 A;  1YO5 C;  4EJV A;  4P55 A;  1K78 A;  3HSE A;  1U5T B;  1MDM B;  3H3Z A;  1B1B A;  3G3Z A;  2QEN A;  1BJA A;  3CUQ C;  2PMU A;  3JTG A;  2L01 A;  1PUE E;  3QPH A;  5LHH A;  2OAZ A;  1T2K A;  1QPM A;  2UXX A;  5KVR A;  2HOE A;  1ZRE A;  2RV8 A;  3KFW X;  3GF2 A;  2GWR A;  5HLG A;  4G6Q A;  1HW1 A;  1U78 A;  2K27 A;  2EWN A;  3BJ6 A;  3ULQ B;  4R1H A;  3RPQ A;  1I1G A;  1OR7 A;  1T39 A;  4KMF A;  2EFQ A;  1Z05 A;  3P9K A;  2EV5 A;  4M6Y A;  1WSU A;  2VBX A;  2XAF A;  4BAY A;  1XB4 A;  4LGW A;  3JAM Z;  1C0W A;  1GHC A;  1XD7 A;  3DQV C;  1FBS A;  3MZH A;  1T98 A;  4RB3 C;  2Z9O A;  5LGU A;  2FBH A;  3ECO A;  3MZY A;  1IN4 A;  3HHH A;  3KP5 A;  3HHG A;  2O6G E;  1S7O A;  1P2F A;  4UVC A;  5ILU A;  4HBL A;  3HTS B;  3QPT A;  2RKH A;  4MHG A;  2MBF A;  1RI7 A;  3P9C A;  3H92 A;  2VOD A;  2ZO4 A;  1SD7 A;  3F23 A;  1PP7 U;  3GX4 X;  2XAJ A;  3L2C A;  3F22 A;  2LF8 A;  2KIM A;  3EUH A;  4HZF A;  1BI0 A;  2HKX A;  2FOK A;  3KP3 A;  2A6H F;  2WV0 A;  4G9Y A;  3EYI A;  2YSR A;  1L0O C;  2TDX A;  2X0L A;  3NQO A;  2ZCW A;  4MEX F;  4WXH A;  3M8F A;  2ESN A;  3QP6 A;  4EV0 A;  4RGU A;  2EFO A;  4P9U A;  1EH8 A;  3WTW C;  4YIF A;  4E70 A;  4GCV A;  1AOY A;  3P7N A;  1T0F A;  4PGH A;  1H0M A;  1SD5 A;  3E97 A;  4CYD A;  2DW4 A;  3OV8 A;  4EQQ A;  1JE8 A;  3BY6 A;  2RDP A;  2QQB A;  1ZHF A;  2IA1 A;  5KK1 A;  3MCZ A;  2XRN A;  3FMQ A;  3SFZ A;  1HBX G;  1H9G A;  5HS8 A;  3O6B B;  2H6C A;  4HX8 A;  2CW0 F;  5CVR A;  2GXB A;  3P9I A;  2Y0M A;  4CIC A;  2B0L A;  1B59 A;  5J8F A;  4B8X A;  1MJA A;  3F72 A;  1XDS A;  1D8J A;  3COA C;  3TDU C;  5D8L B;  2FBK A;  1ZRF A;  1ZN2 A;  1XSX A;  1QZZ A;  1E2X A;  2XIG A;  2IW5 A;  1I1S A;  1MJB A;  2RGV A;  3I71 A;  5FFX A;  3U2R A;  4AIJ A;  3IWZ A;  2NNY A;  2EJR A;  4I02 A;  4ZH4 F;  3GZ6 A;  2KIU A;  1IW7 F;  4UUV A;  4ASN A;  4G7O F;  4L5I A;  3GLX A;  3TGN A;  2Z33 A;  1F5T A;  1FWZ A;  2EK5 A;  1T38 A;  4CO8 A;  5F64 A;  5TRD A;  1J0R A;  1FYM A;  5JVT A;  3WTT C;  5LEJ A;  1LNW A;  5ED4 A;  3TKY A;  3KLO A;  4HDV A;  2E7X A;  4BXU A;  3BJA A;  1HXD A;  1TBX A;  2G7U A;  5LHI A;  4A5N A;  3IKV A;  3FM3 A;  4ZYD A;  5DV5 A;  2L3D A;  3BPV A;  3MWM A;  1YG2 A;  2DLL A;  2Q0O A;  3ERE D;  2GAU A;  2XRO A;  3E5Q A;  1IXR C;  5LEK A;  3RDI A;  2X4H A;  4KIF A;  2DQL A;  5JFR A;  2BV6 A;  2QM3 A;  5IT3 A;  1W4M A;  5BMZ A;  1VTN C;  1Z7U A;  4ETS A;  4L18 B;  4KYW A;  3WG9 A;  3L9F A;  2QVO A;  3ELK A;  2HKO A;  3IHU A;  2R7D A;  4F7Z A;  5K5R A;  3ECH A;  1PDN C;  3QAH A;  3HOT A;  1JXS A;  3M8E A;  1UCR A;  1BOA A;  2VBW A;  4KNY A;  2XKP A;  1WWX A;  3C7J A;  5FLX Z;  1LB2 A;  2H94 A;  1ON1 A;  1XSD A;  2A61 A;  1YFH A;  1BBY A;  1YLF A;  2LKP A;  4PZJ A;  4RGR A;  1JHH A;  1FYK A;  1HKS A;  5H6R A;  1ZG5 A;  1L3L A;  3ZN0 A;  3BJO A;  1P4A A;  3K1P A;  3AAF A;  1BN5 A;  1Z6R A;  4BQA A;  1SFE A;  2XAS A;  1BC8 C;  5L3D A;  2PN6 A;  4XSZ F;  4LFU A;  2IT0 A;  2ZME A;  1R7J A;  4NHJ A;  1T6S A;  2RQP A;  1ULY A;  1H9T A;  2P8T A;  4CDG A;  5HLI A;  5CYV A;  1Z9C A;  1BI3 A;  2J5P A;  2E1N A;  4UHT A;  5HLH A;  5F1R A;  5LLQ A;  2H6B A;  3ZMV A;  4YG2 F;  3REO A;  2PJP A;  3LAP A;  3WGI A;  2VE9 A;  3O3K A;  3JW4 A;  4YFX F;  5ERI A;  5L3G A;  1TNT A;  1GXP A;  4MTD A;  3BOQ A;  4BHP A;  1I6X A;  4EJW A;  3J80 Z;  3HOS A;  3WE3 A;  5CVJ A;  2JT1 A;  5DCM A;  1SMT A;  5D5W B;  4GGG A;  2K4J A;  2XGX A;  5CJ9 A;  3D0S A;  3RKY A;  4RS8 A;  4BHC A;  4O6J A;  4YFN F;  3HIF A;  1U6G A;  1RUN A;  3E5X A;  3ZPL A;  2BGC A;  2M87 A;  1UHM A;  4ENJ A;  1D8K A;  3C3W A;  4MQ9 F;  3WGH A;  2A6E F;  1ZG3 A;  4WXD A;  5LBQ A;  2MA3 A;  1RNL A;  4FT8 A;  1KA8 A;  5E8I A;  2L54 A;  3FXQ A;  2V1X A;  4WWC A;  1Y0U A;  3LA3 A;  1SD4 A;  2QQ9 A;  5H20 A;  2BYV E;  1O57 A;  4G7H F;  2OU2 A;  3BP8 A;  1GXQ A;  4B09 A;  3SZP A;  1XDU A;  3HSF A;  3LA2 A;  3FMS A;  2MH9 A;  1R5H A;  4MNU A;  3V8L A;  1ZLJ A;  4WXC A;  1BI2 A;  4EM1 A;  5HDG A;  3O2P E;  1MKM A;  1EH6 A;  1TW2 A;  1BIA A;  2JZY A;  4LK0 F;  5J6X A;  5FGM A;  3RKX A;  3EYY A;  5A2Q Z;  2JSC A;  3R6S A;  1HW5 A;  2AXL A;  3VOD A;  3K2Z A;  5JR3 A;  1ZG1 A;  3FF5 A;  1K7A A;  1RZ4 A;  4HV5 A;  4N9H A;  4ZZL A;  4PGG A;  2KIF A;  3RYP A;  2O03 A;  5TJJ A;  3E6C C;  1I27 A;  5DUI A;  4FHT A;  1YIO A;  2Z3Y A;  1CF7 B;  1UHW A;  3CO6 C;  2RC4 A;  1EV7 A;  4YII A;  1FSH A;  1FBU A;  1J5Y A;  3VOE A;  4FX0 A;  3DFG A;  4U7B A;  2D1V A;  2CGP A;  4U7D A;  1IN8 A;  5HDK A;  2M1B A;  1XGO A;  2STW A;  2EFP A;  1MDM A;  2JPB A;  4WCG A;  2GIV A;  2CFX A;  1IUY A;  2QUF A;  5DYM A;  4M9S A;  1U2W A;  3IWF A;  3QRF F;  4LLN A;  4OIQ F;  5D4S A;  2DU9 A;  1J59 A;  3KP2 A;  4NB5 A;  2M8E A;  5LRS A;  1KQ8 A;  3I5U A;  4LB6 B;  2M30 A;  2WTE A;  1K79 A;  1LQ1 A;  5BPI A;  2A69 F;  5FB2 A;  3L7W A;  4QWQ A;  1RUO A;  1TQM A;  4EJU A;  4EM0 B;  3LAJ A;  1U5T A;  4EVI A;  4XLP F;  2A3S A;  3DXJ F;  3KE2 A;  2RVC A;  1MZB A;  2F5F A;  3ZQ7 A;  1O3Q A;  1W7P B;  4KIB A;  5BPD A;  2UXN A;  2EFN A;  4TV7 A;  1IZ1 A;  4N0B A;  2VOO A;  1R5G A;  1FP2 A;  5D6F A;  5E1Z B;  3WE2 A;  2HQR A;  1XMA A;  4CZZ A;  5DUK A;  1FYL A;  4I0B A;  2UWM A;  1QQI A;  2R3S A;  2O8X A;  2OQG A;  2QQA A;  5EEG A;  1OYW A;  2CQK A;  4JK1 X;  2OA4 A;  3ISP A;  3Q5F A;  4CHU A;  3WGG A;  4EMS A;  3KP6 A;  4UNO A;  1B4A A;  1SFU A;  1B6A A;  2DK8 A;  3EDP A;  2P6T A;  4WF2 A;  1BC7 C;  3BRO A;  2V1U A;  5AIQ A;  3ABT A;  1DUX C;  3L09 A;  1Z1D A;  1QGP A;  2RN7 A;  5ICC A;  2FXA A;  2Z5U A;  5E18 F;  4KMU X;  1LVA A;  1V4R A;  3V4G A;  1YYV A;  4GYI A;  4G94 A;  3WTZ A;  1SAX A;  3I59 B;  2GXG A;  1J9I A;  1DPR A;  4EM2 A;  4OIR F;  1S29 A;  3FXR A;  3RYR A;  1BIB A;  3KLN A;  2VT3 A;  3GXO A;  1PP8 F;  1I5Z A;  5E8G A;  1YW8 A;  3E3V A;  1IXS B;  2EB7 A;  1ZAO A;  2OBP A;  2VON A;  1E17 A;  2VE8 A;  1G6N A;  4P5O A;  4RGX A;  3Q9S A;  1B9M A;  4A0X A;  1QO0 D;  4DNC A;  2NNN A;  3K0L A;  3R61 A;  2FRH A;  1JGS A;  1K78 B;  4UV8 A;  4RGS A;  4Z2Y A;  3F21 A;  1U3E M;  4AVP A;  4G6D A;  3QOP A;  3VEP A;  5ICF A;  2W25 A;  4N9I A;  4IF4 A;  2YX4 A;  4PCQ A;  4Y15 A;  2IJL A;  3WTV C;  2YX7 A;  4MEY F;  4HF2 A;  1O3S A;  2EA4 A;  3B02 A;  2FMY A;  2RNJ A;  1P6R A;  3ZMU A;  2KKO A;  1W7P D;  4GYG A;  3EET A;  1IN6 A;  1G4D A;  2FA5 A;  5D5X B;  2XVC A;  3GFM A;  4OIP F;  3F3X A;  3GZ5 A;  3ZP5 A;  3LQR A;  3J81 Z;  5DEQ A;  1W7P A;  3I53 A;  1W5T A;  5E1W A;  4XLN F;  2ZFW A;  3HRM A;  4CXF A;  3GFJ A;  1S8N A;  5IT9 K;  4L9J A;  4UVA A;  2ISZ A;  5HVQ C;  1YS7 A;  3PQK A;  2BBY A;  5LGN A;  2KJB A;  1IRG A;  3PQJ A;  4IJA A;  5BQT A;  4RAY A;  3CUQ A;  1AWC A;  2NYX A;  1J75 A;  3RTR A;  3V7S A;  4PDK A;  3ROU A;  5F6F A;  4NQW A;  1S3J A;  1OMI A;  4IRI A;  2G7H A;  3HRU A;  1QNT A;  3FHZ A;  2A5Y B;  2IRF G;  3BWG A;  4HX7 A;  4LG0 A;  5E17 F;  4KIC A;  1TNS A;  4M6X A;  3E6B A;  3SZT A;  4KA4 A;  3TDZ C;  2R7F A;  4A12 A;  4LLL A;  1IN7 A;  4Y17 A;  2WC2 A;  3CO7 C;  4CGZ A;  2FF4 A;  4M72 A;  3K1N A;  1OPC A;  4HLX A;  3CUQ B;  3SQN A;  1G3S A;  3HRT A;  3OOP A;  5JHU A;  2DO7 A;  2CSO A;  1R23 A;  1XCV A;  4MTE A;  3ZMS A;  3HUG A;  3GFI A;  3WTX C;  4ZYH A;  2GA1 A;  2HTJ A;  3NRV A;  4OIN F;  1ZH5 A;  4WK8 F;  2PI0 A;  5D5V B;  2PEX A;  1B9N A;  1TW3 A;  5A2Q K;  2JRT A;  1FLI A;  2Y48 A;  2DK5 A;  2HR3 A;  1TTY A;  3GVA A;  5HDN A;  2QYO A;  1X3U A;  4HYE A;  2PBI A;  1MD0 A;  2H27 A;  2ZNZ A;  4O5V A;  4IHT A;  3BPX A;  1TLH B;  2HEO A;  3E5U A;  1KGS A;  2EV6 A;  3Q9V A;  1LEB A;  2P7C B;  1YTY A;  4KN7 X;  1O3T A;  2CO5 A;  4S04 A;  3V7R A;  4L5J A;  1A04 A;  1R1V A;  2HYG D;  4A6D A;  3GWZ A;  3LQQ A;  4UXN A;  1XSV A;  5ICG A;  3LST A;  4HF1 A;  3FMR A;  2FQ3 A;  3T5X A;  1OYY A;  2DAO A;  2YR2 A;  3RI4 A;  4KN4 X;  2BEO A;  2K02 A;  3GO5 A;  1O7L A;  4MQV A;  1FP1 D;  3T8T A;  3V7C A;  3IRQ A;  2ISY A;  2EV0 A;  1FT9 A;  2VC0 A;  2F5C A;  3M7G A;  1P92 A;  4BH9 A;  1LDJ A;  5HS7 A;  2O3F A;  3JAM K;  3FWE A;  2E7W A;  1V3F A;  5ICE A;  3KET A;  1KU9 A;  3CUO A;  3R0A A;  4G8X A;  3KZZ A;  4M71 A;  1FNN A;  3F6O A;  2G9W A;  2Z99 A;  5ILV A;  1XN7 A;  1KYW A;  4ZYG A;  2A07 F;  3BZ6 A;  1ZRC A;  4LLG F;  1QZY A;  1O3R A;  3F8M A;  3F8B A;  1CF7 A;  4EGY A;  4EJO A;  2L4A A;  4ESJ A;  1LJ9 A;  1ZGA A;  6PAX A;  4ENK A;  1P4X A;  4HOB A;  4XRF A;  1R1T A;  3VFZ A;  4U0V A;  5DD8 A;  3J81 K;  3T1B A;  2HGC A;  4RB2 C;  2FBI A;  4RB1 A;  3ZMD A;  4P9F A;  3K9T A;  4KDP A;  1HQC A;  4GO1 A;  1OYI A;  3CLO A;  1FZP B;  4P96 A;  2F5D A;  5CVU A;  3CDH A;  2XUB A;  5JI6 A;  2ETH A;  2OZU A;  3TO7 A;  3B73 A;  2VBY A;  3WTS C;  2GA2 A;  5IT9 Z;  1FBQ A;  3VB2 A;  2ACJ A;  3RKW A;  2WWY A;  4YFK F;  3ABU A;  1GVJ A;  4I09 A;  4JBA A;  3GW2 A;  5J8C A;  3CJN A;  2D1H A;  4Q47 A;  3GFL A;  3CTA A;  2DTR A;  4EJT A;  2K4B A;  3T0Y A;  5CLS A;  1J2X A;  2DQR A;  3R0J A;  4KT5 C;  3SHF A;  2YU3 A;  3D5L A;  2P5L C;  2DPD A;  1Q1H A;  3BDD A;  4A5M A;  4G7Z F;  1R1U A;  3RIR A;  2QBY A;  3T8R A;  1W5S A;  2YPR A;  4OU0 A;  3KEO A;  2V9V A;  4HA8 A;  2MH2 A;  2PFB A;  1R58 A;  2FU4 A;  1LDK B;  1J7K A;  5FD5 A;  1UST A;  4KFC A;  1YW7 A;  3I54 A;  2QWW A;  3U1D A;  2L4M A;  3I4P A;  1BM9 A;  3W6J B;  1LEA A;  2W84 A;  2ELH A;  2DI3 A;  1G3T A;  1SMY F;  2F5E A;  4BNC A;  1TQI A;  3G73 A;  4IHS A;  2HTS A;  2XAQ A;  4HDU A;  3EQL F;  3WU0 A;  4GXO A;  4ZZD A;  3F8C A;  3F8N A;  4HX4 A;  2PLY A;  4M74 A;  3FXU A;  2P5V A;  3RPU A;  2COM A;  1XGM A;  1F4K A;  3JTH A;  2F2E A;  3DKW A;  2IPQ X;  1IAW A;  4UVB A;  1F1Z A;  2GZW A;  5K5Q A;  3ML6 A;  3W6K B;  5LGT A;  2IVM A;  4LG0 B;  2HS5 A;  3GEZ A;  3IRR A;  1HKQ A;  3MQ0 A;  3ZMZ A;  2MLK A;  2ZNY A;  4L0Z B;  5FLX K;  3ZN1 A;  5K5O A;  5E1X A;  1ON2 A;  2EA2 A;  2VBZ A;  2DFI A;  3IL2 A;  1DPU A;  1XGN A;  2ZKZ A;  4LMY A;  2D2W A;  1DP7 P;  5H6Q A;  4FX4 A;  1U8R A;  1K6O A;  3ZMT A;  2Q8K A;  2XAH A;  2O61 A;  2FNP A;  3HRS A;  3I64 A;  4XSX F;  1YW9 A;  4I01 A;  3TQN A;  1SFX A;  3QP5 A;  3WTY C;  1KU7 A;  2DPU A;  5CVV A;  4K2E A;  1R22 A;  2W85 A;  3WOD F;  3M9A A;  2Y75 A;  5CVI A;  3V8K A;  2JTV A;  2W57 A;  5AON A;  2NS0 A;  1STZ A;  2M45 A;  4WX9 A;  4MGR A;  4M9X A;  2W24 A;  3E6D A;  1USS A;  1KU2 A;  3DV8 A;  2CWE A;  2A68 F;  2MC3 A;  1IN5 A;  1FSE A;  1QBJ A;  3FM5 A;  1KU3 A;  3MEX A;  1HW2 A;  3HTU A;  1U5T C;  4A0Z A;  3KP7 A;  2KJC A;  4IRH A;  3H3U A;  4U0Y A;  4Y13 A;  1S6L A;  2ZJ2 A;  1ZGJ A;  1FPQ A;  1R00 A;  5L3E A;  5D8K B;  1HSJ A;  1BI1 A;  1S7A A;  3V8J A;  2K86 A;  4ESB A;  3KZY A;  2P6S A;  4OMZ A;  2QZ8 A;  5FO5 A;  3KCC A;  3J7A O;  5DCM B;  4KIG A;  2GQQ A;  1XCB A;  4M9Z A;  3DPT A;  1FOK A;  5BOX A;  5E20 A;  3C18 A;  4ENN A;  3I59 A;  3J80 K;  2LNB A;  4L9T A;  4S05 A;  5L3C A;  4U88 A;  2ZBK A;  4O3M A;  3LFK A;  1FY7 A;  4AD9 A;  3TO6 A;  1RIO H;  2OZ6 A;  3K1M A;  4IVN A;  2XHK A;  4ON0 A;  4ZYE A;  2FSW A;  2UZK A;  2QLZ A;  3KEQ A;  2ADU A;  2STT A;  3DP7 A;  3MFK A;  3PFI A;  2V79 A;  4AIH A;  1KQ9 A;  4HQM A;  2FNA A;  3F8F A;  1HST A;  1NHA A;  1TQP A;  1G3Y A;  3U9G A;  2HDC A;  4OIO F;  2XAG A;  3MAJ A;  3FX3 A;  2AS5 F;  1YS6 A;  1G3W A;  4LJZ F;  2CYY A;  2L02 A;  1ZYR F;  1EH7 A;  3WTU C;  1ONV A;  2LSO A;  3IC7 A;  5K1Y A;  2EFW A;  2C6Y A;  2DT5 A;  2P5K A;  3GUD A;  3LA7 A;  4U0W A;  2FML A;  4BYY A;  4ESF A;  4LD5 A;  5FD6 A;  5L3F A;  4HLY A;  1FC3 A;  2VC1 A;  2LDU A;  3C1D A;  1DDN A;  1OKR A;  2ESH A;  3DF8 A;  2ZME B;  1O7F A;  3JSO A;  2IP2 A;  1ZRD A;  2FEZ A;  2PG4 A;  2QBY B;  2NAZ A;  1YQA A;  3DPL C;  4I98 B;  4HV6 A;  4R8H A;  4L0Y B;  4IXA A;  3I0T A;  1D3Y A;  4I0A A;  1UB9 A;  2VN2 A;  1IXC A;  3SXY A;  3S2W A;  2HYF A;  2VXZ A;  3RJP A;  4DQ2 A;  3TOA A;  4M73 A;  4OMY A;  3HSR A;  3QU6 A;  1WI9 A;  3K69 A;  2PMH A;  1KYZ A;  2HWV A;  2V1D A;  2NRA C;  2HFH A;  1FX7 A;  1KQ0 A;  5LHG A;  2OD5 A;  5L3B A;  4QLC U;  5FFZ A;  4R79 A;  2BE5 F;  5D4R A;  3F6V A;  3LWF A;  1REP C;  4Q5S F;  2M5W A;  4A2U A;  1WQ2 A;  3M1E A;  1F9N A;  3FZV A;  4AIK A;  2IA2 A;  1MJ9 A;  1D5V A;  1ZLK A;  2MD5 A;  1IF1 A;  3E6M A;  1LDD A;  4HF0 A;  2K7L A;  1JHF A;  2H09 A;  2E1C A;  1MGT A;  5D5U B;  1ZAR A;  2CG4 A;  4KUM A;  1R36 A;  4JQF A;  4A6E A;  1UFM A;  4RAZ A;  5AIP A;  4H0E A;  5DCF A;  1SD6 A;  3DEU A;  2Q2E A;  3N97 A;  2JPC A;  4LK1 F;  2D45 A;  3NEU A;  4Q4Z F;  4BHB A;  4A0Y A;  2VOP A;  2O0Y A;  3KP4 A;  2XKO A;  5DDG A;  3WU1 B;  4IPA A;  3L00 A;  2OQR A;  1WRJ A;  4HAM A;  2IA0 A;  4LB5 A;  3GYH X;  4AWX B;  5DD4 A;  2P7V B;  1WKM A;  1Z91 A;  4HW0 A;  4ENM A;  4EGZ A;  4L9N A;  2VT2 A;  2HZT A;  1HKT A;  3TOB A;  4Q48 A;  5HS9 A;  2FE3 A;  5HOO A;  3N4M A;  2KRF A;  4D0P A;  5ILS A;  3TO9 A;  3R4K A;  5D6E A;  2LF7 A;  2MLG A;  2P4W A;  4I2O A;  1CGP A;  4XBF A;  1XGS A;  4RB0 A;  2DBB A;  4I7H A;  2XV4 S;  2ZXJ A;  5LRR A;  2J5O A;  4HQE A;  1IRF A;  3IKT A;  2HQN A;  4OOI A;  1ODD A;  5EEH A;  1Z6T A;  2V6C A; 
#chains in the Genus database with same CATH topology
 3JSP A;  1RKT A;  1YJN I;  3R60 A;  1XMK A;  3QU3 A;  4L9V A;  3I58 A;  4A93 J;  2Q2E B;  3S8P A;  4PUS A;  5B1A H;  3I55 I;  3HYI A;  5J40 A;  2V26 A;  3OIQ A;  4IRG A;  3FXL A;  4AVZ A;  1P4W A;  4UV9 A;  5BS6 A;  2PQ8 A;  1YO5 C;  4BJ5 C;  5FKM A;  4EJV A;  5FKK A;  4B1R A;  3K2A A;  4BXF A;  5GPA A;  4P55 A;  3FXM A;  1K78 A;  3HSE A;  9ANT A;  2KRC A;  1U5T B;  1MDM B;  3H3Z A;  1B1B A;  3ZQQ A;  3G3Z A;  2QEN A;  1BJA A;  1D1C A;  3CUQ C;  2PMU A;  3JTG A;  2QEX I;  2CS3 A;  1HLV A;  2L01 A;  1PUE E;  1DQU A;  3QPH A;  1XG1 A;  5LHH A;  2OAZ A;  4XOR A;  1A35 A;  1T2K A;  2R5Z B;  3HKZ N;  1R5I D;  1QPM A;  3IH2 A;  1N77 A;  5F1J A;  1FIA A;  1SVM A;  2AO9 A;  3LSP A;  3KZI C;  4ZJZ A;  2UV1 A;  3A0H C;  4B47 A;  3NAR A;  2UXX A;  1TC3 C;  5KVR A;  2HOE A;  1ZRE A;  2RV8 A;  3KFW X;  2AQE A;  1F43 A;  2BY2 A;  3GF2 A;  4FIS A;  1E0E A;  3TW7 A;  2KZV A;  2FQ4 A;  2GWR A;  2DOF A;  4Y7N J;  2R7W A;  5K7F A;  3SDB A;  5HLG A;  4G6Q A;  1HW1 A;  1U78 A;  3GBG A;  2K27 A;  4AC0 A;  2N8G A;  1JKQ C;  2EWN A;  2LD5 A;  3BJ6 A;  4V2G A;  3KPH A;  3ULQ B;  1FMV A;  2DFF A;  3FDY A;  3LSM A;  4R1H A;  3RPQ A;  2M0M A;  1I1G A;  1OR7 A;  1T39 A;  4KMF A;  2EFQ A;  1FTT A;  2EZK A;  4AYB A;  1Z05 A;  1ACI A;  3P9K A;  2EV5 A;  2O5R A;  4M6Y A;  4GDF A;  1J09 A;  1WSU A;  1WGX A;  2VBX A;  2Y9Y A;  1I39 A;  3M4O J;  2XAF A;  2L7M P;  1XB4 A;  4LGW A;  4BAY A;  2DA2 A;  3JAM Z;  5C4J J;  1C0W A;  1GHC A;  3OS2 A;  1XD7 A;  3DQV C;  1FBS A;  2MW8 A;  2XDV A;  2BY3 A;  3MZH A;  1FOX A;  1T98 A;  4RB3 C;  2Z9O A;  2R93 J;  1UMQ A;  5LGU A;  4FET A;  2VXD A;  2FBH A;  5E79 C;  3ECO A;  3MZY A;  1IN4 A;  4IHY A;  4QPO A;  3HHH A;  2XGC A;  3KP5 A;  3ESW B;  1E3H A;  3HHG A;  2ME0 A;  2KDZ A;  1S7O A;  1P2F A;  2O6G E;  4UVC A;  1BR1 A;  5ILU A;  4HBL A;  3HTS B;  1XX5 A;  2VQH A;  3QPT A;  2RKH A;  4MHG A;  2K9Q A;  2MBF A;  2HPI A;  3ABL H;  2HOT A;  1RI7 A;  3Q0V A;  1TWH J;  3P9C A;  2QSG X;  3H92 A;  2XSD C;  2VOD A;  2ZO4 A;  1EKE A;  1SD7 A;  3F23 A;  3B6A A;  1PP7 U;  3GX4 X;  1AKH B;  2XAJ A;  2M7A A;  2E2J J;  3L2C A;  2X48 A;  2JA8 J;  3FIS A;  4YEL A;  1D0X A;  3BTJ A;  3FXK A;  3F22 A;  3VSK A;  1IV6 A;  2LF8 A;  2KIM A;  3EUH A;  1XPX A;  4HZF A;  1BI0 A;  2HKX A;  3GCM A;  4BGD A;  2FOK A;  2KIS A;  3KP3 A;  2A6H F;  2WV0 A;  1ETO A;  2ICW G;  4G9Y A;  2YSR A;  5LFA A;  1G59 A;  3EYI A;  2B63 J;  1L0O C;  2TDX A;  2KDO A;  3EUH C;  3OYI A;  2X0L A;  3NQO A;  2ZCW A;  4MEX F;  4WXH A;  4PJ0 C;  3M8F A;  3CMM A;  3OYM A;  2F4I A;  2ESN A;  4E7L A;  3QP6 A;  4EV0 A;  3AKZ A;  2RNG A;  2X9D A;  2LVS A;  4RGU A;  2EFO A;  1TWC J;  4P9U A;  3CCE I;  1OLT A;  4XID A;  1RET A;  1EH8 A;  3W2W A;  3WTW C;  4DZP A;  4YIF A;  1YJ9 I;  4QPQ A;  1B8I B;  2GOM A;  4E70 A;  1WI3 A;  3SZG A;  3HDD A;  2D5V A;  2I10 A;  4PJJ A;  4GCV A;  1PYV A;  4IHX A;  1AOY A;  3CDL A;  3P7N A;  4BU2 A;  1T0F A;  4PGH A;  3H9G A;  1H0M A;  2LRD A;  2Y31 A;  2K9L A;  1MNM C;  3RZD J;  1SD5 A;  1X2M A;  3E97 A;  4EEF G;  4FTH A;  1JKO C;  4CYD A;  2DW4 A;  3OV8 A;  2R7U A;  4EQQ A;  1Y8Q B;  1JE8 A;  2P0W A;  2Z16 A;  3BY6 A;  2RDP A;  1HF0 A;  4QTR A;  2QQB A;  3GTM J;  1ZHF A;  2IA1 A;  5KK1 A;  5DS9 A;  3MCZ A;  1ETK A;  1YIJ I;  2XRN A;  3FMQ A;  2M4G A;  4BY7 J;  3SFZ A;  1HBX G;  1H9G A;  5HS8 A;  3O6B B;  2H6C A;  4HX8 A;  1SAU A;  2W4S A;  2CW0 F;  3W6V A;  4LIU A;  4KIS A;  1JT6 A;  4HNT A;  2LKX A;  5CVR A;  1NG7 A;  2GXB A;  4BEH A;  4AYB N;  4A3E J;  3P9I A;  5EG0 A;  2Y0M A;  4EAT A;  3DLA A;  4CIC A;  4BY1 J;  2B0L A;  1BW6 A;  3CDI A;  5GTI C;  1B59 A;  5J8F A;  4B8X A;  1MJA A;  2L5Q A;  3F72 A;  4KT6 A;  2LOO A;  2IS2 A;  2K5C A;  2XF7 A;  5DTD A;  1XDS A;  1D8J A;  3IUO A;  3COA C;  2XRL A;  5IP9 J;  4DYR A;  3HPG A;  3TDU C;  2QCO A;  4XRM A;  1ZR2 A;  5D8L B;  2FBK A;  1ZRF A;  2VPR A;  4LIV A;  4DJA A;  3HC7 A;  1ZN2 A;  4NC8 A;  1XSX A;  1QZZ A;  1E2X A;  3BTI A;  2XIG A;  2DA3 A;  3S1R J;  2IW5 A;  1I1S A;  5JHF A;  3OL3 A;  1MJB A;  2RGV A;  3I71 A;  1SFK A;  4DYQ A;  1K83 J;  5FFX A;  3U2R A;  2KZG A;  5K7Z A;  4AIJ A;  2BVM A;  3IWZ A;  1K6Y A;  2EJR A;  2NNY A;  1Y56 A;  4I02 A;  3E0J B;  3M1C A;  4ZH4 F;  3CCY A;  3JRE A;  3GZ6 A;  2MAB A;  3HBL A;  2QF7 A;  3OR1 C;  2KIU A;  1LPQ A;  3IV5 A;  3G1M A;  1GDT A;  1IW7 F;  4UUV A;  2W48 A;  4D7N A;  4ASN A;  4G7O F;  4L5I A;  3GLX A;  4IEJ A;  1T56 A;  4C9Y A;  3TGN A;  3VYU B;  5F0H A;  2Z33 A;  1F5T A;  1FWZ A;  2EK5 A;  1T38 A;  3LSI A;  5J1Y A;  1FOW A;  4CO8 A;  2XAU A;  5F64 A;  2JWT A;  5TRD A;  1W0U A;  1J0R A;  2BVL A;  1FYM A;  2EQR A;  4B48 A;  2XGE A;  1ZQ3 P;  3QYF A;  5JVT A;  1GUU A;  1ENH A;  3WTT C;  3KYL A;  5IOY A;  3PNT A;  1RR8 C;  2L9R A;  5LEJ A;  1LNW A;  3OIO A;  4IQ4 A;  5ED4 A;  3TKY A;  3KLO A;  4HDV A;  2E7X A;  3VSL A;  4BXU A;  3BJA A;  1HXD A;  1TBX A;  2Y0S A;  4CCO A;  1UJ8 A;  2G7U A;  5LHI A;  4A5N A;  3IKV A;  2EZH A;  3FM3 A;  4RMN A;  4ZYD A;  4OWR B;  2CUF A;  1MBG A;  5DV5 A;  4ANJ A;  3HL2 A;  2L3D A;  5EZG A;  4M3E A;  3BPV A;  3MWM A;  3LSJ A;  2WAQ N;  1YG2 A;  2DLL A;  2Q0O A;  2GAU A;  2XRO A;  3ERE D;  2CQN A;  3ZCO A;  3L2Q A;  2LH9 A;  3E5Q A;  1IXR C;  3UR3 C;  5LEK A;  3RDI A;  2CQX A;  1V54 H;  2X4H A;  2LRE A;  2OPT A;  4BE0 A;  4KIF A;  2DQL A;  4CYC B;  5JFR A;  2BV6 A;  2MSY A;  1BOB A;  2QM3 A;  2Y69 H;  3DWL E;  4PFO A;  4M3F A;  2ECB A;  5IT3 A;  4HSR A;  1W4M A;  2XGD A;  5BMZ A;  1MSE C;  3K7A J;  2E1M B;  1VTN C;  1Z7U A;  4ETS A;  4L18 B;  1ETV A;  1VQ8 I;  4KYW A;  2IS4 A;  3WG9 A;  4IHW A;  3L9F A;  3RSN A;  2QVO A;  3ELK A;  2A05 A;  2HKO A;  3IHU A;  4N4N B;  1UAA A;  2R7D A;  5KHD A;  4MIM A;  4B4C A;  2KT0 A;  2JA2 A;  4F7Z A;  3GME A;  5K5R A;  3ECH A;  2W7N A;  3BR5 A;  2ELJ A;  3QAH A;  1PDN C;  3OMY A;  3HOT A;  1JXS A;  2CFO A;  2VKE A;  3M8E A;  4PJM A;  2LY9 A;  1UCR A;  1BOA A;  2VBW A;  4ZYA A;  2R7Q A;  4KNY A;  2XKP A;  1WWX A;  3C7J A;  5FLX Z;  1LB2 A;  5EZH A;  2H94 A;  1ON1 A;  1YOV B;  1XSD A;  2A61 A;  1YFH A;  1BBY A;  1YLF A;  1IJW C;  5E3N A;  2L7F P;  4BUP A;  2NS8 A;  2LKP A;  4PZJ A;  4RGR A;  1VQO I;  1JHH A;  3OYG A;  5GPC A;  4C2T A;  1IDZ A;  1X58 A;  4FE4 A;  1HKS A;  1FYK A;  5H6R A;  1ZG5 A;  1L3L A;  3ZN0 A;  3MKW B;  3BJO A;  3OL4 A;  4X0G A;  4X6A J;  4XL9 A;  1P4A A;  3K1P A;  3AAF A;  1WJD A;  1BN5 A;  1VF9 A;  1Z6R A;  4BQA A;  2M2E A;  1SFE A;  2XAS A;  1IO2 A;  1BC8 C;  3H36 A;  5L3D A;  2PN6 A;  1X1A A;  3DTK A;  2HDW A;  4XSZ F;  1PJR A;  3WU2 C;  4LFU A;  2IT0 A;  2ZME A;  1R7J A;  1EF4 A;  4NHJ A;  1T6S A;  2RQP A;  1ULY A;  1TWF J;  1H9T A;  2P8T A;  3CQZ J;  4XON A;  4CDG A;  4DBR A;  5HLI A;  5CYV A;  5C44 J;  1A36 A;  3A01 B;  2IBD A;  3BCB A;  4QSH A;  1Z9C A;  1SEU A;  1BI3 A;  1HOM A;  2J5P A;  2E1N A;  4JX6 A;  4UHT A;  5HLH A;  5F1R A;  5LLQ A;  2H6B A;  3ZMV A;  4YG2 F;  1RR7 A;  3REO A;  4HPQ A;  3BR0 A;  4XIC A;  2PJP A;  3LAP A;  3WGI A;  2VE9 A;  3O3K A;  3JW4 A;  1QRY A;  4YFX F;  5ERI A;  3A4C A;  3K4B A;  5L3G A;  1TNT A;  3CCM I;  1VZ0 A;  4MTD A;  1GXP A;  2GXA A;  4XLA A;  3BOQ A;  2NVY J;  4CYC A;  4C2M J;  1LE8 A;  2ZJP F;  4BHP A;  1WJE A;  5J3L A;  3FXO A;  4BJT A;  3DCF A;  5GAH J;  1E3P A;  3H0D A;  1OCC H;  1TP4 A;  1I6X A;  4C30 A;  4EJW A;  4BEH B;  3J80 Z;  2RRE A;  4C3H J;  3WE3 A;  3HOS A;  5CVJ A;  2JT1 A;  5DCM A;  1SMT A;  3HPH A;  3FXJ A;  2LLK A;  4ZDO A;  5D5W B;  1BL0 A;  4HG2 A;  4GGG A;  1JUS A;  3MZ8 A;  2K4J A;  2Z2S B;  2XGX A;  5CJ9 A;  3D0S A;  5CPR B;  4RS8 A;  3RKY A;  4BHC A;  4O6J A;  2X6W A;  3A1Y A;  5JVG F;  4YFN F;  3BTL A;  2ME6 A;  3HIF A;  2DOE A;  1W0T A;  4F92 B;  1N25 A;  1U6G A;  1RUN A;  3E5X A;  3ZPL A;  1YHQ I;  2BGC A;  2M87 A;  3ZQF A;  3W3C A;  3J7Z I;  1UHM A;  2CH0 A;  4ENJ A;  3HGY A;  1D8K A;  2LBF A;  3C3W A;  4MQ9 F;  3WGH A;  4XKC A;  2I8D A;  3CP8 A;  1ZGW A;  5C4X J;  4F93 B;  1LE8 B;  5TIS C;  1BR4 A;  2ZFU A;  2A6E F;  1Y1W J;  3CMA I;  2H8R A;  1ZG3 A;  3BT9 A;  1B72 B;  1QVT A;  2I5U A;  4WXD A;  1HC8 A;  1W36 C;  4D1Q A;  3QOD A;  4XN3 A;  5LBQ A;  4A3G J;  4E7S A;  5IY5 H;  4XLF A;  2MA3 A;  2OJE D;  3QWL A;  3J7Y J;  1RNL A;  3BG5 A;  4FT8 A;  1KA8 A;  2CQQ A;  4FQG A;  5E8I A;  2DMU A;  1DGR M;  5FKO A;  1Q1V A;  2L54 A;  3FXQ A;  3DKY A;  4IL6 C;  2V1X A;  3S1M J;  2ELK A;  2ID3 A;  4D7M A;  4WWC A;  1Y0U A;  2HXO A;  3LA3 A;  1SD4 A;  2JA6 J;  2QQ9 A;  5H20 A;  2BYV E;  1O57 A;  4XKB A;  3PIP F;  4G7H F;  2OU2 A;  1X3W B;  3Q3S A;  3BP8 A;  1GXQ A;  4B09 A;  3SZP A;  2VJ5 A;  1XDU A;  3HSF A;  3LA2 A;  3FMS A;  2LFB A;  2MH9 A;  2F4O B;  2DXI A;  1RC9 A;  3AL0 C;  2NVU B;  1R5H A;  4MNU A;  3V8L A;  1ZLJ A;  1SFO J;  2XC7 A;  4G6T B;  4WXC A;  1BI2 A;  4EM1 A;  5HDG A;  3O2P E;  2AQF A;  4F52 A;  2K85 A;  1MNE A;  1MKM A;  1EH6 A;  1TW2 A;  3FK7 A;  2IGN A;  3RPU D;  2UUZ A;  4IX7 A;  1BIA A;  2JUC A;  1X1C A;  2VQC A;  2Y0S N;  2JZY A;  4LK0 F;  5J6X A;  3KYC B;  5FGM A;  3NWS A;  3RKX A;  3EYY A;  5A2Q Z;  4L5E A;  2JSC A;  3R6S A;  1HW5 A;  3OWT A;  1F36 A;  3S2D J;  5EJC A;  4DOZ A;  2AXL A;  1KZH A;  3VOD A;  5HLT A;  2NVX J;  1WH5 A;  3K2Z A;  5JR3 A;  1V55 H;  4NC6 A;  1WPK A;  2V9P A;  3A01 A;  1JJ8 C;  3S1Q J;  5M5Y J;  1ZG1 A;  2DA6 A;  3FF5 A;  2DA4 A;  5GAD J;  1K7A A;  2JA7 J;  1GLN A;  1RZ4 A;  3CJT B;  4HV5 A;  4GFB A;  2FX0 A;  4N9H A;  4ZZL A;  3DTI A;  4PGG A;  2KIF A;  3Q0W A;  4JOM A;  1K61 A;  3D5R C;  4PJN A;  4NDL A;  2B7E A;  2K40 A;  4BKX A;  2HQ5 A;  4CCN A;  1Z77 A;  4OAZ A;  1R6R A;  3RYP A;  2XB5 A;  2O03 A;  1G2H A;  3X2Q H;  2JVH A;  2WY8 Q;  4BS9 A;  5TJJ A;  3U21 A;  3E6C C;  5J47 A;  1I27 A;  3CMY A;  2MD0 A;  5DUI A;  4FHT A;  3JRA A;  1YIO A;  2OV7 A;  2ZB9 A;  4V2F A;  2Z3Y A;  1CF7 B;  3GZN B;  2KLO A;  2K9S A;  1UHW A;  1TWG J;  3BR2 A;  3CO6 C;  4JP0 A;  2RC4 A;  1B72 A;  2O7O A;  3LFU A;  1H88 C;  1RPW A;  1EV7 A;  4YII A;  1FSH A;  2LG4 A;  1FBU A;  1J5Y A;  3VOE A;  4FX0 A;  3DFG A;  1XS9 A;  1NH3 A;  2Y30 A;  4U7B A;  3K4L A;  2D1V A;  4NQW B;  2CGP A;  4U7D A;  1WJ5 A;  3BCA A;  3OYA A;  1IN8 A;  3CF2 A;  3O8G A;  4PSW A;  2R7X A;  5HDK A;  2M1B A;  2XPW A;  2LYC A;  2DFE A;  2Y2Z A;  1XGO A;  4XRS A;  3HUG B;  3GTK J;  2NOJ B;  2STW A;  1ZR4 A;  2EFP A;  1MDM A;  1VQ7 I;  2JPB A;  2E36 A;  4WCG A;  3PNV A;  3HOV J;  1BR2 A;  2L0K A;  2DJN A;  2WB1 A;  3ABM H;  2CFX A;  2GIV A;  1IUY A;  3SEZ A;  3C2B A;  3DEE A;  3SDG A;  3V42 A;  2QUF A;  4ITV A;  5DYM A;  4FCY A;  4M9S A;  1U2W A;  1DU6 A;  3IWF A;  3QRF F;  2JVG A;  2DYS H;  2F48 A;  4LLN A;  4OIQ F;  5D4S A;  2DU9 A;  5HOD A;  1J59 A;  3LOC A;  2LC2 A;  3BZC A;  2JUG A;  2FJ1 A;  3KP2 A;  1IV8 A;  4NB5 A;  3OY9 A;  2NVT J;  2M8E A;  2XPV A;  5LRS A;  1KQ8 A;  1YX3 A;  3RZO J;  3I5U A;  4LB6 B;  2M30 A;  4V19 K;  2WTE A;  3QYB A;  2R5Z A;  2VKD A;  2MFZ A;  5HNH A;  2E2I J;  2QQ8 A;  1K79 A;  2HQA A;  1YI2 I;  1PUF B;  1LQ1 A;  2X1D A;  2BOL A;  1SVO A;  2VKV A;  5IOZ A;  3K4C A;  5BPI A;  2A69 F;  5FB2 A;  3L7W A;  4QWQ A;  4E7I A;  1TQM A;  3H9Q A;  4EJU A;  1RUO A;  4EM0 B;  3LAJ A;  2VLA A;  1U5T A;  1MMD A;  4EVI A;  4XLP F;  4J01 A;  2A3S A;  3AG4 H;  3DXJ F;  3KE2 A;  3OR2 C;  3S17 J;  2RVC A;  3I3L A;  4D5C A;  1MZB A;  2F5F A;  5DM7 F;  1MBE A;  2ZME C;  5TGT A;  1A6Q A;  3ZQ7 A;  1O3Q A;  1W7P B;  2OCE A;  4KIB A;  1DP3 A;  2LR8 A;  5BPD A;  2UXN A;  2EFN A;  2IS1 A;  3ZR8 X;  4TV7 A;  1IZ1 A;  4N0B A;  2VOO A;  1R5G A;  2LBF B;  1FP2 A;  5D6F A;  3KEY A;  5E1Z B;  3WE2 A;  2HQR A;  3LNQ A;  1XMA A;  3G1L A;  4CZZ A;  3K4M A;  5DUK A;  2ZXI A;  2ZSH B;  3MVP A;  2DA7 A;  1FYL A;  4I0B A;  1EJ9 A;  2VQL A;  2UWM A;  4KIT B;  4HNV A;  1QQI A;  2R3S A;  3I4N J;  2O8X A;  2OQG A;  2QQA A;  3I4M J;  1T08 B;  5EEG A;  5J4V A;  1OYW A;  2CQK A;  1SC7 A;  3L2W A;  3ASN H;  2QSF X;  3QYE A;  4JK1 X;  3OYL A;  3ZQI A;  2OA4 A;  3ISP A;  3Q5F A;  4CHU A;  2VJJ A;  2TCT A;  4HEA 2;  3WGG A;  4EMS A;  3KP6 A;  4F55 A;  4AM3 A;  4UNO A;  3GTP J;  1B4A A;  1SFU A;  1B6A A;  2DK8 A;  4AU7 A;  3EDP A;  1IDY A;  1X19 A;  2P6T A;  4WF2 A;  4XLC A;  2V6E A;  1YX5 A;  3UNG C;  3LSH A;  1BC7 C;  3E1S A;  3NWT A;  3JRG A;  3BRO A;  2V1U A;  5AIQ A;  4UUS B;  3ABT A;  1DUX C;  3L09 A;  1Z1D A;  2EIN H;  2CUZ A;  1QHG A;  1QGP A;  2RN7 A;  3PIO F;  1UG2 A;  2DMP A;  2CQ7 A;  1YIT I;  4PFP A;  5ICC A;  2ZC2 A;  1NG6 A;  2FXA A;  1AHD P;  2Z5U A;  5E18 F;  4KMU X;  4RLQ A;  1LVA A;  3K4J A;  1V4R A;  4GYI A;  1YYV A;  4XK4 A;  4G94 A;  3E7L A;  3V4G A;  3WTZ A;  3CCL I;  1SAX A;  3I59 B;  1IRZ A;  3CC4 I;  2VB6 A;  2R5Y B;  2R7V A;  3OYH A;  1H8A C;  1ZKG A;  2GXG A;  2WAQ A;  1J9I A;  2HI3 A;  1DPR A;  4EM2 A;  3S15 J;  5BNG A;  4OIR F;  1S29 A;  3FXR A;  4M3B A;  4XQF A;  3HOX J;  3RYR A;  1BIB A;  3KLN A;  2VT3 A;  3GXO A;  3S93 A;  3PUF A;  3MMY B;  1PP8 F;  1HDD C;  1I5Z A;  2H1K A;  2E2H J;  5E8G A;  1IRX A;  2LTP A;  3IAS 2;  2GBY A;  1YW8 A;  3E3V A;  1IXS B;  2EB7 A;  2R4G A;  3A02 A;  1ZAO A;  2QGU A;  2OBP A;  1VQN I;  1Z7L A;  3S3N A;  4NBQ A;  1GVD A;  4BE2 A;  1XMX A;  3PFY A;  2VON A;  1E17 A;  2VE8 A;  2DTZ A;  1UZC A;  1G6N A;  4P5O A;  4XLE A;  4RGX A;  2VAS A;  4IZZ A;  3Q9S A;  5LD2 C;  5F04 A;  1B9M A;  4XMY A;  4A0X A;  1QO0 D;  4DNC A;  2NNN A;  3K0L A;  5M3M J;  3R61 A;  2FRH A;  1JGS A;  3L2U A;  1MIJ A;  1OCT C;  1ETW A;  1K78 B;  3K70 D;  4UV8 A;  4RGS A;  1QPI A;  4Z2Y A;  3F21 A;  3QOE A;  1T33 A;  1U3E M;  4A3M J;  3W2A A;  4AVP A;  3KYD B;  4G6D A;  3FBN B;  2YUS A;  3LSG A;  3QOP A;  3VEP A;  3PO2 J;  5ICF A;  2WAF A;  3OYK A;  3JRH A;  2W25 A;  4N9I A;  4IF4 A;  2YX4 A;  4PCQ A;  2Z1D A;  3PNY A;  4Y15 A;  2IJL A;  1DU0 A;  3S3M A;  1TZL A;  4Y33 A;  4B44 A;  3WTV C;  1MW7 A;  2L9V A;  2YX7 A;  4MEY F;  3ZQG A;  4HF2 A;  1O3S A;  1R9T J;  3LL7 A;  2EA4 A;  3B02 A;  2E5N A;  2FMY A;  2KQR A;  2RNJ A;  1P6R A;  2P81 A;  3ZMU A;  1TWA J;  1WJA A;  5F0C A;  4BDZ A;  2KKO A;  1W7P D;  3VDX A;  4W1U A;  4GYG A;  5B5E C;  4Y3O A;  5B1B H;  3EET A;  1Z21 A;  1IN6 A;  4J19 A;  4DYC A;  1G4D A;  1YJW I;  4G12 A;  2FA5 A;  5D5X B;  3BG3 A;  3DEW A;  2XVC A;  4RBO A;  3ZGK A;  3GFM A;  4OIP F;  3F3X A;  3GZ5 A;  3LSK A;  4BE1 A;  3ZP5 A;  1M1E B;  3LQR A;  3J81 Z;  4CUG A;  4A3C J;  3H9J A;  5DEQ A;  1W7P A;  3I53 A;  1W5T A;  5E1W A;  2DDB A;  2M4K A;  4XLN F;  2ZFW A;  3HRM A;  1WJB A;  4CXF A;  2H8W A;  3GFJ A;  3BG9 A;  3M8J A;  1S8N A;  5F08 A;  3WHB A;  5EGO B;  1FJL A;  4BBS J;  3HEF A;  4L9J A;  1GV5 A;  3QQA A;  4UVA A;  2ISZ A;  2BY1 A;  3LSR A;  5HVQ C;  5EG0 B;  3S14 J;  1OFC X;  2IGM A;  1YS7 A;  1W1W E;  3PQK A;  2MG4 A;  2BBY A;  5LGN A;  2KJB A;  3EPZ A;  3JRD A;  3PQJ A;  5J1R A;  4IJA A;  4BQQ A;  1IRG A;  5BQT A;  4RAY A;  3DBH B;  3CUQ A;  1AWC A;  2NYX A;  2K9N A;  4I76 A;  1X4O A;  3S32 A;  1J75 A;  3RTR A;  2ZSI B;  3V7S A;  1OCR H;  4PDK A;  1NTC A;  4LIT A;  3ROU A;  5F6F A;  4NQW A;  2XB0 X;  1S3J A;  1OMI A;  1PVE A;  5E3O A;  2DOD A;  4IRI A;  2E1O A;  2G7H A;  3HRU A;  5GP9 A;  1T8I A;  1QNT A;  3PM1 A;  3FHZ A;  2HOA A;  3BG6 A;  2A5Y B;  2IRF G;  1NK2 P;  2CUJ A;  2QA4 I;  3BWG A;  2QKM B;  2G0E A;  4HX7 A;  1VI0 A;  3K70 C;  3FIW A;  4LG0 A;  5E17 F;  1T0F C;  2FD5 A;  4KIC A;  1TNS A;  4BQN A;  4JX4 A;  5IP6 A;  4CH7 A;  1POG A;  3E6B A;  4M6X A;  3SZT A;  4KA4 A;  2KMU A;  3TDZ C;  4DW6 A;  2R7F A;  4A12 A;  4LLL A;  3OYE A;  1IN7 A;  1U9N A;  3D1N I;  2X1C A;  3BQY A;  1JI8 A;  4Y17 A;  2WC2 A;  3OS0 A;  3CO7 C;  1BA5 A;  4CGZ A;  3G6E I;  2FF4 A;  2BY0 A;  4M72 A;  5M3F J;  3K1N A;  2BHZ A;  1OPC A;  2DMN A;  4HLX A;  2W82 A;  3CUQ B;  1CQT A;  3SQN A;  3B6C A;  4M3G A;  2DJI A;  1G3S A;  3HRT A;  3OOP A;  5JHU A;  2DO7 A;  2CSO A;  1R23 A;  1XCV A;  4MTE A;  5J4Y A;  1ZK8 A;  3HUG A;  3ZMS A;  3WTX C;  3GFI A;  1VQ6 I;  5FRO A;  4ZYH A;  3CCR I;  3OS1 A;  2AHQ A;  4W97 A;  4MO7 A;  4XOP A;  4E7J A;  4ZDL A;  5FRN A;  2GA1 A;  4II3 A;  1XC5 A;  2HTJ A;  3NRV A;  4OIN F;  1ZH5 A;  4WK8 F;  2PI0 A;  2HPM A;  3DKX A;  4ZDP A;  3MKZ A;  2A6T A;  3AG3 H;  5D5V B;  2PEX A;  1B9N A;  3ZXS A;  1TW3 A;  5A2Q K;  2JRT A;  4C2U A;  2LK2 A;  2M8G X;  2VJ4 A;  1FLI A;  1P7J A;  2F6C A;  2Y48 A;  1OJL A;  2KRH A;  2DK5 A;  2KIQ A;  2HR3 A;  3ZQH A;  1TTY A;  2AXT C;  1MBH A;  3S3O A;  3GVA A;  5HDN A;  4XM3 A;  2QYO A;  1X3U A;  4HYE A;  2PBI A;  1MD0 A;  2H27 A;  2EPF A;  2ZNZ A;  3HG9 A;  3SYT A;  5H2F C;  3P5J A;  4O5V A;  3HXL A;  1I3Q J;  4IHT A;  2JN6 A;  2R7T A;  3DBL B;  4QIW N;  1R4N B;  3BPX A;  1TLH B;  2HEO A;  3E5U A;  1KGS A;  1ORK A;  1IGN A;  3RQ4 A;  1V5F A;  1MMS A;  2CV0 A;  2EV6 A;  3Q9V A;  1LEB A;  2P7C B;  2QSH X;  1YTY A;  2WY7 Q;  4KN7 X;  1O3T A;  2CO5 A;  4ZTF A;  4S04 A;  3V7R A;  4L5J A;  1A04 A;  3SJM A;  2L2O A;  1R1V A;  2HYG D;  4A6D A;  1QZE A;  3GWZ A;  3LQQ A;  2ECC A;  4UXN A;  1XSV A;  5E3L A;  2OUM A;  2IS6 A;  5ICG A;  5EF6 A;  4H4K C;  4U87 A;  2LY2 A;  3LST A;  4HF1 A;  2KP6 A;  1S9H A;  3ERM A;  3FMR A;  2FQ3 A;  3T5X A;  1WJC A;  1OYY A;  2DAO A;  3H5R A;  2YR2 A;  3IP4 B;  1LFU P;  4F3Q A;  4J00 A;  2TRT A;  3RI4 A;  1HCR A;  4LG3 A;  4KN4 X;  2BEO A;  2K02 A;  5EGO A;  3GO5 A;  1O7L A;  4MQV A;  1FP1 D;  3H5N A;  3T8T A;  1VQM I;  3V7C A;  3IRQ A;  2ISY A;  3HJE A;  1N75 A;  2EV0 A;  4LOC A;  4PK4 A;  5GAG J;  3CME I;  3H3V K;  4BJ6 C;  1FT9 A;  2VC0 A;  1DGW Y;  1SAN A;  2F5C A;  3M7G A;  1P92 A;  4BH9 A;  1LDJ A;  3OYB A;  1U8B A;  1Z67 A;  1ZTR A;  5HS7 A;  2WB1 N;  3JRI A;  2GM4 A;  2O3F A;  1WCM J;  4II2 A;  5B3S H;  2BW3 B;  3JAM K;  2HYJ A;  3FWE A;  2HOS A;  2E7W A;  2LMD A;  1V3F A;  2NS7 A;  3OSF A;  5ICE A;  1Y39 A;  3KET A;  1KU9 A;  3CUO A;  4YEJ A;  2DN0 A;  3R0A A;  1U0J A;  2VJI A;  4G8X A;  3KZZ A;  4M71 A;  3BQZ A;  3FKI J;  4E4H A;  3OYC A;  1FNN A;  3F6O A;  2G9W A;  2Z99 A;  1OIS A;  5ILV A;  2PJR B;  1XN7 A;  2ZXW H;  1KYW A;  4ZYG A;  3OIP A;  2EIL H;  2A07 F;  3BZ6 A;  1ZRC A;  1JUM A;  1FIP A;  1NK3 P;  4LLG F;  1QZY A;  2M0C A;  3BR1 A;  1O3R A;  4UB6 C;  3VWB A;  4IQJ A;  3F8M A;  3JRF A;  3PSI A;  2X51 A;  5F0F A;  3F8B A;  2IXS A;  1CF7 A;  4EGY A;  3VYT B;  4EJO A;  2L4A A;  4ESJ A;  2DT7 B;  1LJ9 A;  1ZGA A;  2W1O A;  6PAX A;  4ENK A;  1K4T A;  2GLO A;  3MKY B;  1P4X A;  3I56 I;  4HOB A;  4XRF A;  1R1T A;  4C3J J;  5IT9 K;  3BG7 A;  3VFZ A;  4U0V A;  5DD8 A;  3J81 K;  3T1B A;  2HGC A;  4RB2 C;  1IG7 A;  2FBI A;  4RB1 A;  1HA8 A;  3ZMD A;  2M34 A;  4P9F A;  3K9T A;  4NC7 A;  4KDP A;  2BW3 A;  1HQC A;  4GO1 A;  1OYI A;  4PJL A;  3CLO A;  3CP2 A;  1FZP B;  3CCQ I;  4P96 A;  4ABZ A;  4BXX J;  4CCM A;  4A69 C;  2R7O A;  1FMW A;  2F5D A;  3G4S I;  5CVU A;  3CDH A;  1JGG A;  2X1E A;  2XUB A;  2ETH A;  5JI6 A;  2OZU A;  5JLW A;  4AID A;  5DM6 F;  2JJ7 A;  1VND A;  4MFE A;  3TO7 A;  1AU7 A;  3B73 A;  2VBY A;  2QKL B;  4JYK A;  3WTS C;  2GA2 A;  5IT9 Z;  1FBQ A;  3VB2 A;  4RDU A;  2ACJ A;  3RKW A;  3H0G J;  2WWY A;  4YFK F;  1S72 I;  3N05 A;  1MBF A;  5HNF A;  3ABU A;  1GVJ A;  4I09 A;  4JBA A;  3ZQL A;  2E1M C;  3HZJ A;  3GW2 A;  1Z3Y A;  2K9M A;  3H35 A;  3CJN A;  5J8C A;  2D1H A;  4GRI A;  4Q47 A;  3GFL A;  3CTA A;  4YRV A;  1H89 C;  2DTR A;  2M9H A;  2DMQ A;  3QPS A;  4EJT A;  2GIZ A;  3K4N A;  2K4B A;  4MFD A;  3T0Y A;  5CLS A;  1J2X A;  2DOA A;  3CZ6 A;  1VQ5 I;  2DQR A;  3R0J A;  4KT5 C;  3SHF A;  2YU3 A;  2HDD A;  3D5L A;  1UEL B;  2P5L C;  2DPD A;  2E19 A;  1YE9 A;  1Q1H A;  3BDD A;  4A5M A;  2XSJ C;  2YU9 J;  4G7Z F;  1R1U A;  3SFI A;  3S1N J;  3RIR A;  2KHM A;  3ONQ A;  1WHU A;  2QBY A;  3T8R A;  1W5S A;  2YPR A;  4OU0 A;  3KEO A;  1D0Y A;  2V9V A;  3BR6 A;  3HGG A;  4HA8 A;  1IC8 A;  2MH2 A;  2PFB A;  2JK3 A;  1R58 A;  1Y1V J;  2PMZ A;  2L9N A;  2FU4 A;  1LDK B;  3K6G A;  3JRB A;  1J7K A;  3CLQ A;  5FD5 A;  1UST A;  2Y9Z A;  4KFC A;  1YW7 A;  3F0C A;  2QWW A;  3I54 A;  1Y8R B;  3U1D A;  1VQP I;  2L4M A;  4D5F A;  3I4P A;  1BM9 A;  2VUM J;  3W6J B;  1LEA A;  3HB9 A;  5KAF C;  4M3D A;  2W84 A;  2ELH A;  1Y6I A;  2R7S A;  2DI3 A;  1G3T A;  3PL8 A;  3HM5 A;  1QU3 A;  1SMY F;  2F5E A;  3JCU C;  4BNC A;  4S0H B;  1TQI A;  3G73 A;  4IHS A;  2HTS A;  4XNF A;  2HVQ A;  2BZT A;  3DU6 A;  2F4M B;  1P7I A;  5B66 C;  1I50 J;  2XAQ A;  1IUF A;  4HDU A;  2NVQ J;  3EQL F;  3WU0 A;  4BQO A;  4GXO A;  2CMP A;  2X85 A;  4ZZD A;  3F8C A;  3F8N A;  3LMM A;  4HX4 A;  2VL8 A;  2PLY A;  4M74 A;  4A3I J;  2HVR A;  2OCC H;  3FXU A;  2P5V A;  3RPU A;  4Y52 J;  2COM A;  1OR7 C;  4BDY A;  4E6K G;  1XGM A;  1F4K A;  2PJR A;  3JTH A;  2F2E A;  3G1O A;  3DKW A;  2R0Q C;  2IPQ X;  3TW6 A;  1IAW A;  3MN2 A;  4UVB A;  1F1Z A;  3K4K A;  3GLL A;  3ZRG A;  2GZW A;  5K5Q A;  3ML6 A;  3W6K B;  1D0Z A;  5LGT A;  2IVM A;  3RQI A;  2HXI A;  4LG0 B;  2HS5 A;  3GEZ A;  3IRR A;  3BTC A;  1VFC A;  3FK6 A;  1HKQ A;  3MQ0 A;  3ZMZ A;  2MLK A;  1EA3 A;  4CSW A;  2CJJ A;  2ZNY A;  4XLH A;  5E3M A;  4L0Z B;  5FLX K;  3HOW J;  3ZN1 A;  1O4X A;  4JX5 A;  5K5O A;  1FEX A;  2A5W A;  5E1X A;  2KPM A;  1ON2 A;  4RM3 A;  2EA2 A;  1S7E A;  2VBZ A;  2DFI A;  3IL2 A;  1DPU A;  3MD2 A;  1XGN A;  2JMW A;  3J7A Y;  3S2H J;  2VKH A;  1SVL A;  3PSF A;  1LVK A;  2ZKZ A;  3VPR A;  4LMY A;  2D2W A;  1DP7 P;  1A31 A;  5H6Q A;  4FX4 A;  5FLV A;  1U8R A;  2V1N A;  1FOY A;  1UHS A;  3IAM 2;  4FE7 A;  1K6O A;  1WJF A;  3ZMT A;  3H1C A;  2Q8K A;  2XAH A;  5EDN A;  5FJ8 J;  2O61 A;  2FNP A;  2PMZ N;  3EUA A;  2E71 A;  3HRS A;  3I64 A;  4XSX F;  2DMT A;  1Y0N A;  1YW9 A;  2L9S A;  4I01 A;  3TQN A;  1SFX A;  1JKP C;  2WAE A;  3GTQ J;  3QP5 A;  3M07 A;  3WTY C;  1KU7 A;  2DPU A;  4A3L J;  5CVV A;  4K2E A;  3DU5 A;  1R22 A;  2W85 A;  2VIX A;  1A6I A;  4UB8 C;  5CQG A;  3C2G A;  3DTE A;  3M9A A;  3WOD F;  5J1U A;  3L2V A;  2ZXH A;  4AUX A;  4B43 A;  1T95 A;  4E7K A;  2B9S A;  2Y75 A;  5CVI A;  1TT0 A;  3V8K A;  2JTV A;  2W57 A;  3VYR B;  5AON A;  1X1P A;  2FOW A;  2NS0 A;  1STZ A;  2M45 A;  4WX9 A;  2COB A;  1D1A A;  4M9X A;  4MGR A;  2W24 A;  3E6D A;  1USS A;  5C3E J;  1OCO H;  1KU2 A;  3DV8 A;  2CWE A;  2A68 F;  2EZI A;  5M5W J;  2MC3 A;  1IN5 A;  1FSE A;  1QBJ A;  1RRJ A;  4IKF A;  1OCZ H;  4XN0 A;  3FM5 A;  1KU3 A;  1MMA A;  3MEX A;  1HW2 A;  3GTJ J;  4MLO A;  3HTU A;  1U5T C;  1P9Q C;  4A0Z A;  3KP7 A;  2XPU A;  3ZOB A;  2KJC A;  4IRH A;  4DBQ A;  3VYS B;  3H3U A;  4U0Y A;  1JT0 A;  4A3B J;  4A3D J;  1MSF C;  3S16 J;  1TT5 B;  4Y13 A;  1S6L A;  2ZJR F;  3RKQ A;  2ZJ2 A;  1ZGJ A;  1FPQ A;  1R00 A;  5L3E A;  5JLX A;  4I6Z A;  1LKX A;  1U9O A;  5D8K B;  1WH7 A;  2CU7 A;  3H5A A;  3CD6 I;  4DIQ A;  3M3Y J;  1HSJ A;  1BI1 A;  1MMG A;  1ITY A;  5KCM A;  1S7A A;  3V8J A;  2V7F A;  2K86 A;  4BL0 B;  1VQ9 I;  4ESB A;  4E7H A;  2BXZ A;  2P6S A;  3KZY A;  4OMZ A;  2H1L A;  2QZ8 A;  5CQE A;  4ZTJ A;  5FO5 A;  3GTG J;  1JTY A;  5EYR A;  1AKH A;  3KCC A;  3J7A O;  1E3O C;  5DCM B;  1G8X A;  2XF6 A;  5M5X J;  3PUB A;  4KIG A;  4X1E A;  4F91 B;  2BXY A;  2GQQ A;  3OYF A;  1XCB A;  4PSX A;  2E5Z A;  4M9Z A;  3DBR B;  4NNJ A;  3DPT A;  1FOK A;  2JQ7 A;  2DA5 A;  5EEA A;  4IOC F;  5E20 A;  5BOX A;  1K4S A;  3C18 A;  1BW5 A;  1XTA A;  4ENN A;  3CF5 F;  5FRM A;  1JKR C;  1X1D A;  3I59 A;  3J80 K;  3CJR B;  1N78 A;  3DLL F;  2LNB A;  4L9T A;  4S05 A;  5L3C A;  2GOX B;  3IH3 A;  4U88 A;  2ZBK A;  1APL C;  2BHY A;  4O3M A;  3LFK A;  1FY7 A;  4IO9 F;  1VQL I;  4AD9 A;  4A3F J;  3TO6 A;  4HNU A;  5GAE J;  3WHC A;  1ERD A;  2X6O A;  1RIO H;  2OZ6 A;  3K1M A;  1OCP A;  4XRS G;  3AL0 B;  2DFH A;  4IVN A;  3TMO A;  2XHK A;  2OTJ I;  1A5J A;  4ON0 A;  2EIM H;  4CA0 A;  1MBK A;  4ZYE A;  1MH4 A;  3ASO H;  3HOY J;  2FSW A;  2UZK A;  1D5Y A;  2QLZ A;  2CUE A;  3KEQ A;  2ADU A;  2WV1 A;  2STT A;  2VPL A;  3DP7 A;  3MFK A;  3PFI A;  3TP0 A;  2V79 A;  1X3Z B;  2ID6 A;  4AIH A;  1KQ9 A;  4HQM A;  1KON A;  2FNA A;  3F8F A;  1HST A;  5IPA A;  1NHA A;  1TQP A;  3K10 A;  1G3Y A;  3U9G A;  2HDC A;  4NUB A;  4OIO F;  2XAG A;  3MAJ A;  2MC4 A;  3FX3 A;  3UKG A;  2AS5 F;  1YS6 A;  3U1K A;  2MYS A;  2DCE A;  3AG1 H;  2M3A A;  2Q1Z B;  3BC8 A;  1G3W A;  4LJZ F;  1FTZ A;  2CYY A;  5IP7 J;  2IAI A;  4Y4R A;  3HKZ A;  3A0B C;  1RKW A;  4RAG A;  2M7B A;  2L02 A;  2YS9 A;  1ZYR F;  1EH7 A;  3WTU C;  1ONV A;  2LSO A;  3C2H A;  3OOU A;  3PJR A;  3IC7 A;  3F9K A;  5K1Y A;  2EFW A;  1S5L C;  2C6Y A;  2DT5 A;  2P5K A;  3GUD A;  3LA7 A;  2O8K A;  4UY8 I;  4RM2 A;  4IOA F;  4U0W A;  2OC6 A;  2FML A;  4BYY A;  1PUF A;  4ESF A;  4LD5 A;  5FD6 A;  3CCU I;  2KL4 A;  5L3F A;  4HLY A;  4IHV A;  1FC3 A;  2VC1 A;  2LDU A;  3C1D A;  4CCJ A;  1TL8 A;  1DDN A;  1ETY A;  1OKR A;  2ESH A;  3DF8 A;  2V4J C;  2ZME B;  1V5G A;  1O7F A;  3OYD A;  3W2V A;  3JSO A;  2IP2 A;  4RLF A;  1ZRD A;  2HNH A;  3DPU A;  2MGQ A;  3GTL J;  1D1B A;  2FEZ A;  2PG4 A;  3EUK L;  5FLM J;  2QBY B;  1Z3X A;  2NAZ A;  4FAS D;  1YQA A;  5FKL A;  3KX2 A;  4HRI A;  1X2N A;  2VQG A;  3JR9 A;  2LKS A;  1R4M B;  2HZD A;  3DPL C;  3FHN A;  4HV6 A;  4I98 B;  4R8H A;  4P1W A;  4L0Y B;  4IXA A;  3I0T A;  1R71 A;  4Z6Y A;  3QPL A;  2WBM A;  2DYR H;  4XKW A;  1D3Y A;  2ZJQ F;  4I0A A;  1UB9 A;  1X4P A;  2IEK A;  2VN2 A;  1IXC A;  2JSP A;  3SXY A;  3S2W A;  2HYF A;  2O9L A;  2VXZ A;  3RJP A;  1GV2 A;  4DQ2 A;  3AFH A;  3TOA A;  3BZK A;  1MND A;  1GT0 C;  2X6X A;  2DT6 A;  2EH3 A;  4M73 A;  4A3J J;  3HSR A;  1W36 D;  4OMY A;  2E60 A;  3HOU J;  3QU6 A;  1WI9 A;  3KIO A;  1QA6 A;  2JA5 J;  3FBI B;  3K69 A;  3CCV I;  2PMH A;  1KYZ A;  2HWV A;  5K7H A;  2V1D A;  2NRA C;  2HFH A;  3PO3 J;  2CW7 A;  1FX7 A;  1KQ0 A;  5LHG A;  5KNL A;  2OD5 A;  5L3B A;  4QLC U;  5FFZ A;  4R79 A;  2BE5 F;  5D4R A;  3F6V A;  3L1P A;  3D5S C;  3LWF A;  1REP C;  1I6H J;  4Q5S F;  2M5W A;  3WG7 H;  4B3X A;  1ETQ A;  2KFD A;  2WA0 A;  4CCL A;  1HDP A;  4A2U A;  1WQ2 A;  3M1E A;  1F9N A;  1R49 A;  3FZV A;  4AIK A;  3G2B A;  2IA2 A;  1MJ9 A;  1D5V A;  1ZLK A;  1Z0X A;  4DGW B;  3OSG A;  2VI6 A;  2MD5 A;  1I3A A;  1IF1 A;  3IH4 A;  3E6M A;  1LDD A;  4HF0 A;  2EIJ H;  2K7L A;  3Q0U A;  1JHF A;  2H09 A;  2DDA A;  2WAD A;  1WVR A;  3CJQ B;  2E1C A;  1MGT A;  4ZC3 A;  3RCO A;  1WFX A;  5D5U B;  2L7Z A;  1BJZ A;  4I99 C;  1ZAR A;  2CG4 A;  2LP0 A;  1MBJ A;  3G71 I;  4KUM A;  1R36 A;  4D9J A;  1VQK I;  4JQF A;  1B8I A;  4A6E A;  1UFM A;  4KJZ A;  4RAZ A;  2LY1 A;  5AIP A;  3ZQC A;  2W00 A;  1LFP A;  3AG2 H;  3CC2 I;  3CCJ I;  5DCF A;  4H0E A;  1UG0 A;  1SD6 A;  2OF7 A;  3DEU A;  1AA7 A;  3TL4 X;  4XOT A;  2Q2E A;  3N97 A;  2JPC A;  4LK1 F;  1W5C C;  5IYB J;  3NAU A;  5FKN A;  2R92 J;  2D45 A;  3NEU A;  2F5V A;  1JJ6 C;  4Q4Z F;  2RAE A;  2HU9 A;  2DA1 A;  3FKJ A;  4BHB A;  4E7Z A;  1YRN A;  3TP3 A;  4A0Y A;  3CC7 I;  3BR3 A;  2VOP A;  2O0Y A;  3KP4 A;  2XKO A;  5DDG A;  3HOZ J;  3WU1 B;  3CCS I;  4YIR X;  3I9V 2;  4IPA A;  2CV1 A;  3GTO J;  1QVU A;  3L00 A;  4OAY A;  2OQR A;  1WRJ A;  1LFB A;  3ABK H;  4HAM A;  2IA0 A;  1YRN B;  4XR6 A;  4RAF A;  4RA2 A;  1MH3 A;  4LB5 A;  3CES A;  3GYH X;  2R7R A;  4AWX B;  5DD4 A;  2P7V B;  2RQQ A;  1WKM A;  1Z91 A;  4M6V A;  4HW0 A;  4DZJ A;  1JTX A;  4ENM A;  4EGZ A;  4L9N A;  2VT2 A;  2R5Y A;  4XKV A;  2HZT A;  1HKT A;  3A03 A;  3TOB A;  2XF5 A;  4Q48 A;  2L7K A;  2NOG A;  1V5E A;  2FE3 A;  5HS9 A;  2PX9 A;  2HVS A;  2NXN B;  5IYD J;  2CRG A;  5HOO A;  2IGK A;  3N4M A;  2KRF A;  2IGO A;  4D0P A;  5ILS A;  4A3K J;  2JRM A;  3TO9 A;  4B3A A;  1LUJ B;  3R4K A;  5D6E A;  2K3P A;  2LF7 A;  2MLG A;  2P4W A;  3BLY A;  2CW8 A;  2E35 A;  1RES A;  1X1B A;  2EIK H;  3MKL A;  2EBI A;  1JUP A;  4I2O A;  1CGP A;  3SEQ A;  3TBI A;  2FUG 2;  4XBF A;  2EZL A;  1XGS A;  4UUS A;  4RB0 A;  4CZC A;  3OYJ A;  1ZEL A;  4HST A;  3L2R A;  2R7Z J;  3OYN A;  2E34 A;  1ETX A;  2DBB A;  5KAI C;  3TED A;  4I7H A;  2XV4 S;  2ZXJ A;  2CV2 A;  3A2K A;  2X6Y A;  4BAC A;  2V9K A;  5LRR A;  4N4O B;  2J5O A;  1VQ4 I;  2OTL I;  1OQY A;  4HQE A;  1MMN A;  4BBR J;  1IRF A;  5CKT A;  1QHH D;  4UUT A;  3O8H A;  5GTH C;  3IKT A;  5F27 A;  2HQN A;  4C3I J;  4OOI A;  1ODD A;  3JRC A;  5IYC J;  1WZ2 A;  5EEH A;  1Z6T A;  2K3F A;  2V6C A;  4CCK A; 
#chains in the Genus database with same CATH homology
 3JSP A;  3R60 A;  1XMK A;  3QU3 A;  4L9V A;  3I58 A;  3HYI A;  4IRG A;  1P4W A;  4UV9 A;  5BS6 A;  2PQ8 A;  1YO5 C;  4EJV A;  4P55 A;  1K78 A;  3HSE A;  1U5T B;  1MDM B;  3H3Z A;  1B1B A;  3G3Z A;  2QEN A;  1BJA A;  3CUQ C;  2PMU A;  3JTG A;  2L01 A;  1PUE E;  3QPH A;  5LHH A;  2OAZ A;  1T2K A;  1QPM A;  2UXX A;  5KVR A;  2HOE A;  1ZRE A;  2RV8 A;  3KFW X;  3GF2 A;  2GWR A;  5HLG A;  4G6Q A;  1HW1 A;  1U78 A;  2K27 A;  2EWN A;  3BJ6 A;  3ULQ B;  4R1H A;  3RPQ A;  1I1G A;  1OR7 A;  1T39 A;  4KMF A;  2EFQ A;  1Z05 A;  3P9K A;  2EV5 A;  4M6Y A;  1WSU A;  2VBX A;  2XAF A;  4BAY A;  1XB4 A;  4LGW A;  3JAM Z;  1C0W A;  1GHC A;  1XD7 A;  3DQV C;  1FBS A;  3MZH A;  1T98 A;  4RB3 C;  2Z9O A;  5LGU A;  2FBH A;  3ECO A;  3MZY A;  1IN4 A;  3HHH A;  3KP5 A;  3HHG A;  2O6G E;  1S7O A;  1P2F A;  4UVC A;  5ILU A;  4HBL A;  3HTS B;  3QPT A;  2RKH A;  4MHG A;  2MBF A;  1RI7 A;  3P9C A;  3H92 A;  2VOD A;  2ZO4 A;  1SD7 A;  3F23 A;  1PP7 U;  3GX4 X;  2XAJ A;  3L2C A;  3F22 A;  2LF8 A;  2KIM A;  3EUH A;  4HZF A;  1BI0 A;  2HKX A;  2FOK A;  3KP3 A;  2A6H F;  2WV0 A;  4G9Y A;  3EYI A;  2YSR A;  1L0O C;  2TDX A;  2X0L A;  3NQO A;  2ZCW A;  4MEX F;  4WXH A;  3M8F A;  2ESN A;  3QP6 A;  4EV0 A;  4RGU A;  2EFO A;  4P9U A;  1EH8 A;  3WTW C;  4YIF A;  4E70 A;  4GCV A;  1AOY A;  3P7N A;  1T0F A;  4PGH A;  1H0M A;  1SD5 A;  3E97 A;  4CYD A;  2DW4 A;  3OV8 A;  4EQQ A;  1JE8 A;  3BY6 A;  2RDP A;  2QQB A;  1ZHF A;  2IA1 A;  5KK1 A;  3MCZ A;  2XRN A;  3FMQ A;  3SFZ A;  1HBX G;  1H9G A;  5HS8 A;  3O6B B;  2H6C A;  4HX8 A;  2CW0 F;  5CVR A;  2GXB A;  3P9I A;  2Y0M A;  4CIC A;  2B0L A;  1B59 A;  5J8F A;  4B8X A;  1MJA A;  3F72 A;  1XDS A;  1D8J A;  3COA C;  3TDU C;  5D8L B;  2FBK A;  1ZRF A;  1ZN2 A;  1XSX A;  1QZZ A;  1E2X A;  2XIG A;  2IW5 A;  1I1S A;  1MJB A;  2RGV A;  3I71 A;  5FFX A;  3U2R A;  4AIJ A;  3IWZ A;  2NNY A;  2EJR A;  4I02 A;  4ZH4 F;  3GZ6 A;  2KIU A;  1IW7 F;  4UUV A;  4ASN A;  4G7O F;  4L5I A;  3GLX A;  3TGN A;  2Z33 A;  1F5T A;  1FWZ A;  2EK5 A;  1T38 A;  4CO8 A;  5F64 A;  5TRD A;  1J0R A;  1FYM A;  5JVT A;  3WTT C;  5LEJ A;  1LNW A;  5ED4 A;  3TKY A;  3KLO A;  4HDV A;  2E7X A;  4BXU A;  3BJA A;  1HXD A;  1TBX A;  2G7U A;  5LHI A;  4A5N A;  3IKV A;  3FM3 A;  4ZYD A;  5DV5 A;  2L3D A;  3BPV A;  3MWM A;  1YG2 A;  2DLL A;  2Q0O A;  3ERE D;  2GAU A;  2XRO A;  3E5Q A;  1IXR C;  5LEK A;  3RDI A;  2X4H A;  4KIF A;  2DQL A;  5JFR A;  2BV6 A;  2QM3 A;  5IT3 A;  1W4M A;  5BMZ A;  1VTN C;  1Z7U A;  4ETS A;  4L18 B;  4KYW A;  3WG9 A;  3L9F A;  2QVO A;  3ELK A;  2HKO A;  3IHU A;  2R7D A;  4F7Z A;  5K5R A;  3ECH A;  1PDN C;  3QAH A;  3HOT A;  1JXS A;  3M8E A;  1UCR A;  1BOA A;  2VBW A;  4KNY A;  2XKP A;  1WWX A;  3C7J A;  5FLX Z;  1LB2 A;  2H94 A;  1ON1 A;  1XSD A;  2A61 A;  1YFH A;  1BBY A;  1YLF A;  2LKP A;  4PZJ A;  4RGR A;  1JHH A;  1FYK A;  1HKS A;  5H6R A;  1ZG5 A;  1L3L A;  3ZN0 A;  3BJO A;  1P4A A;  3K1P A;  3AAF A;  1BN5 A;  1Z6R A;  4BQA A;  1SFE A;  2XAS A;  1BC8 C;  5L3D A;  2PN6 A;  4XSZ F;  4LFU A;  2IT0 A;  2ZME A;  1R7J A;  4NHJ A;  1T6S A;  2RQP A;  1ULY A;  1H9T A;  2P8T A;  4CDG A;  5HLI A;  5CYV A;  1Z9C A;  1BI3 A;  2J5P A;  2E1N A;  4UHT A;  5HLH A;  5F1R A;  5LLQ A;  2H6B A;  3ZMV A;  4YG2 F;  3REO A;  2PJP A;  3LAP A;  3WGI A;  2VE9 A;  3O3K A;  3JW4 A;  4YFX F;  5ERI A;  5L3G A;  1TNT A;  1GXP A;  4MTD A;  3BOQ A;  4BHP A;  1I6X A;  4EJW A;  3J80 Z;  3HOS A;  3WE3 A;  5CVJ A;  2JT1 A;  5DCM A;  1SMT A;  5D5W B;  4GGG A;  2K4J A;  2XGX A;  5CJ9 A;  3D0S A;  3RKY A;  4RS8 A;  4BHC A;  4O6J A;  4YFN F;  3HIF A;  1U6G A;  1RUN A;  3E5X A;  3ZPL A;  2BGC A;  2M87 A;  1UHM A;  4ENJ A;  1D8K A;  3C3W A;  4MQ9 F;  3WGH A;  2A6E F;  1ZG3 A;  4WXD A;  5LBQ A;  2MA3 A;  1RNL A;  4FT8 A;  1KA8 A;  5E8I A;  2L54 A;  3FXQ A;  2V1X A;  4WWC A;  1Y0U A;  3LA3 A;  1SD4 A;  2QQ9 A;  5H20 A;  2BYV E;  1O57 A;  4G7H F;  2OU2 A;  3BP8 A;  1GXQ A;  4B09 A;  3SZP A;  1XDU A;  3HSF A;  3LA2 A;  3FMS A;  2MH9 A;  1R5H A;  4MNU A;  3V8L A;  1ZLJ A;  4WXC A;  1BI2 A;  4EM1 A;  5HDG A;  3O2P E;  1MKM A;  1EH6 A;  1TW2 A;  1BIA A;  2JZY A;  4LK0 F;  5J6X A;  5FGM A;  3RKX A;  3EYY A;  5A2Q Z;  2JSC A;  3R6S A;  1HW5 A;  2AXL A;  3VOD A;  3K2Z A;  5JR3 A;  1ZG1 A;  3FF5 A;  1K7A A;  1RZ4 A;  4HV5 A;  4N9H A;  4ZZL A;  4PGG A;  2KIF A;  3RYP A;  2O03 A;  5TJJ A;  3E6C C;  1I27 A;  5DUI A;  4FHT A;  1YIO A;  2Z3Y A;  1CF7 B;  1UHW A;  3CO6 C;  2RC4 A;  1EV7 A;  4YII A;  1FSH A;  1FBU A;  1J5Y A;  3VOE A;  4FX0 A;  3DFG A;  4U7B A;  2D1V A;  2CGP A;  4U7D A;  1IN8 A;  5HDK A;  2M1B A;  1XGO A;  2STW A;  2EFP A;  1MDM A;  2JPB A;  4WCG A;  2GIV A;  2CFX A;  1IUY A;  2QUF A;  5DYM A;  4M9S A;  1U2W A;  3IWF A;  3QRF F;  4LLN A;  4OIQ F;  5D4S A;  2DU9 A;  1J59 A;  3KP2 A;  4NB5 A;  2M8E A;  5LRS A;  1KQ8 A;  3I5U A;  4LB6 B;  2M30 A;  2WTE A;  1K79 A;  1LQ1 A;  5BPI A;  2A69 F;  5FB2 A;  3L7W A;  4QWQ A;  1RUO A;  1TQM A;  4EJU A;  4EM0 B;  3LAJ A;  1U5T A;  4EVI A;  4XLP F;  2A3S A;  3DXJ F;  3KE2 A;  2RVC A;  1MZB A;  2F5F A;  3ZQ7 A;  1O3Q A;  1W7P B;  4KIB A;  5BPD A;  2UXN A;  2EFN A;  4TV7 A;  1IZ1 A;  4N0B A;  2VOO A;  1R5G A;  1FP2 A;  5D6F A;  5E1Z B;  3WE2 A;  2HQR A;  1XMA A;  4CZZ A;  5DUK A;  1FYL A;  4I0B A;  2UWM A;  1QQI A;  2R3S A;  2O8X A;  2OQG A;  2QQA A;  5EEG A;  1OYW A;  2CQK A;  4JK1 X;  2OA4 A;  3ISP A;  3Q5F A;  4CHU A;  3WGG A;  4EMS A;  3KP6 A;  4UNO A;  1B4A A;  1SFU A;  1B6A A;  2DK8 A;  3EDP A;  2P6T A;  4WF2 A;  1BC7 C;  3BRO A;  2V1U A;  5AIQ A;  3ABT A;  1DUX C;  3L09 A;  1Z1D A;  1QGP A;  2RN7 A;  5ICC A;  2FXA A;  2Z5U A;  5E18 F;  4KMU X;  1LVA A;  1V4R A;  3V4G A;  1YYV A;  4GYI A;  4G94 A;  3WTZ A;  1SAX A;  3I59 B;  2GXG A;  1J9I A;  1DPR A;  4EM2 A;  4OIR F;  1S29 A;  3FXR A;  3RYR A;  1BIB A;  3KLN A;  2VT3 A;  3GXO A;  1PP8 F;  1I5Z A;  5E8G A;  1YW8 A;  3E3V A;  1IXS B;  2EB7 A;  1ZAO A;  2OBP A;  2VON A;  1E17 A;  2VE8 A;  1G6N A;  4P5O A;  4RGX A;  3Q9S A;  1B9M A;  4A0X A;  1QO0 D;  4DNC A;  2NNN A;  3K0L A;  3R61 A;  2FRH A;  1JGS A;  1K78 B;  4UV8 A;  4RGS A;  4Z2Y A;  3F21 A;  1U3E M;  4AVP A;  4G6D A;  3QOP A;  3VEP A;  5ICF A;  2W25 A;  4N9I A;  4IF4 A;  2YX4 A;  4PCQ A;  4Y15 A;  2IJL A;  3WTV C;  2YX7 A;  4MEY F;  4HF2 A;  1O3S A;  2EA4 A;  3B02 A;  2FMY A;  2RNJ A;  1P6R A;  3ZMU A;  2KKO A;  1W7P D;  4GYG A;  3EET A;  1IN6 A;  1G4D A;  2FA5 A;  5D5X B;  2XVC A;  3GFM A;  4OIP F;  3F3X A;  3GZ5 A;  3ZP5 A;  3LQR A;  3J81 Z;  5DEQ A;  1W7P A;  3I53 A;  1W5T A;  5E1W A;  4XLN F;  2ZFW A;  3HRM A;  4CXF A;  3GFJ A;  1S8N A;  5IT9 K;  4L9J A;  4UVA A;  2ISZ A;  5HVQ C;  1YS7 A;  3PQK A;  2BBY A;  5LGN A;  2KJB A;  1IRG A;  3PQJ A;  4IJA A;  5BQT A;  4RAY A;  3CUQ A;  1AWC A;  2NYX A;  1J75 A;  3RTR A;  3V7S A;  4PDK A;  3ROU A;  5F6F A;  4NQW A;  1S3J A;  1OMI A;  4IRI A;  2G7H A;  3HRU A;  1QNT A;  3FHZ A;  2A5Y B;  2IRF G;  3BWG A;  4HX7 A;  4LG0 A;  5E17 F;  4KIC A;  1TNS A;  4M6X A;  3E6B A;  3SZT A;  4KA4 A;  3TDZ C;  2R7F A;  4A12 A;  4LLL A;  1IN7 A;  4Y17 A;  2WC2 A;  3CO7 C;  4CGZ A;  2FF4 A;  4M72 A;  3K1N A;  1OPC A;  4HLX A;  3CUQ B;  3SQN A;  1G3S A;  3HRT A;  3OOP A;  5JHU A;  2DO7 A;  2CSO A;  1R23 A;  1XCV A;  4MTE A;  3ZMS A;  3HUG A;  3GFI A;  3WTX C;  4ZYH A;  2GA1 A;  2HTJ A;  3NRV A;  4OIN F;  1ZH5 A;  4WK8 F;  2PI0 A;  5D5V B;  2PEX A;  1B9N A;  1TW3 A;  5A2Q K;  2JRT A;  1FLI A;  2Y48 A;  2DK5 A;  2HR3 A;  1TTY A;  3GVA A;  5HDN A;  2QYO A;  1X3U A;  4HYE A;  2PBI A;  1MD0 A;  2H27 A;  2ZNZ A;  4O5V A;  4IHT A;  3BPX A;  1TLH B;  2HEO A;  3E5U A;  1KGS A;  2EV6 A;  3Q9V A;  1LEB A;  2P7C B;  1YTY A;  4KN7 X;  1O3T A;  2CO5 A;  4S04 A;  3V7R A;  4L5J A;  1A04 A;  1R1V A;  2HYG D;  4A6D A;  3GWZ A;  3LQQ A;  4UXN A;  1XSV A;  5ICG A;  3LST A;  4HF1 A;  3FMR A;  2FQ3 A;  3T5X A;  1OYY A;  2DAO A;  2YR2 A;  3RI4 A;  4KN4 X;  2BEO A;  2K02 A;  3GO5 A;  1O7L A;  4MQV A;  1FP1 D;  3T8T A;  3V7C A;  3IRQ A;  2ISY A;  2EV0 A;  1FT9 A;  2VC0 A;  2F5C A;  3M7G A;  1P92 A;  4BH9 A;  1LDJ A;  5HS7 A;  2O3F A;  3JAM K;  3FWE A;  2E7W A;  1V3F A;  5ICE A;  3KET A;  1KU9 A;  3CUO A;  3R0A A;  4G8X A;  3KZZ A;  4M71 A;  1FNN A;  3F6O A;  2G9W A;  2Z99 A;  5ILV A;  1XN7 A;  1KYW A;  4ZYG A;  2A07 F;  3BZ6 A;  1ZRC A;  4LLG F;  1QZY A;  1O3R A;  3F8M A;  3F8B A;  1CF7 A;  4EGY A;  4EJO A;  2L4A A;  4ESJ A;  1LJ9 A;  1ZGA A;  6PAX A;  4ENK A;  1P4X A;  4HOB A;  4XRF A;  1R1T A;  3VFZ A;  4U0V A;  5DD8 A;  3J81 K;  3T1B A;  2HGC A;  4RB2 C;  2FBI A;  4RB1 A;  3ZMD A;  4P9F A;  3K9T A;  4KDP A;  1HQC A;  4GO1 A;  1OYI A;  3CLO A;  1FZP B;  4P96 A;  2F5D A;  5CVU A;  3CDH A;  2XUB A;  5JI6 A;  2ETH A;  2OZU A;  3TO7 A;  3B73 A;  2VBY A;  3WTS C;  2GA2 A;  5IT9 Z;  1FBQ A;  3VB2 A;  2ACJ A;  3RKW A;  2WWY A;  4YFK F;  3ABU A;  1GVJ A;  4I09 A;  4JBA A;  3GW2 A;  5J8C A;  3CJN A;  2D1H A;  4Q47 A;  3GFL A;  3CTA A;  2DTR A;  4EJT A;  2K4B A;  3T0Y A;  5CLS A;  1J2X A;  2DQR A;  3R0J A;  4KT5 C;  3SHF A;  2YU3 A;  3D5L A;  2P5L C;  2DPD A;  1Q1H A;  3BDD A;  4A5M A;  4G7Z F;  1R1U A;  3RIR A;  2QBY A;  3T8R A;  1W5S A;  2YPR A;  4OU0 A;  3KEO A;  2V9V A;  4HA8 A;  2MH2 A;  2PFB A;  1R58 A;  2FU4 A;  1LDK B;  1J7K A;  5FD5 A;  1UST A;  4KFC A;  1YW7 A;  3I54 A;  2QWW A;  3U1D A;  2L4M A;  3I4P A;  1BM9 A;  3W6J B;  1LEA A;  2W84 A;  2ELH A;  2DI3 A;  1G3T A;  1SMY F;  2F5E A;  4BNC A;  1TQI A;  3G73 A;  4IHS A;  2HTS A;  2XAQ A;  4HDU A;  3EQL F;  3WU0 A;  4GXO A;  4ZZD A;  3F8C A;  3F8N A;  4HX4 A;  2PLY A;  4M74 A;  3FXU A;  2P5V A;  3RPU A;  2COM A;  1XGM A;  1F4K A;  3JTH A;  2F2E A;  3DKW A;  2IPQ X;  1IAW A;  4UVB A;  1F1Z A;  2GZW A;  5K5Q A;  3ML6 A;  3W6K B;  5LGT A;  2IVM A;  4LG0 B;  2HS5 A;  3GEZ A;  3IRR A;  1HKQ A;  3MQ0 A;  3ZMZ A;  2MLK A;  2ZNY A;  4L0Z B;  5FLX K;  3ZN1 A;  5K5O A;  5E1X A;  1ON2 A;  2EA2 A;  2VBZ A;  2DFI A;  3IL2 A;  1DPU A;  1XGN A;  2ZKZ A;  4LMY A;  2D2W A;  1DP7 P;  5H6Q A;  4FX4 A;  1U8R A;  1K6O A;  3ZMT A;  2Q8K A;  2XAH A;  2O61 A;  2FNP A;  3HRS A;  3I64 A;  4XSX F;  1YW9 A;  4I01 A;  3TQN A;  1SFX A;  3QP5 A;  3WTY C;  1KU7 A;  2DPU A;  5CVV A;  4K2E A;  1R22 A;  2W85 A;  3WOD F;  3M9A A;  2Y75 A;  5CVI A;  3V8K A;  2JTV A;  2W57 A;  5AON A;  2NS0 A;  1STZ A;  2M45 A;  4WX9 A;  4MGR A;  4M9X A;  2W24 A;  3E6D A;  1USS A;  1KU2 A;  3DV8 A;  2CWE A;  2A68 F;  2MC3 A;  1IN5 A;  1FSE A;  1QBJ A;  3FM5 A;  1KU3 A;  3MEX A;  1HW2 A;  3HTU A;  1U5T C;  4A0Z A;  3KP7 A;  2KJC A;  4IRH A;  3H3U A;  4U0Y A;  4Y13 A;  1S6L A;  2ZJ2 A;  1ZGJ A;  1FPQ A;  1R00 A;  5L3E A;  5D8K B;  1HSJ A;  1BI1 A;  1S7A A;  3V8J A;  2K86 A;  4ESB A;  3KZY A;  2P6S A;  4OMZ A;  2QZ8 A;  5FO5 A;  3KCC A;  3J7A O;  5DCM B;  4KIG A;  2GQQ A;  1XCB A;  4M9Z A;  3DPT A;  1FOK A;  5BOX A;  5E20 A;  3C18 A;  4ENN A;  3I59 A;  3J80 K;  2LNB A;  4L9T A;  4S05 A;  5L3C A;  4U88 A;  2ZBK A;  4O3M A;  3LFK A;  1FY7 A;  4AD9 A;  3TO6 A;  1RIO H;  2OZ6 A;  3K1M A;  4IVN A;  2XHK A;  4ON0 A;  4ZYE A;  2FSW A;  2UZK A;  2QLZ A;  3KEQ A;  2ADU A;  2STT A;  3DP7 A;  3MFK A;  3PFI A;  2V79 A;  4AIH A;  1KQ9 A;  4HQM A;  2FNA A;  3F8F A;  1HST A;  1NHA A;  1TQP A;  1G3Y A;  3U9G A;  2HDC A;  4OIO F;  2XAG A;  3MAJ A;  3FX3 A;  2AS5 F;  1YS6 A;  1G3W A;  4LJZ F;  2CYY A;  2L02 A;  1ZYR F;  1EH7 A;  3WTU C;  1ONV A;  2LSO A;  3IC7 A;  5K1Y A;  2EFW A;  2C6Y A;  2DT5 A;  2P5K A;  3GUD A;  3LA7 A;  4U0W A;  2FML A;  4BYY A;  4ESF A;  4LD5 A;  5FD6 A;  5L3F A;  4HLY A;  1FC3 A;  2VC1 A;  2LDU A;  3C1D A;  1DDN A;  1OKR A;  2ESH A;  3DF8 A;  2ZME B;  1O7F A;  3JSO A;  2IP2 A;  1ZRD A;  2FEZ A;  2PG4 A;  2QBY B;  2NAZ A;  1YQA A;  3DPL C;  4I98 B;  4HV6 A;  4R8H A;  4L0Y B;  4IXA A;  3I0T A;  1D3Y A;  4I0A A;  1UB9 A;  2VN2 A;  1IXC A;  3SXY A;  3S2W A;  2HYF A;  2VXZ A;  3RJP A;  4DQ2 A;  3TOA A;  4M73 A;  4OMY A;  3HSR A;  3QU6 A;  1WI9 A;  3K69 A;  2PMH A;  1KYZ A;  2HWV A;  2V1D A;  2NRA C;  2HFH A;  1FX7 A;  1KQ0 A;  5LHG A;  2OD5 A;  5L3B A;  4QLC U;  5FFZ A;  4R79 A;  2BE5 F;  5D4R A;  3F6V A;  3LWF A;  1REP C;  4Q5S F;  2M5W A;  4A2U A;  1WQ2 A;  3M1E A;  1F9N A;  3FZV A;  4AIK A;  2IA2 A;  1MJ9 A;  1D5V A;  1ZLK A;  2MD5 A;  1IF1 A;  3E6M A;  1LDD A;  4HF0 A;  2K7L A;  1JHF A;  2H09 A;  2E1C A;  1MGT A;  5D5U B;  1ZAR A;  2CG4 A;  4KUM A;  1R36 A;  4JQF A;  4A6E A;  1UFM A;  4RAZ A;  5AIP A;  4H0E A;  5DCF A;  1SD6 A;  3DEU A;  2Q2E A;  3N97 A;  2JPC A;  4LK1 F;  2D45 A;  3NEU A;  4Q4Z F;  4BHB A;  4A0Y A;  2VOP A;  2O0Y A;  3KP4 A;  2XKO A;  5DDG A;  3WU1 B;  4IPA A;  3L00 A;  2OQR A;  1WRJ A;  4HAM A;  2IA0 A;  4LB5 A;  3GYH X;  4AWX B;  5DD4 A;  2P7V B;  1WKM A;  1Z91 A;  4HW0 A;  4ENM A;  4EGZ A;  4L9N A;  2VT2 A;  2HZT A;  1HKT A;  3TOB A;  4Q48 A;  5HS9 A;  2FE3 A;  5HOO A;  3N4M A;  2KRF A;  4D0P A;  5ILS A;  3TO9 A;  3R4K A;  5D6E A;  2LF7 A;  2MLG A;  2P4W A;  4I2O A;  1CGP A;  4XBF A;  1XGS A;  4RB0 A;  2DBB A;  4I7H A;  2XV4 S;  2ZXJ A;  5LRR A;  2J5O A;  4HQE A;  1IRF A;  3IKT A;  2HQN A;  4OOI A;  1ODD A;  5EEH A;  1Z6T A;  2V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...