1CF7A

Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*TP*TP*TP*TP*CP*GP*CP*GP*CP*GP*GP*TP*TP*TP*T)-3
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02319 E2F_TDP E2F/DP family winged-helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cf7A00
4EV0A 4G7HF 1L3LA 3C7JA 3GZ5A 1G3WA 5A2QK 4WXCA 4L9NA 1O3TA 1OYYA 4NHJA 3I0TA 3I4PA 4KN4X 3VODA 2DLLA 1USSA 1Z1DA 2W57A 5LLQA 3SHFA 3E6BA 2EV5A 2A69F 4U7BA 2RVCA 1D5VA 1STZA 5ICCA 2KIFA 2EFQA 3TDZC 5BPDA 1P2FA 3J7AO 2BV6A 1O3QA 3I71A 3KEQA 3SZPA 1QGPA 2HDCA 3RJPA 1SFUA 1O3SA 5D6EA 1W7PD 2RDPA 3ML6A 4XSXF 1ULYA 1ONVA 4BXUA 2ELHA 4UVCA 4BAYA 4GYIA 3ULQB 3F8BA 3WU0A 3FX3A 3BWGA 4IVNA 4M9XA 4KIGA 1HKSA 2FA5A 4U0YA 1HSTA 3ZQ7A 1XMKA 3GEZA 4OIOF 1TLHB 4M6XA 4P9UA 2W24A 3LA7A 2YX7A 2G7UA 1TBXA 2UWMA 1OKRA 2ZNZA 4LB5A 3LWFA 4AIJA 4ZZLA 2QZ8A 2OAZA 2A3SA 3K9TA 2QBYA 2NRAC 3C1DA 5DV5A 4CO8A 1YO5C 2K4BA 3IKVA 2PFBA 2EK5A 5AIPA 1TW2A 3RKYA 5FD6A 3DF8A 1QO0D 2DFIA 5LRSA 3NQOA 3BPVA 3K2ZA 3WTYC 4HX8A 3F23A 3F8MA 4MEXF 1BIAA 5D5UB 2NS0A 2IA0A 2PJPA 3ERED 2E7WA 3R60A 4YFXF 1QNTA 2ESHA 2F5EA 1HW1A 4ESBA 4WK8F 1CF7B 4K2EA 4HV5A 2QQBA 2M45A 3W6KB 1ZREA 3ECHA 3CJNA 1BI0A 4I2OA 1RNLA 3WE3A 1IRFA 4FT8A 4GYGA 1IN8A 1B59A 3EQLF 3KFWX 3PFIA 2ACJA 1IXRC 2ISZA 4OINF 3BJ6A 1OPCA 3D0SA 1J7KA 1EH7A 5HS9A 3DP7A 3GF2A 1R58A 3V7CA 1S29A 4M71A 2L4MA 2OA4A 5ED4A 1JXSA 3RTRA 2ZXJA 4UV8A 4L5JA 6PAXA 1U6GA 1XB4A 5CVVA 1W4MA 4RGXA 4EJTA 2MLKA 3SQNA 3WGIA 2FMYA 4MNUA 2HQRA 3QP5A 1B9NA 5DDGA 2H94A 2VC0A 1P6RA 1R1VA 3P9IA 2O0YA 2XAGA 2ZBKA 1ZH5A 1JHHA 1FBUA 3KP7A 2XV4S 2ZJ2A 1QQIA 3K1PA 4PGGA 5E1XA 4EM0B 2GZWA 5D8LB 3F22A 3ISPA 5E8IA 4U7DA 5KK1A 2NYXA 4HZFA 4AWXB 2P7CB 2HQNA 4MQ9F 3I59B 4L18B 1KA8A 3COAC 1B6AA 3RKXA 2XGXA 1V3FA 3L00A 5CYVA 2W25A 1I1GA 1W7PB 1Z6TA 4HOBA 2P5LC 4LGWA 1K79A 4LG0B 3Q9SA 2NAZA 1LDJA 4G6QA 4L5IA 3RDIA 3CUQA 2QQ9A 3ZMSA 4N9HA 1D3YA 1GVJA 1HXDA 4RB2C 2EA2A 5FB2A 1A04A 3W6JB 1QZZA 2M87A 3FXRA 1MJBA 2RGVA 5FD5A 3HTUA 3HYIA 5CVRA 4PDKA 3DKWA 2GXGA 1J0RA 3GLXA 2HGCA 1IF1A 4G6DA 5LEKA 1Z05A 2DI3A 1AWCA 4BQAA 3ELKA 1Z91A 1R1UA 2A5YB 3CO7C 4YG2F 3MWMA 3RIRA 5CJ9A 2GA2A 3V8KA 2XRNA 2DPUA 3VOEA 4GCVA 1S3JA 2HKOA 1XDUA 2CYYA 1W5TA 2RV8A 2FEZA 2HTSA 4N0BA 5HOOA 4LD5A 3BJOA 2OQGA 2F5DA 1FP1D 2L3DA 2K27A 4MHGA 1S6LA 4B09A 1D8KA 5H20A 1U78A 1R36A 3V8JA 1OYIA 2R7DA 5DUIA 1KU7A 5LGTA 2VOPA 3TO7A 1SFEA 4OIRF 1ZLJA 4HF0A 2OZ6A 4QWQA 3IWZA 5A2QZ 2O03A 3IC7A 4XBFA 3TDUC 4M73A 2STTA 3L7WA 2OBPA 3MFKA 2GXBA 1T6SA 3HSFA 2DAOA 4RGSA 1IRGA 4GO1A 5KVRA 3IRRA 4ENNA 2VOOA 1ZRCA 2ZMEB 1LB2A 4EVIA 4HA8A 5LGNA 1KQ8A 1FT9A 3DV8A 3ZMUA 2DO7A 2FNPA 4F7ZA 3KP6A 2IA2A 3IRQA 3EUHA 1PUEE 4Q4ZF 5K1YA 4M6YA 1DUXC 3OV8A 1BJAA 1KU9A 5BOXA 2JT1A 2HTJA 1K78A 4CICA 2FQ3A 1MJ9A 2HYFA 2DW4A 2KRFA 2A6HF 2A68F 3HRSA 3EETA 3V7SA 2FMLA 5AONA 4RAZA 1SD5A 4A5NA 3F6VA 3U1DA 2Z9OA 5LHGA 3KE2A 4WXHA 2V79A 4O5VA 2TDXA 3BOQA 3LAPA 4CGZA 5LRRA 3RYPA 1GHCA 1YW7A 1F5TA 1S7AA 5L3FA 4EJUA 1GXQA 2VT2A 1SMTA 5H6QA 1TTYA 1ON2A 4NQWA 4LLLA 2P6TA 4ASNA 1J59A 4G9YA 1R22A 5IT9Z 2W85A 4YIFA 3WGHA 2H27A 3GFJA 3LAJA 2XVCA 4UVBA 3TKYA 1R23A 1O7LA 2VC1A 2STWA 5ERIA 3GFIA 4GXOA 3HHHA 1WI9A 1Z9CA 4FHTA 1LEAA 3GUDA 4EQQA 4HQEA 3HUGA 4S04A 1RUNA 4I7HA 2COMA 1YYVA 1UB9A 2XROA 3RKWA 1ZLKA 3F21A 1FSHA 4HDVA 5CVUA 3G3ZA 4KN7X 5IT9K 5BMZA 4LK1F 1I27A 4AIKA 4L9VA 5DEQA 2EFWA 3DFGA 4JBAA 1YLFA 3HOTA 2RNJA 1ZG5A 1UFMA 5D5XB 3ABTA 3I58A 3I5UA 3M8FA 4TV7A 3T0YA 4Q47A 2JZYA 5AIQA 2DQRA 3EDPA 1BI3A 2JPCA 4BYYA 3M1EA 3V8LA 3WTSC 5L3CA 1XGMA 4O6JA 1FBSA 1E2XA 2QBYB 3JSPA 1RUOA 4I98B 1BC7C 2E1CA 2CFXA 1EV7A 1T2KA 1ZAOA 1MD0A 2M1BA 5L3EA 1IXSB 4R8HA 3KP2A 1XGSA 3B73A 3O3KA 3WG9A 5DCFA 5HLHA 3QPTA 2FSWA 3RPQA 1XD7A 2XAQA 1CF7A 3I54A 4HLXA 2YX4A 1OR7A 2V1UA 1FBQA 2UXNA 1QPMA 3Q5FA 4XSZF 1J2XA 4KMUX 2LF7A 4CDGA 5JFRA 4XRFA 1ON1A 1FC3A 5D8KB 2VBXA 1KU3A 5CLSA 3WU1B 4KYWA 2H6BA 4BHPA 2IW5A 1TW3A 2YR2A 3JW4A 5HVQC 1LDKB 2RKHA 3O6BB 4S05A 1K6OA 4OU0A 2VXZA 5J8CA 4KUMA 3IL2A 3IKTA 1DDNA 1EH6A 4BHCA 3JSOA 3KZZA 4ESFA 2PMHA 5K5QA 2J5PA 4EGYA 3HRUA 2IT0A 2BYVE 2L02A 1W7PA 2DU9A 1BBYA 2L54A 2EJRA 2IRFG 2Z5UA 1R1TA 3E5XA 4I01A 5LHHA 1LEBA 4PGHA 2PG4A 4UVAA 2D1VA 4BNCA 1FP2A 4OIPF 2XKPA 4WCGA 3U2RA 2CQKA 1JE8A 1H0MA 1ZHFA 2QM3A 2R3SA 4IRGA 2QUFA 4UHTA 1C0WA 3M7GA 1CGPA 3F8FA 4MGRA 2QVOA 5F6FA 1DPRA 4OMZA 3ZMTA 2ISYA 2EFPA 4LMYA 5E18F 4KT5C 1YFHA 3HIFA 2O8XA 1PDNC 3MCZA 2XAHA 3BJAA 4EM1A 3BPXA 3V7RA 4HYEA 3SXYA 4P96A 3ZN1A 1S8NA 4O3MA 4G8XA 3T8TA 1TNSA 3TOAA 1GXPA 1RZ4A 3LQQA 1LDDA 1U8RA 5BQTA 2MD5A 1ZG3A 4I02A 3FXQA 1F4KA 2CWEA 2IP2A 3WODF 1ODDA 3LA3A 3QAHA 1L0OC 3TO6A 5ILUA 1IN5A 2V1XA 1O57A 2A07F 2Y0MA 1OMIA 4M72A 5HDKA 4R1HA 3F3XA 3HRTA 5ICEA 3ZP5A 3GO5A 3ZMZA 1ZARA 3N97A 1WKMA 1TQIA 2DBBA 1KQ0A 3ZN0A 1XGOA 1KQ9A 1WRJA 1I1SA 1XSXA 4HAMA 2FF4A 1AOYA 1SFXA 1U2WA 2JRTA 3CTAA 2MA3A 1KYWA 5EEGA 4RB0A 4LFUA 3I59A 5D4RA 2IVMA 4M9ZA 4HF1A 2VT3A 4L0ZB 4AVPA 2DK8A 3SFZA 3M8EA 4RS8A 3R0AA 5ICGA 3MZHA 3S2WA 1IW7F 2DK5A 4IF4A 1IN6A 2QYOA 3IHUA 4HW0A 2QLZA 5ILVA 1SMYF 2WWYA 1OYWA 2WTEA 3REOA 4P5OA 1ZRFA 3E6CC 4PCQA 3EYYA 5FO5A 1MZBA 3E5UA 1O3RA 3VEPA 1DPUA 1TQMA 3J81K 1P4AA 2EFOA 2PMUA 5J8FA 3PQJA 1YS7A 1Q1HA 3MQ0A 5D5WB 3CUQB 4R79A 3E5QA 3KETA 2CSOA 1T38A 3DXJF 1KYZA 1LJ9A 3PQKA 2W84A 4EJWA 3RI4A 3O2PE 2YPRA 4RAYA 2DQLA 2PQ8A 1BN5A 1FSEA 1H9TA 1Y0UA 3LFKA 3F8NA 3P7NA 1FNNA 3B02A 1XGNA 2P8TA 1S7OA 1MDMA 3F8CA 3AAFA 2ZCWA 1BI1A 2EV6A 5JR3A 2PN6A 1U5TA 3T8RA 4IJAA 1IN4A 3L9FA 4G7ZF 3OOPA 4LB6B 2V1DA 2Y48A 3GW2A 3C3WA 4NB5A 3BDDA 4A2UA 3FXUA 3H3UA 1ZGAA 4CHUA 4EGZA 4WXDA 2MH9A 3TOBA 1UCRA 3TQNA 1SAXA 4OOIA 3E6MA 4ENKA 4I0AA 4DNCA 3FWEA 1H9GA 2BBYA 1W5SA 5HS8A 3JTGA 2P5KA 4CZZA 3R6SA 2FBKA 2E7XA 2XKOA 3CLOA 1BI2A 5DUKA 4EJOA 4MTEA 4BHBA 4ETSA 1LQ1A 2LSOA 5HLGA 5DCMB 1FZPB 3NEUA 1FYLA 2LKPA 4WF2A 4Y17A 1HSJA 1FYMA 5CVJA 1JHFA 2H09A 1R5HA 1P4WA 4ENMA 3GYHX 3MAJA 3ZMDA 3ZPLA 1HW5A 4U88A 1T98A 5IT3A 2E1NA 3KP3A 4IHTA 1R7JA 2KIMA 5E1ZB 4KICA 2UZKA 3FMSA 3KLOA 4L9TA 4ZYEA 4MQVA 4M74A 5H6RA 3N4MA 1HBXG 3HHGA 1IN7A 1Z7UA 2Q2EA 4LG0A 2VE8A 2C6YA 1USTA 3BZ6A 4Y13A 2X4HA 1MJAA 3CDHA 4IRHA 4Q5SF 2QENA 2G9WA 2HFHA 1LVAA 2VONA 3ROUA 4WX9A 1B9MA 1FWZA 5F64A 1IAWA 3WTXC 1J5YA 5HLIA 5D6FA 1IXCA 3RPUA 3WGGA 2P6SA 1BIBA 2V9VA 1ZRDA 2LF8A 2L01A 3JTHA 2ZMEA 5E17F 2FXAA 4N9IA 4HV6A 4JQFA 4RGRA 2YSRA 3V4GA 1FLIA 3TGNA 1R5GA 4KIFA 5HDNA 1VTNC 1WSUA 3QP6A 1TNTA 4LJZF 1U5TC 2NNNA 5EEHA 1TQPA 3KEOA 1HKTA 3KCCA 1O7FA 4ENJA 2F2EA 1I5ZA 1D8JA 1IUYA 2L4AA 3FMRA 4UXNA 3K1NA 3MZYA 3E3VA 4KA4A 2EA4A 5D4SA 2KKOA 2QWWA 2CGPA 3MEXA 5BPIA 3K0LA 3VFZA 1K7AA 2FRHA 5E8GA 3H3ZA 3T1BA 1YTYA 1LNWA 3DQVC 3WTWC 3C18A 2GA1A 1R00A 2K02A 5DYMA 2Z3YA 3R61A 2P7VB 5FLXZ 2XAJA 2HKXA 4KIBA 3ZMVA 2K86A 4PZJA 2JTVA 2OQRA 2HS5A 1F1ZA 2Q8KA 3GFMA 2EB7A 4I09A 2O3FA 3D5LA 5HS7A 3RYRA 3FMQA 1P4XA 4L9JA 1JGSA 3BP8A 5FLXK 5L3DA 5LGUA 1RIOH 4HX4A 4A6EA 1PP8F 5L3BA 5LBQA 2NNYA 1XCVA 3FF5A 5E20A 2UXXA 1SD7A 3FZVA 3ABUA 3ECOA 1DP7P 3Q9VA 2OU2A 3HSEA 1F9NA 5FFXA 4Z2YA 5D5VB 5CVIA 1B4AA 1X3UA 4A5MA 3GXOA 2IJLA 4U0WA 2XIGA 4G7OF 4CXFA 1WWXA 2VODA 4DQ2A 2PLYA 4FX4A 4ZYGA 2J5OA 1XSDA 3R4KA 3BY6A 2FE3A 3EYIA 4IPAA 3L2CA 1BOAA 1FPQA 3HRMA 3TO9A 1G3SA 4ZYHA 2AXLA 3WE2A 1KU2A 4A0YA 4GGGA 4HLYA 3BROA 4FX0A 1FX7A 5LHIA 2DT5A 2ESNA 5HDGA 5TJJA 4YFKF 4B8XA 3HTSB 2ZFWA 2ADUA 1ZN2A 1YS6A 3IWFA 3FM3A 2P4WA 1QZYA 2XHKA 1P92A 2KJCA 2R7FA 1PP7U 3KP5A 1XMAA 3JAMK 1XCBA 4OIQF 3NRVA 2HEOA 3J80Z 3K69A 2O61A 2VN2A 1QBJA 1BM9A 3GZ6A 4ZH4F 2A61A 4EM2A 3WTTC 4I0BA 2IA1A 2ZO4A 3QRFF 3E97A 1T39A 2CG4A 2JSCA 5DCMA 4XLNF 5L3GA 1ZGJA 4IRIA 4KNYA 3GVAA 4KMFA 4JK1X 2O6GE 2HYGD 2MH2A 3F72A 2EV0A 1REPC 5K5OA 2MBFA 1K78B 1U5TB 3CUOA 4HX7A 2Z33A 2MC3A 2A6EF 1Z6RA 1WQ2A 4A0ZA 1V4RA 2D1HA 4YIIA 1XDSA 5E1WA 4E70A 1E17A 3FHZA 5LEJA 4UNOA 4UUVA 4AD9A 2WV0A 2GIVA 4RGUA 2GAUA 2FBIA 2V6CA 4EMSA 3J80K 4ZZDA 2BE5F 4A6DA 4QLCU 1HW2A 3QOPA 2VBWA 2H6CA 2XAFA 4LLGF 2K4JA 1YW9A 3K1MA 4RB3C 4KDPA 2B0LA 3GX4X 4IHSA 3H92A 2DPDA 2XASA 2FNAA 1FY7A 2KIUA 2ZKZA 3WTZA 4HQMA 1RI7A 2P5VA 1MGTA 1MDMB 3LQRA 4M9SA 2ETHA 2F5CA 4ON0A 1FOKA 4HBLA 5ILSA 1IZ1A 2LNBA 4LLNA 1YW8A 1XN7A 4OMYA 3G73A 4HF2A 2FBHA 1I6XA 5FFZA 2PBIA 2KJBA 2QQAA 3U9GA 5K5RA 2MLGA 5FGMA 2Y75A 1BC8C 3JAMZ 2RN7A 4G94A 2OZUA 2D2WA 3E6DA 4Y15A 4MTDA 2OD5A 1SD6A 3QPHA 1ZYRF 3WTVC 2HWVA 3I64A 1HQCA 1UHWA 2D45A 1XSVA 3F6OA 4Q48A 5DD4A 4MEYF 3VB2A 3R0JA 4AIHA 3KP4A 4IXAA 2BEOA 3HOSA 1FYKA 2Q0OA 1MKMA 2HR3A 1YIOA 2Z99A 3DPTA 1ZG1A 2K7LA 2EFNA 4CYDA 1EH8A 2GWRA 5BS6A 3CO6C 5DD8A 2JPBA 1HKQA 4LK0F 2YU3A 2G7HA 2HOEA 3P9KA 2DTRA 1G6NA 5ICFA 2LDUA 5J6XA 4YFNF 1B1BA 1G3YA 1YQAA 4WWCA 4KFCA 1T0FA 1G3TA 4A0XA 3KLNA 3GWZA 3HSRA 5JVTA 3QU6A 4H0EA 2FOKA 2M30A 3KZYA 3QU3A 4UV9A 3GFLA 3P9CA 4EJVA 3WTUC 2AS5F 2PEXA 4A12A 2XUBA 5TRDA 4U0VA 4ESJA 2FU4A 4BH9A 3LA2A 2RQPA 1YG2A 4XLPF 3LSTA 4D0PA 2F5FA 2VE9A 3DPLC 2IPQX 2BGCA 2PI0A 2VBZA 2M5WA 1J9IA 2CO5A 3DEUA 1G4DA 2ZNYA 1J75A 4RB1A 4HDUA 3L09A 1KGSA 3T5XA 1NHAA 2M8EA 2HZTA 5JI6A 5F1RA 1UHMA 3SZTA 1SD4A 4ZYDA 5JHUA 4P9FA 2GQQA 2VBYA 2CW0F 3I53A 3FM5A 4P55A 4L0YB 3CUQC 3J81Z 2EWNA 2RC4A 1U3EM 3M9AA 2WC2A 2X0LA
chains in the Genus database with same CATH superfamily
1Y39A 2LD5A 4EV0A 2HZDA 5E79C 4F3QA 3SEQA 3VPRA 4G7HF 4BEHB 1R5ID 1L3LA 3C7JA 3GZ5A 1G3WA 3L1PA 5A2QK 3OR1C 4WXCA 2H8WA 4L9NA 1O3TA 1OYYA 4MFEA 4NHJA 3GTOJ 3MKZA 3I0TA 3I4PA 4MFDA 4KN4X 4A3DJ 3VODA 2DLLA 1USSA 1Z1DA 2W57A 3JRBA 2OUMA 5LLQA 3SHFA 1MMNA 3E6BA 2NVXJ 2R7QA 2EV5A 2A69F 2Q1ZB 3MKYB 4W1UA 1HDPA 2PMZA 3A4CA 3CF5F 2XAUA 2OPTA 4U7BA 3BQZA 3GZNB 4E7LA 2GM4A 3JRGA 4FASD 1I39A 2RVCA 3H5AA 3OL4A 1D5VA 1STZA 2KDOA 5GPAA 4JX6A 5ICCA 2KIFA 1ETKA 2EFQA 3TDZC 4IKFA 2OTJI 5BPDA 3W2AA 1P2FA 3J7AO 2ECBA 4CCJA 3JCUC 2BV6A 1I3AA 1O3QA 5F1JA 3I71A 1D0XA 3KEQA 3SZPA 1MMSA 1QGPA 2HDCA 1A31A 3RJPA 3MKLA 2FOWA 1VNDA 1SFUA 1O3SA 5D6EA 2VPLA 3LSPA 2E2HJ 3A01B 1E3PA 1RETA 2IAIA 1Y0NA 1W7PD 2RDPA 3ML6A 1WJEA 2ECCA 4AYBN 4XSXF 1ULYA 1WFXA 4E7KA 2UV1A 1ONVA 4BXUA 2ELHA 4UVCA 2JMWA 4BAYA 3FXMA 5IYBJ 4GYIA 2HPMA 2VQCA 3ULQB 3F8BA 3WU0A 3FX3A 3BWGA 4IVNA 4M9XA 5FKNA 4KIGA 3ZGKA 1HKSA 3HG9A 2FA5A 4U0YA 1HSTA 4E6KG 4HNVA 3ZQ7A 1XMKA 3GEZA 3JRHA 4OIOF 3H35A 2R7RA 1S5LC 1QU3A 1TLHB 3DLAA 4M6XA 4P9UA 2W24A 3LA7A 2K9MA 2G7UA 1TBXA 2YX7A 1V54H 2UWMA 1Y6IA 1OKRA 2ZNZA 4LB5A 3OY9A 2QSGX 3LWFA 4AIJA 4ZZLA 2QZ8A 2OAZA 2FUG2 2HVQA 2LBFA 2A3SA 4DGWB 1LPQA 3K9TA 2QBYA 3OMYA 3HPGA 3C1DA 2NRAC 5DV5A 4CO8A 3CMYA 2NVUB 1MBKA 1WJ5A 1YO5C 2K4BA 1VQ5I 4BBRJ 2QCOA 4ANJA 2O5RA 3IKVA 2PFBA 2EK5A 5AIPA 1TW2A 3RKYA 5FD6A 3DF8A 1QO0D 2DFIA 5LRSA 3NQOA 3BPVA 3K2ZA 3WTYC 4HX8A 3F23A 3K4LA 5GTHC 3F8MA 4MEXF 1BIAA 5D5UB 1AKHB 2IGMA 3AL0B 1ENHA 2NS0A 2IA0A 2PJPA 3ERED 1OFCX 5EYRA 2DT6A 2E7WA 2R5ZA 3R60A 1H89C 4YFXF 2QQ8A 2JN6A 1QNTA 2ESHA 3LSIA 2F5EA 1HW1A 4ESBA 2L9NA 4WK8F 1KZHA 1CF7B 4K2EA 4HV5A 4D7MA 2QQBA 1FIAA 2WB1N 3I9V2 3OYNA 4ZDPA 2HI3A 3E7LA 2M45A 3W6KB 5E3LA 1ZREA 1A6IA 3ECHA 3NAUA 4XR6A 2F48A 3CJNA 1BI0A 2IGOA 4I2OA 2WV1A 2VB6A 1RNLA 2GIZA 2KDZA 1W5CC 3LNQA 2K9NA 3CLQA 1ZGWA 3WHBA 4F55A 3WE3A 1DQUA 1IRFA 4FT8A 2YUSA 2E1MB 2DA1A 4GYGA 2BY1A 3GMEA 1IN8A 1B59A 3OYBA 1I3QJ 3EQLF 3KFWX 5C4XJ 5EG0B 1JUPA 3PFIA 5HNFA 4BU2A 2XDVA 1K4TA 2ACJA 1IXRC 2BVLA 4OINF 2VJ4A 2ISZA 2YU9J 1N78A 3CC7I 3BJ6A 1FIPA 1OPCA 1IUFA 3D0SA 3RCOA 1J7KA 3OR2C 3IAS2 2PX9A 2Y31A 1TT0A 1EH7A 2DA5A 5HS9A 3DP7A 2OV7A 3GF2A 3FXKA 1R58A 3V7CA 5KAFC 1ITYA 3L2QA 2KQRA 1S29A 4DZJA 4HSRA 4M71A 2L4MA 3RPUD 2OA4A 5ED4A 3OIOA 1JXSA 1ZR4A 3RTRA 2ZXJA 3DEEA 1FJLA 1ETWA 2CMPA 4DOZA 4UUSB 2CW8A 4UV8A 4PFOA 2DMTA 4L5JA 3BZKA 3CJTB 3HB9A 6PAXA 1X2MA 2W1OA 2B7EA 1U6GA 1XB4A 5CVVA 1VI0A 1W4MA 4RGXA 4RDUA 2O9LA 2MLKA 4EJTA 3SQNA 2DFFA 2DYSH 1VQNI 3WGIA 4A93J 2KT0A 2FMYA 4MNUA 1B72B 2HVRA 1VF9A 2NXNB 2HQRA 9ANTA 1TT5B 3QP5A 1B9NA 5DDGA 2H94A 4XKBA 2VC0A 1Y1VJ 1P6RA 2CQNA 1R1VA 3P9IA 2O0YA 4XONA 3HOYJ 4B44A 1MIJA 2XAGA 4PJNA 2ZBKA 4NUBA 3BR1A 4BUPA 2UUZA 1ZH5A 3S1MJ 1JHHA 1FBUA 3C2HA 1QVUA 1Y56A 2XV4S 2ZJ2A 1QQIA 3KP7A 3K1PA 4PGGA 3MN2A 4IHYA 3TMOA 5E1XA 4EM0B 4L5EA 2W4SA 3WG7H 2GZWA 5E3MA 2H1LA 3JRIA 5D8LB 3F22A 3ISPA 2E2IJ 5E8IA 4U7DA 1RKWA 5KK1A 2NYXA 4HZFA 2HU9A 4AWXB 2P7CB 2HQNA 1BA5A 4MQ9F 3I59B 4LITA 2X1EA 4L18B 1KA8A 2OJED 3COAC 4XKCA 2XSDC 2X6OA 2FQ4A 2V1NA 3FKJA 1T0FC 1B6AA 3RKXA 2XGXA 1T33A 1V3FA 2EZHA 1BOBA 2KISA 3L00A 5CYVA 2W25A 1RR8C 2DYRH 1I1GA 2ZXIA 1W7PB 2XGDA 3PFYA 3DWLE 1Z6TA 4HOBA 2P5LC 4LGWA 1K79A 2QSFX 3ZQQA 4LG0B 1X1CA 5IOYA 1K6YA 3Q9SA 2NAZA 3ESWB 1LDJA 4G6QA 4L5IA 2EIKH 3RDIA 2TCTA 3CUQA 2QQ9A 4JP0A 3ZMSA 1UG0A 1WJAA 4N9HA 1D3YA 4EEFG 3BR2A 1GVJA 2KFDA 1HXDA 4RB2C 1D1AA 1S7EA 2EA2A 4MO7A 5FB2A 1A04A 4A3CJ 3W6JB 1QZZA 4V2FA 2M87A 3FXRA 3ABMH 4X6AJ 4YEJA 2ZSHB 1MJBA 4II2A 2RGVA 4XOTA 1ETXA 2WY7Q 5FD5A 3HTUA 1LFBA 4B3XA 1X4PA 4B43A 1IG7A 3BTCA 3HYIA 5CVRA 4A3BJ 4PDKA 2X1CA 1MBHA 3M07A 3DKWA 2GXGA 1J0RA 1R9TJ 3GLXA 3FK7A 2HGCA 1IF1A 3CJQB 4G6DA 5LEKA 2COBA 1Z05A 5IYDJ 3C2GA 3DLLF 2DI3A 4YRVA 1AWCA 4BQAA 2IS6A 3ELKA 5IP7J 2HOTA 1QA6A 5DM6F 2O8KA 1G8XA 1Z91A 3A2KA 3BR3A 1R1UA 5E3NA 2A5YB 3CO7C 4YG2F 1SANA 4AUXA 3KZIC 3MWMA 3RIRA 1NTCA 4XMYA 5CJ9A 1SVLA 2GA2A 3V8KA 4GRIA 2XRNA 2DPUA 4FE4A 3VOEA 4GCVA 1S3JA 1WJCA 2AHQA 2DA3A 2HKOA 1XDUA 3H0DA 2CYYA 3OS0A 1W5TA 2CUZA 2RV8A 1WH7A 4M3BA 2FEZA 2VQHA 4B1RA 2BY2A 4XRSG 2HTSA 3PM1A 4N0BA 3SEZA 3BCAA 5HOOA 2HDDA 4LD5A 3BJOA 3PUFA 1LVKA 5KCMA 2OQGA 2F5DA 1FP1D 2L3DA 3M8JA 2K27A 1YHQI 4MHGA 4GFBA 1S6LA 4GDFA 2EH3A 4B09A 1D8KA 1IRZA 5H20A 5FKOA 3IUOA 1U78A 1IO2A 1P7JA 3O8HA 1R36A 2HPIA 3V8JA 1OYIA 2R7DA 5DUIA 1KU7A 5LGTA 5DM7F 3Q3SA 2VOPA 2G0EA 1EA3A 3CDLA 3TO7A 1SFEA 1WJDA 4OIRF 5FROA 4ZDOA 1ZLJA 3AG1H 2OZ6A 4HF0A 4QWQA 3IWZA 3CC2I 5A2QZ 2QKLB 2O03A 4OAZA 3J7YJ 1YJNI 2FJ1A 5CQGA 4DZPA 3S16J 3IC7A 4XLAA 4F92B 4XBFA 4BDZA 1MSFC 3TDUC 3ZR8X 4XN3A 4M73A 2XSJC 3GBGA 2STTA 3L7WA 2OBPA 3MFKA 2GXBA 1T6SA 2KZVA 3HSFA 2DAOA 4RGSA 4XLEA 3LSHA 3BCBA 2HVSA 1IRGA 4BDYA 1U0JA 4GO1A 5KVRA 2L7FP 3IRRA 3W6VA 2CRGA 3ZCOA 1K83J 1JTXA 4RMNA 4ENNA 5DS9A 3RQIA 4JX4A 3HUGB 2VOOA 1ZRCA 4XKVA 5M3FJ 1YX3A 1Z21A 2ZMEB 1J09A 3I3LA 1LB2A 4EVIA 2CV1A 4HA8A 3PIPF 3GTQJ 2LLKA 4IZZA 5LGNA 5JLWA 1TZLA 4QSHA 1KQ8A 1FT9A 3DV8A 3K4JA 3ZMUA 2DO7A 1ETQA 4CYCB 2DMPA 2L9RA 3N05A 2FNPA 2NVTJ 1A35A 4F7ZA 3I56I 4E7HA 3KP6A 2IA2A 5B1AH 5GPCA 3ABLH 2E19A 3OOUA 3IRQA 3HC7A 2M2EA 2RQQA 1IV6A 4XNFA 3EUHA 5M3MJ 1PUEE 4C2MJ 4Q4ZF 3IV5A 3OYLA 5K1YA 3DCFA 4M6YA 2CJJA 3FXOA 1DUXC 3OV8A 1BJAA 3OYMA 1KU9A 5BOXA 2JT1A 4F52A 2HTJA 1JUMA 1DGWY 1K78A 2KIQA 4CICA 2FQ3A 2VJIA 4CCOA 1MJ9A 2HYFA 2DW4A 2KRFA 2A6HF 2A68F 3HRSA 2R7ZJ 3EETA 3V7SA 5JVGF 3BLYA 2DODA 2HXIA 3VSKA 2FMLA 5AONA 4RAZA 1YRNB 5FRMA 2A6TA 3JRCA 1SD5A 4A5NA 3F6VA 3U1DA 1DU6A 2Z9OA 1VQ4I 5LHGA 2CQ7A 3O8GA 3KE2A 2K40A 4WXHA 2LKXA 3ZQGA 2V79A 4O5VA 4XOPA 4QTRA 2TDXA 2QF7A 2L2OA 3BOQA 3LAPA 1X1DA 5LRRA 4CGZA 3S2DJ 1YRNA 1X1PA 3RYPA 1GHCA 1YW7A 5TGTA 1F5TA 2RREA 1S7AA 5GTIC 5L3FA 4EJUA 1GXQA 2LKSA 2VT2A 1JI8A 1SMTA 4EATA 2JRMA 1HOMA 5H6QA 1TTYA 1ON2A 4NQWA 4LLLA 4BQQA 2V4JC 4A3GJ 3NARA 3S93A 2CUJA 2P6TA 4NC7A 2E36A 3FBIB 4ASNA 4XL9A 1J59A 4G9YA 3GLLA 4C30A 3DPUA 1R22A 3OYJA 2VLAA 1JJ8C 5IT9Z 5FRNA 2W85A 4A3MJ 2Z16A 4YIFA 2LFBA 4CCNA 3HJEA 3WGHA 2H27A 3GFJA 3CP2A 3BQYA 2XVCA 4UVBA 3TKYA 3LAJA 1TL8A 1R23A 1O7LA 2VC1A 2DJNA 2HXOA 2K9LA 5ERIA 4C9YA 2STWA 4GXOA 3HHHA 3GFIA 1WI9A 2HDWA 3K2AA 2M3AA 1VQ9I 1Z9CA 4FHTA 1Y1WJ 1LEAA 3GUDA 4EQQA 5IP6A 1FMWA 3HUGA 4S04A 4HQEA 1RUNA 4I7HA 2COMA 1YYVA 2R7SA 1WI3A 1UB9A 2F4OB 2XROA 2JA6J 1IRXA 4DYCA 3G71I 3RKWA 1ZLKA 2OC6A 1RPWA 4UY8I 2HOSA 3F21A 1FSHA 2BY0A 5CVUA 2EILH 4HDVA 3G3ZA 4KN7X 2Y9YA 1WH5A 5IT9K 5BMZA 4LK1F 1I27A 3RSNA 4FE7A 3DTKA 1GUUA 4AIKA 4L9VA 5DEQA 2EFWA 2L7MP 3DFGA 4JBAA 1YLFA 3K4MA 3HOTA 2RNJA 1ZG5A 2X1DA 1UFMA 1F36A 5D5XB 3ABTA 1GV5A 3I58A 4UUSA 3I5UA 3HKZA 1D5YA 3M8FA 2LREA 4TV7A 3BG7A 1X3WB 3MD2A 3UNGC 3T0YA 4Q47A 1JTYA 2MG4A 4NQWB 2JZYA 1YJWI 5AIQA 2DQRA 3EDPA 4S0HB 1BI3A 4A3KJ 2JPCA 1QVTA 4BYYA 3M1EA 3V8LA 3OWTA 3WTSC 5L3CA 1XGMA 4O6JA 3W2WA 1FBSA 1E2XA 1BR1A 2QBYB 3JSPA 1RUOA 2IBDA 4UB6C 5EG0A 4I98B 1BC7C 5H2FC 2E1CA 2CFXA 1EV7A 1Z0XA 1T2KA 1R6RA 1V55H 1ZAOA 3ZQCA 1MD0A 2WAQA 1D1CA 5GAGJ 2M1BA 5L3EA 1JKQC 4D5FA 1IXSB 4R8HA 2X6WA 1TWFJ 3KP2A 3FXJA 1XGSA 3VSLA 3B73A 3CD6I 3O3KA 4C2TA 1BR4A 3WG9A 5DCFA 3K70D 5HLHA 2DT7B 3B6AA 3QPTA 4YIRX 2FSWA 3RPQA 3AG2H 3L2VA 1XD7A 2XAQA 1CF7A 2JVHA 2R0QC 3I54A 4HLXA 2YX4A 1OR7A 5J4VA 3ABKH 1E3OC 2DOFA 2R5ZB 2V1UA 5F04A 1JJ6C 1FBQA 2UXNA 1QPMA 3Q5FA 4XSZF 1J2XA 2VKVA 4KMUX 4E7SA 4KITB 2LF7A 4CDGA 2DA2A 4BEHA 5JFRA 2N8GA 4XRFA 2JA5J 3G1OA 1ON1A 1FC3A 5D8KB 2VBXA 3I55I 4RM2A 1KU3A 3PNVA 1JT0A 5FLVA 1NG7A 4PSWA 1FEXA 5CLSA 2XF7A 4UB8C 3QODA 3BG9A 2XPUA 3HDDA 2ID3A 3WU1B 4KYWA 4PJJA 2H6BA 4BHPA 2IW5A 1TW3A 1OCZH 2DTZA 5GAHJ 2YR2A 3JW4A 5HVQC 4M3DA 4BS9A 1SVOA 1LDKB 2RKHA 2LBFB 3O6BB 3SDBA 1UELB 4D1QA 4S05A 3D1NI 1K6OA 4OU0A 2VXZA 2VQLA 4D7NA 4RM3A 2V9KA 4RA2A 5J8CA 5EZGA 4BL0B 4KUMA 2NVYJ 3IL2A 3LSKA 3IKTA 1DDNA 1BW6A 1EH6A 4BHCA 3JSOA 2MD0A 3KZZA 4ESFA 2P81A 1NG6A 2PMHA 4U87A 5K5QA 2J5PA 4HSTA 1VQLI 5IOZA 4EGYA 3HRUA 3DTIA 3U1KA 2IT0A 2WBMA 2BYVE 2L02A 1W7PA 2ZSIB 2DU9A 1BBYA 2L54A 2EJRA 2IRFG 1XPXA 2Z5UA 1W0TA 2ZMEC 3EPZA 1EJ9A 1E3HA 1R1TA 3PNYA 3E5XA 4I01A 2LR8A 5LHHA 2CH0A 3M1CA 1LEBA 5J40A 3CESA 4RAFA 4PGHA 2PG4A 5GP9A 4UVAA 2D1VA 4BNCA 1FP2A 4V2GA 2Y0SA 4OIPF 2XKPA 4WCGA 4CCMA 4AYBA 4HNUA 5CQEA 3U2RA 3CCSI 2CQKA 3CP8A 1JE8A 1H0MA 1ZHFA 2EPFA 1W0UA 2QM3A 2TRTA 4XLFA 3VYSB 2R3SA 4E7ZA 3TBIA 4IRGA 3BC8A 2QUFA 4UHTA 1C0WA 3M7GA 5K7ZA 3RKQA 3QYEA 1CGPA 5KAIC 2ZC2A 2ZXWH 3F8FA 5J1YA 3S3OA 3SZGA 4MGRA 3JRDA 2QVOA 5F6FA 1Q1VA 4BQNA 1SC7A 3AKZA 4Y3OA 1DPRA 4OMZA 4UUTA 2LY9A 3EUHC 3KYDB 3ZMTA 2ISYA 4BJ5C 4A3JJ 3OSFA 2EFPA 3CCRI 2VASA 4LMYA 4DYRA 5E18F 4KT5C 1FOYA 2ZB9A 2LC2A 3JRAA 3H5RA 3HIFA 1YFHA 3S2HJ 2EZLA 2O8XA 3MCZA 1PDNC 2XAHA 1PVEA 3S14J 3BJAA 2KMUA 4EM1A 4M3EA 3BPXA 3V7RA 4HYEA 4IHXA 2MSYA 3SXYA 2L7ZA 4XM3A 4P96A 3ZN1A 1S8NA 1R71A 4O3MA 2BW3B 2HNHA 2A5WA 1EF4A 4G8XA 5C44J 2GXAA 3OL3A 2W82A 2HOAA 3E0JB 3T8TA 3GTMJ 3CCUI 1TNSA 3TOAA 1GXPA 2KL4A 1RZ4A 2QGUA 3LQQA 1LDDA 1U8RA 1DP3A 3G2BA 5BQTA 3Q0UA 2MD5A 3BTJA 2BW3A 1ETVA 1ZG3A 2IEKA 1Z67A 4I02A 3FXQA 3WHCA 1F4KA 1XMXA 1ETOA 2CWEA 2E35A 2IP2A 3WODF 1I6HJ 1ODDA 1RR7A 2YS9A 3LA3A 1NH3A 5EGOB 4ZC3A 2L0KA 4Y52J 3QAHA 3J7AY 1L0OC 3K4BA 4IQJA 3TO6A 3AG3H 3H9GA 1X2NA 4BXXJ 5ILUA 1IN5A 2V1XA 1O57A 2A07F 2GOMA 2Y0MA 1OMIA 4M72A 5HDKA 4R1HA 2KRHA 3HRTA 1SAUA 3F3XA 4B3AA 5ICEA 3ZP5A 2XPWA 2VXDA 3GO5A 2LYCA 3ZMZA 1ZARA 3N97A 2NOJB 1TC3C 1WKMA 4RBOA 4ZYAA 1TQIA 3TW6A 2DBBA 1D1BA 1KQ0A 3QQAA 3ZN0A 1XGOA 1KQ9A 1WRJA 5K7FA 1I1SA 1XSXA 1N77A 4HAMA 3CMMA 2FF4A 1AOYA 1SFXA 1U2WA 2K9SA 2JRTA 1VQKI 3CTAA 3HZJA 1GVDA 2MA3A 4IEJA 2Y30A 1KYWA 2XRLA 5KNLA 1ZKGA 3CMAI 2Z2SB 2AQEA 5EEGA 4RB0A 2QA4I 4LFUA 3I59A 5D4RA 4XN0A 3BTIA 2IVMA 4XIDA 4M9ZA 4HF1A 2VT3A 4L0ZB 4AVPA 2DK8A 2LVSA 3SFZA 3M8EA 4RS8A 3R0AA 5ICGA 4BY7J 3MZHA 3S2WA 1IW7F 1W1WE 2DK5A 4IF4A 4BE2A 1IN6A 2QYOA 1VZ0A 3IHUA 4HW0A 4IX7A 2QLZA 3V42A 5ILVA 1SMYF 2WWYA 3VDXA 1MBGA 3S1QJ 4Y4RA 1OYWA 2XF5A 2WTEA 3REOA 4P5OA 1ZRFA 1YX5A 3E6CC 4PCQA 1B8IA 3EYYA 1GT0C 1OISA 5FO5A 1MZBA 4CZCA 4IO9F 3E5UA 1O3RA 3IAM2 3VEPA 3C2BA 3BZCA 1DPUA 1AHDP 1TQMA 3HGYA 3J81K 1P4AA 3WU2C 4PJ0C 2EFOA 2PMUA 5J8FA 2F5VA 3PQJA 1R49A 1YS7A 3VWBA 1Q1HA 4N4OB 5LFAA 2M8GX 3MQ0A 4RLQA 5D5WB 4FTHA 3CUQB 4R79A 3E5QA 1QHHD 2CSOA 2NS7A 3H9QA 3KETA 1T38A 4Z6YA 3LMMA 3DXJF 1KYZA 1LJ9A 3PQKA 3AL0C 2W84A 2IS1A 4EJWA 3CCVI 3RI4A 3MKWB 1Z3YA 3OYDA 3O2PE 2YPRA 1VQ6I 4RAYA 2DQLA 4C3JJ 2PQ8A 1BN5A 1FSEA 2IGKA 1H9TA 3ZQLA 1Y0UA 3LFKA 2CFOA 4PJLA 1MMAA 3F8NA 3P7NA 3GTJJ 1FNNA 3CCMI 4XLHA 3HPHA 3B02A 4QIWN 1XGNA 1GV2A 3TW7A 2X6YA 2P8TA 1S7OA 1MDMA 2LTPA 4OAYA 2MW8A 3NWSA 4A69C 1JKOC 4YELA 3CC4I 3BG6A 3F8CA 2ZJPF 5IYCJ 3AAFA 2ZCWA 1BI1A 1D0ZA 2EV6A 2EIMH 3I4NJ 5JR3A 5FKMA 5GADJ 2PN6A 1F43A 1U5TA 2KLOA 1Z7LA 4CSWA 3T8RA 4IJAA 2DFHA 1IN4A 1YIJI 2E1MC 3L9FA 3QYBA 1MBJA 1U9OA 2NVQJ 4G7ZF 3KYCB 3OOPA 4LB6B 2VKDA 2WAEA 2V1DA 3OSGA 4ITVA 3MVPA 2QKMB 2Y48A 3GW2A 3C3WA 4NB5A 3BDDA 4A2UA 1YI2I 3D5RC 3PNTA 1HC8A 2DMNA 3FXUA 4FETA 5DTDA 1LFPA 1AKHA 3H3UA 1ZGAA 4CHUA 3DKYA 5CKTA 4WXDA 3HOXJ 4EGZA 2MH9A 3TOBA 2DXIA 3IH2A 4H4KC 2VL8A 1UCRA 3ASNH 3TQNA 3A01A 2E2JJ 4MLOA 1SAXA 4OOIA 1G2HA 3E6MA 1TWCJ 3VYRB 2VJ5A 4ENKA 4I0AA 4D9JA 4DNCA 1WGXA 2M7BA 1P7IA 3FWEA 3KYLA 3CCLI 1WZ2A 4OWRB 2L9VA 1SVMA 3HL2A 1H9GA 2BBYA 1VQMI 5EF6A 4I6ZA 3PJRA 1W5SA 2M34A 5HS8A 3J7ZI 1X1BA 4XRMA 3JTGA 4NDLA 2WB1A 1HDDC 2LY1A 2P5KA 3OYIA 3KIOA 2MABA 3R6SA 4CZZA 3HOUJ 2FBKA 3VYTB 1MW7A 2E7XA 2XKOA 3CLOA 1PYVA 3G6EI 3KEYA 1BI2A 5DUKA 3M4OJ 4EJOA 4MTEA 4BHBA 4DW6A 2H8RA 3S15J 4ETSA 1LQ1A 4XORA 2LSOA 1LE8A 1SFOJ 5HLGA 5DCMB 4AM3A 2WY8Q 1FZPB 3NEUA 4LIUA 1TP4A 1FYLA 2LKPA 4WF2A 4Y17A 3QPLA 2D5VA 2ME0A 1HSJA 3M3YJ 4BQOA 4QPQA 2R7VA 3H9JA 1H8AC 1FYMA 3GCMA 5CVJA 1JHFA 2H09A 1YITI 1R5HA 1P4WA 3DBLB 2R7WA 4ENMA 5GAEJ 3BR6A 1YOVB 3GYHX 3MAJA 5JLXA 1A5JA 1AA7A 1GLNA 3ZMDA 4PK4A 3LSJA 1UG2A 3ZPLA 2R7XA 1YJ9I 2I5UA 1HW5A 4U88A 4BE0A 1T98A 5IT3A 1RRJA 2E1NA 3KP3A 4IHTA 1R7JA 2KIMA 5E1ZB 4KICA 2UZKA 3FMSA 4BE1A 3KLOA 4L9TA 3JR9A 1W36C 4ZYEA 1TWHJ 2IGNA 4MQVA 3K10A 4FISA 2GOXB 4M74A 3ZXSA 2Y69H 3K7AJ 5H6RA 4NNJA 3N4MA 1UZCA 1HBXG 3HHGA 1IN7A 1Z7UA 1VQPI 2Q2EA 4J00A 4LG0A 2KPMA 2VE8A 2IS4A 5EGOA 4CA0A 2DOEA 3G4SI 3PSFA 1T8IA 2E5ZA 2F4IA 1B72A 2I8DA 2C6YA 1USTA 3SYTA 3HOWJ 3BZ6A 2JUGA 4Y7NJ 2EBIA 4Y13A 2GLOA 2X4HA 3L2UA 5HLTA 1MJAA 5KHDA 3CDHA 4IRHA 4ABZA 4KISA 1U8BA 2AO9A 2W48A 4Q5SF 2QENA 2G9WA 4I99C 2HFHA 2W00A 2BXZA 1LVAA 2DMUA 3TP3A 2AXTC 3ROUA 4A3IJ 2VONA 4WX9A 1U9NA 1B9MA 1FWZA 3HBLA 1WCMJ 5F64A 1IAWA 3HOVJ 2E34A 2RAEA 1WJBA 4A3LJ 1POGA 3PL8A 3WTXC 4PUSA 1OQYA 1J5YA 2DN0A 1MSEC 3CDIA 5D6FA 1X3ZB 5HLIA 4KJZA 1GDTA 1IXCA 1FMVA 3RPUA 1Y8QB 3F0CA 1S72I 3GTPJ 3WGGA 4JOMA 2LRDA 4XRSA 3EUAA 3NWTA 1ETYA 2P6SA 1JUSA 3A1YA 1BIBA 2X51A 2V9VA 1ZRDA 4NC6A 3BTLA 2LF8A 1HA8A 3HOZJ 2L01A 3JTHA 5J4YA 2ZMEA 1WJFA 5E17F 2FXAA 3IP4B 2JQ7A 2XB0X 4N9IA 2ZJQF 2VPRA 3HGGA 1W36D 4HV6A 1MNEA 3CCQI 2M4KA 4FCYA 4JQFA 4RGRA 3LSMA 2YSRA 1VFCA 2Z1DA 3LL7A 2JSPA 3V4GA 3KPHA 3ZRGA 1QPIA 2B9SA 1T08B 1FLIA 3TGNA 2R7UA 2VIXA 3GTKJ 1R5GA 4KIFA 5J1RA 5HDNA 2JWTA 1VTNC 3DU5A 1WSUA 3QP6A 1TNTA 2WAQN 4LJZF 2OTLI 1R4MB 3OYHA 1U5TC 1HCRA 2NNNA 1WHUA 3VYUB 3ZQIA 2E60A 5EEHA 1TQPA 2R5YB 3KEOA 1V5FA 4PJMA 1HKTA 3KCCA 2R92J 1MNMC 1O7FA 1BW5A 3SDGA 3OS2A 5B5EC 4ENJA 3DTEA 4Y33A 3BT9A 1PUFA 2F2EA 1R4NB 1I5ZA 1D8JA 1IUYA 2L4AA 3FMRA 4UXNA 5E3OA 2M7AA 2B63J 3K1NA 3MZYA 4ZDLA 3E3VA 4KA4A 2EA4A 5D4SA 2JJ7A 2KKOA 2QWWA 3FXLA 2CGPA 3MEXA 4XKWA 4BKXA 5BPIA 2F6CA 4C3IJ 3CCYA 5J1UA 3K0LA 3VFZA 1K7AA 5FJ8J 2FRHA 5E8GA 3H3ZA 3HKZN 3T1BA 1LNWA 2E1OA 2RNGA 1YTYA 3G1MA 3DU6A 3DQVC 3WTWC 3C18A 2GA1A 1R00A 2K02A 4I76A 5DYMA 2Z3YA 3UR3C 3CQZJ 2CUEA 5EZHA 3PIOF 3QYFA 1SFKA 4D5CA 3R61A 2P7VB 1FOWA 3H1CA 5FLXZ 2XAJA 2HKXA 3DBRB 4KIBA 3A03A 5CPRB 3ZMVA 4XK4A 3ZOBA 1B8IB 3LOCA 2K86A 3H3VK 4PZJA 3UKGA 1PUFB 2LH9A 3AFHA 2JTVA 3DKXA 3LFUA 4DBRA 5EJCA 2OQRA 4XLCA 2HS5A 1F1ZA 3RZDJ 2Q8KA 3GFMA 2EB7A 1XC5A 2DA6A 4I09A 2DDBA 4IHVA 3IH3A 4CCKA 2O3FA 3OIPA 2R7OA 3D5LA 3CZ6A 5HS7A 3RYRA 2PJRB 3FMQA 5J3LA 1P4XA 2HYJA 1JGSA 3BP8A 4L9JA 1LUJB 5L3DA 5FLMJ 5FLXK 2VKHA 5LGUA 1ZELA 1RIOH 1X58A 3S3MA 3P5JA 4HX4A 4A6EA 1PP8F 5LD2C 4CH7A 2JA8J 5L3BA 5LBQA 2NNYA 1XCVA 3FF5A 3HXLA 3H0GJ 1JKRC 2CV2A 5E20A 2UXXA 2LY2A 5C4JJ 1SD7A 3JREA 2OCEA 3FZVA 3OYGA 3K4KA 2LP0A 3ABUA 3ECOA 1DP7P 3I4MJ 3Q9VA 1V5EA 2K3PA 2K5CA 2OU2A 2CQXA 2FX0A 3HSEA 2KZGA 1UAAA 1F9NA 5FFXA 4Z2YA 5D5VB 5CVIA 3FKIJ 1ZQ3P 2JA7J 1B4AA 2BHYA 1X3UA 2ZXHA 1XS9A 3PO2J 4A5MA 3GXOA 1IDYA 2ICWG 2IJLA 4U0WA 2XIGA 4G7OF 1DU0A 4CXFA 1A6QA 1MMDA 2R5YA 1WWXA 2VODA 4DQ2A 3H36A 2MC4A 2PLYA 4FX4A 4ZYGA 2J5OA 1XSDA 3R4KA 3BY6A 1TWAJ 2FE3A 1FTTA 1IC8A 1X1AA 4HG2A 2L7KA 5FKLA 4LOCA 5B66C 1MBEA 1Y8RB 3EYIA 1RESA 4IPAA 2R4GA 3D5SC 4BJTA 3L2CA 1BOAA 1FPQA 3HRMA 3TO9A 1G3SA 3B6CA 3FISA 4G6TB 4ZYHA 2AXLA 3WE2A 1P9QC 4NC8A 1KU2A 4A0YA 4GGGA 3MMYB 2LOOA 2OCCH 4HLYA 1OCOH 4JX5A 3U21A 3W2VA 3BG5A 3BROA 2FD5A 1NK2P 1LKXA 3RQ4A 4FX0A 1FX7A 2V9PA 5LHIA 1IJWC 2ELJA 2MFZA 2DT5A 3S1RJ 2ESNA 5HDGA 5TJJA 4YFKF 1AU7A 4B8XA 3HTSB 2ZFWA 2ADUA 3FIWA 2M0CA 3S8PA 3EUKL 3H5NA 3CF2A 3TEDA 1ZN2A 1YS6A 3IWFA 3FM3A 3W3CA 3BG3A 2P4WA 1QZYA 2XHKA 3HM5A 1BR2A 2X48A 1P92A 5F0HA 4LIVA 2KJCA 2R7FA 1PP7U 3KP5A 1XMAA 4NBQA 4DIQA 3JAMK 1XCBA 4OIQF 2ZFUA 3NRVA 2M9HA 2HEOA 3J80Z 1BJZA 3K69A 2O61A 1I50J 1S9HA 2JA2A 2VN2A 1QBJA 1BM9A 3QOEA 3GZ6A 4G12A 3HEFA 1ZTRA 2WA0A 4ZH4F 2A61A 4EM2A 5HNHA 4I0BA 3WTTC 2XGEA 2IA1A 2ZO4A 3F9KA 3QRFF 3QWLA 3E97A 2DCEA 1T39A 2CG4A 2JSCA 2KHMA 5DCMA 4CUGA 2WAFA 5K7HA 2DFEA 4XLNF 5L3GA 1ZGJA 4IRIA 4KNYA 2R93J 2QSHX 2HQAA 3BR5A 4W97A 3GVAA 4KMFA 4JK1X 3OYKA 2O6GE 2HYGD 4X1EA 2IS2A 2MH2A 2X6XA 3LSRA 4MIMA 3Q0WA 5EEAA 4KT6A 2Y0SN 3F72A 3ASOH 2EV0A 1REPC 5K5OA 1XG1A 2MBFA 2V6EA 1K78B 1U5TB 3SFIA 3K4NA 3GTGJ 5HODA 2CS3A 2ME6A 2CW7A 1N75A 2M0MA 3CCEI 1G59A 2GBYA 3CUOA 4HEA2 4HX7A 2XB5A 5M5XJ 2Z33A 4IOAF 4ZTFA 2MC3A 1QZEA 2A6EF 1K4SA 4E7IA 1Z6RA 1WQ2A 4A0ZA 4HRIA 4P1WA 1V4RA 2D1HA 4XQFA 4YIIA 1OCTC 1XDSA 3S3NA 1V5GA 5E1WA 1FTZA 5B3SH 4E70A 2V26A 2QEXI 1E17A 1A36A 3FHZA 5LEJA 4UNOA 4UUVA 1VQ7I 2DMQA 3L2WA 4AD9A 5TISC 3GTLJ 3S17J 4CYCA 2WV0A 3G1LA 1SEUA 2GIVA 2BVMA 2BHZA 4QPOA 4RGUA 2GAUA 2FBIA 2V6CA 5F0CA 4EMSA 3OYAA 3J80K 3E1SA 4ZZDA 2BE5F 4A6DA 1NK3P 4QLCU 3S1NJ 1OCPA 1ZR2A 2JUCA 2KRCA 1OCCH 1HW2A 3QOPA 3FBNB 2O7OA 2VBWA 4M3GA 4V19K 2LG4A 2H6CA 2P0WA 2XAFA 3PSIA 2M4GA 4IQ4A 4LLGF 2K4JA 4BBSJ 4C2UA 1YW9A 3K1MA 3ONQA 4RB3C 4KDPA 1UJ8A 1MBFA 2ELKA 2XGCA 1TWGJ 2B0LA 3GX4X 4IHSA 3H92A 4RLFA 5C3EJ 1KONA 4BXFA 4IOCF 2DPDA 3K4CA 1RKTA 2FNAA 2XASA 1JKPC 1FY7A 2KIUA 2ZKZA 3BR0A 4A3FJ 3WTZA 3K70C 4HQMA 1RI7A 2NS8A 2XF6A 4LG3A 2P5VA 4DBQA 2LMDA 1MGTA 4BACA 3OS1A 3OYEA 3LQRA 4M9SA 1MDMB 4AIDA 4C3HJ 2H1KA 2ETHA 2F5CA 2CQQA 4B47A 4HNTA 4AC0A 5F08A 4ON0A 1FOKA 4HBLA 1IGNA 2VUMJ 2X85A 5ILSA 2R7TA 3DEWA 3PUBA 1IZ1A 2LNBA 3DBHB 2DA7A 4M6VA 5B1BH 3ZQFA 1FOXA 4LLNA 1YW8A 5M5WJ 1LFUP 1XN7A 1Z3XA 2JVGA 3FHNA 4OMYA 1UHSA 1K61A 3K6GA 1EKEA 1MH4A 3G73A 4J19A 4HF2A 2FBHA 2HQ5A 1I6XA 3LSGA 1ZK8A 2L9SA 2PBIA 2BOLA 5FFZA 2KJBA 2QQAA 3U9GA 5K5RA 4ZJZA 1OR7C 5IP9J 2CU7A 2MLGA 3OYFA 5FGMA 2Y75A 2DDAA 1BC8C 3JAMZ 2RN7A 1IDZA 4G94A 1CQTA 2OZUA 1DGRM 2D2WA 1JGGA 2PMZN 1OCRH 1MNDA 4IHWA 3TP0A 1ACIA 3E6DA 2K9QA 1ERDA 1XX5A 3KX2A 4M3FA 2Q2EB 4Y15A 4B4CA 4MTDA 2OD5A 1HF0A 1SD6A 3QPHA 1ZYRF 2MGQA 4B48A 2I10A 2EZKA 3WTVC 2A05A 2EINH 2HWVA 4DYQA 2K85A 4A3EJ 2PJRA 2Y9ZA 4DJAA 1QHGA 3I64A 1HQCA 1Z77A 1UHWA 4E4HA 2D45A 1X4OA 1XSVA 3F6OA 4N4NB 4Q48A 5DD4A 4MEYF 3VB2A 3R0JA 4AIHA 3KP4A 3PO3J 4IXAA 1JT6A 1PJRA 2BEOA 1UMQA 4F93B 1XTAA 3RZOJ 2XPVA 1IV8A 1X19A 3HOSA 1FYKA 2Q0OA 3Q0VA 5F27A 2MYSA 1MKMA 4JYKA 1E0EA 2HR3A 1YIOA 2Z99A 3DPTA 1ZG1A 1O4XA 2K7LA 2EFNA 4CYDA 3MZ8A 1EH8A 2GWRA 5BS6A 1OLTA 1N25A 4AU7A 2EZIA 4AVZA 3CO6C 3A02A 5DD8A 2E71A 2JPBA 1HKQA 1MH3A 4LK0F 2YU3A 2G7HA 2HOEA 4J01A 3P9KA 2DTRA 1G6NA 5ICFA 2LDUA 5J6XA 4YFNF 2KP6A 1B1BA 4E7JA 1G3YA 1ORKA 2JK3A 1YQAA 1H88C 4WWCA 4KFCA 2X9DA 4HPQA 2BY3A 3TL4X 2ZJRF 1T0FA 4ZTJA 2VQGA 3FDYA 2NOGA 1WPKA 1G3TA 4PSXA 4A0XA 3CJRB 3KLNA 2VI6A 2AQFA 2EIJH 2VJJA 2XC7A 3GWZA 3HSRA 5JVTA 3QU6A 4H0EA 2FOKA 2M30A 4X0GA 3KZYA 3QU3A 4UV9A 3GFLA 3P9CA 2VKEA 4EJVA 3WTUC 5M5YJ 2AS5F 1HLVA 4IL6C 2PEXA 3AG4H 2OF7A 4A12A 2XUBA 4RAGA 3X2QH 5TRDA 4U0VA 4ESJA 2FU4A 4BH9A 5J47A 3LA2A 4PFPA 1BL0A 2RQPA 2L5QA 1YG2A 4XLPF 3LSTA 2F4MB 4D0PA 2F5FA 5F0FA 3IH4A 2VE9A 3OIQA 3DPLC 5EDNA 1D0YA 2IPQX 2V7FA 2BGCA 4F91B 3CCJI 2PI0A 1T95A 2VBZA 2M5WA 3SJMA 1J9IA 2CO5A 3DEUA 2CV0A 1G4DA 2ZNYA 4CCLA 1T56A 1J75A 4RB1A 2DOAA 2K3FA 3ZQHA 1VQ8I 2EQRA 1MMGA 4HDUA 3L09A 1KGSA 3QPSA 3A0HC 3OYCA 3T5XA 3FK6A 1NHAA 2WADA 4FQGA 2DA4A 4XICA 2M8EA 2HZTA 1LE8B 4BJ6C 5JI6A 1OJLA 4BY1J 3L2RA 5F1RA 1UHMA 3SZTA 1SD4A 1YE9A 3JRFA 5FKKA 4ZYDA 2W7NA 5JHUA 3ERMA 4II3A 2Y2ZA 4P9FA 2GQQA 1M1EB 2VBYA 2E5NA 2DJIA 5JHFA 1VQOI 1APLC 1WVRA 2CW0F 3I53A 3S32A 3A0BC 2LK2A 2BXYA 2CUFA 3CMEI 3FM5A 4P55A 4L0YB 2ID6A 3CUQC 5BNGA 3J81Z 2EWNA 5IPAA 2RC4A 1RC9A 1U3EM 1QRYA 4BGDA 3M9AA 2IXSA 2WC2A 2X0LA 2BZTA 5IY5H
chains in the Genus database with same CATH topology
4EV0A 4G7HF 1L3LA 3C7JA 3GZ5A 1G3WA 5A2QK 4WXCA 4L9NA 1O3TA 1OYYA 4NHJA 3I0TA 3I4PA 4KN4X 3VODA 2DLLA 1USSA 1Z1DA 2W57A 5LLQA 3SHFA 3E6BA 2EV5A 2A69F 4U7BA 2RVCA 1D5VA 1STZA 5ICCA 2KIFA 2EFQA 3TDZC 5BPDA 1P2FA 3J7AO 2BV6A 1O3QA 3I71A 3KEQA 3SZPA 1QGPA 2HDCA 3RJPA 1SFUA 1O3SA 5D6EA 1W7PD 2RDPA 3ML6A 4XSXF 1ULYA 1ONVA 4BXUA 2ELHA 4UVCA 4BAYA 4GYIA 3ULQB 3F8BA 3WU0A 3FX3A 3BWGA 4IVNA 4M9XA 4KIGA 1HKSA 2FA5A 4U0YA 1HSTA 3ZQ7A 1XMKA 3GEZA 4OIOF 1TLHB 4M6XA 4P9UA 2W24A 3LA7A 2YX7A 2G7UA 1TBXA 2UWMA 1OKRA 2ZNZA 4LB5A 3LWFA 4AIJA 4ZZLA 2QZ8A 2OAZA 2A3SA 3K9TA 2QBYA 2NRAC 3C1DA 5DV5A 4CO8A 1YO5C 2K4BA 3IKVA 2PFBA 2EK5A 5AIPA 1TW2A 3RKYA 5FD6A 3DF8A 1QO0D 2DFIA 5LRSA 3NQOA 3BPVA 3K2ZA 3WTYC 4HX8A 3F23A 3F8MA 4MEXF 1BIAA 5D5UB 2NS0A 2IA0A 2PJPA 3ERED 2E7WA 3R60A 4YFXF 1QNTA 2ESHA 2F5EA 1HW1A 4ESBA 4WK8F 1CF7B 4K2EA 4HV5A 2QQBA 2M45A 3W6KB 1ZREA 3ECHA 3CJNA 1BI0A 4I2OA 1RNLA 3WE3A 1IRFA 4FT8A 4GYGA 1IN8A 1B59A 3EQLF 3KFWX 3PFIA 2ACJA 1IXRC 2ISZA 4OINF 3BJ6A 1OPCA 3D0SA 1J7KA 1EH7A 5HS9A 3DP7A 3GF2A 1R58A 3V7CA 1S29A 4M71A 2L4MA 2OA4A 5ED4A 1JXSA 3RTRA 2ZXJA 4UV8A 4L5JA 6PAXA 1U6GA 1XB4A 5CVVA 1W4MA 4RGXA 4EJTA 2MLKA 3SQNA 3WGIA 2FMYA 4MNUA 2HQRA 3QP5A 1B9NA 5DDGA 2H94A 2VC0A 1P6RA 1R1VA 3P9IA 2O0YA 2XAGA 2ZBKA 1ZH5A 1JHHA 1FBUA 3KP7A 2XV4S 2ZJ2A 1QQIA 3K1PA 4PGGA 5E1XA 4EM0B 2GZWA 5D8LB 3F22A 3ISPA 5E8IA 4U7DA 5KK1A 2NYXA 4HZFA 4AWXB 2P7CB 2HQNA 4MQ9F 3I59B 4L18B 1KA8A 3COAC 1B6AA 3RKXA 2XGXA 1V3FA 3L00A 5CYVA 2W25A 1I1GA 1W7PB 1Z6TA 4HOBA 2P5LC 4LGWA 1K79A 4LG0B 3Q9SA 2NAZA 1LDJA 4G6QA 4L5IA 3RDIA 3CUQA 2QQ9A 3ZMSA 4N9HA 1D3YA 1GVJA 1HXDA 4RB2C 2EA2A 5FB2A 1A04A 3W6JB 1QZZA 2M87A 3FXRA 1MJBA 2RGVA 5FD5A 3HTUA 3HYIA 5CVRA 4PDKA 3DKWA 2GXGA 1J0RA 3GLXA 2HGCA 1IF1A 4G6DA 5LEKA 1Z05A 2DI3A 1AWCA 4BQAA 3ELKA 1Z91A 1R1UA 2A5YB 3CO7C 4YG2F 3MWMA 3RIRA 5CJ9A 2GA2A 3V8KA 2XRNA 2DPUA 3VOEA 4GCVA 1S3JA 2HKOA 1XDUA 2CYYA 1W5TA 2RV8A 2FEZA 2HTSA 4N0BA 5HOOA 4LD5A 3BJOA 2OQGA 2F5DA 1FP1D 2L3DA 2K27A 4MHGA 1S6LA 4B09A 1D8KA 5H20A 1U78A 1R36A 3V8JA 1OYIA 2R7DA 5DUIA 1KU7A 5LGTA 2VOPA 3TO7A 1SFEA 4OIRF 1ZLJA 4HF0A 2OZ6A 4QWQA 3IWZA 5A2QZ 2O03A 3IC7A 4XBFA 3TDUC 4M73A 2STTA 3L7WA 2OBPA 3MFKA 2GXBA 1T6SA 3HSFA 2DAOA 4RGSA 1IRGA 4GO1A 5KVRA 3IRRA 4ENNA 2VOOA 1ZRCA 2ZMEB 1LB2A 4EVIA 4HA8A 5LGNA 1KQ8A 1FT9A 3DV8A 3ZMUA 2DO7A 2FNPA 4F7ZA 3KP6A 2IA2A 3IRQA 3EUHA 1PUEE 4Q4ZF 5K1YA 4M6YA 1DUXC 3OV8A 1BJAA 1KU9A 5BOXA 2JT1A 2HTJA 1K78A 4CICA 2FQ3A 1MJ9A 2HYFA 2DW4A 2KRFA 2A6HF 2A68F 3HRSA 3EETA 3V7SA 2FMLA 5AONA 4RAZA 1SD5A 4A5NA 3F6VA 3U1DA 2Z9OA 5LHGA 3KE2A 4WXHA 2V79A 4O5VA 2TDXA 3BOQA 3LAPA 4CGZA 5LRRA 3RYPA 1GHCA 1YW7A 1F5TA 1S7AA 5L3FA 4EJUA 1GXQA 2VT2A 1SMTA 5H6QA 1TTYA 1ON2A 4NQWA 4LLLA 2P6TA 4ASNA 1J59A 4G9YA 1R22A 5IT9Z 2W85A 4YIFA 3WGHA 2H27A 3GFJA 3LAJA 2XVCA 4UVBA 3TKYA 1R23A 1O7LA 2VC1A 2STWA 5ERIA 3GFIA 4GXOA 3HHHA 1WI9A 1Z9CA 4FHTA 1LEAA 3GUDA 4EQQA 4HQEA 3HUGA 4S04A 1RUNA 4I7HA 2COMA 1YYVA 1UB9A 2XROA 3RKWA 1ZLKA 3F21A 1FSHA 4HDVA 5CVUA 3G3ZA 4KN7X 5IT9K 5BMZA 4LK1F 1I27A 4AIKA 4L9VA 5DEQA 2EFWA 3DFGA 4JBAA 1YLFA 3HOTA 2RNJA 1ZG5A 1UFMA 5D5XB 3ABTA 3I58A 3I5UA 3M8FA 4TV7A 3T0YA 4Q47A 2JZYA 5AIQA 2DQRA 3EDPA 1BI3A 2JPCA 4BYYA 3M1EA 3V8LA 3WTSC 5L3CA 1XGMA 4O6JA 1FBSA 1E2XA 2QBYB 3JSPA 1RUOA 4I98B 1BC7C 2E1CA 2CFXA 1EV7A 1T2KA 1ZAOA 1MD0A 2M1BA 5L3EA 1IXSB 4R8HA 3KP2A 1XGSA 3B73A 3O3KA 3WG9A 5DCFA 5HLHA 3QPTA 2FSWA 3RPQA 1XD7A 2XAQA 1CF7A 3I54A 4HLXA 2YX4A 1OR7A 2V1UA 1FBQA 2UXNA 1QPMA 3Q5FA 4XSZF 1J2XA 4KMUX 2LF7A 4CDGA 5JFRA 4XRFA 1ON1A 1FC3A 5D8KB 2VBXA 1KU3A 5CLSA 3WU1B 4KYWA 2H6BA 4BHPA 2IW5A 1TW3A 2YR2A 3JW4A 5HVQC 1LDKB 2RKHA 3O6BB 4S05A 1K6OA 4OU0A 2VXZA 5J8CA 4KUMA 3IL2A 3IKTA 1DDNA 1EH6A 4BHCA 3JSOA 3KZZA 4ESFA 2PMHA 5K5QA 2J5PA 4EGYA 3HRUA 2IT0A 2BYVE 2L02A 1W7PA 2DU9A 1BBYA 2L54A 2EJRA 2IRFG 2Z5UA 1R1TA 3E5XA 4I01A 5LHHA 1LEBA 4PGHA 2PG4A 4UVAA 2D1VA 4BNCA 1FP2A 4OIPF 2XKPA 4WCGA 3U2RA 2CQKA 1JE8A 1H0MA 1ZHFA 2QM3A 2R3SA 4IRGA 2QUFA 4UHTA 1C0WA 3M7GA 1CGPA 3F8FA 4MGRA 2QVOA 5F6FA 1DPRA 4OMZA 3ZMTA 2ISYA 2EFPA 4LMYA 5E18F 4KT5C 1YFHA 3HIFA 2O8XA 1PDNC 3MCZA 2XAHA 3BJAA 4EM1A 3BPXA 3V7RA 4HYEA 3SXYA 4P96A 3ZN1A 1S8NA 4O3MA 4G8XA 3T8TA 1TNSA 3TOAA 1GXPA 1RZ4A 3LQQA 1LDDA 1U8RA 5BQTA 2MD5A 1ZG3A 4I02A 3FXQA 1F4KA 2CWEA 2IP2A 3WODF 1ODDA 3LA3A 3QAHA 1L0OC 3TO6A 5ILUA 1IN5A 2V1XA 1O57A 2A07F 2Y0MA 1OMIA 4M72A 5HDKA 4R1HA 3F3XA 3HRTA 5ICEA 3ZP5A 3GO5A 3ZMZA 1ZARA 3N97A 1WKMA 1TQIA 2DBBA 1KQ0A 3ZN0A 1XGOA 1KQ9A 1WRJA 1I1SA 1XSXA 4HAMA 2FF4A 1AOYA 1SFXA 1U2WA 2JRTA 3CTAA 2MA3A 1KYWA 5EEGA 4RB0A 4LFUA 3I59A 5D4RA 2IVMA 4M9ZA 4HF1A 2VT3A 4L0ZB 4AVPA 2DK8A 3SFZA 3M8EA 4RS8A 3R0AA 5ICGA 3MZHA 3S2WA 1IW7F 2DK5A 4IF4A 1IN6A 2QYOA 3IHUA 4HW0A 2QLZA 5ILVA 1SMYF 2WWYA 1OYWA 2WTEA 3REOA 4P5OA 1ZRFA 3E6CC 4PCQA 3EYYA 5FO5A 1MZBA 3E5UA 1O3RA 3VEPA 1DPUA 1TQMA 3J81K 1P4AA 2EFOA 2PMUA 5J8FA 3PQJA 1YS7A 1Q1HA 3MQ0A 5D5WB 3CUQB 4R79A 3E5QA 3KETA 2CSOA 1T38A 3DXJF 1KYZA 1LJ9A 3PQKA 2W84A 4EJWA 3RI4A 3O2PE 2YPRA 4RAYA 2DQLA 2PQ8A 1BN5A 1FSEA 1H9TA 1Y0UA 3LFKA 3F8NA 3P7NA 1FNNA 3B02A 1XGNA 2P8TA 1S7OA 1MDMA 3F8CA 3AAFA 2ZCWA 1BI1A 2EV6A 5JR3A 2PN6A 1U5TA 3T8RA 4IJAA 1IN4A 3L9FA 4G7ZF 3OOPA 4LB6B 2V1DA 2Y48A 3GW2A 3C3WA 4NB5A 3BDDA 4A2UA 3FXUA 3H3UA 1ZGAA 4CHUA 4EGZA 4WXDA 2MH9A 3TOBA 1UCRA 3TQNA 1SAXA 4OOIA 3E6MA 4ENKA 4I0AA 4DNCA 3FWEA 1H9GA 2BBYA 1W5SA 5HS8A 3JTGA 2P5KA 4CZZA 3R6SA 2FBKA 2E7XA 2XKOA 3CLOA 1BI2A 5DUKA 4EJOA 4MTEA 4BHBA 4ETSA 1LQ1A 2LSOA 5HLGA 5DCMB 1FZPB 3NEUA 1FYLA 2LKPA 4WF2A 4Y17A 1HSJA 1FYMA 5CVJA 1JHFA 2H09A 1R5HA 1P4WA 4ENMA 3GYHX 3MAJA 3ZMDA 3ZPLA 1HW5A 4U88A 1T98A 5IT3A 2E1NA 3KP3A 4IHTA 1R7JA 2KIMA 5E1ZB 4KICA 2UZKA 3FMSA 3KLOA 4L9TA 4ZYEA 4MQVA 4M74A 5H6RA 3N4MA 1HBXG 3HHGA 1IN7A 1Z7UA 2Q2EA 4LG0A 2VE8A 2C6YA 1USTA 3BZ6A 4Y13A 2X4HA 1MJAA 3CDHA 4IRHA 4Q5SF 2QENA 2G9WA 2HFHA 1LVAA 2VONA 3ROUA 4WX9A 1B9MA 1FWZA 5F64A 1IAWA 3WTXC 1J5YA 5HLIA 5D6FA 1IXCA 3RPUA 3WGGA 2P6SA 1BIBA 2V9VA 1ZRDA 2LF8A 2L01A 3JTHA 2ZMEA 5E17F 2FXAA 4N9IA 4HV6A 4JQFA 4RGRA 2YSRA 3V4GA 1FLIA 3TGNA 1R5GA 4KIFA 5HDNA 1VTNC 1WSUA 3QP6A 1TNTA 4LJZF 1U5TC 2NNNA 5EEHA 1TQPA 3KEOA 1HKTA 3KCCA 1O7FA 4ENJA 2F2EA 1I5ZA 1D8JA 1IUYA 2L4AA 3FMRA 4UXNA 3K1NA 3MZYA 3E3VA 4KA4A 2EA4A 5D4SA 2KKOA 2QWWA 2CGPA 3MEXA 5BPIA 3K0LA 3VFZA 1K7AA 2FRHA 5E8GA 3H3ZA 3T1BA 1YTYA 1LNWA 3DQVC 3WTWC 3C18A 2GA1A 1R00A 2K02A 5DYMA 2Z3YA 3R61A 2P7VB 5FLXZ 2XAJA 2HKXA 4KIBA 3ZMVA 2K86A 4PZJA 2JTVA 2OQRA 2HS5A 1F1ZA 2Q8KA 3GFMA 2EB7A 4I09A 2O3FA 3D5LA 5HS7A 3RYRA 3FMQA 1P4XA 4L9JA 1JGSA 3BP8A 5FLXK 5L3DA 5LGUA 1RIOH 4HX4A 4A6EA 1PP8F 5L3BA 5LBQA 2NNYA 1XCVA 3FF5A 5E20A 2UXXA 1SD7A 3FZVA 3ABUA 3ECOA 1DP7P 3Q9VA 2OU2A 3HSEA 1F9NA 5FFXA 4Z2YA 5D5VB 5CVIA 1B4AA 1X3UA 4A5MA 3GXOA 2IJLA 4U0WA 2XIGA 4G7OF 4CXFA 1WWXA 2VODA 4DQ2A 2PLYA 4FX4A 4ZYGA 2J5OA 1XSDA 3R4KA 3BY6A 2FE3A 3EYIA 4IPAA 3L2CA 1BOAA 1FPQA 3HRMA 3TO9A 1G3SA 4ZYHA 2AXLA 3WE2A 1KU2A 4A0YA 4GGGA 4HLYA 3BROA 4FX0A 1FX7A 5LHIA 2DT5A 2ESNA 5HDGA 5TJJA 4YFKF 4B8XA 3HTSB 2ZFWA 2ADUA 1ZN2A 1YS6A 3IWFA 3FM3A 2P4WA 1QZYA 2XHKA 1P92A 2KJCA 2R7FA 1PP7U 3KP5A 1XMAA 3JAMK 1XCBA 4OIQF 3NRVA 2HEOA 3J80Z 3K69A 2O61A 2VN2A 1QBJA 1BM9A 3GZ6A 4ZH4F 2A61A 4EM2A 3WTTC 4I0BA 2IA1A 2ZO4A 3QRFF 3E97A 1T39A 2CG4A 2JSCA 5DCMA 4XLNF 5L3GA 1ZGJA 4IRIA 4KNYA 3GVAA 4KMFA 4JK1X 2O6GE 2HYGD 2MH2A 3F72A 2EV0A 1REPC 5K5OA 2MBFA 1K78B 1U5TB 3CUOA 4HX7A 2Z33A 2MC3A 2A6EF 1Z6RA 1WQ2A 4A0ZA 1V4RA 2D1HA 4YIIA 1XDSA 5E1WA 4E70A 1E17A 3FHZA 5LEJA 4UNOA 4UUVA 4AD9A 2WV0A 2GIVA 4RGUA 2GAUA 2FBIA 2V6CA 4EMSA 3J80K 4ZZDA 2BE5F 4A6DA 4QLCU 1HW2A 3QOPA 2VBWA 2H6CA 2XAFA 4LLGF 2K4JA 1YW9A 3K1MA 4RB3C 4KDPA 2B0LA 3GX4X 4IHSA 3H92A 2DPDA 2XASA 2FNAA 1FY7A 2KIUA 2ZKZA 3WTZA 4HQMA 1RI7A 2P5VA 1MGTA 1MDMB 3LQRA 4M9SA 2ETHA 2F5CA 4ON0A 1FOKA 4HBLA 5ILSA 1IZ1A 2LNBA 4LLNA 1YW8A 1XN7A 4OMYA 3G73A 4HF2A 2FBHA 1I6XA 5FFZA 2PBIA 2KJBA 2QQAA 3U9GA 5K5RA 2MLGA 5FGMA 2Y75A 1BC8C 3JAMZ 2RN7A 4G94A 2OZUA 2D2WA 3E6DA 4Y15A 4MTDA 2OD5A 1SD6A 3QPHA 1ZYRF 3WTVC 2HWVA 3I64A 1HQCA 1UHWA 2D45A 1XSVA 3F6OA 4Q48A 5DD4A 4MEYF 3VB2A 3R0JA 4AIHA 3KP4A 4IXAA 2BEOA 3HOSA 1FYKA 2Q0OA 1MKMA 2HR3A 1YIOA 2Z99A 3DPTA 1ZG1A 2K7LA 2EFNA 4CYDA 1EH8A 2GWRA 5BS6A 3CO6C 5DD8A 2JPBA 1HKQA 4LK0F 2YU3A 2G7HA 2HOEA 3P9KA 2DTRA 1G6NA 5ICFA 2LDUA 5J6XA 4YFNF 1B1BA 1G3YA 1YQAA 4WWCA 4KFCA 1T0FA 1G3TA 4A0XA 3KLNA 3GWZA 3HSRA 5JVTA 3QU6A 4H0EA 2FOKA 2M30A 3KZYA 3QU3A 4UV9A 3GFLA 3P9CA 4EJVA 3WTUC 2AS5F 2PEXA 4A12A 2XUBA 5TRDA 4U0VA 4ESJA 2FU4A 4BH9A 3LA2A 2RQPA 1YG2A 4XLPF 3LSTA 4D0PA 2F5FA 2VE9A 3DPLC 2IPQX 2BGCA 2PI0A 2VBZA 2M5WA 1J9IA 2CO5A 3DEUA 1G4DA 2ZNYA 1J75A 4RB1A 4HDUA 3L09A 1KGSA 3T5XA 1NHAA 2M8EA 2HZTA 5JI6A 5F1RA 1UHMA 3SZTA 1SD4A 4ZYDA 5JHUA 4P9FA 2GQQA 2VBYA 2CW0F 3I53A 3FM5A 4P55A 4L0YB 3CUQC 3J81Z 2EWNA 2RC4A 1U3EM 3M9AA 2WC2A 2X0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EV0 A;  4G7H F;  1L3L A;  3C7J A;  3GZ5 A;  1G3W A;  5A2Q K;  4WXC A;  4L9N A;  1O3T A;  1OYY A;  4NHJ A;  3I0T A;  3I4P A;  4KN4 X;  3VOD A;  2DLL A;  1USS A;  1Z1D A;  2W57 A;  5LLQ A;  3SHF A;  3E6B A;  2EV5 A;  2A69 F;  4U7B A;  2RVC A;  1D5V A;  1STZ A;  5ICC A;  2KIF A;  2EFQ A;  3TDZ C;  5BPD A;  1P2F A;  3J7A O;  2BV6 A;  1O3Q A;  3I71 A;  3KEQ A;  3SZP A;  1QGP A;  2HDC A;  3RJP A;  1SFU A;  1O3S A;  5D6E A;  1W7P D;  2RDP A;  3ML6 A;  4XSX F;  1ULY A;  1ONV A;  4BXU A;  2ELH A;  4UVC A;  4BAY A;  4GYI A;  3ULQ B;  3F8B A;  3WU0 A;  3FX3 A;  3BWG A;  4IVN A;  4M9X A;  4KIG A;  1HKS A;  2FA5 A;  4U0Y A;  1HST A;  3ZQ7 A;  1XMK A;  3GEZ A;  4OIO F;  1TLH B;  4M6X A;  4P9U A;  2W24 A;  3LA7 A;  2YX7 A;  2G7U A;  1TBX A;  2UWM A;  1OKR A;  2ZNZ A;  4LB5 A;  3LWF A;  4AIJ A;  4ZZL A;  2QZ8 A;  2OAZ A;  2A3S A;  3K9T A;  2QBY A;  2NRA C;  3C1D A;  5DV5 A;  4CO8 A;  1YO5 C;  2K4B A;  3IKV A;  2PFB A;  2EK5 A;  5AIP A;  1TW2 A;  3RKY A;  5FD6 A;  3DF8 A;  1QO0 D;  2DFI A;  5LRS A;  3NQO A;  3BPV A;  3K2Z A;  3WTY C;  4HX8 A;  3F23 A;  3F8M A;  4MEX F;  1BIA A;  5D5U B;  2NS0 A;  2IA0 A;  2PJP A;  3ERE D;  2E7W A;  3R60 A;  4YFX F;  1QNT A;  2ESH A;  2F5E A;  1HW1 A;  4ESB A;  4WK8 F;  1CF7 B;  4K2E A;  4HV5 A;  2QQB A;  2M45 A;  3W6K B;  1ZRE A;  3ECH A;  3CJN A;  1BI0 A;  4I2O A;  1RNL A;  3WE3 A;  1IRF A;  4FT8 A;  4GYG A;  1IN8 A;  1B59 A;  3EQL F;  3KFW X;  3PFI A;  2ACJ A;  1IXR C;  2ISZ A;  4OIN F;  3BJ6 A;  1OPC A;  3D0S A;  1J7K A;  1EH7 A;  5HS9 A;  3DP7 A;  3GF2 A;  1R58 A;  3V7C A;  1S29 A;  4M71 A;  2L4M A;  2OA4 A;  5ED4 A;  1JXS A;  3RTR A;  2ZXJ A;  4UV8 A;  4L5J A;  6PAX A;  1U6G A;  1XB4 A;  5CVV A;  1W4M A;  4RGX A;  4EJT A;  2MLK A;  3SQN A;  3WGI A;  2FMY A;  4MNU A;  2HQR A;  3QP5 A;  1B9N A;  5DDG A;  2H94 A;  2VC0 A;  1P6R A;  1R1V A;  3P9I A;  2O0Y A;  2XAG A;  2ZBK A;  1ZH5 A;  1JHH A;  1FBU A;  3KP7 A;  2XV4 S;  2ZJ2 A;  1QQI A;  3K1P A;  4PGG A;  5E1X A;  4EM0 B;  2GZW A;  5D8L B;  3F22 A;  3ISP A;  5E8I A;  4U7D A;  5KK1 A;  2NYX A;  4HZF A;  4AWX B;  2P7C B;  2HQN A;  4MQ9 F;  3I59 B;  4L18 B;  1KA8 A;  3COA C;  1B6A A;  3RKX A;  2XGX A;  1V3F A;  3L00 A;  5CYV A;  2W25 A;  1I1G A;  1W7P B;  1Z6T A;  4HOB A;  2P5L C;  4LGW A;  1K79 A;  4LG0 B;  3Q9S A;  2NAZ A;  1LDJ A;  4G6Q A;  4L5I A;  3RDI A;  3CUQ A;  2QQ9 A;  3ZMS A;  4N9H A;  1D3Y A;  1GVJ A;  1HXD A;  4RB2 C;  2EA2 A;  5FB2 A;  1A04 A;  3W6J B;  1QZZ A;  2M87 A;  3FXR A;  1MJB A;  2RGV A;  5FD5 A;  3HTU A;  3HYI A;  5CVR A;  4PDK A;  3DKW A;  2GXG A;  1J0R A;  3GLX A;  2HGC A;  1IF1 A;  4G6D A;  5LEK A;  1Z05 A;  2DI3 A;  1AWC A;  4BQA A;  3ELK A;  1Z91 A;  1R1U A;  2A5Y B;  3CO7 C;  4YG2 F;  3MWM A;  3RIR A;  5CJ9 A;  2GA2 A;  3V8K A;  2XRN A;  2DPU A;  3VOE A;  4GCV A;  1S3J A;  2HKO A;  1XDU A;  2CYY A;  1W5T A;  2RV8 A;  2FEZ A;  2HTS A;  4N0B A;  5HOO A;  4LD5 A;  3BJO A;  2OQG A;  2F5D A;  1FP1 D;  2L3D A;  2K27 A;  4MHG A;  1S6L A;  4B09 A;  1D8K A;  5H20 A;  1U78 A;  1R36 A;  3V8J A;  1OYI A;  2R7D A;  5DUI A;  1KU7 A;  5LGT A;  2VOP A;  3TO7 A;  1SFE A;  4OIR F;  1ZLJ A;  4HF0 A;  2OZ6 A;  4QWQ A;  3IWZ A;  5A2Q Z;  2O03 A;  3IC7 A;  4XBF A;  3TDU C;  4M73 A;  2STT A;  3L7W A;  2OBP A;  3MFK A;  2GXB A;  1T6S A;  3HSF A;  2DAO A;  4RGS A;  1IRG A;  4GO1 A;  5KVR A;  3IRR A;  4ENN A;  2VOO A;  1ZRC A;  2ZME B;  1LB2 A;  4EVI A;  4HA8 A;  5LGN A;  1KQ8 A;  1FT9 A;  3DV8 A;  3ZMU A;  2DO7 A;  2FNP A;  4F7Z A;  3KP6 A;  2IA2 A;  3IRQ A;  3EUH A;  1PUE E;  4Q4Z F;  5K1Y A;  4M6Y A;  1DUX C;  3OV8 A;  1BJA A;  1KU9 A;  5BOX A;  2JT1 A;  2HTJ A;  1K78 A;  4CIC A;  2FQ3 A;  1MJ9 A;  2HYF A;  2DW4 A;  2KRF A;  2A6H F;  2A68 F;  3HRS A;  3EET A;  3V7S A;  2FML A;  5AON A;  4RAZ A;  1SD5 A;  4A5N A;  3F6V A;  3U1D A;  2Z9O A;  5LHG A;  3KE2 A;  4WXH A;  2V79 A;  4O5V A;  2TDX A;  3BOQ A;  3LAP A;  4CGZ A;  5LRR A;  3RYP A;  1GHC A;  1YW7 A;  1F5T A;  1S7A A;  5L3F A;  4EJU A;  1GXQ A;  2VT2 A;  1SMT A;  5H6Q A;  1TTY A;  1ON2 A;  4NQW A;  4LLL A;  2P6T A;  4ASN A;  1J59 A;  4G9Y A;  1R22 A;  5IT9 Z;  2W85 A;  4YIF A;  3WGH A;  2H27 A;  3GFJ A;  3LAJ A;  2XVC A;  4UVB A;  3TKY A;  1R23 A;  1O7L A;  2VC1 A;  2STW A;  5ERI A;  3GFI A;  4GXO A;  3HHH A;  1WI9 A;  1Z9C A;  4FHT A;  1LEA A;  3GUD A;  4EQQ A;  4HQE A;  3HUG A;  4S04 A;  1RUN A;  4I7H A;  2COM A;  1YYV A;  1UB9 A;  2XRO A;  3RKW A;  1ZLK A;  3F21 A;  1FSH A;  4HDV A;  5CVU A;  3G3Z A;  4KN7 X;  5IT9 K;  5BMZ A;  4LK1 F;  1I27 A;  4AIK A;  4L9V A;  5DEQ A;  2EFW A;  3DFG A;  4JBA A;  1YLF A;  3HOT A;  2RNJ A;  1ZG5 A;  1UFM A;  5D5X B;  3ABT A;  3I58 A;  3I5U A;  3M8F A;  4TV7 A;  3T0Y A;  4Q47 A;  2JZY A;  5AIQ A;  2DQR A;  3EDP A;  1BI3 A;  2JPC A;  4BYY A;  3M1E A;  3V8L A;  3WTS C;  5L3C A;  1XGM A;  4O6J A;  1FBS A;  1E2X A;  2QBY B;  3JSP A;  1RUO A;  4I98 B;  1BC7 C;  2E1C A;  2CFX A;  1EV7 A;  1T2K A;  1ZAO A;  1MD0 A;  2M1B A;  5L3E A;  1IXS B;  4R8H A;  3KP2 A;  1XGS A;  3B73 A;  3O3K A;  3WG9 A;  5DCF A;  5HLH A;  3QPT A;  2FSW A;  3RPQ A;  1XD7 A;  2XAQ A;  1CF7 A;  3I54 A;  4HLX A;  2YX4 A;  1OR7 A;  2V1U A;  1FBQ A;  2UXN A;  1QPM A;  3Q5F A;  4XSZ F;  1J2X A;  4KMU X;  2LF7 A;  4CDG A;  5JFR A;  4XRF A;  1ON1 A;  1FC3 A;  5D8K B;  2VBX A;  1KU3 A;  5CLS A;  3WU1 B;  4KYW A;  2H6B A;  4BHP A;  2IW5 A;  1TW3 A;  2YR2 A;  3JW4 A;  5HVQ C;  1LDK B;  2RKH A;  3O6B B;  4S05 A;  1K6O A;  4OU0 A;  2VXZ A;  5J8C A;  4KUM A;  3IL2 A;  3IKT A;  1DDN A;  1EH6 A;  4BHC A;  3JSO A;  3KZZ A;  4ESF A;  2PMH A;  5K5Q A;  2J5P A;  4EGY A;  3HRU A;  2IT0 A;  2BYV E;  2L02 A;  1W7P A;  2DU9 A;  1BBY A;  2L54 A;  2EJR A;  2IRF G;  2Z5U A;  1R1T A;  3E5X A;  4I01 A;  5LHH A;  1LEB A;  4PGH A;  2PG4 A;  4UVA A;  2D1V A;  4BNC A;  1FP2 A;  4OIP F;  2XKP A;  4WCG A;  3U2R A;  2CQK A;  1JE8 A;  1H0M A;  1ZHF A;  2QM3 A;  2R3S A;  4IRG A;  2QUF A;  4UHT A;  1C0W A;  3M7G A;  1CGP A;  3F8F A;  4MGR A;  2QVO A;  5F6F A;  1DPR A;  4OMZ A;  3ZMT A;  2ISY A;  2EFP A;  4LMY A;  5E18 F;  4KT5 C;  1YFH A;  3HIF A;  2O8X A;  1PDN C;  3MCZ A;  2XAH A;  3BJA A;  4EM1 A;  3BPX A;  3V7R A;  4HYE A;  3SXY A;  4P96 A;  3ZN1 A;  1S8N A;  4O3M A;  4G8X A;  3T8T A;  1TNS A;  3TOA A;  1GXP A;  1RZ4 A;  3LQQ A;  1LDD A;  1U8R A;  5BQT A;  2MD5 A;  1ZG3 A;  4I02 A;  3FXQ A;  1F4K A;  2CWE A;  2IP2 A;  3WOD F;  1ODD A;  3LA3 A;  3QAH A;  1L0O C;  3TO6 A;  5ILU A;  1IN5 A;  2V1X A;  1O57 A;  2A07 F;  2Y0M A;  1OMI A;  4M72 A;  5HDK A;  4R1H A;  3F3X A;  3HRT A;  5ICE A;  3ZP5 A;  3GO5 A;  3ZMZ A;  1ZAR A;  3N97 A;  1WKM A;  1TQI A;  2DBB A;  1KQ0 A;  3ZN0 A;  1XGO A;  1KQ9 A;  1WRJ A;  1I1S A;  1XSX A;  4HAM A;  2FF4 A;  1AOY A;  1SFX A;  1U2W A;  2JRT A;  3CTA A;  2MA3 A;  1KYW A;  5EEG A;  4RB0 A;  4LFU A;  3I59 A;  5D4R A;  2IVM A;  4M9Z A;  4HF1 A;  2VT3 A;  4L0Z B;  4AVP A;  2DK8 A;  3SFZ A;  3M8E A;  4RS8 A;  3R0A A;  5ICG A;  3MZH A;  3S2W A;  1IW7 F;  2DK5 A;  4IF4 A;  1IN6 A;  2QYO A;  3IHU A;  4HW0 A;  2QLZ A;  5ILV A;  1SMY F;  2WWY A;  1OYW A;  2WTE A;  3REO A;  4P5O A;  1ZRF A;  3E6C C;  4PCQ A;  3EYY A;  5FO5 A;  1MZB A;  3E5U A;  1O3R A;  3VEP A;  1DPU A;  1TQM A;  3J81 K;  1P4A A;  2EFO A;  2PMU A;  5J8F A;  3PQJ A;  1YS7 A;  1Q1H A;  3MQ0 A;  5D5W B;  3CUQ B;  4R79 A;  3E5Q A;  3KET A;  2CSO A;  1T38 A;  3DXJ F;  1KYZ A;  1LJ9 A;  3PQK A;  2W84 A;  4EJW A;  3RI4 A;  3O2P E;  2YPR A;  4RAY A;  2DQL A;  2PQ8 A;  1BN5 A;  1FSE A;  1H9T A;  1Y0U A;  3LFK A;  3F8N A;  3P7N A;  1FNN A;  3B02 A;  1XGN A;  2P8T A;  1S7O A;  1MDM A;  3F8C A;  3AAF A;  2ZCW A;  1BI1 A;  2EV6 A;  5JR3 A;  2PN6 A;  1U5T A;  3T8R A;  4IJA A;  1IN4 A;  3L9F A;  4G7Z F;  3OOP A;  4LB6 B;  2V1D A;  2Y48 A;  3GW2 A;  3C3W A;  4NB5 A;  3BDD A;  4A2U A;  3FXU A;  3H3U A;  1ZGA A;  4CHU A;  4EGZ A;  4WXD A;  2MH9 A;  3TOB A;  1UCR A;  3TQN A;  1SAX A;  4OOI A;  3E6M A;  4ENK A;  4I0A A;  4DNC A;  3FWE A;  1H9G A;  2BBY A;  1W5S A;  5HS8 A;  3JTG A;  2P5K A;  4CZZ A;  3R6S A;  2FBK A;  2E7X A;  2XKO A;  3CLO A;  1BI2 A;  5DUK A;  4EJO A;  4MTE A;  4BHB A;  4ETS A;  1LQ1 A;  2LSO A;  5HLG A;  5DCM B;  1FZP B;  3NEU A;  1FYL A;  2LKP A;  4WF2 A;  4Y17 A;  1HSJ A;  1FYM A;  5CVJ A;  1JHF A;  2H09 A;  1R5H A;  1P4W A;  4ENM A;  3GYH X;  3MAJ A;  3ZMD A;  3ZPL A;  1HW5 A;  4U88 A;  1T98 A;  5IT3 A;  2E1N A;  3KP3 A;  4IHT A;  1R7J A;  2KIM A;  5E1Z B;  4KIC A;  2UZK A;  3FMS A;  3KLO A;  4L9T A;  4ZYE A;  4MQV A;  4M74 A;  5H6R A;  3N4M A;  1HBX G;  3HHG A;  1IN7 A;  1Z7U A;  2Q2E A;  4LG0 A;  2VE8 A;  2C6Y A;  1UST A;  3BZ6 A;  4Y13 A;  2X4H A;  1MJA A;  3CDH A;  4IRH A;  4Q5S F;  2QEN A;  2G9W A;  2HFH A;  1LVA A;  2VON A;  3ROU A;  4WX9 A;  1B9M A;  1FWZ A;  5F64 A;  1IAW A;  3WTX C;  1J5Y A;  5HLI A;  5D6F A;  1IXC A;  3RPU A;  3WGG A;  2P6S A;  1BIB A;  2V9V A;  1ZRD A;  2LF8 A;  2L01 A;  3JTH A;  2ZME A;  5E17 F;  2FXA A;  4N9I A;  4HV6 A;  4JQF A;  4RGR A;  2YSR A;  3V4G A;  1FLI A;  3TGN A;  1R5G A;  4KIF A;  5HDN A;  1VTN C;  1WSU A;  3QP6 A;  1TNT A;  4LJZ F;  1U5T C;  2NNN A;  5EEH A;  1TQP A;  3KEO A;  1HKT A;  3KCC A;  1O7F A;  4ENJ A;  2F2E A;  1I5Z A;  1D8J A;  1IUY A;  2L4A A;  3FMR A;  4UXN A;  3K1N A;  3MZY A;  3E3V A;  4KA4 A;  2EA4 A;  5D4S A;  2KKO A;  2QWW A;  2CGP A;  3MEX A;  5BPI A;  3K0L A;  3VFZ A;  1K7A A;  2FRH A;  5E8G A;  3H3Z A;  3T1B A;  1YTY A;  1LNW A;  3DQV C;  3WTW C;  3C18 A;  2GA1 A;  1R00 A;  2K02 A;  5DYM A;  2Z3Y A;  3R61 A;  2P7V B;  5FLX Z;  2XAJ A;  2HKX A;  4KIB A;  3ZMV A;  2K86 A;  4PZJ A;  2JTV A;  2OQR A;  2HS5 A;  1F1Z A;  2Q8K A;  3GFM A;  2EB7 A;  4I09 A;  2O3F A;  3D5L A;  5HS7 A;  3RYR A;  3FMQ A;  1P4X A;  4L9J A;  1JGS A;  3BP8 A;  5FLX K;  5L3D A;  5LGU A;  1RIO H;  4HX4 A;  4A6E A;  1PP8 F;  5L3B A;  5LBQ A;  2NNY A;  1XCV A;  3FF5 A;  5E20 A;  2UXX A;  1SD7 A;  3FZV A;  3ABU A;  3ECO A;  1DP7 P;  3Q9V A;  2OU2 A;  3HSE A;  1F9N A;  5FFX A;  4Z2Y A;  5D5V B;  5CVI A;  1B4A A;  1X3U A;  4A5M A;  3GXO A;  2IJL A;  4U0W A;  2XIG A;  4G7O F;  4CXF A;  1WWX A;  2VOD A;  4DQ2 A;  2PLY A;  4FX4 A;  4ZYG A;  2J5O A;  1XSD A;  3R4K A;  3BY6 A;  2FE3 A;  3EYI A;  4IPA A;  3L2C A;  1BOA A;  1FPQ A;  3HRM A;  3TO9 A;  1G3S A;  4ZYH A;  2AXL A;  3WE2 A;  1KU2 A;  4A0Y A;  4GGG A;  4HLY A;  3BRO A;  4FX0 A;  1FX7 A;  5LHI A;  2DT5 A;  2ESN A;  5HDG A;  5TJJ A;  4YFK F;  4B8X A;  3HTS B;  2ZFW A;  2ADU A;  1ZN2 A;  1YS6 A;  3IWF A;  3FM3 A;  2P4W A;  1QZY A;  2XHK A;  1P92 A;  2KJC A;  2R7F A;  1PP7 U;  3KP5 A;  1XMA A;  3JAM K;  1XCB A;  4OIQ F;  3NRV A;  2HEO A;  3J80 Z;  3K69 A;  2O61 A;  2VN2 A;  1QBJ A;  1BM9 A;  3GZ6 A;  4ZH4 F;  2A61 A;  4EM2 A;  3WTT C;  4I0B A;  2IA1 A;  2ZO4 A;  3QRF F;  3E97 A;  1T39 A;  2CG4 A;  2JSC A;  5DCM A;  4XLN F;  5L3G A;  1ZGJ A;  4IRI A;  4KNY A;  3GVA A;  4KMF A;  4JK1 X;  2O6G E;  2HYG D;  2MH2 A;  3F72 A;  2EV0 A;  1REP C;  5K5O A;  2MBF A;  1K78 B;  1U5T B;  3CUO A;  4HX7 A;  2Z33 A;  2MC3 A;  2A6E F;  1Z6R A;  1WQ2 A;  4A0Z A;  1V4R A;  2D1H A;  4YII A;  1XDS A;  5E1W A;  4E70 A;  1E17 A;  3FHZ A;  5LEJ A;  4UNO A;  4UUV A;  4AD9 A;  2WV0 A;  2GIV A;  4RGU A;  2GAU A;  2FBI A;  2V6C A;  4EMS A;  3J80 K;  4ZZD A;  2BE5 F;  4A6D A;  4QLC U;  1HW2 A;  3QOP A;  2VBW A;  2H6C A;  2XAF A;  4LLG F;  2K4J A;  1YW9 A;  3K1M A;  4RB3 C;  4KDP A;  2B0L A;  3GX4 X;  4IHS A;  3H92 A;  2DPD A;  2XAS A;  2FNA A;  1FY7 A;  2KIU A;  2ZKZ A;  3WTZ A;  4HQM A;  1RI7 A;  2P5V A;  1MGT A;  1MDM B;  3LQR A;  4M9S A;  2ETH A;  2F5C A;  4ON0 A;  1FOK A;  4HBL A;  5ILS A;  1IZ1 A;  2LNB A;  4LLN A;  1YW8 A;  1XN7 A;  4OMY A;  3G73 A;  4HF2 A;  2FBH A;  1I6X A;  5FFZ A;  2PBI A;  2KJB A;  2QQA A;  3U9G A;  5K5R A;  2MLG A;  5FGM A;  2Y75 A;  1BC8 C;  3JAM Z;  2RN7 A;  4G94 A;  2OZU A;  2D2W A;  3E6D A;  4Y15 A;  4MTD A;  2OD5 A;  1SD6 A;  3QPH A;  1ZYR F;  3WTV C;  2HWV A;  3I64 A;  1HQC A;  1UHW A;  2D45 A;  1XSV A;  3F6O A;  4Q48 A;  5DD4 A;  4MEY F;  3VB2 A;  3R0J A;  4AIH A;  3KP4 A;  4IXA A;  2BEO A;  3HOS A;  1FYK A;  2Q0O A;  1MKM A;  2HR3 A;  1YIO A;  2Z99 A;  3DPT A;  1ZG1 A;  2K7L A;  2EFN A;  4CYD A;  1EH8 A;  2GWR A;  5BS6 A;  3CO6 C;  5DD8 A;  2JPB A;  1HKQ A;  4LK0 F;  2YU3 A;  2G7H A;  2HOE A;  3P9K A;  2DTR A;  1G6N A;  5ICF A;  2LDU A;  5J6X A;  4YFN F;  1B1B A;  1G3Y A;  1YQA A;  4WWC A;  4KFC A;  1T0F A;  1G3T A;  4A0X A;  3KLN A;  3GWZ A;  3HSR A;  5JVT A;  3QU6 A;  4H0E A;  2FOK A;  2M30 A;  3KZY A;  3QU3 A;  4UV9 A;  3GFL A;  3P9C A;  4EJV A;  3WTU C;  2AS5 F;  2PEX A;  4A12 A;  2XUB A;  5TRD A;  4U0V A;  4ESJ A;  2FU4 A;  4BH9 A;  3LA2 A;  2RQP A;  1YG2 A;  4XLP F;  3LST A;  4D0P A;  2F5F A;  2VE9 A;  3DPL C;  2IPQ X;  2BGC A;  2PI0 A;  2VBZ A;  2M5W A;  1J9I A;  2CO5 A;  3DEU A;  1G4D A;  2ZNY A;  1J75 A;  4RB1 A;  4HDU A;  3L09 A;  1KGS A;  3T5X A;  1NHA A;  2M8E A;  2HZT A;  5JI6 A;  5F1R A;  1UHM A;  3SZT A;  1SD4 A;  4ZYD A;  5JHU A;  4P9F A;  2GQQ A;  2VBY A;  2CW0 F;  3I53 A;  3FM5 A;  4P55 A;  4L0Y B;  3CUQ C;  3J81 Z;  2EWN A;  2RC4 A;  1U3E M;  3M9A A;  2WC2 A;  2X0L A; 
#chains in the Genus database with same CATH topology
 1Y39 A;  2LD5 A;  4EV0 A;  2HZD A;  5E79 C;  4F3Q A;  3SEQ A;  3VPR A;  4G7H F;  4BEH B;  1R5I D;  1L3L A;  3C7J A;  3GZ5 A;  1G3W A;  3L1P A;  5A2Q K;  3OR1 C;  4WXC A;  2H8W A;  4L9N A;  1O3T A;  1OYY A;  4MFE A;  4NHJ A;  3GTO J;  3MKZ A;  3I0T A;  3I4P A;  4MFD A;  4KN4 X;  4A3D J;  3VOD A;  2DLL A;  1USS A;  1Z1D A;  2W57 A;  3JRB A;  2OUM A;  5LLQ A;  3SHF A;  1MMN A;  3E6B A;  2NVX J;  2R7Q A;  2EV5 A;  2A69 F;  2Q1Z B;  3MKY B;  4W1U A;  1HDP A;  2PMZ A;  3A4C A;  3CF5 F;  2XAU A;  2OPT A;  4U7B A;  3BQZ A;  3GZN B;  4E7L A;  2GM4 A;  3JRG A;  4FAS D;  1I39 A;  2RVC A;  3H5A A;  3OL4 A;  1D5V A;  1STZ A;  2KDO A;  5GPA A;  4JX6 A;  5ICC A;  2KIF A;  1ETK A;  2EFQ A;  3TDZ C;  4IKF A;  2OTJ I;  5BPD A;  3W2A A;  1P2F A;  3J7A O;  2ECB A;  4CCJ A;  3JCU C;  2BV6 A;  1I3A A;  1O3Q A;  5F1J A;  3I71 A;  1D0X A;  3KEQ A;  3SZP A;  1MMS A;  1QGP A;  2HDC A;  1A31 A;  3RJP A;  3MKL A;  2FOW A;  1VND A;  1SFU A;  1O3S A;  5D6E A;  2VPL A;  3LSP A;  2E2H J;  3A01 B;  1E3P A;  1RET A;  2IAI A;  1Y0N A;  1W7P D;  2RDP A;  3ML6 A;  1WJE A;  2ECC A;  4AYB N;  4XSX F;  1ULY A;  1WFX A;  4E7K A;  2UV1 A;  1ONV A;  4BXU A;  2ELH A;  4UVC A;  2JMW A;  4BAY A;  3FXM A;  5IYB J;  4GYI A;  2HPM A;  2VQC A;  3ULQ B;  3F8B A;  3WU0 A;  3FX3 A;  3BWG A;  4IVN A;  4M9X A;  5FKN A;  4KIG A;  3ZGK A;  1HKS A;  3HG9 A;  2FA5 A;  4U0Y A;  1HST A;  4E6K G;  4HNV A;  3ZQ7 A;  1XMK A;  3GEZ A;  3JRH A;  4OIO F;  3H35 A;  2R7R A;  1S5L C;  1QU3 A;  1TLH B;  3DLA A;  4M6X A;  4P9U A;  2W24 A;  3LA7 A;  2K9M A;  2G7U A;  1TBX A;  2YX7 A;  1V54 H;  2UWM A;  1Y6I A;  1OKR A;  2ZNZ A;  4LB5 A;  3OY9 A;  2QSG X;  3LWF A;  4AIJ A;  4ZZL A;  2QZ8 A;  2OAZ A;  2FUG 2;  2HVQ A;  2LBF A;  2A3S A;  4DGW B;  1LPQ A;  3K9T A;  2QBY A;  3OMY A;  3HPG A;  3C1D A;  2NRA C;  5DV5 A;  4CO8 A;  3CMY A;  2NVU B;  1MBK A;  1WJ5 A;  1YO5 C;  2K4B A;  1VQ5 I;  4BBR J;  2QCO A;  4ANJ A;  2O5R A;  3IKV A;  2PFB A;  2EK5 A;  5AIP A;  1TW2 A;  3RKY A;  5FD6 A;  3DF8 A;  1QO0 D;  2DFI A;  5LRS A;  3NQO A;  3BPV A;  3K2Z A;  3WTY C;  4HX8 A;  3F23 A;  3K4L A;  5GTH C;  3F8M A;  4MEX F;  1BIA A;  5D5U B;  1AKH B;  2IGM A;  3AL0 B;  1ENH A;  2NS0 A;  2IA0 A;  2PJP A;  3ERE D;  1OFC X;  5EYR A;  2DT6 A;  2E7W A;  2R5Z A;  3R60 A;  1H89 C;  4YFX F;  2QQ8 A;  2JN6 A;  1QNT A;  2ESH A;  3LSI A;  2F5E A;  1HW1 A;  4ESB A;  2L9N A;  4WK8 F;  1KZH A;  1CF7 B;  4K2E A;  4HV5 A;  4D7M A;  2QQB A;  1FIA A;  2WB1 N;  3I9V 2;  3OYN A;  4ZDP A;  2HI3 A;  3E7L A;  2M45 A;  3W6K B;  5E3L A;  1ZRE A;  1A6I A;  3ECH A;  3NAU A;  4XR6 A;  2F48 A;  3CJN A;  1BI0 A;  2IGO A;  4I2O A;  2WV1 A;  2VB6 A;  1RNL A;  2GIZ A;  2KDZ A;  1W5C C;  3LNQ A;  2K9N A;  3CLQ A;  1ZGW A;  3WHB A;  4F55 A;  3WE3 A;  1DQU A;  1IRF A;  4FT8 A;  2YUS A;  2E1M B;  2DA1 A;  4GYG A;  2BY1 A;  3GME A;  1IN8 A;  1B59 A;  3OYB A;  1I3Q J;  3EQL F;  3KFW X;  5C4X J;  5EG0 B;  1JUP A;  3PFI A;  5HNF A;  4BU2 A;  2XDV A;  1K4T A;  2ACJ A;  1IXR C;  2BVL A;  4OIN F;  2VJ4 A;  2ISZ A;  2YU9 J;  1N78 A;  3CC7 I;  3BJ6 A;  1FIP A;  1OPC A;  1IUF A;  3D0S A;  3RCO A;  1J7K A;  3OR2 C;  3IAS 2;  2PX9 A;  2Y31 A;  1TT0 A;  1EH7 A;  2DA5 A;  5HS9 A;  3DP7 A;  2OV7 A;  3GF2 A;  3FXK A;  1R58 A;  3V7C A;  5KAF C;  1ITY A;  3L2Q A;  2KQR A;  1S29 A;  4DZJ A;  4HSR A;  4M71 A;  2L4M A;  3RPU D;  2OA4 A;  5ED4 A;  3OIO A;  1JXS A;  1ZR4 A;  3RTR A;  2ZXJ A;  3DEE A;  1FJL A;  1ETW A;  2CMP A;  4DOZ A;  4UUS B;  2CW8 A;  4UV8 A;  4PFO A;  2DMT A;  4L5J A;  3BZK A;  3CJT B;  3HB9 A;  6PAX A;  1X2M A;  2W1O A;  2B7E A;  1U6G A;  1XB4 A;  5CVV A;  1VI0 A;  1W4M A;  4RGX A;  4RDU A;  2O9L A;  2MLK A;  4EJT A;  3SQN A;  2DFF A;  2DYS H;  1VQN I;  3WGI A;  4A93 J;  2KT0 A;  2FMY A;  4MNU A;  1B72 B;  2HVR A;  1VF9 A;  2NXN B;  2HQR A;  9ANT A;  1TT5 B;  3QP5 A;  1B9N A;  5DDG A;  2H94 A;  4XKB A;  2VC0 A;  1Y1V J;  1P6R A;  2CQN A;  1R1V A;  3P9I A;  2O0Y A;  4XON A;  3HOY J;  4B44 A;  1MIJ A;  2XAG A;  4PJN A;  2ZBK A;  4NUB A;  3BR1 A;  4BUP A;  2UUZ A;  1ZH5 A;  3S1M J;  1JHH A;  1FBU A;  3C2H A;  1QVU A;  1Y56 A;  2XV4 S;  2ZJ2 A;  1QQI A;  3KP7 A;  3K1P A;  4PGG A;  3MN2 A;  4IHY A;  3TMO A;  5E1X A;  4EM0 B;  4L5E A;  2W4S A;  3WG7 H;  2GZW A;  5E3M A;  2H1L A;  3JRI A;  5D8L B;  3F22 A;  3ISP A;  2E2I J;  5E8I A;  4U7D A;  1RKW A;  5KK1 A;  2NYX A;  4HZF A;  2HU9 A;  4AWX B;  2P7C B;  2HQN A;  1BA5 A;  4MQ9 F;  3I59 B;  4LIT A;  2X1E A;  4L18 B;  1KA8 A;  2OJE D;  3COA C;  4XKC A;  2XSD C;  2X6O A;  2FQ4 A;  2V1N A;  3FKJ A;  1T0F C;  1B6A A;  3RKX A;  2XGX A;  1T33 A;  1V3F A;  2EZH A;  1BOB A;  2KIS A;  3L00 A;  5CYV A;  2W25 A;  1RR8 C;  2DYR H;  1I1G A;  2ZXI A;  1W7P B;  2XGD A;  3PFY A;  3DWL E;  1Z6T A;  4HOB A;  2P5L C;  4LGW A;  1K79 A;  2QSF X;  3ZQQ A;  4LG0 B;  1X1C A;  5IOY A;  1K6Y A;  3Q9S A;  2NAZ A;  3ESW B;  1LDJ A;  4G6Q A;  4L5I A;  2EIK H;  3RDI A;  2TCT A;  3CUQ A;  2QQ9 A;  4JP0 A;  3ZMS A;  1UG0 A;  1WJA A;  4N9H A;  1D3Y A;  4EEF G;  3BR2 A;  1GVJ A;  2KFD A;  1HXD A;  4RB2 C;  1D1A A;  1S7E A;  2EA2 A;  4MO7 A;  5FB2 A;  1A04 A;  4A3C J;  3W6J B;  1QZZ A;  4V2F A;  2M87 A;  3FXR A;  3ABM H;  4X6A J;  4YEJ A;  2ZSH B;  1MJB A;  4II2 A;  2RGV A;  4XOT A;  1ETX A;  2WY7 Q;  5FD5 A;  3HTU A;  1LFB A;  4B3X A;  1X4P A;  4B43 A;  1IG7 A;  3BTC A;  3HYI A;  5CVR A;  4A3B J;  4PDK A;  2X1C A;  1MBH A;  3M07 A;  3DKW A;  2GXG A;  1J0R A;  1R9T J;  3GLX A;  3FK7 A;  2HGC A;  1IF1 A;  3CJQ B;  4G6D A;  5LEK A;  2COB A;  1Z05 A;  5IYD J;  3C2G A;  3DLL F;  2DI3 A;  4YRV A;  1AWC A;  4BQA A;  2IS6 A;  3ELK A;  5IP7 J;  2HOT A;  1QA6 A;  5DM6 F;  2O8K A;  1G8X A;  1Z91 A;  3A2K A;  3BR3 A;  1R1U A;  5E3N A;  2A5Y B;  3CO7 C;  4YG2 F;  1SAN A;  4AUX A;  3KZI C;  3MWM A;  3RIR A;  1NTC A;  4XMY A;  5CJ9 A;  1SVL A;  2GA2 A;  3V8K A;  4GRI A;  2XRN A;  2DPU A;  4FE4 A;  3VOE A;  4GCV A;  1S3J A;  1WJC A;  2AHQ A;  2DA3 A;  2HKO A;  1XDU A;  3H0D A;  2CYY A;  3OS0 A;  1W5T A;  2CUZ A;  2RV8 A;  1WH7 A;  4M3B A;  2FEZ A;  2VQH A;  4B1R A;  2BY2 A;  4XRS G;  2HTS A;  3PM1 A;  4N0B A;  3SEZ A;  3BCA A;  5HOO A;  2HDD A;  4LD5 A;  3BJO A;  3PUF A;  1LVK A;  5KCM A;  2OQG A;  2F5D A;  1FP1 D;  2L3D A;  3M8J A;  2K27 A;  1YHQ I;  4MHG A;  4GFB A;  1S6L A;  4GDF A;  2EH3 A;  4B09 A;  1D8K A;  1IRZ A;  5H20 A;  5FKO A;  3IUO A;  1U78 A;  1IO2 A;  1P7J A;  3O8H A;  1R36 A;  2HPI A;  3V8J A;  1OYI A;  2R7D A;  5DUI A;  1KU7 A;  5LGT A;  5DM7 F;  3Q3S A;  2VOP A;  2G0E A;  1EA3 A;  3CDL A;  3TO7 A;  1SFE A;  1WJD A;  4OIR F;  5FRO A;  4ZDO A;  1ZLJ A;  3AG1 H;  2OZ6 A;  4HF0 A;  4QWQ A;  3IWZ A;  3CC2 I;  5A2Q Z;  2QKL B;  2O03 A;  4OAZ A;  3J7Y J;  1YJN I;  2FJ1 A;  5CQG A;  4DZP A;  3S16 J;  3IC7 A;  4XLA A;  4F92 B;  4XBF A;  4BDZ A;  1MSF C;  3TDU C;  3ZR8 X;  4XN3 A;  4M73 A;  2XSJ C;  3GBG A;  2STT A;  3L7W A;  2OBP A;  3MFK A;  2GXB A;  1T6S A;  2KZV A;  3HSF A;  2DAO A;  4RGS A;  4XLE A;  3LSH A;  3BCB A;  2HVS A;  1IRG A;  4BDY A;  1U0J A;  4GO1 A;  5KVR A;  2L7F P;  3IRR A;  3W6V A;  2CRG A;  3ZCO A;  1K83 J;  1JTX A;  4RMN A;  4ENN A;  5DS9 A;  3RQI A;  4JX4 A;  3HUG B;  2VOO A;  1ZRC A;  4XKV A;  5M3F J;  1YX3 A;  1Z21 A;  2ZME B;  1J09 A;  3I3L A;  1LB2 A;  4EVI A;  2CV1 A;  4HA8 A;  3PIP F;  3GTQ J;  2LLK A;  4IZZ A;  5LGN A;  5JLW A;  1TZL A;  4QSH A;  1KQ8 A;  1FT9 A;  3DV8 A;  3K4J A;  3ZMU A;  2DO7 A;  1ETQ A;  4CYC B;  2DMP A;  2L9R A;  3N05 A;  2FNP A;  2NVT J;  1A35 A;  4F7Z A;  3I56 I;  4E7H A;  3KP6 A;  2IA2 A;  5B1A H;  5GPC A;  3ABL H;  2E19 A;  3OOU A;  3IRQ A;  3HC7 A;  2M2E A;  2RQQ A;  1IV6 A;  4XNF A;  3EUH A;  5M3M J;  1PUE E;  4C2M J;  4Q4Z F;  3IV5 A;  3OYL A;  5K1Y A;  3DCF A;  4M6Y A;  2CJJ A;  3FXO A;  1DUX C;  3OV8 A;  1BJA A;  3OYM A;  1KU9 A;  5BOX A;  2JT1 A;  4F52 A;  2HTJ A;  1JUM A;  1DGW Y;  1K78 A;  2KIQ A;  4CIC A;  2FQ3 A;  2VJI A;  4CCO A;  1MJ9 A;  2HYF A;  2DW4 A;  2KRF A;  2A6H F;  2A68 F;  3HRS A;  2R7Z J;  3EET A;  3V7S A;  5JVG F;  3BLY A;  2DOD A;  2HXI A;  3VSK A;  2FML A;  5AON A;  4RAZ A;  1YRN B;  5FRM A;  2A6T A;  3JRC A;  1SD5 A;  4A5N A;  3F6V A;  3U1D A;  1DU6 A;  2Z9O A;  1VQ4 I;  5LHG A;  2CQ7 A;  3O8G A;  3KE2 A;  2K40 A;  4WXH A;  2LKX A;  3ZQG A;  2V79 A;  4O5V A;  4XOP A;  4QTR A;  2TDX A;  2QF7 A;  2L2O A;  3BOQ A;  3LAP A;  1X1D A;  5LRR A;  4CGZ A;  3S2D J;  1YRN A;  1X1P A;  3RYP A;  1GHC A;  1YW7 A;  5TGT A;  1F5T A;  2RRE A;  1S7A A;  5GTI C;  5L3F A;  4EJU A;  1GXQ A;  2LKS A;  2VT2 A;  1JI8 A;  1SMT A;  4EAT A;  2JRM A;  1HOM A;  5H6Q A;  1TTY A;  1ON2 A;  4NQW A;  4LLL A;  4BQQ A;  2V4J C;  4A3G J;  3NAR A;  3S93 A;  2CUJ A;  2P6T A;  4NC7 A;  2E36 A;  3FBI B;  4ASN A;  4XL9 A;  1J59 A;  4G9Y A;  3GLL A;  4C30 A;  3DPU A;  1R22 A;  3OYJ A;  2VLA A;  1JJ8 C;  5IT9 Z;  5FRN A;  2W85 A;  4A3M J;  2Z16 A;  4YIF A;  2LFB A;  4CCN A;  3HJE A;  3WGH A;  2H27 A;  3GFJ A;  3CP2 A;  3BQY A;  2XVC A;  4UVB A;  3TKY A;  3LAJ A;  1TL8 A;  1R23 A;  1O7L A;  2VC1 A;  2DJN A;  2HXO A;  2K9L A;  5ERI A;  4C9Y A;  2STW A;  4GXO A;  3HHH A;  3GFI A;  1WI9 A;  2HDW A;  3K2A A;  2M3A A;  1VQ9 I;  1Z9C A;  4FHT A;  1Y1W J;  1LEA A;  3GUD A;  4EQQ A;  5IP6 A;  1FMW A;  3HUG A;  4S04 A;  4HQE A;  1RUN A;  4I7H A;  2COM A;  1YYV A;  2R7S A;  1WI3 A;  1UB9 A;  2F4O B;  2XRO A;  2JA6 J;  1IRX A;  4DYC A;  3G71 I;  3RKW A;  1ZLK A;  2OC6 A;  1RPW A;  4UY8 I;  2HOS A;  3F21 A;  1FSH A;  2BY0 A;  5CVU A;  2EIL H;  4HDV A;  3G3Z A;  4KN7 X;  2Y9Y A;  1WH5 A;  5IT9 K;  5BMZ A;  4LK1 F;  1I27 A;  3RSN A;  4FE7 A;  3DTK A;  1GUU A;  4AIK A;  4L9V A;  5DEQ A;  2EFW A;  2L7M P;  3DFG A;  4JBA A;  1YLF A;  3K4M A;  3HOT A;  2RNJ A;  1ZG5 A;  2X1D A;  1UFM A;  1F36 A;  5D5X B;  3ABT A;  1GV5 A;  3I58 A;  4UUS A;  3I5U A;  3HKZ A;  1D5Y A;  3M8F A;  2LRE A;  4TV7 A;  3BG7 A;  1X3W B;  3MD2 A;  3UNG C;  3T0Y A;  4Q47 A;  1JTY A;  2MG4 A;  4NQW B;  2JZY A;  1YJW I;  5AIQ A;  2DQR A;  3EDP A;  4S0H B;  1BI3 A;  4A3K J;  2JPC A;  1QVT A;  4BYY A;  3M1E A;  3V8L A;  3OWT A;  3WTS C;  5L3C A;  1XGM A;  4O6J A;  3W2W A;  1FBS A;  1E2X A;  1BR1 A;  2QBY B;  3JSP A;  1RUO A;  2IBD A;  4UB6 C;  5EG0 A;  4I98 B;  1BC7 C;  5H2F C;  2E1C A;  2CFX A;  1EV7 A;  1Z0X A;  1T2K A;  1R6R A;  1V55 H;  1ZAO A;  3ZQC A;  1MD0 A;  2WAQ A;  1D1C A;  5GAG J;  2M1B A;  5L3E A;  1JKQ C;  4D5F A;  1IXS B;  4R8H A;  2X6W A;  1TWF J;  3KP2 A;  3FXJ A;  1XGS A;  3VSL A;  3B73 A;  3CD6 I;  3O3K A;  4C2T A;  1BR4 A;  3WG9 A;  5DCF A;  3K70 D;  5HLH A;  2DT7 B;  3B6A A;  3QPT A;  4YIR X;  2FSW A;  3RPQ A;  3AG2 H;  3L2V A;  1XD7 A;  2XAQ A;  1CF7 A;  2JVH A;  2R0Q C;  3I54 A;  4HLX A;  2YX4 A;  1OR7 A;  5J4V A;  3ABK H;  1E3O C;  2DOF A;  2R5Z B;  2V1U A;  5F04 A;  1JJ6 C;  1FBQ A;  2UXN A;  1QPM A;  3Q5F A;  4XSZ F;  1J2X A;  2VKV A;  4KMU X;  4E7S A;  4KIT B;  2LF7 A;  4CDG A;  2DA2 A;  4BEH A;  5JFR A;  2N8G A;  4XRF A;  2JA5 J;  3G1O A;  1ON1 A;  1FC3 A;  5D8K B;  2VBX A;  3I55 I;  4RM2 A;  1KU3 A;  3PNV A;  1JT0 A;  5FLV A;  1NG7 A;  4PSW A;  1FEX A;  5CLS A;  2XF7 A;  4UB8 C;  3QOD A;  3BG9 A;  2XPU A;  3HDD A;  2ID3 A;  3WU1 B;  4KYW A;  4PJJ A;  2H6B A;  4BHP A;  2IW5 A;  1TW3 A;  1OCZ H;  2DTZ A;  5GAH J;  2YR2 A;  3JW4 A;  5HVQ C;  4M3D A;  4BS9 A;  1SVO A;  1LDK B;  2RKH A;  2LBF B;  3O6B B;  3SDB A;  1UEL B;  4D1Q A;  4S05 A;  3D1N I;  1K6O A;  4OU0 A;  2VXZ A;  2VQL A;  4D7N A;  4RM3 A;  2V9K A;  4RA2 A;  5J8C A;  5EZG A;  4BL0 B;  4KUM A;  2NVY J;  3IL2 A;  3LSK A;  3IKT A;  1DDN A;  1BW6 A;  1EH6 A;  4BHC A;  3JSO A;  2MD0 A;  3KZZ A;  4ESF A;  2P81 A;  1NG6 A;  2PMH A;  4U87 A;  5K5Q A;  2J5P A;  4HST A;  1VQL I;  5IOZ A;  4EGY A;  3HRU A;  3DTI A;  3U1K A;  2IT0 A;  2WBM A;  2BYV E;  2L02 A;  1W7P A;  2ZSI B;  2DU9 A;  1BBY A;  2L54 A;  2EJR A;  2IRF G;  1XPX A;  2Z5U A;  1W0T A;  2ZME C;  3EPZ A;  1EJ9 A;  1E3H A;  1R1T A;  3PNY A;  3E5X A;  4I01 A;  2LR8 A;  5LHH A;  2CH0 A;  3M1C A;  1LEB A;  5J40 A;  3CES A;  4RAF A;  4PGH A;  2PG4 A;  5GP9 A;  4UVA A;  2D1V A;  4BNC A;  1FP2 A;  4V2G A;  2Y0S A;  4OIP F;  2XKP A;  4WCG A;  4CCM A;  4AYB A;  4HNU A;  5CQE A;  3U2R A;  3CCS I;  2CQK A;  3CP8 A;  1JE8 A;  1H0M A;  1ZHF A;  2EPF A;  1W0U A;  2QM3 A;  2TRT A;  4XLF A;  3VYS B;  2R3S A;  4E7Z A;  3TBI A;  4IRG A;  3BC8 A;  2QUF A;  4UHT A;  1C0W A;  3M7G A;  5K7Z A;  3RKQ A;  3QYE A;  1CGP A;  5KAI C;  2ZC2 A;  2ZXW H;  3F8F A;  5J1Y A;  3S3O A;  3SZG A;  4MGR A;  3JRD A;  2QVO A;  5F6F A;  1Q1V A;  4BQN A;  1SC7 A;  3AKZ A;  4Y3O A;  1DPR A;  4OMZ A;  4UUT A;  2LY9 A;  3EUH C;  3KYD B;  3ZMT A;  2ISY A;  4BJ5 C;  4A3J J;  3OSF A;  2EFP A;  3CCR I;  2VAS A;  4LMY A;  4DYR A;  5E18 F;  4KT5 C;  1FOY A;  2ZB9 A;  2LC2 A;  3JRA A;  3H5R A;  3HIF A;  1YFH A;  3S2H J;  2EZL A;  2O8X A;  3MCZ A;  1PDN C;  2XAH A;  1PVE A;  3S14 J;  3BJA A;  2KMU A;  4EM1 A;  4M3E A;  3BPX A;  3V7R A;  4HYE A;  4IHX A;  2MSY A;  3SXY A;  2L7Z A;  4XM3 A;  4P96 A;  3ZN1 A;  1S8N A;  1R71 A;  4O3M A;  2BW3 B;  2HNH A;  2A5W A;  1EF4 A;  4G8X A;  5C44 J;  2GXA A;  3OL3 A;  2W82 A;  2HOA A;  3E0J B;  3T8T A;  3GTM J;  3CCU I;  1TNS A;  3TOA A;  1GXP A;  2KL4 A;  1RZ4 A;  2QGU A;  3LQQ A;  1LDD A;  1U8R A;  1DP3 A;  3G2B A;  5BQT A;  3Q0U A;  2MD5 A;  3BTJ A;  2BW3 A;  1ETV A;  1ZG3 A;  2IEK A;  1Z67 A;  4I02 A;  3FXQ A;  3WHC A;  1F4K A;  1XMX A;  1ETO A;  2CWE A;  2E35 A;  2IP2 A;  3WOD F;  1I6H J;  1ODD A;  1RR7 A;  2YS9 A;  3LA3 A;  1NH3 A;  5EGO B;  4ZC3 A;  2L0K A;  4Y52 J;  3QAH A;  3J7A Y;  1L0O C;  3K4B A;  4IQJ A;  3TO6 A;  3AG3 H;  3H9G A;  1X2N A;  4BXX J;  5ILU A;  1IN5 A;  2V1X A;  1O57 A;  2A07 F;  2GOM A;  2Y0M A;  1OMI A;  4M72 A;  5HDK A;  4R1H A;  2KRH A;  3HRT A;  1SAU A;  3F3X A;  4B3A A;  5ICE A;  3ZP5 A;  2XPW A;  2VXD A;  3GO5 A;  2LYC A;  3ZMZ A;  1ZAR A;  3N97 A;  2NOJ B;  1TC3 C;  1WKM A;  4RBO A;  4ZYA A;  1TQI A;  3TW6 A;  2DBB A;  1D1B A;  1KQ0 A;  3QQA A;  3ZN0 A;  1XGO A;  1KQ9 A;  1WRJ A;  5K7F A;  1I1S A;  1XSX A;  1N77 A;  4HAM A;  3CMM A;  2FF4 A;  1AOY A;  1SFX A;  1U2W A;  2K9S A;  2JRT A;  1VQK I;  3CTA A;  3HZJ A;  1GVD A;  2MA3 A;  4IEJ A;  2Y30 A;  1KYW A;  2XRL A;  5KNL A;  1ZKG A;  3CMA I;  2Z2S B;  2AQE A;  5EEG A;  4RB0 A;  2QA4 I;  4LFU A;  3I59 A;  5D4R A;  4XN0 A;  3BTI A;  2IVM A;  4XID A;  4M9Z A;  4HF1 A;  2VT3 A;  4L0Z B;  4AVP A;  2DK8 A;  2LVS A;  3SFZ A;  3M8E A;  4RS8 A;  3R0A A;  5ICG A;  4BY7 J;  3MZH A;  3S2W A;  1IW7 F;  1W1W E;  2DK5 A;  4IF4 A;  4BE2 A;  1IN6 A;  2QYO A;  1VZ0 A;  3IHU A;  4HW0 A;  4IX7 A;  2QLZ A;  3V42 A;  5ILV A;  1SMY F;  2WWY A;  3VDX A;  1MBG A;  3S1Q J;  4Y4R A;  1OYW A;  2XF5 A;  2WTE A;  3REO A;  4P5O A;  1ZRF A;  1YX5 A;  3E6C C;  4PCQ A;  1B8I A;  3EYY A;  1GT0 C;  1OIS A;  5FO5 A;  1MZB A;  4CZC A;  4IO9 F;  3E5U A;  1O3R A;  3IAM 2;  3VEP A;  3C2B A;  3BZC A;  1DPU A;  1AHD P;  1TQM A;  3HGY A;  3J81 K;  1P4A A;  3WU2 C;  4PJ0 C;  2EFO A;  2PMU A;  5J8F A;  2F5V A;  3PQJ A;  1R49 A;  1YS7 A;  3VWB A;  1Q1H A;  4N4O B;  5LFA A;  2M8G X;  3MQ0 A;  4RLQ A;  5D5W B;  4FTH A;  3CUQ B;  4R79 A;  3E5Q A;  1QHH D;  2CSO A;  2NS7 A;  3H9Q A;  3KET A;  1T38 A;  4Z6Y A;  3LMM A;  3DXJ F;  1KYZ A;  1LJ9 A;  3PQK A;  3AL0 C;  2W84 A;  2IS1 A;  4EJW A;  3CCV I;  3RI4 A;  3MKW B;  1Z3Y A;  3OYD A;  3O2P E;  2YPR A;  1VQ6 I;  4RAY A;  2DQL A;  4C3J J;  2PQ8 A;  1BN5 A;  1FSE A;  2IGK A;  1H9T A;  3ZQL A;  1Y0U A;  3LFK A;  2CFO A;  4PJL A;  1MMA A;  3F8N A;  3P7N A;  3GTJ J;  1FNN A;  3CCM I;  4XLH A;  3HPH A;  3B02 A;  4QIW N;  1XGN A;  1GV2 A;  3TW7 A;  2X6Y A;  2P8T A;  1S7O A;  1MDM A;  2LTP A;  4OAY A;  2MW8 A;  3NWS A;  4A69 C;  1JKO C;  4YEL A;  3CC4 I;  3BG6 A;  3F8C A;  2ZJP F;  5IYC J;  3AAF A;  2ZCW A;  1BI1 A;  1D0Z A;  2EV6 A;  2EIM H;  3I4N J;  5JR3 A;  5FKM A;  5GAD J;  2PN6 A;  1F43 A;  1U5T A;  2KLO A;  1Z7L A;  4CSW A;  3T8R A;  4IJA A;  2DFH A;  1IN4 A;  1YIJ I;  2E1M C;  3L9F A;  3QYB A;  1MBJ A;  1U9O A;  2NVQ J;  4G7Z F;  3KYC B;  3OOP A;  4LB6 B;  2VKD A;  2WAE A;  2V1D A;  3OSG A;  4ITV A;  3MVP A;  2QKM B;  2Y48 A;  3GW2 A;  3C3W A;  4NB5 A;  3BDD A;  4A2U A;  1YI2 I;  3D5R C;  3PNT A;  1HC8 A;  2DMN A;  3FXU A;  4FET A;  5DTD A;  1LFP A;  1AKH A;  3H3U A;  1ZGA A;  4CHU A;  3DKY A;  5CKT A;  4WXD A;  3HOX J;  4EGZ A;  2MH9 A;  3TOB A;  2DXI A;  3IH2 A;  4H4K C;  2VL8 A;  1UCR A;  3ASN H;  3TQN A;  3A01 A;  2E2J J;  4MLO A;  1SAX A;  4OOI A;  1G2H A;  3E6M A;  1TWC J;  3VYR B;  2VJ5 A;  4ENK A;  4I0A A;  4D9J A;  4DNC A;  1WGX A;  2M7B A;  1P7I A;  3FWE A;  3KYL A;  3CCL I;  1WZ2 A;  4OWR B;  2L9V A;  1SVM A;  3HL2 A;  1H9G A;  2BBY A;  1VQM I;  5EF6 A;  4I6Z A;  3PJR A;  1W5S A;  2M34 A;  5HS8 A;  3J7Z I;  1X1B A;  4XRM A;  3JTG A;  4NDL A;  2WB1 A;  1HDD C;  2LY1 A;  2P5K A;  3OYI A;  3KIO A;  2MAB A;  3R6S A;  4CZZ A;  3HOU J;  2FBK A;  3VYT B;  1MW7 A;  2E7X A;  2XKO A;  3CLO A;  1PYV A;  3G6E I;  3KEY A;  1BI2 A;  5DUK A;  3M4O J;  4EJO A;  4MTE A;  4BHB A;  4DW6 A;  2H8R A;  3S15 J;  4ETS A;  1LQ1 A;  4XOR A;  2LSO A;  1LE8 A;  1SFO J;  5HLG A;  5DCM B;  4AM3 A;  2WY8 Q;  1FZP B;  3NEU A;  4LIU A;  1TP4 A;  1FYL A;  2LKP A;  4WF2 A;  4Y17 A;  3QPL A;  2D5V A;  2ME0 A;  1HSJ A;  3M3Y J;  4BQO A;  4QPQ A;  2R7V A;  3H9J A;  1H8A C;  1FYM A;  3GCM A;  5CVJ A;  1JHF A;  2H09 A;  1YIT I;  1R5H A;  1P4W A;  3DBL B;  2R7W A;  4ENM A;  5GAE J;  3BR6 A;  1YOV B;  3GYH X;  3MAJ A;  5JLX A;  1A5J A;  1AA7 A;  1GLN A;  3ZMD A;  4PK4 A;  3LSJ A;  1UG2 A;  3ZPL A;  2R7X A;  1YJ9 I;  2I5U A;  1HW5 A;  4U88 A;  4BE0 A;  1T98 A;  5IT3 A;  1RRJ A;  2E1N A;  3KP3 A;  4IHT A;  1R7J A;  2KIM A;  5E1Z B;  4KIC A;  2UZK A;  3FMS A;  4BE1 A;  3KLO A;  4L9T A;  3JR9 A;  1W36 C;  4ZYE A;  1TWH J;  2IGN A;  4MQV A;  3K10 A;  4FIS A;  2GOX B;  4M74 A;  3ZXS A;  2Y69 H;  3K7A J;  5H6R A;  4NNJ A;  3N4M A;  1UZC A;  1HBX G;  3HHG A;  1IN7 A;  1Z7U A;  1VQP I;  2Q2E A;  4J00 A;  4LG0 A;  2KPM A;  2VE8 A;  2IS4 A;  5EGO A;  4CA0 A;  2DOE A;  3G4S I;  3PSF A;  1T8I A;  2E5Z A;  2F4I A;  1B72 A;  2I8D A;  2C6Y A;  1UST A;  3SYT A;  3HOW J;  3BZ6 A;  2JUG A;  4Y7N J;  2EBI A;  4Y13 A;  2GLO A;  2X4H A;  3L2U A;  5HLT A;  1MJA A;  5KHD A;  3CDH A;  4IRH A;  4ABZ A;  4KIS A;  1U8B A;  2AO9 A;  2W48 A;  4Q5S F;  2QEN A;  2G9W A;  4I99 C;  2HFH A;  2W00 A;  2BXZ A;  1LVA A;  2DMU A;  3TP3 A;  2AXT C;  3ROU A;  4A3I J;  2VON A;  4WX9 A;  1U9N A;  1B9M A;  1FWZ A;  3HBL A;  1WCM J;  5F64 A;  1IAW A;  3HOV J;  2E34 A;  2RAE A;  1WJB A;  4A3L J;  1POG A;  3PL8 A;  3WTX C;  4PUS A;  1OQY A;  1J5Y A;  2DN0 A;  1MSE C;  3CDI A;  5D6F A;  1X3Z B;  5HLI A;  4KJZ A;  1GDT A;  1IXC A;  1FMV A;  3RPU A;  1Y8Q B;  3F0C A;  1S72 I;  3GTP J;  3WGG A;  4JOM A;  2LRD A;  4XRS A;  3EUA A;  3NWT A;  1ETY A;  2P6S A;  1JUS A;  3A1Y A;  1BIB A;  2X51 A;  2V9V A;  1ZRD A;  4NC6 A;  3BTL A;  2LF8 A;  1HA8 A;  3HOZ J;  2L01 A;  3JTH A;  5J4Y A;  2ZME A;  1WJF A;  5E17 F;  2FXA A;  3IP4 B;  2JQ7 A;  2XB0 X;  4N9I A;  2ZJQ F;  2VPR A;  3HGG A;  1W36 D;  4HV6 A;  1MNE A;  3CCQ I;  2M4K A;  4FCY A;  4JQF A;  4RGR A;  3LSM A;  2YSR A;  1VFC A;  2Z1D A;  3LL7 A;  2JSP A;  3V4G A;  3KPH A;  3ZRG A;  1QPI A;  2B9S A;  1T08 B;  1FLI A;  3TGN A;  2R7U A;  2VIX A;  3GTK J;  1R5G A;  4KIF A;  5J1R A;  5HDN A;  2JWT A;  1VTN C;  3DU5 A;  1WSU A;  3QP6 A;  1TNT A;  2WAQ N;  4LJZ F;  2OTL I;  1R4M B;  3OYH A;  1U5T C;  1HCR A;  2NNN A;  1WHU A;  3VYU B;  3ZQI A;  2E60 A;  5EEH A;  1TQP A;  2R5Y B;  3KEO A;  1V5F A;  4PJM A;  1HKT A;  3KCC A;  2R92 J;  1MNM C;  1O7F A;  1BW5 A;  3SDG A;  3OS2 A;  5B5E C;  4ENJ A;  3DTE A;  4Y33 A;  3BT9 A;  1PUF A;  2F2E A;  1R4N B;  1I5Z A;  1D8J A;  1IUY A;  2L4A A;  3FMR A;  4UXN A;  5E3O A;  2M7A A;  2B63 J;  3K1N A;  3MZY A;  4ZDL A;  3E3V A;  4KA4 A;  2EA4 A;  5D4S A;  2JJ7 A;  2KKO A;  2QWW A;  3FXL A;  2CGP A;  3MEX A;  4XKW A;  4BKX A;  5BPI A;  2F6C A;  4C3I J;  3CCY A;  5J1U A;  3K0L A;  3VFZ A;  1K7A A;  5FJ8 J;  2FRH A;  5E8G A;  3H3Z A;  3HKZ N;  3T1B A;  1LNW A;  2E1O A;  2RNG A;  1YTY A;  3G1M A;  3DU6 A;  3DQV C;  3WTW C;  3C18 A;  2GA1 A;  1R00 A;  2K02 A;  4I76 A;  5DYM A;  2Z3Y A;  3UR3 C;  3CQZ J;  2CUE A;  5EZH A;  3PIO F;  3QYF A;  1SFK A;  4D5C A;  3R61 A;  2P7V B;  1FOW A;  3H1C A;  5FLX Z;  2XAJ A;  2HKX A;  3DBR B;  4KIB A;  3A03 A;  5CPR B;  3ZMV A;  4XK4 A;  3ZOB A;  1B8I B;  3LOC A;  2K86 A;  3H3V K;  4PZJ A;  3UKG A;  1PUF B;  2LH9 A;  3AFH A;  2JTV A;  3DKX A;  3LFU A;  4DBR A;  5EJC A;  2OQR A;  4XLC A;  2HS5 A;  1F1Z A;  3RZD J;  2Q8K A;  3GFM A;  2EB7 A;  1XC5 A;  2DA6 A;  4I09 A;  2DDB A;  4IHV A;  3IH3 A;  4CCK A;  2O3F A;  3OIP A;  2R7O A;  3D5L A;  3CZ6 A;  5HS7 A;  3RYR A;  2PJR B;  3FMQ A;  5J3L A;  1P4X A;  2HYJ A;  1JGS A;  3BP8 A;  4L9J A;  1LUJ B;  5L3D A;  5FLM J;  5FLX K;  2VKH A;  5LGU A;  1ZEL A;  1RIO H;  1X58 A;  3S3M A;  3P5J A;  4HX4 A;  4A6E A;  1PP8 F;  5LD2 C;  4CH7 A;  2JA8 J;  5L3B A;  5LBQ A;  2NNY A;  1XCV A;  3FF5 A;  3HXL A;  3H0G J;  1JKR C;  2CV2 A;  5E20 A;  2UXX A;  2LY2 A;  5C4J J;  1SD7 A;  3JRE A;  2OCE A;  3FZV A;  3OYG A;  3K4K A;  2LP0 A;  3ABU A;  3ECO A;  1DP7 P;  3I4M J;  3Q9V A;  1V5E A;  2K3P A;  2K5C A;  2OU2 A;  2CQX A;  2FX0 A;  3HSE A;  2KZG A;  1UAA A;  1F9N A;  5FFX A;  4Z2Y A;  5D5V B;  5CVI A;  3FKI J;  1ZQ3 P;  2JA7 J;  1B4A A;  2BHY A;  1X3U A;  2ZXH A;  1XS9 A;  3PO2 J;  4A5M A;  3GXO A;  1IDY A;  2ICW G;  2IJL A;  4U0W A;  2XIG A;  4G7O F;  1DU0 A;  4CXF A;  1A6Q A;  1MMD A;  2R5Y A;  1WWX A;  2VOD A;  4DQ2 A;  3H36 A;  2MC4 A;  2PLY A;  4FX4 A;  4ZYG A;  2J5O A;  1XSD A;  3R4K A;  3BY6 A;  1TWA J;  2FE3 A;  1FTT A;  1IC8 A;  1X1A A;  4HG2 A;  2L7K A;  5FKL A;  4LOC A;  5B66 C;  1MBE A;  1Y8R B;  3EYI A;  1RES A;  4IPA A;  2R4G A;  3D5S C;  4BJT A;  3L2C A;  1BOA A;  1FPQ A;  3HRM A;  3TO9 A;  1G3S A;  3B6C A;  3FIS A;  4G6T B;  4ZYH A;  2AXL A;  3WE2 A;  1P9Q C;  4NC8 A;  1KU2 A;  4A0Y A;  4GGG A;  3MMY B;  2LOO A;  2OCC H;  4HLY A;  1OCO H;  4JX5 A;  3U21 A;  3W2V A;  3BG5 A;  3BRO A;  2FD5 A;  1NK2 P;  1LKX A;  3RQ4 A;  4FX0 A;  1FX7 A;  2V9P A;  5LHI A;  1IJW C;  2ELJ A;  2MFZ A;  2DT5 A;  3S1R J;  2ESN A;  5HDG A;  5TJJ A;  4YFK F;  1AU7 A;  4B8X A;  3HTS B;  2ZFW A;  2ADU A;  3FIW A;  2M0C A;  3S8P A;  3EUK L;  3H5N A;  3CF2 A;  3TED A;  1ZN2 A;  1YS6 A;  3IWF A;  3FM3 A;  3W3C A;  3BG3 A;  2P4W A;  1QZY A;  2XHK A;  3HM5 A;  1BR2 A;  2X48 A;  1P92 A;  5F0H A;  4LIV A;  2KJC A;  2R7F A;  1PP7 U;  3KP5 A;  1XMA A;  4NBQ A;  4DIQ A;  3JAM K;  1XCB A;  4OIQ F;  2ZFU A;  3NRV A;  2M9H A;  2HEO A;  3J80 Z;  1BJZ A;  3K69 A;  2O61 A;  1I50 J;  1S9H A;  2JA2 A;  2VN2 A;  1QBJ A;  1BM9 A;  3QOE A;  3GZ6 A;  4G12 A;  3HEF A;  1ZTR A;  2WA0 A;  4ZH4 F;  2A61 A;  4EM2 A;  5HNH A;  4I0B A;  3WTT C;  2XGE A;  2IA1 A;  2ZO4 A;  3F9K A;  3QRF F;  3QWL A;  3E97 A;  2DCE A;  1T39 A;  2CG4 A;  2JSC A;  2KHM A;  5DCM A;  4CUG A;  2WAF A;  5K7H A;  2DFE A;  4XLN F;  5L3G A;  1ZGJ A;  4IRI A;  4KNY A;  2R93 J;  2QSH X;  2HQA A;  3BR5 A;  4W97 A;  3GVA A;  4KMF A;  4JK1 X;  3OYK A;  2O6G E;  2HYG D;  4X1E A;  2IS2 A;  2MH2 A;  2X6X A;  3LSR A;  4MIM A;  3Q0W A;  5EEA A;  4KT6 A;  2Y0S N;  3F72 A;  3ASO H;  2EV0 A;  1REP C;  5K5O A;  1XG1 A;  2MBF A;  2V6E A;  1K78 B;  1U5T B;  3SFI A;  3K4N A;  3GTG J;  5HOD A;  2CS3 A;  2ME6 A;  2CW7 A;  1N75 A;  2M0M A;  3CCE I;  1G59 A;  2GBY A;  3CUO A;  4HEA 2;  4HX7 A;  2XB5 A;  5M5X J;  2Z33 A;  4IOA F;  4ZTF A;  2MC3 A;  1QZE A;  2A6E F;  1K4S A;  4E7I A;  1Z6R A;  1WQ2 A;  4A0Z A;  4HRI A;  4P1W A;  1V4R A;  2D1H A;  4XQF A;  4YII A;  1OCT C;  1XDS A;  3S3N A;  1V5G A;  5E1W A;  1FTZ A;  5B3S H;  4E70 A;  2V26 A;  2QEX I;  1E17 A;  1A36 A;  3FHZ A;  5LEJ A;  4UNO A;  4UUV A;  1VQ7 I;  2DMQ A;  3L2W A;  4AD9 A;  5TIS C;  3GTL J;  3S17 J;  4CYC A;  2WV0 A;  3G1L A;  1SEU A;  2GIV A;  2BVM A;  2BHZ A;  4QPO A;  4RGU A;  2GAU A;  2FBI A;  2V6C A;  5F0C A;  4EMS A;  3OYA A;  3J80 K;  3E1S A;  4ZZD A;  2BE5 F;  4A6D A;  1NK3 P;  4QLC U;  3S1N J;  1OCP A;  1ZR2 A;  2JUC A;  2KRC A;  1OCC H;  1HW2 A;  3QOP A;  3FBN B;  2O7O A;  2VBW A;  4M3G A;  4V19 K;  2LG4 A;  2H6C A;  2P0W A;  2XAF A;  3PSI A;  2M4G A;  4IQ4 A;  4LLG F;  2K4J A;  4BBS J;  4C2U A;  1YW9 A;  3K1M A;  3ONQ A;  4RB3 C;  4KDP A;  1UJ8 A;  1MBF A;  2ELK A;  2XGC A;  1TWG J;  2B0L A;  3GX4 X;  4IHS A;  3H92 A;  4RLF A;  5C3E J;  1KON A;  4BXF A;  4IOC F;  2DPD A;  3K4C A;  1RKT A;  2FNA A;  2XAS A;  1JKP C;  1FY7 A;  2KIU A;  2ZKZ A;  3BR0 A;  4A3F J;  3WTZ A;  3K70 C;  4HQM A;  1RI7 A;  2NS8 A;  2XF6 A;  4LG3 A;  2P5V A;  4DBQ A;  2LMD A;  1MGT A;  4BAC A;  3OS1 A;  3OYE A;  3LQR A;  4M9S A;  1MDM B;  4AID A;  4C3H J;  2H1K A;  2ETH A;  2F5C A;  2CQQ A;  4B47 A;  4HNT A;  4AC0 A;  5F08 A;  4ON0 A;  1FOK A;  4HBL A;  1IGN A;  2VUM J;  2X85 A;  5ILS A;  2R7T A;  3DEW A;  3PUB A;  1IZ1 A;  2LNB A;  3DBH B;  2DA7 A;  4M6V A;  5B1B H;  3ZQF A;  1FOX A;  4LLN A;  1YW8 A;  5M5W J;  1LFU P;  1XN7 A;  1Z3X A;  2JVG A;  3FHN A;  4OMY A;  1UHS A;  1K61 A;  3K6G A;  1EKE A;  1MH4 A;  3G73 A;  4J19 A;  4HF2 A;  2FBH A;  2HQ5 A;  1I6X A;  3LSG A;  1ZK8 A;  2L9S A;  2PBI A;  2BOL A;  5FFZ A;  2KJB A;  2QQA A;  3U9G A;  5K5R A;  4ZJZ A;  1OR7 C;  5IP9 J;  2CU7 A;  2MLG A;  3OYF A;  5FGM A;  2Y75 A;  2DDA A;  1BC8 C;  3JAM Z;  2RN7 A;  1IDZ A;  4G94 A;  1CQT A;  2OZU A;  1DGR M;  2D2W A;  1JGG A;  2PMZ N;  1OCR H;  1MND A;  4IHW A;  3TP0 A;  1ACI A;  3E6D A;  2K9Q A;  1ERD A;  1XX5 A;  3KX2 A;  4M3F A;  2Q2E B;  4Y15 A;  4B4C A;  4MTD A;  2OD5 A;  1HF0 A;  1SD6 A;  3QPH A;  1ZYR F;  2MGQ A;  4B48 A;  2I10 A;  2EZK A;  3WTV C;  2A05 A;  2EIN H;  2HWV A;  4DYQ A;  2K85 A;  4A3E J;  2PJR A;  2Y9Z A;  4DJA A;  1QHG A;  3I64 A;  1HQC A;  1Z77 A;  1UHW A;  4E4H A;  2D45 A;  1X4O A;  1XSV A;  3F6O A;  4N4N B;  4Q48 A;  5DD4 A;  4MEY F;  3VB2 A;  3R0J A;  4AIH A;  3KP4 A;  3PO3 J;  4IXA A;  1JT6 A;  1PJR A;  2BEO A;  1UMQ A;  4F93 B;  1XTA A;  3RZO J;  2XPV A;  1IV8 A;  1X19 A;  3HOS A;  1FYK A;  2Q0O A;  3Q0V A;  5F27 A;  2MYS A;  1MKM A;  4JYK A;  1E0E A;  2HR3 A;  1YIO A;  2Z99 A;  3DPT A;  1ZG1 A;  1O4X A;  2K7L A;  2EFN A;  4CYD A;  3MZ8 A;  1EH8 A;  2GWR A;  5BS6 A;  1OLT A;  1N25 A;  4AU7 A;  2EZI A;  4AVZ A;  3CO6 C;  3A02 A;  5DD8 A;  2E71 A;  2JPB A;  1HKQ A;  1MH3 A;  4LK0 F;  2YU3 A;  2G7H A;  2HOE A;  4J01 A;  3P9K A;  2DTR A;  1G6N A;  5ICF A;  2LDU A;  5J6X A;  4YFN F;  2KP6 A;  1B1B A;  4E7J A;  1G3Y A;  1ORK A;  2JK3 A;  1YQA A;  1H88 C;  4WWC A;  4KFC A;  2X9D A;  4HPQ A;  2BY3 A;  3TL4 X;  2ZJR F;  1T0F A;  4ZTJ A;  2VQG A;  3FDY A;  2NOG A;  1WPK A;  1G3T A;  4PSX A;  4A0X A;  3CJR B;  3KLN A;  2VI6 A;  2AQF A;  2EIJ H;  2VJJ A;  2XC7 A;  3GWZ A;  3HSR A;  5JVT A;  3QU6 A;  4H0E A;  2FOK A;  2M30 A;  4X0G A;  3KZY A;  3QU3 A;  4UV9 A;  3GFL A;  3P9C A;  2VKE A;  4EJV A;  3WTU C;  5M5Y J;  2AS5 F;  1HLV A;  4IL6 C;  2PEX A;  3AG4 H;  2OF7 A;  4A12 A;  2XUB A;  4RAG A;  3X2Q H;  5TRD A;  4U0V A;  4ESJ A;  2FU4 A;  4BH9 A;  5J47 A;  3LA2 A;  4PFP A;  1BL0 A;  2RQP A;  2L5Q A;  1YG2 A;  4XLP F;  3LST A;  2F4M B;  4D0P A;  2F5F A;  5F0F A;  3IH4 A;  2VE9 A;  3OIQ A;  3DPL C;  5EDN A;  1D0Y A;  2IPQ X;  2V7F A;  2BGC A;  4F91 B;  3CCJ I;  2PI0 A;  1T95 A;  2VBZ A;  2M5W A;  3SJM A;  1J9I A;  2CO5 A;  3DEU A;  2CV0 A;  1G4D A;  2ZNY A;  4CCL A;  1T56 A;  1J75 A;  4RB1 A;  2DOA A;  2K3F A;  3ZQH A;  1VQ8 I;  2EQR A;  1MMG A;  4HDU A;  3L09 A;  1KGS A;  3QPS A;  3A0H C;  3OYC A;  3T5X A;  3FK6 A;  1NHA A;  2WAD A;  4FQG A;  2DA4 A;  4XIC A;  2M8E A;  2HZT A;  1LE8 B;  4BJ6 C;  5JI6 A;  1OJL A;  4BY1 J;  3L2R A;  5F1R A;  1UHM A;  3SZT A;  1SD4 A;  1YE9 A;  3JRF A;  5FKK A;  4ZYD A;  2W7N A;  5JHU A;  3ERM A;  4II3 A;  2Y2Z A;  4P9F A;  2GQQ A;  1M1E B;  2VBY A;  2E5N A;  2DJI A;  5JHF A;  1VQO I;  1APL C;  1WVR A;  2CW0 F;  3I53 A;  3S32 A;  3A0B C;  2LK2 A;  2BXY A;  2CUF A;  3CME I;  3FM5 A;  4P55 A;  4L0Y B;  2ID6 A;  3CUQ C;  5BNG A;  3J81 Z;  2EWN A;  5IPA A;  2RC4 A;  1RC9 A;  1U3E M;  1QRY A;  4BGD A;  3M9A A;  2IXS A;  2WC2 A;  2X0L A;  2BZT A;  5IY5 H; 
#chains in the Genus database with same CATH homology
 4EV0 A;  4G7H F;  1L3L A;  3C7J A;  3GZ5 A;  1G3W A;  5A2Q K;  4WXC A;  4L9N A;  1O3T A;  1OYY A;  4NHJ A;  3I0T A;  3I4P A;  4KN4 X;  3VOD A;  2DLL A;  1USS A;  1Z1D A;  2W57 A;  5LLQ A;  3SHF A;  3E6B A;  2EV5 A;  2A69 F;  4U7B A;  2RVC A;  1D5V A;  1STZ A;  5ICC A;  2KIF A;  2EFQ A;  3TDZ C;  5BPD A;  1P2F A;  3J7A O;  2BV6 A;  1O3Q A;  3I71 A;  3KEQ A;  3SZP A;  1QGP A;  2HDC A;  3RJP A;  1SFU A;  1O3S A;  5D6E A;  1W7P D;  2RDP A;  3ML6 A;  4XSX F;  1ULY A;  1ONV A;  4BXU A;  2ELH A;  4UVC A;  4BAY A;  4GYI A;  3ULQ B;  3F8B A;  3WU0 A;  3FX3 A;  3BWG A;  4IVN A;  4M9X A;  4KIG A;  1HKS A;  2FA5 A;  4U0Y A;  1HST A;  3ZQ7 A;  1XMK A;  3GEZ A;  4OIO F;  1TLH B;  4M6X A;  4P9U A;  2W24 A;  3LA7 A;  2YX7 A;  2G7U A;  1TBX A;  2UWM A;  1OKR A;  2ZNZ A;  4LB5 A;  3LWF A;  4AIJ A;  4ZZL A;  2QZ8 A;  2OAZ A;  2A3S A;  3K9T A;  2QBY A;  2NRA C;  3C1D A;  5DV5 A;  4CO8 A;  1YO5 C;  2K4B A;  3IKV A;  2PFB A;  2EK5 A;  5AIP A;  1TW2 A;  3RKY A;  5FD6 A;  3DF8 A;  1QO0 D;  2DFI A;  5LRS A;  3NQO A;  3BPV A;  3K2Z A;  3WTY C;  4HX8 A;  3F23 A;  3F8M A;  4MEX F;  1BIA A;  5D5U B;  2NS0 A;  2IA0 A;  2PJP A;  3ERE D;  2E7W A;  3R60 A;  4YFX F;  1QNT A;  2ESH A;  2F5E A;  1HW1 A;  4ESB A;  4WK8 F;  1CF7 B;  4K2E A;  4HV5 A;  2QQB A;  2M45 A;  3W6K B;  1ZRE A;  3ECH A;  3CJN A;  1BI0 A;  4I2O A;  1RNL A;  3WE3 A;  1IRF A;  4FT8 A;  4GYG A;  1IN8 A;  1B59 A;  3EQL F;  3KFW X;  3PFI A;  2ACJ A;  1IXR C;  2ISZ A;  4OIN F;  3BJ6 A;  1OPC A;  3D0S A;  1J7K A;  1EH7 A;  5HS9 A;  3DP7 A;  3GF2 A;  1R58 A;  3V7C A;  1S29 A;  4M71 A;  2L4M A;  2OA4 A;  5ED4 A;  1JXS A;  3RTR A;  2ZXJ A;  4UV8 A;  4L5J A;  6PAX A;  1U6G A;  1XB4 A;  5CVV A;  1W4M A;  4RGX A;  4EJT A;  2MLK A;  3SQN A;  3WGI A;  2FMY A;  4MNU A;  2HQR A;  3QP5 A;  1B9N A;  5DDG A;  2H94 A;  2VC0 A;  1P6R A;  1R1V A;  3P9I A;  2O0Y A;  2XAG A;  2ZBK A;  1ZH5 A;  1JHH A;  1FBU A;  3KP7 A;  2XV4 S;  2ZJ2 A;  1QQI A;  3K1P A;  4PGG A;  5E1X A;  4EM0 B;  2GZW A;  5D8L B;  3F22 A;  3ISP A;  5E8I A;  4U7D A;  5KK1 A;  2NYX A;  4HZF A;  4AWX B;  2P7C B;  2HQN A;  4MQ9 F;  3I59 B;  4L18 B;  1KA8 A;  3COA C;  1B6A A;  3RKX A;  2XGX A;  1V3F A;  3L00 A;  5CYV A;  2W25 A;  1I1G A;  1W7P B;  1Z6T A;  4HOB A;  2P5L C;  4LGW A;  1K79 A;  4LG0 B;  3Q9S A;  2NAZ A;  1LDJ A;  4G6Q A;  4L5I A;  3RDI A;  3CUQ A;  2QQ9 A;  3ZMS A;  4N9H A;  1D3Y A;  1GVJ A;  1HXD A;  4RB2 C;  2EA2 A;  5FB2 A;  1A04 A;  3W6J B;  1QZZ A;  2M87 A;  3FXR A;  1MJB A;  2RGV A;  5FD5 A;  3HTU A;  3HYI A;  5CVR A;  4PDK A;  3DKW A;  2GXG A;  1J0R A;  3GLX A;  2HGC A;  1IF1 A;  4G6D A;  5LEK A;  1Z05 A;  2DI3 A;  1AWC A;  4BQA A;  3ELK A;  1Z91 A;  1R1U A;  2A5Y B;  3CO7 C;  4YG2 F;  3MWM A;  3RIR A;  5CJ9 A;  2GA2 A;  3V8K A;  2XRN A;  2DPU A;  3VOE A;  4GCV A;  1S3J A;  2HKO A;  1XDU A;  2CYY A;  1W5T A;  2RV8 A;  2FEZ A;  2HTS A;  4N0B A;  5HOO A;  4LD5 A;  3BJO A;  2OQG A;  2F5D A;  1FP1 D;  2L3D A;  2K27 A;  4MHG A;  1S6L A;  4B09 A;  1D8K A;  5H20 A;  1U78 A;  1R36 A;  3V8J A;  1OYI A;  2R7D A;  5DUI A;  1KU7 A;  5LGT A;  2VOP A;  3TO7 A;  1SFE A;  4OIR F;  1ZLJ A;  4HF0 A;  2OZ6 A;  4QWQ A;  3IWZ A;  5A2Q Z;  2O03 A;  3IC7 A;  4XBF A;  3TDU C;  4M73 A;  2STT A;  3L7W A;  2OBP A;  3MFK A;  2GXB A;  1T6S A;  3HSF A;  2DAO A;  4RGS A;  1IRG A;  4GO1 A;  5KVR A;  3IRR A;  4ENN A;  2VOO A;  1ZRC A;  2ZME B;  1LB2 A;  4EVI A;  4HA8 A;  5LGN A;  1KQ8 A;  1FT9 A;  3DV8 A;  3ZMU A;  2DO7 A;  2FNP A;  4F7Z A;  3KP6 A;  2IA2 A;  3IRQ A;  3EUH A;  1PUE E;  4Q4Z F;  5K1Y A;  4M6Y A;  1DUX C;  3OV8 A;  1BJA A;  1KU9 A;  5BOX A;  2JT1 A;  2HTJ A;  1K78 A;  4CIC A;  2FQ3 A;  1MJ9 A;  2HYF A;  2DW4 A;  2KRF A;  2A6H F;  2A68 F;  3HRS A;  3EET A;  3V7S A;  2FML A;  5AON A;  4RAZ A;  1SD5 A;  4A5N A;  3F6V A;  3U1D A;  2Z9O A;  5LHG A;  3KE2 A;  4WXH A;  2V79 A;  4O5V A;  2TDX A;  3BOQ A;  3LAP A;  4CGZ A;  5LRR A;  3RYP A;  1GHC A;  1YW7 A;  1F5T A;  1S7A A;  5L3F A;  4EJU A;  1GXQ A;  2VT2 A;  1SMT A;  5H6Q A;  1TTY A;  1ON2 A;  4NQW A;  4LLL A;  2P6T A;  4ASN A;  1J59 A;  4G9Y A;  1R22 A;  5IT9 Z;  2W85 A;  4YIF A;  3WGH A;  2H27 A;  3GFJ A;  3LAJ A;  2XVC A;  4UVB A;  3TKY A;  1R23 A;  1O7L A;  2VC1 A;  2STW A;  5ERI A;  3GFI A;  4GXO A;  3HHH A;  1WI9 A;  1Z9C A;  4FHT A;  1LEA A;  3GUD A;  4EQQ A;  4HQE A;  3HUG A;  4S04 A;  1RUN A;  4I7H A;  2COM A;  1YYV A;  1UB9 A;  2XRO A;  3RKW A;  1ZLK A;  3F21 A;  1FSH A;  4HDV A;  5CVU A;  3G3Z A;  4KN7 X;  5IT9 K;  5BMZ A;  4LK1 F;  1I27 A;  4AIK A;  4L9V A;  5DEQ A;  2EFW A;  3DFG A;  4JBA A;  1YLF A;  3HOT A;  2RNJ A;  1ZG5 A;  1UFM A;  5D5X B;  3ABT A;  3I58 A;  3I5U A;  3M8F A;  4TV7 A;  3T0Y A;  4Q47 A;  2JZY A;  5AIQ A;  2DQR A;  3EDP A;  1BI3 A;  2JPC A;  4BYY A;  3M1E A;  3V8L A;  3WTS C;  5L3C A;  1XGM A;  4O6J A;  1FBS A;  1E2X A;  2QBY B;  3JSP A;  1RUO A;  4I98 B;  1BC7 C;  2E1C A;  2CFX A;  1EV7 A;  1T2K A;  1ZAO A;  1MD0 A;  2M1B A;  5L3E A;  1IXS B;  4R8H A;  3KP2 A;  1XGS A;  3B73 A;  3O3K A;  3WG9 A;  5DCF A;  5HLH A;  3QPT A;  2FSW A;  3RPQ A;  1XD7 A;  2XAQ A;  1CF7 A;  3I54 A;  4HLX A;  2YX4 A;  1OR7 A;  2V1U A;  1FBQ A;  2UXN A;  1QPM A;  3Q5F A;  4XSZ F;  1J2X A;  4KMU X;  2LF7 A;  4CDG A;  5JFR A;  4XRF A;  1ON1 A;  1FC3 A;  5D8K B;  2VBX A;  1KU3 A;  5CLS A;  3WU1 B;  4KYW A;  2H6B A;  4BHP A;  2IW5 A;  1TW3 A;  2YR2 A;  3JW4 A;  5HVQ C;  1LDK B;  2RKH A;  3O6B B;  4S05 A;  1K6O A;  4OU0 A;  2VXZ A;  5J8C A;  4KUM A;  3IL2 A;  3IKT A;  1DDN A;  1EH6 A;  4BHC A;  3JSO A;  3KZZ A;  4ESF A;  2PMH A;  5K5Q A;  2J5P A;  4EGY A;  3HRU A;  2IT0 A;  2BYV E;  2L02 A;  1W7P A;  2DU9 A;  1BBY A;  2L54 A;  2EJR A;  2IRF G;  2Z5U A;  1R1T A;  3E5X A;  4I01 A;  5LHH A;  1LEB A;  4PGH A;  2PG4 A;  4UVA A;  2D1V A;  4BNC A;  1FP2 A;  4OIP F;  2XKP A;  4WCG A;  3U2R A;  2CQK A;  1JE8 A;  1H0M A;  1ZHF A;  2QM3 A;  2R3S A;  4IRG A;  2QUF A;  4UHT A;  1C0W A;  3M7G A;  1CGP A;  3F8F A;  4MGR A;  2QVO A;  5F6F A;  1DPR A;  4OMZ A;  3ZMT A;  2ISY A;  2EFP A;  4LMY A;  5E18 F;  4KT5 C;  1YFH A;  3HIF A;  2O8X A;  1PDN C;  3MCZ A;  2XAH A;  3BJA A;  4EM1 A;  3BPX A;  3V7R A;  4HYE A;  3SXY A;  4P96 A;  3ZN1 A;  1S8N A;  4O3M A;  4G8X A;  3T8T A;  1TNS A;  3TOA A;  1GXP A;  1RZ4 A;  3LQQ A;  1LDD A;  1U8R A;  5BQT A;  2MD5 A;  1ZG3 A;  4I02 A;  3FXQ A;  1F4K A;  2CWE A;  2IP2 A;  3WOD F;  1ODD A;  3LA3 A;  3QAH A;  1L0O C;  3TO6 A;  5ILU A;  1IN5 A;  2V1X A;  1O57 A;  2A07 F;  2Y0M A;  1OMI A;  4M72 A;  5HDK A;  4R1H A;  3F3X A;  3HRT A;  5ICE A;  3ZP5 A;  3GO5 A;  3ZMZ A;  1ZAR A;  3N97 A;  1WKM A;  1TQI A;  2DBB A;  1KQ0 A;  3ZN0 A;  1XGO A;  1KQ9 A;  1WRJ A;  1I1S A;  1XSX A;  4HAM A;  2FF4 A;  1AOY A;  1SFX A;  1U2W A;  2JRT A;  3CTA A;  2MA3 A;  1KYW A;  5EEG A;  4RB0 A;  4LFU A;  3I59 A;  5D4R A;  2IVM A;  4M9Z A;  4HF1 A;  2VT3 A;  4L0Z B;  4AVP A;  2DK8 A;  3SFZ A;  3M8E A;  4RS8 A;  3R0A A;  5ICG A;  3MZH A;  3S2W A;  1IW7 F;  2DK5 A;  4IF4 A;  1IN6 A;  2QYO A;  3IHU A;  4HW0 A;  2QLZ A;  5ILV A;  1SMY F;  2WWY A;  1OYW A;  2WTE A;  3REO A;  4P5O A;  1ZRF A;  3E6C C;  4PCQ A;  3EYY A;  5FO5 A;  1MZB A;  3E5U A;  1O3R A;  3VEP A;  1DPU A;  1TQM A;  3J81 K;  1P4A A;  2EFO A;  2PMU A;  5J8F A;  3PQJ A;  1YS7 A;  1Q1H A;  3MQ0 A;  5D5W B;  3CUQ B;  4R79 A;  3E5Q A;  3KET A;  2CSO A;  1T38 A;  3DXJ F;  1KYZ A;  1LJ9 A;  3PQK A;  2W84 A;  4EJW A;  3RI4 A;  3O2P E;  2YPR A;  4RAY A;  2DQL A;  2PQ8 A;  1BN5 A;  1FSE A;  1H9T A;  1Y0U A;  3LFK A;  3F8N A;  3P7N A;  1FNN A;  3B02 A;  1XGN A;  2P8T A;  1S7O A;  1MDM A;  3F8C A;  3AAF A;  2ZCW A;  1BI1 A;  2EV6 A;  5JR3 A;  2PN6 A;  1U5T A;  3T8R A;  4IJA A;  1IN4 A;  3L9F A;  4G7Z F;  3OOP A;  4LB6 B;  2V1D A;  2Y48 A;  3GW2 A;  3C3W A;  4NB5 A;  3BDD A;  4A2U A;  3FXU A;  3H3U A;  1ZGA A;  4CHU A;  4EGZ A;  4WXD A;  2MH9 A;  3TOB A;  1UCR A;  3TQN A;  1SAX A;  4OOI A;  3E6M A;  4ENK A;  4I0A A;  4DNC A;  3FWE A;  1H9G A;  2BBY A;  1W5S A;  5HS8 A;  3JTG A;  2P5K A;  4CZZ A;  3R6S A;  2FBK A;  2E7X A;  2XKO A;  3CLO A;  1BI2 A;  5DUK A;  4EJO A;  4MTE A;  4BHB A;  4ETS A;  1LQ1 A;  2LSO A;  5HLG A;  5DCM B;  1FZP B;  3NEU A;  1FYL A;  2LKP A;  4WF2 A;  4Y17 A;  1HSJ A;  1FYM A;  5CVJ A;  1JHF A;  2H09 A;  1R5H A;  1P4W A;  4ENM A;  3GYH X;  3MAJ A;  3ZMD A;  3ZPL A;  1HW5 A;  4U88 A;  1T98 A;  5IT3 A;  2E1N A;  3KP3 A;  4IHT A;  1R7J A;  2KIM A;  5E1Z B;  4KIC A;  2UZK A;  3FMS A;  3KLO A;  4L9T A;  4ZYE A;  4MQV A;  4M74 A;  5H6R A;  3N4M A;  1HBX G;  3HHG A;  1IN7 A;  1Z7U A;  2Q2E A;  4LG0 A;  2VE8 A;  2C6Y A;  1UST A;  3BZ6 A;  4Y13 A;  2X4H A;  1MJA A;  3CDH A;  4IRH A;  4Q5S F;  2QEN A;  2G9W A;  2HFH A;  1LVA A;  2VON A;  3ROU A;  4WX9 A;  1B9M A;  1FWZ A;  5F64 A;  1IAW A;  3WTX C;  1J5Y A;  5HLI A;  5D6F A;  1IXC A;  3RPU A;  3WGG A;  2P6S A;  1BIB A;  2V9V A;  1ZRD A;  2LF8 A;  2L01 A;  3JTH A;  2ZME A;  5E17 F;  2FXA A;  4N9I A;  4HV6 A;  4JQF A;  4RGR A;  2YSR A;  3V4G A;  1FLI A;  3TGN A;  1R5G A;  4KIF A;  5HDN A;  1VTN C;  1WSU A;  3QP6 A;  1TNT A;  4LJZ F;  1U5T C;  2NNN A;  5EEH A;  1TQP A;  3KEO A;  1HKT A;  3KCC A;  1O7F A;  4ENJ A;  2F2E A;  1I5Z A;  1D8J A;  1IUY A;  2L4A A;  3FMR A;  4UXN A;  3K1N A;  3MZY A;  3E3V A;  4KA4 A;  2EA4 A;  5D4S A;  2KKO A;  2QWW A;  2CGP A;  3MEX A;  5BPI A;  3K0L A;  3VFZ A;  1K7A A;  2FRH A;  5E8G A;  3H3Z A;  3T1B A;  1YTY A;  1LNW A;  3DQV C;  3WTW C;  3C18 A;  2GA1 A;  1R00 A;  2K02 A;  5DYM A;  2Z3Y A;  3R61 A;  2P7V B;  5FLX Z;  2XAJ A;  2HKX A;  4KIB A;  3ZMV A;  2K86 A;  4PZJ A;  2JTV A;  2OQR A;  2HS5 A;  1F1Z A;  2Q8K A;  3GFM A;  2EB7 A;  4I09 A;  2O3F A;  3D5L A;  5HS7 A;  3RYR A;  3FMQ A;  1P4X A;  4L9J A;  1JGS A;  3BP8 A;  5FLX K;  5L3D A;  5LGU A;  1RIO H;  4HX4 A;  4A6E A;  1PP8 F;  5L3B A;  5LBQ A;  2NNY A;  1XCV A;  3FF5 A;  5E20 A;  2UXX A;  1SD7 A;  3FZV A;  3ABU A;  3ECO A;  1DP7 P;  3Q9V A;  2OU2 A;  3HSE A;  1F9N A;  5FFX A;  4Z2Y A;  5D5V B;  5CVI A;  1B4A A;  1X3U A;  4A5M A;  3GXO A;  2IJL A;  4U0W A;  2XIG A;  4G7O F;  4CXF A;  1WWX A;  2VOD A;  4DQ2 A;  2PLY A;  4FX4 A;  4ZYG A;  2J5O A;  1XSD A;  3R4K A;  3BY6 A;  2FE3 A;  3EYI A;  4IPA A;  3L2C A;  1BOA A;  1FPQ A;  3HRM A;  3TO9 A;  1G3S A;  4ZYH A;  2AXL A;  3WE2 A;  1KU2 A;  4A0Y A;  4GGG A;  4HLY A;  3BRO A;  4FX0 A;  1FX7 A;  5LHI A;  2DT5 A;  2ESN A;  5HDG A;  5TJJ A;  4YFK F;  4B8X A;  3HTS B;  2ZFW A;  2ADU A;  1ZN2 A;  1YS6 A;  3IWF A;  3FM3 A;  2P4W A;  1QZY A;  2XHK A;  1P92 A;  2KJC A;  2R7F A;  1PP7 U;  3KP5 A;  1XMA A;  3JAM K;  1XCB A;  4OIQ F;  3NRV A;  2HEO A;  3J80 Z;  3K69 A;  2O61 A;  2VN2 A;  1QBJ A;  1BM9 A;  3GZ6 A;  4ZH4 F;  2A61 A;  4EM2 A;  3WTT C;  4I0B A;  2IA1 A;  2ZO4 A;  3QRF F;  3E97 A;  1T39 A;  2CG4 A;  2JSC A;  5DCM A;  4XLN F;  5L3G A;  1ZGJ A;  4IRI A;  4KNY A;  3GVA A;  4KMF A;  4JK1 X;  2O6G E;  2HYG D;  2MH2 A;  3F72 A;  2EV0 A;  1REP C;  5K5O A;  2MBF A;  1K78 B;  1U5T B;  3CUO A;  4HX7 A;  2Z33 A;  2MC3 A;  2A6E F;  1Z6R A;  1WQ2 A;  4A0Z A;  1V4R A;  2D1H A;  4YII A;  1XDS A;  5E1W A;  4E70 A;  1E17 A;  3FHZ A;  5LEJ A;  4UNO A;  4UUV A;  4AD9 A;  2WV0 A;  2GIV A;  4RGU A;  2GAU A;  2FBI A;  2V6C A;  4EMS A;  3J80 K;  4ZZD A;  2BE5 F;  4A6D A;  4QLC U;  1HW2 A;  3QOP A;  2VBW A;  2H6C A;  2XAF A;  4LLG F;  2K4J A;  1YW9 A;  3K1M A;  4RB3 C;  4KDP A;  2B0L A;  3GX4 X;  4IHS A;  3H92 A;  2DPD A;  2XAS A;  2FNA A;  1FY7 A;  2KIU A;  2ZKZ A;  3WTZ A;  4HQM A;  1RI7 A;  2P5V A;  1MGT A;  1MDM B;  3LQR A;  4M9S A;  2ETH A;  2F5C A;  4ON0 A;  1FOK A;  4HBL A;  5ILS A;  1IZ1 A;  2LNB A;  4LLN A;  1YW8 A;  1XN7 A;  4OMY A;  3G73 A;  4HF2 A;  2FBH A;  1I6X A;  5FFZ A;  2PBI A;  2KJB A;  2QQA A;  3U9G A;  5K5R A;  2MLG A;  5FGM A;  2Y75 A;  1BC8 C;  3JAM Z;  2RN7 A;  4G94 A;  2OZU A;  2D2W A;  3E6D A;  4Y15 A;  4MTD A;  2OD5 A;  1SD6 A;  3QPH A;  1ZYR F;  3WTV C;  2HWV A;  3I64 A;  1HQC A;  1UHW A;  2D45 A;  1XSV A;  3F6O A;  4Q48 A;  5DD4 A;  4MEY F;  3VB2 A;  3R0J A;  4AIH A;  3KP4 A;  4IXA A;  2BEO A;  3HOS A;  1FYK A;  2Q0O A;  1MKM A;  2HR3 A;  1YIO A;  2Z99 A;  3DPT A;  1ZG1 A;  2K7L A;  2EFN A;  4CYD A;  1EH8 A;  2GWR A;  5BS6 A;  3CO6 C;  5DD8 A;  2JPB A;  1HKQ A;  4LK0 F;  2YU3 A;  2G7H A;  2HOE A;  3P9K A;  2DTR A;  1G6N A;  5ICF A;  2LDU A;  5J6X A;  4YFN F;  1B1B A;  1G3Y A;  1YQA A;  4WWC A;  4KFC A;  1T0F A;  1G3T A;  4A0X A;  3KLN A;  3GWZ A;  3HSR A;  5JVT A;  3QU6 A;  4H0E A;  2FOK A;  2M30 A;  3KZY A;  3QU3 A;  4UV9 A;  3GFL A;  3P9C A;  4EJV A;  3WTU C;  2AS5 F;  2PEX A;  4A12 A;  2XUB A;  5TRD A;  4U0V A;  4ESJ A;  2FU4 A;  4BH9 A;  3LA2 A;  2RQP A;  1YG2 A;  4XLP F;  3LST A;  4D0P A;  2F5F A;  2VE9 A;  3DPL C;  2IPQ X;  2BGC A;  2PI0 A;  2VBZ A;  2M5W A;  1J9I A;  2CO5 A;  3DEU A;  1G4D A;  2ZNY A;  1J75 A;  4RB1 A;  4HDU A;  3L09 A;  1KGS A;  3T5X A;  1NHA A;  2M8E A;  2HZT A;  5JI6 A;  5F1R A;  1UHM A;  3SZT A;  1SD4 A;  4ZYD A;  5JHU A;  4P9F A;  2GQQ A;  2VBY A;  2CW0 F;  3I53 A;  3FM5 A;  4P55 A;  4L0Y B;  3CUQ C;  3J81 Z;  2EWN A;  2RC4 A;  1U3E M;  3M9A A;  2WC2 A;  2X0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...