1CF7A

Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*TP*TP*TP*TP*CP*GP*CP*GP*CP*GP*GP*TP*TP*TP*T)-3
publication title Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02319 E2F_TDP E2F/DP family winged-helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cf7A00
1CGPA 4CICA 3E5UA 1F5TA 1HW2A 2DT5A 1WI9A 1XN7A 5E8GA 2LF7A 4U0VA 5L3DA 3C7JA 2CQKA 2X0LA 4ENJA 3MZHA 2MA3A 2COMA 3RJPA 1P6RA 2WWYA 3R4KA 4U0WA 2UWMA 3FXRA 2L3DA 3DXJF 2DFIA 2DK5A 1A04A 3JAMK 1YS6A 1R5GA 2H6CA 5FFZA 1BC7C 1FYKA 2HDCA 3GUDA 4EJWA 4OIRF 2R7FA 2GIVA 1IRGA 2FBHA 1EH7A 3L00A 1FYLA 3I5UA 2VOOA 3E6BA 1TNSA 4KA4A 4CHUA 3K9TA 1TQMA 2UXNA 2EJRA 1R36A 4UNOA 4Q5SF 2XAQA 4AD9A 4I0AA 4IHTA 5ICFA 5FLXZ 1KGSA 2PQ8A 2E1CA 5DUKA 4G6DA 2NRAC 1YW9A 2BEOA 4I09A 2PG4A 1VTNC 1U78A 3Q9SA 3MAJA 1O7FA 2F5DA 4CYDA 1V3FA 5D6FA 4KICA 3I53A 2PN6A 2FQ3A 3ROUA 2F5CA 2IJLA 2XHKA 1MJBA 3ERED 5FD6A 3KE2A 1FBUA 3JSPA 1HXDA 2CG4A 1OR7A 3F72A 4WXHA 1XD7A 2HKXA 4LLNA 5E17F 2HQNA 1USTA 3W6JB 1XCBA 1P4XA 3AAFA 2STTA 4BHPA 4M9SA 2V1XA 3GZ5A 3WTWC 2HS5A 3EETA 2FF4A 3WTSC 3TOBA 2RV8A 5HDGA 2HKOA 4LFUA 3EYYA 2K86A 2IVMA 1BIAA 2V79A 1SD7A 6PAXA 1JE8A 3K69A 1T2KA 2CO5A 1ZRDA 3R0AA 1KQ9A 2RC4A 1FBQA 4KYWA 3DQVC 4CXFA 1G3TA 3GEZA 1ZGAA 3CUQA 3F6OA 2EFPA 1GXQA 2OBPA 4LLGF 2QYOA 1Z6RA 4ZYDA 3HRTA 5LGNA 5LHGA 2EFWA 1HW1A 4ASNA 2FRHA 3KFWX 3PQJA 3R0JA 1LNWA 5JVTA 4NHJA 2XGXA 2V9VA 1ZRFA 3LQRA 2FEZA 5TRDA 1MKMA 1J9IA 1GVJA 5HDKA 3I59A 2JRTA 5LEJA 2JPBA 4MTEA 4EGYA 4RGUA 3HOTA 5L3CA 3KP5A 1YO5C 3EYIA 1QZZA 3JAMZ 2MH2A 2V1DA 4L9TA 3NEUA 1EH8A 2ZFWA 2XASA 3K1NA 4MEYF 2TDXA 1FP1D 2DPDA 3E6DA 4XBFA 3CUQC 5A2QZ 2DU9A 3OV8A 4UVCA 2DW4A 4BAYA 3CUQB 2Q2EA 1S3JA 3TOAA 2XAFA 2ETHA 3HOSA 2RNJA 4HA8A 5DCMA 4HLYA 5KK1A 3D0SA 2P7CB 4ESJA 4U88A 4TV7A 2A3SA 2EFQA 1K6OA 2NAZA 2P5LC 2UXXA 3T8RA 2DAOA 4I01A 4HZFA 4B09A 4HV5A 4IXAA 3MWMA 4UXNA 5AIQA 2VONA 2ESNA 2HZTA 3I59B 2O0YA 2PMHA 1FNNA 1K79A 1T39A 5D4SA 1HQCA 2M1BA 2QLZA 3SZPA 4CGZA 3CLOA 4BQAA 1Z05A 3MFKA 3KP2A 4EQQA 2FE3A 2KIUA 2HYGD 1S7AA 3HRMA 1YG2A 3WTVC 2GA1A 1QQIA 3FM3A 2HTSA 4YG2F 5DCMB 2KIFA 2LKPA 3QP5A 3K2ZA 4OINF 1BN5A 2R7DA 3RKWA 4WK8F 2EB7A 2P8TA 3GFLA 3TGNA 4JBAA 3F8NA 1G6NA 4P9UA 3V7SA 5HS9A 1Z7UA 3V8LA 2VE9A 2IA2A 2VT3A 4BHCA 5CJ9A 1IXSB 2L4MA 3MZYA 3HYIA 3E3VA 4O5VA 3WTYC 1ZRCA 3EQLF 1KU3A 5CYVA 2K27A 4UHTA 4A5MA 1R00A 4EJVA 4ESBA 1FWZA 2DI3A 2HYFA 1U5TA 5L3FA 1F1ZA 2P6SA 1B59A 3TKYA 2O3FA 1B4AA 1P4WA 5L3BA 3MEXA 2HGCA 1ZYRF 3K1PA 5HS7A 4ZYEA 2IA0A 2JTVA 2XAJA 1LJ9A 4UV8A 4G6QA 1E17A 5ICCA 3GW2A 2Y0MA 1J7KA 3H3UA 5F6FA 2A68F 2JT1A 2IT0A 1PP8F 1STZA 1RUOA 3J7AO 1XSDA 3QU3A 3IKTA 1D8JA 5JFRA 5L3GA 4I02A 4M6YA 5DYMA 1YW8A 2YPRA 5D8KB 4HV6A 3HTSB 3ZP5A 2GXGA 4LB6B 5D5WB 4CDGA 3JW4A 3IWFA 1DPRA 5JHUA 2FNPA 2L54A 4JQFA 4M9ZA 4RAZA 1GHCA 3P9KA 2MD5A 1IXCA 1U5TB 2E7XA 2D1VA 4EM1A 1J59A 3L2CA 2HTJA 4RAYA 5AIPA 4LLLA 3L09A 3RI4A 2P7VB 4A0ZA 2BE5F 5HLGA 2QQ9A 2F5FA 1MJAA 1F9NA 4HYEA 5E18F 4IRGA 4S04A 4U0YA 2E7WA 4IVNA 3FZVA 5LHIA 4KN7X 2HWVA 1LQ1A 1CF7A 2BGCA 3J80K 3I58A 2IPQX 2EFNA 1UFMA 3GFIA 1ZREA 5JR3A 1G3YA 2YX7A 4MQVA 3SFZA 4OOIA 1FLIA 1UCRA 4A12A 1FBSA 2Z5UA 5EEHA 4BYYA 1W4MA 1TW2A 1O7LA 3C1DA 3LFKA 4WF2A 4NQWA 3F8BA 1O3SA 3FXQA 3SXYA 1I6XA 4I7HA 4LK1F 5DD8A 1OMIA 3QAHA 4Y17A 3CTAA 4KT5C 4YFNF 1TTYA 2VOPA 2LNBA 2CGPA 4L5JA 2MH9A 3KLOA 3GX4X 3KETA 2IA1A 4FX0A 3Q5FA 4A5NA 1CF7B 4HOBA 1MDMA 1YIOA 1REPC 1WWXA 1KQ0A 2QM3A 4M73A 1R23A 1O57A 1R7JA 2F5EA 1IN8A 2NNNA 1DP7P 2VBWA 3CUOA 3BJ6A 2VN2A 2H27A 4M6XA 1FC3A 3G3ZA 1H0MA 1WQ2A 1ZG3A 4FX4A 1TQIA 2VC1A 2FU4A 4QWQA 4M9XA 1JXSA 3P9CA 5BQTA 1TBXA 3SQNA 4DQ2A 2G9WA 3RPUA 5EEGA 1SMTA 3WU1B 5ED4A 1Z91A 1TLHB 4OU0A 3GFMA 1XSXA 4ZYHA 4L9NA 1I27A 5H6RA 1W5SA 5DV5A 2D1HA 3LAPA 3V4GA 1DPUA 1YW7A 1MDMB 3DP7A 5FB2A 3WTUC 1ZHFA 2Q8KA 3PQKA 5IT9Z 1YFHA 4GGGA 4MTDA 3QP6A 3R6SA 1S6LA 1J75A 3WTZA 1LDJA 1BC8C 2Z33A 1I1GA 1FZPB 4BH9A 2PBIA 1BIBA 2RN7A 5CLSA 4EM0B 1FSHA 3DEUA 3ML6A 1RI7A 4LG0A 2RKHA 2IW5A 2ZBKA 2KKOA 5LLQA 3J80Z 1T6SA 5IT3A 1XB4A 2RQPA 4ESFA 1FP2A 2QUFA 2YU3A 1XMAA 2G7HA 3WODF 1NHAA 2FBKA 1LDDA 1ZG5A 3L9FA 3MQ0A 4KMUX 4L9JA 3GZ6A 1IN6A 1I5ZA 1MZBA 1TW3A 4PZJA 1U2WA 2WTEA 1B6AA 3TO6A 1BM9A 4RGXA 4M72A 3BWGA 3WGIA 4GXOA 1RZ4A 2OZUA 4EM2A 2HR3A 3FXUA 2DLLA 2WC2A 1QPMA 3REOA 2XROA 3WU0A 1LVAA 3BZ6A 3K1MA 2K4BA 1F4KA 1FT9A 4MEXF 3FX3A 4N9HA 3F8FA 2ACJA 4OMZA 3HTUA 1SD4A 2XKPA 3U2RA 3T1BA 3ZMSA 4P55A 4RB0A 5JI6A 3CDHA 2XKOA 3JTHA 4XRFA 3J81K 1W5TA 4MHGA 2ZNZA 4LD5A 4BNCA 3DKWA 3RKYA 2ISZA 3VODA 4XSZF 2BYVE 4GYIA 2XRNA 3CJNA 1JHHA 1HW5A 3DV8A 2Q0OA 3FM5A 4MGRA 4PDKA 4A6DA 5TJJA 2GA2A 2MC3A 2LSOA 1O3QA 1ZLKA 4G8XA 2QBYA 2O6GE 4HX7A 2Y75A 2V1UA 3O3KA 5D5XB 2VODA 4N0BA 2W57A 2VC0A 3H92A 1Y0UA 1KU9A 1SD6A 4ZH4F 5HDNA 5K5QA 2XAHA 1LEBA 3F22A 1HSTA 4QLCU 3C3WA 2QQBA 1RUNA 1FX7A 1AWCA 3C18A 4L18B 5LEKA 1PDNC 4AVPA 3V8JA 4OIPF 1ULYA 1BJAA 1JHFA 1ZAOA 2HFHA 4RGSA 1HKTA 2ZJ2A 5FGMA 3BPVA 4YIIA 4P5OA 2E1NA 4L0ZB 5H20A 1BI3A 3R61A 4WWCA 4HF1A 2FMLA 2JZYA 1BOAA 3T0YA 1ZARA 4JK1X 2K7LA 2W85A 1IW7F 2PFBA 3T5XA 4E70A 4I0BA 1T38A 4BHBA 2F2EA 4IRHA 3RPQA 1ZGJA 1SFEA 4HX4A 4UV9A 3VOEA 3P9IA 3T8TA 1PUEE 4HDUA 1R22A 4KMFA 1SFXA 4ZYGA 1KYZA 2XIGA 1YS7A 4O6JA 1K7AA 2Y48A 1H9GA 2EV5A 3O2PE 4RB2C 2DBBA 4XLNF 1MD0A 4Q4ZF 3HSRA 2A5YB 1R58A 1P92A 4RB3C 4MNUA 2FSWA 3KEQA 1SFUA 2GZWA 1USSA 4IJAA 1MJ9A 1W7PA 4PCQA 5CVRA 2HQRA 3BJAA 5D4RA 1KU7A 5CVJA 2BV6A 4U7BA 3TO9A 4XLPF 3LA2A 4WX9A 2EA2A 2IP2A 2GAUA 5HS8A 1J2XA 2CWEA 1LDKB 5FFXA 3IRRA 3F8CA 1EV7A 2RVCA 2M8EA 3ABTA 3F23A 4AIKA 3M1EA 5K5RA 1ZLJA 3J81Z 1BI0A 4O3MA 3WE3A 2P6TA 1W7PD 1U5TC 3GYHX 1O3TA 4ETSA 1BI2A 3M9AA 2YSRA 5E20A 2LDUA 4KDPA 3L7WA 1L0OC 3RKXA 3VFZA 2DK8A 1ON2A 4KN4X 5ICGA 2YR2A 1W7PB 3HUGA 2QQAA 4ZZDA 2O8XA 4YIFA 3M8EA 1X3UA 1FPQA 1KU2A 4M71A 4B8XA 1U8RA 3E97A 4EGZA 1IN5A 2EFOA 2QVOA 5LHHA 1Z9CA 4UUVA 2VT2A 4IPAA 5ILVA 5LGTA 1H9TA 3BP8A 4ZZLA 5BPIA 2O61A 2QWWA 2D2WA 4M74A 3FF5A 5LGUA 3GF2A 4D0PA 2KJBA 3O6BB 3D5LA 5FD5A 2VXZA 4G7OF 3ZQ7A 3LSTA 3HSFA 2W25A 1JGSA 1IF1A 4S05A 1BBYA 4Z2YA 5HVQC 1XGNA 2XAGA 2P4WA 5J6XA 3FMRA 4H0EA 3DPTA 3HHGA 1HKQA 2L02A 2CYYA 1FY7A 2OZ6A 2GXBA 4YFXF 1J0RA 4Q48A 2VBYA 3E5XA 5ERIA 2Z9OA 4P9FA 1QGPA 1AOYA 3ECHA 2KJCA 5H6QA 4OMYA 1MGTA 4ENKA 1IXRC 2W24A 2M30A 1Z6TA 2HOEA 3FMSA 1TQPA 5DUIA 2L4AA 1HKSA 4HW0A 1XMKA 1K78A 1WRJA 2G7UA 1XDUA 2ESHA 1IUYA 5D5VB 4HLXA 3ISPA 4IRIA 3R60A 3KLNA 2ZKZA 2M5WA 1B9MA 3TDZC 1UHMA 4HQMA 4IF4A 4HBLA 3LWFA 1QZYA 2A07F 5A2QK 1R1UA 4WCGA 3F21A 1ZG1A 4EJOA 1S7OA 2RGVA 4LK0F 2A6EF 5E1ZB 5BOXA 3I4PA 4EMSA 2VBXA 3WGGA 4WXDA 5AONA 1D3YA 2J5OA 2GWRA 3H3ZA 1Z1DA 3SHFA 2ELHA 3I0TA 3GWZA 2DTRA 5CVVA 1ON1A 2EV6A 3FWEA 1OYIA 1K78B 1IZ1A 2MLKA 1ONVA 4AWXB 1IRFA 2OQGA 3E5QA 5ILSA 5E8IA 2EWNA 2Z3YA 3EUHA 1SMYF 4IHSA 2K4JA 4HDVA 2ADUA 4G7HF 3RYPA 3I54A 1J5YA 5J8CA 4A6EA 2DPUA 3COAC 5D6EA 2FOKA 1R1TA 2H6BA 1FSEA 4KIFA 4L5IA 3LAJA 1D5VA 2NNYA 3TO7A 1OKRA 4KUMA 5D8LB 4A0YA 1XGMA 3BJOA 1UHWA 3GXOA 3E6MA 4K2EA 3V7CA 1U6GA 4OIQF 2CW0F 3QOPA 2K02A 2JPCA 4Q47A 3W6KB 4G94A 3E6CC 1P4AA 1BI1A 5K5OA 4U7DA 3WTTC 3OOPA 4L9VA 4LMYA 2V6CA 4RGRA 3ZMZA 2C6YA 4UVBA 2HEOA 1XDSA 3B02A 1LEAA 3GVAA 5E1WA 1YLFA 3RIRA 4AIJA 4XSXF 3HHHA 3ECOA 3WTXC 1RIOH 4MQ9F 4LG0B 5FO5A 4FT8A 4KIGA 1S8NA 3KEOA 3WE2A 2XV4S 3GO5A 3N4MA 3SZTA 3ELKA 1QO0D 1RNLA 3QPHA 3QPTA 3LA7A 4FHTA 3ABUA 5DDGA 3CO7C 2AS5F 2AXLA 2L01A 3F3XA 2UZKA 1ZN2A 1EH6A 3F6VA 1KA8A 1ODDA 2H09A 5F1RA 3KCCA 2OD5A 3TDUC 4A0XA 4EV0A 3JSOA 4R1HA 1SAXA 3WG9A 4RB1A 3M8FA 3GLXA 2XVCA 3KZYA 3MCZA 4PGHA 2A61A 1XSVA 1S29A 3DPLC 3ULQB 5D5UB 2M45A 2A6HF 1QNTA 1TNTA 4R79A 1WSUA 4LGWA 1XGOA 2GQQA 4GYGA 4RS8A 3BROA 3ZMVA 3V8KA 3TQNA 4HX8A 1I1SA 2PJPA 2D45A 1HSJA 3VEPA 4F7ZA 3JTGA 3HSEA 3KP3A 1YYVA 3KP4A 2ISYA 3WGHA 3M7GA 2OU2A 2FNAA 5E1XA 3RTRA 1DDNA 2DO7A 5CVUA 1PP7U 1IAWA 4G7ZF 2VBZA 1OPCA 3GFJA 1U3EM 3FMQA 3RYRA 3QRFF 1IN4A 2PMUA 4HQEA 3I64A 5K1YA 4PGGA 3ZN0A 2ZMEA 1O3RA 2FBIA 3ZMUA 5DCFA 4I2OA 4HAMA 4WXCA 4CZZA 4ENMA 3HRSA 4BXUA 2QBYB 1UB9A 3BDDA 4L0YB 1Q1HA 1FOKA 2WV0A 2FXAA 2X4HA 1B9NA 2MLGA 3LQQA 4ENNA 2EV0A 3IKVA 1OYWA 4A2UA 1HBXG 2OAZA 2H94A 2W84A 3IHUA 3KP6A 3ZMDA 1DUXC 4ON0A 2ZXJA 2NYXA 4DNCA 2CFXA 4OIOF 1D8KA 3U9GA 4I98B 1G3SA 5HOOA 1V4RA 2R3SA 3CO6C 1G4DA 5DD4A 2FA5A 2PEXA 2OQRA 1B1BA 1KYWA 1OYYA 4CO8A 2XUBA 5J8FA 1IN7A 3B73A 5BS6A 2PI0A 2FMYA 2ZMEB 2EK5A 2P5VA 5LBQA 2VE8A 3DF8A 4EVIA 4G9YA 1XGSA 5DEQA 4EJTA 5LRRA 1ZH5A 4HF2A 4R8HA 5BPDA 3VB2A 3K0LA 2J5PA 3I71A 3ZMTA 2QENA 3PFIA 3IL2A 4EJUA 2DQRA 3NRVA 5ILUA 5FLXK 2B0LA 3P7NA 2OA4A 5ICEA 2RDPA 5HLHA 1T98A 3KZZA 4LB5A 1QBJA 2NS0A 4Y13A 3ZPLA 2EA4A 2O03A 3IC7A 1T0FA 5HLIA 2DQLA 3BPXA 1KQ8A 3BOQA 3S2WA 3QU6A 3G73A 4YFKF 3DFGA 1FYMA 2IRFG 4KFCA 1R5HA 3IWZA 5L3EA 1XCVA 5LRSA 2Z99A 1SD5A 2PLYA 1GXPA 2A69F 4KNYA 3EDPA 5IT9K 2M87A 3ZN1A 1R1VA 2KRFA 5CVIA 4AIHA 4NB5A 2ZCWA 3Q9VA 2BBYA 3U1DA 4P96A 2QZ8A 2KIMA 3HIFA 4UVAA 2STWA 3KP7A 4LJZF 4KIBA 2ZNYA 2P5KA 2LF8A 3F8MA 3FHZA 1P2FA 3V7RA 5F64A 3NQOA 3RDIA 5KVRA 1WKMA 1C0WA 1G3WA 3N97A 3BY6A 4HF0A 1L3LA 4Y15A 2JSCA 2ZO4A 1E2XA 1YQAA 5BMZA 2CSOA 1LB2A 3HRUA 4GCVA 4N9IA 2YX4A 4GO1A 1YTYA 3IRQA 2MBFA 3LA3A
chains in the Genus database with same CATH superfamily
1Q1VA 3CLQA 4CICA 1CGPA 3E5UA 2LKXA 1F5TA 1MBKA 1WJBA 1HW2A 2DT5A 1WI9A 3OIPA 3AKZA 1XN7A 5E8GA 4A3LJ 2LF7A 2R7VA 4U0VA 2QQ8A 4I76A 5L3DA 1RKTA 2CQKA 3C7JA 4HNTA 1D1AA 3FHNA 1QU3A 1ZTRA 2VQCA 4M6VA 2X0LA 2NXNB 3RZDJ 1UAAA 4ENJA 3MZHA 2IBDA 2E1MC 2MA3A 2COMA 2WAQA 3RJPA 1P6RA 3OSFA 1P7JA 2WWYA 3W3CA 3R4KA 4U0WA 4CSWA 2UWMA 2EZIA 4AU7A 4IHWA 2E1MB 2Y69H 3FXRA 2L3DA 2WY7Q 4BBRJ 3DXJF 1GDTA 2DFIA 2DK5A 2F48A 1A04A 2OTLI 3JAMK 1YS6A 2ICWG 1T8IA 2KMUA 1DGRM 4CCJA 1R5GA 2H6CA 3AG2H 5FFZA 1BC7C 2DOFA 1FYKA 2HDCA 3A1YA 3GUDA 5F04A 4EJWA 2NVYJ 4MIMA 1ZKGA 3CMAI 4II3A 2R7FA 4OIRF 2PX9A 5LD2C 2GIVA 2NVTJ 2LVSA 1IRGA 1YIJI 4IO9F 2FBHA 4MLOA 3I4MJ 1EH7A 3L00A 1FYLA 3ABMH 3I5UA 2VOOA 3E6BA 1TNSA 2CQNA 1Z3YA 5KAIC 4FQGA 4KA4A 2OPTA 2IS6A 4CHUA 3K9TA 1TQMA 3OL4A 2F4MB 2EJRA 2UXNA 1R36A 4UNOA 4A3BJ 2M2EA 5GPAA 4Q5SF 3G1OA 2XAQA 3QPLA 4XN0A 4AD9A 4I0AA 1ORKA 2L9NA 4XL9A 4IHTA 2GBYA 5ICFA 3FBNB 5FLXZ 5HNHA 3S3OA 1X58A 1KGSA 1LVKA 2BXYA 5FJ8J 2PQ8A 4V2GA 2E1CA 5DUKA 1FMWA 3QWLA 3TW7A 3H3VK 5B5EC 2BZTA 4G6DA 2NRAC 1YW9A 2BEOA 4I09A 2PG4A 1IGNA 1VTNC 1U78A 3Q9SA 5IYCJ 3MAJA 2X9DA 2HZDA 1O7FA 2F5DA 5FKMA 3TL4X 4CYDA 1X1AA 1V3FA 1XTAA 5D6FA 4KICA 3I53A 4C2MJ 3GTOJ 3CCRI 2DDBA 3BG5A 2PN6A 4XLEA 2FQ3A 3ROUA 2F5CA 2IJLA 2M4KA 2XHKA 1MJBA 2YUSA 1MMNA 3BG9A 5FD6A 3ERED 3FIWA 3BR1A 1E0EA 3KE2A 3L2VA 1FBUA 4Y52J 3JSPA 2H1LA 4NUBA 2ELKA 1RRJA 3LSKA 1HXDA 2CG4A 1UZCA 1OR7A 3LSGA 3F72A 1GLNA 4WXHA 1XD7A 4XKWA 4XMYA 4IQ4A 2HKXA 4LLNA 1X3WB 1D1BA 2CU7A 5E17F 1Y1VJ 2HQNA 1USTA 2XPVA 3W6JB 3DBLB 1XCBA 2LRDA 4DZPA 2O8KA 1P4XA 4J01A 3AAFA 5B1AH 2HOSA 2STTA 4BHPA 3VYTB 5H2FC 2HYJA 1VQPI 2DN0A 4M9SA 4EATA 2IXSA 2V1XA 3GZ5A 1ITYA 3WTWC 2HS5A 3EETA 5TISC 2FF4A 5EZGA 1HDDC 3TBIA 3WTSC 2H1KA 3TOBA 3H0DA 2HVSA 2RV8A 2X85A 4CH7A 5HDGA 1IV8A 2HKOA 4LFUA 1Y0NA 3EYYA 2K86A 2EIMH 2NVXJ 4OAZA 4XONA 2IVMA 3K2AA 1BIAA 2V79A 1SD7A 6PAXA 1Y56A 3KYCB 1GV5A 4DOZA 1JE8A 3EUHC 3K69A 1LFBA 1T2KA 2CO5A 1ZRDA 1ACIA 3R0AA 4E4HA 1KQ9A 2RC4A 1FBQA 3H5RA 3LSRA 3U21A 4E7ZA 4KYWA 3DQVC 2CQXA 4CXFA 1G3TA 3GEZA 1ZGAA 1OR7C 3CUQA 3F6OA 3SZGA 2EFPA 1GXQA 2HXOA 3K70C 2OBPA 4CCOA 1MW7A 2XSDC 4LLGF 4C3JJ 3H35A 2QYOA 2CJJA 1APLC 1Z6RA 4ZYDA 3HRTA 5LGNA 3CP8A 5LHGA 2ZFUA 1HW1A 4ASNA 2EFWA 2FRHA 3KFWX 3NAUA 1HCRA 4DW6A 5IP7J 3AL0C 3PQJA 3R0JA 3OS2A 2EPFA 5E79C 4NC7A 4IQJA 1LNWA 5JVTA 4NHJA 2XGXA 4E7SA 2V9VA 2WBMA 1ZRFA 3LQRA 2FEZA 3GBGA 1MKMA 2R5YA 5TRDA 3AL0B 1J9IA 2R0QC 1GVJA 2VLAA 5HDKA 2I10A 3I59A 2JRTA 4E7HA 4M3GA 5LEJA 2JPBA 4MTEA 4EGYA 5CKTA 4RGUA 1YE9A 3M1CA 2XGEA 1WFXA 3HOTA 5L3CA 1Y39A 3KP5A 4RA2A 3ZOBA 1YO5C 3J7ZI 1QZZA 3JAMZ 3EYIA 2MH2A 3GTGJ 2V1DA 4L9TA 3NEUA 2KFDA 3NWTA 5GTIC 1EH8A 1IO2A 3TEDA 2ZFWA 1N75A 4PK4A 2XASA 5DTDA 1MSFC 3K1NA 4MEYF 2DA2A 1G2HA 3S2DJ 1ETVA 1LUJB 2TDXA 5GP9A 1MBHA 1FP1D 2DPDA 1MBJA 3E6DA 3CC4I 4XBFA 3CUQC 5A2QZ 2DU9A 2X1EA 2FUG2 2OTJI 2M3AA 2K5CA 2IGKA 2F4OB 3HPHA 3OV8A 4UVCA 4XORA 2DW4A 4BAYA 2CRGA 2L0KA 3CUQB 1K6YA 2Q2EA 5CQGA 3OR1C 1S3JA 2QEXI 2ZSHB 3TOAA 3VWBA 3S1QJ 2JSPA 2XAFA 1LKXA 2ETHA 3HOSA 2RNJA 4HA8A 4JX6A 4BBSJ 1VNDA 5DCMA 4HLYA 5KK1A 3D0SA 3VDXA 3OOUA 4ESJA 2P7CB 4U88A 4TV7A 1TWHJ 2A3SA 2COBA 2EFQA 2NAZA 1K6OA 2P5LC 2UXXA 3T8RA 3PNYA 2DAOA 4I01A 4HZFA 3DU6A 3A0HC 3E0JB 5J3LA 2DODA 2LG4A 3GMEA 4HV5A 4II2A 4RMNA 2K9MA 4IXAA 4B09A 5KHDA 2R5YB 3MWMA 3H1CA 4IL6C 4UXNA 5AIQA 1H88C 3HDDA 1QHGA 3DBHB 2M7BA 2QKMB 2X6OA 3LFUA 2ESNA 1TP4A 2HZTA 3I59B 4QPQA 2VONA 1A35A 3NARA 1X1DA 3I56I 3MKZA 4V19K 2O0YA 2PMHA 1E3OC 1FNNA 3K4BA 3K4KA 1K79A 1T39A 5D4SA 2E1OA 1HQCA 3Q0VA 1I6HJ 4IOAF 1HLVA 1W36C 3AG3H 1TT0A 2M1BA 2QLZA 3VYSB 4LG3A 2QKLB 3SZPA 3MKWB 2XF5A 4CGZA 3L2WA 3CLOA 1R6RA 2K40A 1WJCA 1YX3A 2OCEA 4XQFA 2JA5J 1Z05A 2DTZA 5B1BH 3MFKA 2YS9A 4BQAA 3K4MA 5F0CA 3KP2A 4G12A 4EQQA 1WZ2A 3DU5A 2IEKA 2FE3A 2VPRA 2KIUA 2HYGD 2AHQA 1S7AA 3HRMA 2ID3A 2DJIA 2LOOA 1KONA 2O5RA 1YG2A 3WTVC 3MD2A 2GA1A 1R4NB 4XKCA 2Q2EB 1G59A 1HDPA 1QQIA 3FM3A 2HTSA 3A2KA 4PSXA 4YG2F 4QSHA 3I9V2 3HB9A 2DA4A 1ETWA 2XF7A 4MFEA 5DCMB 2KIFA 2LKPA 3QP5A 3K2ZA 4RLFA 4OINF 1FEXA 1BN5A 2XGCA 2L7ZA 3FXKA 3B6AA 2R7DA 3RKWA 5EEAA 4WK8F 3UR3C 2AXTC 2EB7A 2P8TA 3GFLA 3TGNA 4JBAA 3DTIA 3F8NA 1HOMA 1G6NA 4P9UA 2HPMA 2QCOA 1JT0A 3V7SA 5HS9A 1Z7UA 2XAUA 3V8LA 2VE9A 2IA2A 2VT3A 4CCKA 2LY9A 2LLKA 1VQ4I 4BHCA 5CJ9A 2LKSA 4GRIA 2E5NA 1IXSB 1K4TA 2L4MA 3MZYA 3HYIA 3E3VA 4O5VA 3WTYC 1ZRCA 3EQLF 3EUKL 1HA8A 1TZLA 3S8PA 1KU3A 5CYVA 3JRFA 3JR9A 1YITI 1D0XA 2N8GA 2K27A 4UHTA 4A5MA 3LSMA 2ELJA 5EGOA 1XMXA 3OYCA 4BY1J 3SEQA 4NNJA 2L9VA 3PJRA 2JA6J 1R00A 5TGTA 2VKHA 1KZHA 4EJVA 4ESBA 2LY2A 4L5EA 5GPCA 1FWZA 1WH7A 1NH3A 2KQRA 2DI3A 2IS1A 2HYFA 5K7ZA 1U5TA 5E3NA 3PFYA 1AKHB 1G8XA 1LFPA 1F1ZA 5L3FA 1OCCH 2F5VA 2V4JC 2P6SA 1H8AC 1B59A 4CZCA 1GV2A 1EA3A 1ZR4A 1Y1WJ 3TKYA 2O3FA 3C2GA 3CMMA 3IP4B 2QSFX 3FXJA 1B4AA 2Q1ZB 1P4WA 5L3BA 3CJRB 4A3GJ 4XRMA 3MEXA 4F55A 3KPHA 2HGCA 1ZYRF 3K1PA 2DA5A 2KRCA 2YU9J 1FMVA 5HS7A 1YOVB 4ZYEA 2IA0A 2JTVA 2XAJA 1LJ9A 2R7ZJ 4UV8A 3K4JA 4G6QA 2FQ4A 1E17A 4E7IA 1B72B 5ICCA 1JUSA 3GW2A 2Y0MA 2DA7A 2TRTA 2OJED 1J7KA 3OIQA 2GIZA 2IGMA 3H3UA 5F6FA 4BE1A 2A68F 3M4OJ 2JT1A 1FTTA 2IT0A 3RZOJ 1PP8F 1STZA 2E36A 2HQ5A 1RUOA 1AA7A 3J7AO 1XSDA 3QU3A 3QYEA 3LOCA 3IKTA 1D8JA 5JFRA 5L3GA 1X4OA 1D1CA 4I02A 4M6YA 4M3BA 5DYMA 1YW8A 1QRYA 2YPRA 4XM3A 5D8KB 4HV6A 1EKEA 3HTSB 4X1EA 3ZP5A 2GXGA 4LB6B 5D5WB 4CDGA 3JW4A 3IWFA 1DPRA 5JHUA 5EGOB 2FNPA 2L54A 3MKYB 4JQFA 1FOXA 4M9ZA 4RAZA 3SEZA 4AVZA 1GHCA 3P9KA 1WVRA 2MD5A 3KYDB 1ZGWA 1IXCA 1U5TB 2H8WA 2E7XA 3FBIB 2D1VA 2ZXIA 2JA2A 1VI0A 2QF7A 4EM1A 1J59A 3L2CA 5K7HA 2HTJA 4RAYA 3ZQIA 2R7SA 5AIPA 3G1MA 5B3SH 4LLLA 4A93J 5DM6F 4RLQA 1I39A 3L09A 3RI4A 2P7VB 4A0ZA 3CMYA 2BE5F 2B9SA 5HLGA 2QQ9A 1TC3C 2F5FA 3L2QA 2NS7A 4DBQA 1MJAA 1F9NA 4HYEA 5E18F 2WB1N 4IRGA 4BUPA 3S14J 2L7KA 1U9NA 4S04A 4U0YA 2M0CA 1A6QA 1OCPA 1JKOC 2E7WA 4XLHA 2M34A 4IVNA 3HEFA 3FZVA 3M8JA 3QYFA 5LHIA 3GZNB 4KN7X 4N4OB 4A3CJ 2HWVA 4LIVA 1LQ1A 1CF7A 4IHYA 3GTQJ 2BGCA 3RSNA 2E2IJ 3J80K 2MGQA 3I58A 2H8RA 4KITB 5F1JA 2IPQX 5HNFA 1SFKA 1Y6IA 2EFNA 1ZELA 3A4CA 1UFMA 3GFIA 1ZREA 5JR3A 3CZ6A 3H9GA 1G3YA 2W48A 2YX7A 3K7AJ 4MQVA 3SFZA 4OOIA 5F0FA 2XSJC 1FLIA 1POGA 1UCRA 2QGUA 2ZJQF 1UELB 2IS2A 4A12A 1FBSA 2K3PA 2Z5UA 2VB6A 5EEHA 4BYYA 1X19A 1RETA 1BR4A 1P7IA 5LFAA 2L7FP 2MFZA 2ZB9A 1W4MA 1TW2A 2EZKA 3OYGA 1E3HA 1O7LA 2O9LA 4XIDA 4V2FA 2ZJPF 3C1DA 3S1NJ 3LFKA 4WF2A 4NQWA 3F8BA 1O3SA 3FXQA 3SXYA 1I6XA 4I7HA 4LK1F 1N78A 5DD8A 1OMIA 3QAHA 4Y17A 2EBIA 2K9NA 3CTAA 4KT5C 2X1CA 4YFNF 1TTYA 2VOPA 2LNBA 1SEUA 2CGPA 4L5JA 1MBGA 1VQNI 3CC2I 2MH9A 1PJRA 3KLOA 3HC7A 2ZJRF 2R5ZB 3MN2A 3RQ4A 3GX4X 3KETA 2JVGA 2IA1A 4FX0A 4DZJA 5DS9A 4ZTFA 3A0BC 1D0YA 3FK7A 3Q5FA 1ETOA 2KT0A 4A5NA 1WH5A 2JUCA 1CF7B 4HOBA 1MDMA 1YIOA 1OFCX 5GAHJ 4BL0B 2DA1A 4Y3OA 4A3KJ 1REPC 1WWXA 1KQ0A 1IRZA 2QM3A 4M73A 1VQ6I 3AFHA 1VQMI 1D5YA 1R23A 1O57A 5FKNA 1R7JA 2F5EA 1IN8A 3P5JA 2W00A 2NNNA 3HOXJ 2QSGX 1DP7P 2VBWA 1JTXA 3CUOA 2E35A 1JKRC 3BJ6A 4B3AA 4RDUA 2VN2A 2H27A 4M6XA 1FC3A 3G3ZA 1H0MA 1WQ2A 1ZG3A 2P81A 3KEYA 3N05A 2WV1A 4FX4A 1TQIA 1NK3P 2VC1A 4Z6YA 3JRIA 4IZZA 2ME6A 2XPWA 2FU4A 2BHZA 4QWQA 4NQWB 4XRSA 4M9XA 3JCUC 1JXSA 1JUMA 2MYSA 3P9CA 5BQTA 1TBXA 2DA6A 3H9JA 1QPIA 3BT9A 3ESWB 3BC8A 3SQNA 3WHBA 3GTMJ 4DQ2A 4YRVA 2G9WA 3RPUA 5J4YA 3UNGC 4ZC3A 5EEGA 2QSHX 1SMTA 3H36A 2CUJA 3S3MA 3WU1B 5ED4A 1Z91A 3G4SI 1WPKA 1VQKI 1TLHB 2DFEA 3GFMA 4OU0A 4UUTA 1XSXA 4ZDPA 3ZQQA 4ZYHA 2DMPA 4L9NA 1DQUA 1I27A 3K6GA 5H6RA 1B8IA 2ZSIB 2VPLA 1W5SA 3OIOA 4BQOA 4CYCA 5IYBJ 5DV5A 3CMEI 2D1HA 4F52A 2LH9A 1VQLI 3LAPA 3CF2A 4E6KG 1VFCA 1MMAA 3V4GA 1DPUA 2BY3A 1YW7A 3GTPJ 1MDMB 3DP7A 5FB2A 3WTUC 3PO3J 2V9KA 4XR6A 1ZHFA 5EZHA 2Q8KA 3PQKA 3S3NA 3CC7I 5IT9Z 1R71A 4XLCA 1YFHA 4GGGA 3OYIA 2P0WA 3Q0WA 4CA0A 4MTDA 2VJ4A 3QP6A 2HVRA 2EILH 3R6SA 1S6LA 4CUGA 1J75A 3BQYA 3WTZA 5FKOA 2M7AA 1LDJA 2RNGA 4FE7A 5CPRB 9ANTA 3RPUD 1Z0XA 1BC8C 3VYRB 2Z33A 5C4XJ 4ANJA 1YRNA 1I1GA 1FZPB 4BH9A 2EINH 2PBIA 3LL7A 4DYRA 1BIBA 1E3PA 3CDIA 2RN7A 3K10A 2JMWA 3ABLH 2K3FA 1JJ8C 5CLSA 4EM0B 3FXMA 5IP9J 1FSHA 3DEUA 1TWAJ 3ML6A 5M5WJ 1RI7A 4LG0A 2RKHA 2FD5A 5E3MA 2IW5A 5JVGF 1BL0A 1I3AA 1FOYA 2B63J 2ZBKA 2KKOA 5LLQA 4BGDA 3J80Z 1T6SA 1VQ8I 2VKVA 1RC9A 1MH3A 2DYRH 2FX0A 3DPUA 5IT3A 3TW6A 3JRCA 1XB4A 3CJQB 4BE0A 2RQPA 3K4LA 4ESFA 2E2HJ 1FP2A 2QUFA 2YU3A 1XMAA 1B8IB 2G7HA 2EQRA 3WODF 2FBKA 1NHAA 4C2TA 1LDDA 1ZG5A 2BOLA 3L9FA 2E5ZA 2VXDA 2X48A 2EIKH 3MQ0A 2LR8A 4A3DJ 4KMUX 4L9JA 3GZ6A 1IN6A 1I5ZA 3LSIA 1NTCA 4KT6A 2NOJB 1MZBA 1TW3A 4PZJA 1R5ID 1YJ9I 1LE8A 2LC2A 2LK2A 2NS8A 3FKJA 3CCYA 1U2WA 2WTEA 1B6AA 1XG1A 4B1RA 3MVPA 3TO6A 2F4IA 1BM9A 4RGXA 2HNHA 4M72A 3BWGA 2DMTA 3WGIA 4GXOA 1T33A 1RZ4A 2OZUA 3OYDA 2Y9YA 4EM2A 1QVUA 3H5AA 4AYBN 3BG6A 3KYLA 2HR3A 3FXUA 2DLLA 2R7OA 2WC2A 3LSHA 1QPMA 3REOA 2XROA 3WU0A 5FLMJ 3CCJI 1LVAA 3BZ6A 3K1MA 3M07A 2K4BA 1EJ9A 1F4KA 2PMZN 2EIJH 3BCBA 3B6CA 4AM3A 1FT9A 3A01A 1VQ7I 4MEXF 1XPXA 3X2QH 3FX3A 4F93B 5M5YJ 3HOVJ 4N9HA 1IDZA 3F8FA 2ACJA 4OMZA 3ABKH 3HTUA 1SD4A 2XKPA 3U2RA 3J7AY 3T1BA 4BQNA 3ZMSA 5F27A 1IUFA 4PFPA 1BA5A 3CCLI 2M0MA 3WG7H 4XN3A 4P55A 4RB0A 5JI6A 3CDHA 2XKOA 3HGYA 3W2AA 4LOCA 3JTHA 1A36A 3ZCOA 2CV1A 4XRFA 1RR8C 5HODA 4ZTJA 2DXIA 2EZLA 3J81K 1W5TA 4MHGA 2ZNZA 4LD5A 1MMDA 3EUAA 1JGGA 2KP6A 4RM3A 1O4XA 1LE8B 4BNCA 1TL8A 3DKWA 2R4GA 3RKYA 4FE4A 2ISZA 3PIOF 1BJZA 2KZGA 3VODA 4PUSA 3F0CA 2OV7A 4HNVA 1IC8A 3BCAA 2BYVE 4XSZF 3W2WA 4GYIA 2XRNA 2I8DA 3CJNA 1JHHA 1HW5A 1R4MB 3DV8A 3CCQI 2LMDA 3PNTA 2OUMA 2Q0OA 2KLOA 2VASA 3FM5A 4MGRA 4PDKA 4A6DA 5TJJA 5E3OA 2GA2A 2WAFA 3MZ8A 2ME0A 1IG7A 2MC3A 2LSOA 3SDBA 3A01B 3S1RJ 4PJJA 1O3QA 1ETXA 4G8XA 1ZLKA 2QBYA 2LBFA 2O6GE 1A6IA 4HX7A 2M9HA 3PSIA 4ZJZA 2Y75A 2V1UA 3O3KA 5D5XB 2VODA 4PJLA 4N0BA 3S93A 2W57A 2MG4A 2CUFA 1D0ZA 2VC0A 2R7TA 3H92A 1Y0UA 1KU9A 1SD6A 2W1OA 2OF7A 4ZH4F 5HDNA 3WHCA 3C2HA 2XAHA 5K5QA 1LEBA 3LNQA 3F22A 3S1MJ 1HSTA 2W82A 2ZC2A 4QLCU 2XB5A 3C3WA 2QQBA 3LSPA 2LY1A 1YJWI 1RUNA 1FX7A 1AWCA 3C18A 3SDGA 4L18B 4I99C 1V55H 2DCEA 2K9SA 4AVPA 5LEKA 3V8JA 1PDNC 3DEWA 4OIPF 2HOAA 1ULYA 1BJAA 1JHFA 1ZAOA 1T08B 2HFHA 4RGSA 2Y30A 3RQIA 1HKTA 4BQQA 2ZJ2A 5FGMA 3BPVA 4YIIA 4UY8I 3IH4A 4DGWB 4P5OA 2E1NA 4L0ZB 5H20A 1BI3A 2DDAA 2EZHA 3R61A 4WWCA 4ZDOA 4HF1A 4M3EA 2FMLA 2JZYA 2L2OA 3FK6A 3CDLA 1BOAA 2F6CA 1S9HA 2KHMA 2PJRA 3PM1A 1MNEA 3T0YA 4DJAA 1T56A 1ZARA 4JK1X 2K7LA 2W85A 1IW7F 2PFBA 3T5XA 4E70A 3QOEA 4I0BA 3HPGA 1T38A 4XKVA 4QTRA 3FDYA 3F9KA 4BHBA 2F2EA 3CCVI 4IHXA 3L1PA 1U9OA 2L5QA 4ZYAA 4IRHA 4LITA 1UHSA 3BR0A 3GTLJ 2RREA 1Z21A 3CJTB 2XGDA 3RPQA 1ZGJA 2K85A 1SFEA 2BXZA 4HX4A 4UV9A 3DTEA 3P9IA 2LBFB 3T8TA 3VOEA 4B3XA 4HDUA 1PUEE 2CUZA 1R22A 3BR6A 4KMFA 5GTHC 1SFXA 4ZYGA 1KYZA 1Y8RB 5IP6A 2XIGA 1YS7A 4O6JA 1K7AA 2Y48A 1H9GA 2EV5A 2XF6A 3O2PE 4RB2C 3D5SC 2DBBA 2DT6A 3VYUB 1R9TJ 4XLNF 1OCTC 2R93J 1MD0A 4BEHA 4C2UA 1U0JA 4Q4ZF 3HSRA 2A5YB 2A5WA 3ZQGA 4UUSA 1R58A 1P92A 4RB3C 1ZR2A 4MNUA 2FSWA 3KEQA 1SFUA 5C4JJ 2GZWA 1USSA 3W2VA 2VIXA 1OQYA 2G0EA 1OISA 4IJAA 3OYJA 1ERDA 1MJ9A 2JRMA 3JRHA 1W7PA 3BG7A 4RM2A 1JT6A 4PCQA 5CVRA 2HQRA 4E7JA 3BJAA 5D4RA 1KU7A 5CVJA 3Q0UA 4E7KA 2BV6A 1MMGA 4JOMA 3TO9A 4U7BA 4XLPF 2DMNA 3LA2A 4WX9A 2EA2A 2IP2A 3ZGKA 2PJRB 2GAUA 5HS8A 3CD6I 4X6AJ 2M8GX 3DWLE 3G1LA 1J2XA 2CWEA 3S15J 3OWTA 2JUGA 1LDKB 2X1DA 5FFXA 2RQQA 4PJ0C 3IRRA 3F8CA 1EV7A 3CF5F 2RVCA 4CCMA 2M8EA 3ABTA 3F23A 4AIKA 1UG2A 5EG0A 4DYQA 2TCTA 3M1EA 5K5RA 4C30A 1ZLJA 1HF0A 2V1NA 3D5RC 3J81Z 2VQHA 1BI0A 2HXIA 5DM7F 4QPOA 3TP0A 5EF6A 4O3MA 3U1KA 3WE3A 4PJNA 1OLTA 2P6TA 1W7PD 1U5TC 3GYHX 2CH0A 1O3TA 4ETSA 1BI2A 3M9AA 2YSRA 2FJ1A 3ERMA 4BEHB 5E20A 2LDUA 3IH3A 4FTHA 4KDPA 1BR2A 3L7WA 5IYDJ 1L0OC 3RKXA 1V5GA 3VFZA 1A5JA 2DK8A 1WJEA 4A3JJ 1ON2A 3OY9A 4KN4X 1X2NA 4BDZA 1QHHD 2KIQA 5ICGA 3H9QA 4XLFA 1MBEA 2YR2A 1WJAA 3QODA 1W7PB 3HUGA 1ETQA 2QQAA 4ZZDA 1LFUP 2BY0A 3OSGA 2O8XA 4YIFA 3M8EA 4OAYA 2DYSH 1X3UA 3MMYB 1Z77A 1FPQA 1KU2A 2AQFA 1BW6A 4M71A 4B8XA 3PNVA 3K4CA 2BVLA 2Y0SN 1BOBA 4HSTA 4BJTA 1U8RA 1DGWY 3BLYA 3E97A 2LP0A 4EGZA 1IN5A 2A6TA 2EFOA 2UV1A 2QVOA 5LHHA 1Z9CA 4UUVA 3BZCA 1ZK8A 2VT2A 2L9RA 4IPAA 4AUXA 5ILVA 5LGTA 4C3IJ 4HEA2 4JYKA 3BP8A 4PJMA 1H9TA 3OYNA 4BXFA 4ZZLA 2DMQA 1S5LC 2L7MP 5BPIA 3OR2C 2O61A 1TWCJ 5EG0B 2QWWA 5GADJ 2D2WA 4M74A 2V26A 4UB6C 3FF5A 4Y7NJ 5LGUA 1PYVA 4XK4A 1MNDA 3GF2A 2Z1DA 1RR7A 4D0PA 2KJBA 4A3IJ 2KPMA 3O6BB 3D5LA 3KX2A 5FD5A 2KRHA 2VXZA 3I55I 2DMUA 4G7OF 3ZQ7A 2CQ7A 3OL3A 4JX5A 1GVDA 4D9JA 1WGXA 3LSTA 3HSFA 2W25A 3BTIA 2X6YA 4I6ZA 1JGSA 2IAIA 1IF1A 3AG1H 4S05A 4BY7J 3OYBA 5J1UA 1S72I 1BBYA 4Z2YA 3SYTA 2E71A 4A3MJ 2GXAA 4UB8C 5HVQC 4FASD 1XGNA 2XAGA 2P4WA 5J6XA 5C3EJ 2L9SA 3JRAA 3FMRA 1F43A 4H0EA 3HKZN 3DPTA 3IV5A 3HHGA 1HKQA 1MBFA 2L02A 2AQEA 4KISA 1U8BA 1SC7A 2VUMJ 2CYYA 1FY7A 2OZ6A 5BNGA 2GXBA 4YFXF 1J0RA 3G71I 4Q48A 3DKXA 2VI6A 2O7OA 2VBYA 3BR5A 3E5XA 3VPRA 3BG3A 1GUUA 1SVOA 4J19A 5ERIA 2Z9OA 4P9FA 1QGPA 3GCMA 3OYKA 1AOYA 3ZQFA 4BDYA 2WA0A 3ECHA 1IV6A 2KJCA 5H6QA 2NVQJ 4OMYA 1I3QJ 4ABZA 1MGTA 4CCLA 1SANA 1H89C 2JQ7A 4ENKA 1IXRC 2W24A 2M30A 1A31A 1Z6TA 4HSRA 2CV2A 2HOEA 4BXXJ 3FMSA 1TQPA 5EJCA 5DUIA 2L4AA 1HKSA 4HW0A 1XMKA 1K78A 2DFHA 1WRJA 2BW3A 1JJ6C 4BJ6C 2BY2A 2G7UA 1XDUA 2RAEA 3IAM2 4YIRX 2ESHA 1IUYA 4BS9A 2DJNA 4HLXA 3ISPA 5D5VB 1XS9A 4IRIA 1VZ0A 2V9PA 3A03A 2JA8J 1X1PA 4Y4RA 3QPSA 3R60A 3KLNA 5M3FJ 4GDFA 2ZKZA 3IUOA 2M5WA 1B9MA 3TDZC 3ZRGA 3OYEA 1UHMA 4HQMA 3JREA 3C2BA 4IF4A 4HBLA 1VQ5I 3IH2A 3LWFA 1QZYA 2E19A 4U87A 1CQTA 2A07F 5A2QK 2R7QA 1R1UA 4WCGA 3F21A 1ZG1A 4BJ5C 1S7OA 4EJOA 2RGVA 4LK0F 3O8HA 4XLAA 2A6EF 2CUEA 3HM5A 5E1ZB 5BOXA 3I4PA 3PSFA 4EMSA 2LYCA 2VBXA 4JP0A 2Y31A 3WGGA 4C3HJ 4WXDA 5AONA 3ASOH 1D3YA 2J5OA 2VJIA 2WAQN 3AG4H 5J47A 2E60A 2KISA 4DIQA 2GWRA 1SAUA 2KDOA 3H3ZA 1RESA 1PVEA 1ENHA 2JN6A 2R7WA 1Z1DA 3SHFA 2ELHA 3I0TA 2JA7J 2AO9A 3GWZA 2DTRA 2Z2SB 5CVVA 2BY1A 4F91B 1VQOI 1ON1A 2EV6A 3FWEA 1OYIA 3DLLF 1UMQA 2V6EA 4M3DA 1JI8A 3E7LA 1VQ9I 3D1NI 1K78B 1IZ1A 1V5FA 2MLKA 4W97A 1ONVA 2BW3B 4AWXB 1IRFA 2CQQA 2OQGA 5J1RA 3E5QA 5ILSA 5E8IA 1MH4A 2EWNA 2Z3YA 3EUHA 2CMPA 1SMYF 4IHSA 2K4JA 1BW5A 3OYHA 4HDVA 3HG9A 4LIUA 2HQAA 2ADUA 2CW7A 2X51A 3HBLA 3RYPA 4G7HF 3I54A 1YI2I 2DA3A 5J4VA 1J5YA 2JWTA 5J8CA 2ZXHA 1QVTA 4A6EA 3IAS2 1FIPA 2IS4A 1X1BA 2DPUA 4A3EJ 3COAC 2EH3A 1V54H 2MABA 5D6EA 5K7FA 2FOKA 4AYBA 1YJNI 1R1TA 4YEJA 2H6BA 1FSEA 1W1WE 4Y33A 2K9QA 4KIFA 5J40A 4L5IA 2PMZA 3LAJA 2CW8A 1WHUA 3DCFA 2W7NA 1D5VA 2NNYA 1MMSA 4YELA 3TO7A 4RBOA 1PUFA 1OKRA 4KUMA 3ONQA 2FOWA 5D8LB 5IOYA 3FXOA 4A0YA 1XGMA 4CYCB 1UJ8A 3BJOA 4MFDA 1UHWA 5JHFA 3GXOA 1JKQC 2ID6A 3E6MA 4K2EA 2Z16A 3V7CA 2BVMA 4DYCA 1U6GA 3CESA 4J00A 4OIQF 2CW0F 1NG7A 3QOPA 2K02A 2JPCA 3HJEA 4Q47A 4D1QA 4P1WA 3MKLA 3DLAA 3W6KB 3K70D 2WY8Q 2Y2ZA 4G94A 3E6CC 2HDWA 3OS0A 1ZQ3P 5FLVA 4N4NB 1P4AA 2CV0A 1BI1A 5K5OA 1FIAA 1MIJA 4U7DA 3WTTC 3OOPA 4L9VA 4MO7A 1YHQI 3BR3A 1ETYA 3UKGA 5J1YA 4LMYA 2V6CA 5FKLA 1WCMJ 3PL8A 1TWGJ 4RAFA 4RGRA 3ZMZA 3FXLA 4UVBA 1YRNB 2C6YA 2HEOA 1BR1A 3S2HJ 2K9LA 2VKEA 1XDSA 3KZIC 3B02A 2M4GA 1LEAA 3GVAA 5E1WA 1YLFA 3RIRA 4AIJA 2BHYA 1TWFJ 4XSXF 1FJLA 3HHHA 3ECOA 3WTXC 1F36A 1RIOH 4MQ9F 1OJLA 4LG0B 5FO5A 2R92J 1MSEC 3PO2J 3BZKA 4FT8A 5GAEJ 4QIWN 4KIGA 2VKDA 1S8NA 3KEOA 1WJ5A 3WE2A 2XV4S 2JVHA 3H0GJ 2E2JJ 1QA6A 2D5VA 3CP2A 4KJZA 1DU6A 3GO5A 4B43A 1PUFB 3N4MA 2LD5A 3SZTA 3ELKA 1QO0D 1RNLA 3CCEI 1S7EA 3G2BA 3QPHA 5F08A 3QPTA 3LA7A 4FHTA 2X6XA 2QA4I 3PUBA 2LFBA 3ABUA 4CCNA 1IRXA 3HGGA 4G6TB 5DDGA 3CO7C 4E7LA 2AS5F 2AXLA 3LMMA 2KDZA 2L01A 2XPUA 1NG6A 1ZN2A 1EH6A 3F3XA 3F6VA 1KA8A 3OYFA 2UZKA 2DFFA 2XRLA 3JRGA 3HZJA 4NDLA 1ODDA 4EEFG 2H09A 5F1RA 3KCCA 1VF9A 2OD5A 3TDUC 1FTZA 3BTLA 4A0XA 1JKPC 2HVQA 5F0HA 2ECCA 2W4SA 1IJWC 3ZQCA 4EV0A 3JSOA 4R1HA 3I3LA 1SAXA 5FROA 3WG9A 2GM4A 4HNUA 4NC6A 4RB1A 2WAEA 3M8FA 3GLXA 2XVCA 3KZYA 3MCZA 1XX5A 3HOYJ 5B66C 4PGHA 2A61A 1HC8A 1XSVA 1S29A 3DPLC 3ULQB 4FISA 5D5UB 2M45A 2A6HF 1W0UA 4IOCF 3FKIJ 1QNTA 1TNTA 4R79A 1WSUA 4LGWA 1XGOA 3W6VA 2GQQA 4GYGA 1J09A 4IX7A 4A3FJ 5EDNA 4RS8A 2X6WA 4JX4A 3BROA 3ZMVA 2MD0A 3V8KA 3TQNA 2I5UA 4HX8A 1I1SA 1W36D 2PJPA 2DOEA 3L2RA 3BR2A 2D45A 1HSJA 3VEPA 4F7ZA 4XKBA 3JTGA 1N77A 3HSEA 1AU7A 2MSYA 3OMYA 4XOTA 3KP3A 4XOPA 1YYVA 2ZXWH 3KP4A 2ISYA 3WGHA 4AIDA 4D7MA 4D7NA 3M7GA 2OU2A 2FNAA 5E1XA 3RTRA 1DDNA 2E34A 1JUPA 3S17J 2HOTA 3OS1A 2DO7A 2OCCH 3JRDA 5CVUA 1V5EA 5GAGJ 1K83J 1PP7U 2IGNA 1IAWA 1MNMC 3L2UA 3GTJJ 4G7ZF 1NK2P 1X2MA 2VBZA 2UUZA 1OPCA 3VSKA 1K61A 3GFJA 1U3EM 2Y9ZA 3HL2A 3FMQA 3CCSI 2V7FA 2JK3A 4RAGA 1AKHA 3RYRA 3QRFF 5IOZA 1IN4A 2PMUA 1X3ZB 4HQEA 2CFOA 2KL4A 4ITVA 3OYMA 3S32A 4S0HB 3I64A 3OYLA 5JLXA 5K1YA 3Q3SA 4A69C 5KCMA 4B4CA 4BKXA 4PGGA 3ZN0A 5EYRA 5IY5H 2ZMEA 4AC0A 1O3RA 3ZXSA 3QQAA 2FBIA 3ZMUA 4XICA 4DBRA 3LSJA 5KNLA 5DCFA 4I2OA 4HAMA 4WXCA 4CZZA 4ENMA 3HRSA 4BXUA 2QBYB 1UB9A 2XC7A 1GT0C 3BDDA 3M3YJ 1UG0A 1W5CC 1B72A 4L0YB 1Q1HA 1FOKA 2WV0A 2FXAA 2X4HA 1B9NA 2MLGA 3LQQA 4ENNA 2EV0A 3IKVA 1OYWA 4A2UA 1HBXG 2OAZA 3GLLA 4PFOA 4NC8A 3S16J 2H94A 3J7YJ 2W84A 3DTKA 3IHUA 3KP6A 1RPWA 4D5FA 3ZMDA 5FKKA 1DUXC 4ON0A 2ZXJA 3E1SA 4F92B 2NYXA 5JLWA 4DNCA 3JRBA 2KZVA 1SVMA 2XDVA 2CFXA 4OIOF 1D8KA 3RKQA 3U9GA 4I98B 1SVLA 1G3SA 1P9QC 3DKYA 5HOOA 2VJ5A 4OWRB 3RCOA 4ZDLA 1V4RA 1T95A 2GOXB 2R3SA 4FETA 3CO6C 1G4DA 5DD4A 3H5NA 4BU2A 1DP3A 1EF4A 4FCYA 1JTYA 2FA5A 2HU9A 2OQRA 2PEXA 1B1BA 5FRNA 1KYWA 4D5CA 2GLOA 2ZMEC 3SJMA 3NWSA 1OYYA 4CO8A 2HDDA 5CQEA 1AHDP 2XUBA 5J8FA 1IN7A 3PUFA 3B73A 4X0GA 3G6EI 4XRSG 5BS6A 2PI0A 2FMYA 2ZMEB 2EK5A 2P5VA 2VE8A 5LBQA 2Y0SA 4W1UA 1OCOH 2OC6A 4GFBA 3DF8A 3VSLA 4EVIA 3HXLA 2WB1A 4G9YA 1XGSA 5DEQA 3V42A 4BACA 5LRRA 3ZQHA 4EJTA 5FRMA 1ZH5A 3DBRB 2R7RA 4R8HA 4HF2A 5BPDA 3VB2A 3HOZJ 1LPQA 3K0LA 4XNFA 2J5PA 3I71A 3ZMTA 2VQLA 1WI3A 2QENA 3PFIA 3IL2A 3DEEA 4C9YA 4EJUA 2DQRA 3NRVA 5ILUA 3CCMI 5FLXK 2LREA 2B0LA 3P7NA 1WJDA 2OA4A 1OCRH 5ICEA 4BE2A 2RDPA 5HLHA 1T98A 3KZZA 2DT7B 4UUSB 4LB5A 1QBJA 2NS0A 4Y13A 3ZPLA 2EA4A 2O03A 3IC7A 3KIOA 3ZQLA 2MC4A 2R7UA 2R7XA 3WU2C 1Z67A 1T0FA 3I4NJ 5HLIA 1XC5A 2DQLA 3BPXA 1KQ8A 3BOQA 3S2WA 3QU6A 3G73A 1YX5A 1Z7LA 4YFKF 3DFGA 4B47A 2VQGA 4B44A 1FYMA 2IRFG 5IPAA 4KFCA 1R5HA 3IWZA 5L3EA 4HG2A 1XCVA 5LRSA 3QYBA 2HI3A 1DU0A 2Z99A 2VL8A 1SD5A 1W0TA 1SFOJ 1GXPA 2PLYA 3ZR8X 4HPQA 1R49A 1ETKA 1K4SA 3HOWJ 2A69F 5KAFC 4B48A 2B7EA 4KNYA 4IKFA 1Y8QB 2A05A 3EDPA 5IT9K 2M87A 3ZN1A 1R1VA 4IHVA 2KRFA 3HKZA 5CVIA 5C44J 4AIHA 4NB5A 2ZCWA 4IEJA 3Q9VA 2BBYA 4M3FA 4PSWA 3U1DA 1I50J 4P96A 1X1CA 2QZ8A 2KIMA 3HIFA 3TMOA 4UVAA 3ASNH 2STWA 2MW8A 1IDYA 2JJ7A 3HOUJ 3CQZJ 3KP7A 3BTJA 2DOAA 2VJJA 3O8GA 2LTPA 4LJZF 3CCUI 1M1EB 3BQZA 3BTCA 4KIBA 1FOWA 2WADA 5M3MJ 2R5ZA 2ZNYA 2P5KA 3A02A 2LF8A 3PIPF 3F8MA 2NVUB 3FHZA 1P2FA 5E3LA 1QZEA 3V7RA 3EPZA 5F64A 5M5XJ 4HRIA 1OCZH 1Z3XA 4H4KC 3NQOA 2XB0X 1N25A 1RKWA 2ECBA 1T0FC 3RDIA 3GTKJ 5KVRA 1WKMA 1X4PA 3SFIA 1C0WA 1G3WA 3N97A 3FISA 3BY6A 1TT5B 3OYAA 4HF0A 4NBQA 4Y15A 1L3LA 2JSCA 2ZO4A 3K4NA 1E2XA 1YQAA 5BMZA 2CS3A 1WJFA 2CSOA 1LB2A 3HRUA 4GCVA 4N9IA 2YX4A 4GO1A 1YTYA 5HLTA 2NOGA 2HPIA 3HUGB 3TP3A 3IRQA 2GOMA 4F3QA 2IGOA 2MBFA 3LA3A
chains in the Genus database with same CATH topology
1CGPA 4CICA 3E5UA 1F5TA 1HW2A 2DT5A 1WI9A 1XN7A 5E8GA 2LF7A 4U0VA 5L3DA 3C7JA 2CQKA 2X0LA 4ENJA 3MZHA 2MA3A 2COMA 3RJPA 1P6RA 2WWYA 3R4KA 4U0WA 2UWMA 3FXRA 2L3DA 3DXJF 2DFIA 2DK5A 1A04A 3JAMK 1YS6A 1R5GA 2H6CA 5FFZA 1BC7C 1FYKA 2HDCA 3GUDA 4EJWA 4OIRF 2R7FA 2GIVA 1IRGA 2FBHA 1EH7A 3L00A 1FYLA 3I5UA 2VOOA 3E6BA 1TNSA 4KA4A 4CHUA 3K9TA 1TQMA 2UXNA 2EJRA 1R36A 4UNOA 4Q5SF 2XAQA 4AD9A 4I0AA 4IHTA 5ICFA 5FLXZ 1KGSA 2PQ8A 2E1CA 5DUKA 4G6DA 2NRAC 1YW9A 2BEOA 4I09A 2PG4A 1VTNC 1U78A 3Q9SA 3MAJA 1O7FA 2F5DA 4CYDA 1V3FA 5D6FA 4KICA 3I53A 2PN6A 2FQ3A 3ROUA 2F5CA 2IJLA 2XHKA 1MJBA 3ERED 5FD6A 3KE2A 1FBUA 3JSPA 1HXDA 2CG4A 1OR7A 3F72A 4WXHA 1XD7A 2HKXA 4LLNA 5E17F 2HQNA 1USTA 3W6JB 1XCBA 1P4XA 3AAFA 2STTA 4BHPA 4M9SA 2V1XA 3GZ5A 3WTWC 2HS5A 3EETA 2FF4A 3WTSC 3TOBA 2RV8A 5HDGA 2HKOA 4LFUA 3EYYA 2K86A 2IVMA 1BIAA 2V79A 1SD7A 6PAXA 1JE8A 3K69A 1T2KA 2CO5A 1ZRDA 3R0AA 1KQ9A 2RC4A 1FBQA 4KYWA 3DQVC 4CXFA 1G3TA 3GEZA 1ZGAA 3CUQA 3F6OA 2EFPA 1GXQA 2OBPA 4LLGF 2QYOA 1Z6RA 4ZYDA 3HRTA 5LGNA 5LHGA 2EFWA 1HW1A 4ASNA 2FRHA 3KFWX 3PQJA 3R0JA 1LNWA 5JVTA 4NHJA 2XGXA 2V9VA 1ZRFA 3LQRA 2FEZA 5TRDA 1MKMA 1J9IA 1GVJA 5HDKA 3I59A 2JRTA 5LEJA 2JPBA 4MTEA 4EGYA 4RGUA 3HOTA 5L3CA 3KP5A 1YO5C 3EYIA 1QZZA 3JAMZ 2MH2A 2V1DA 4L9TA 3NEUA 1EH8A 2ZFWA 2XASA 3K1NA 4MEYF 2TDXA 1FP1D 2DPDA 3E6DA 4XBFA 3CUQC 5A2QZ 2DU9A 3OV8A 4UVCA 2DW4A 4BAYA 3CUQB 2Q2EA 1S3JA 3TOAA 2XAFA 2ETHA 3HOSA 2RNJA 4HA8A 5DCMA 4HLYA 5KK1A 3D0SA 2P7CB 4ESJA 4U88A 4TV7A 2A3SA 2EFQA 1K6OA 2NAZA 2P5LC 2UXXA 3T8RA 2DAOA 4I01A 4HZFA 4B09A 4HV5A 4IXAA 3MWMA 4UXNA 5AIQA 2VONA 2ESNA 2HZTA 3I59B 2O0YA 2PMHA 1FNNA 1K79A 1T39A 5D4SA 1HQCA 2M1BA 2QLZA 3SZPA 4CGZA 3CLOA 4BQAA 1Z05A 3MFKA 3KP2A 4EQQA 2FE3A 2KIUA 2HYGD 1S7AA 3HRMA 1YG2A 3WTVC 2GA1A 1QQIA 3FM3A 2HTSA 4YG2F 5DCMB 2KIFA 2LKPA 3QP5A 3K2ZA 4OINF 1BN5A 2R7DA 3RKWA 4WK8F 2EB7A 2P8TA 3GFLA 3TGNA 4JBAA 3F8NA 1G6NA 4P9UA 3V7SA 5HS9A 1Z7UA 3V8LA 2VE9A 2IA2A 2VT3A 4BHCA 5CJ9A 1IXSB 2L4MA 3MZYA 3HYIA 3E3VA 4O5VA 3WTYC 1ZRCA 3EQLF 1KU3A 5CYVA 2K27A 4UHTA 4A5MA 1R00A 4EJVA 4ESBA 1FWZA 2DI3A 2HYFA 1U5TA 5L3FA 1F1ZA 2P6SA 1B59A 3TKYA 2O3FA 1B4AA 1P4WA 5L3BA 3MEXA 2HGCA 1ZYRF 3K1PA 5HS7A 4ZYEA 2IA0A 2JTVA 2XAJA 1LJ9A 4UV8A 4G6QA 1E17A 5ICCA 3GW2A 2Y0MA 1J7KA 3H3UA 5F6FA 2A68F 2JT1A 2IT0A 1PP8F 1STZA 1RUOA 3J7AO 1XSDA 3QU3A 3IKTA 1D8JA 5JFRA 5L3GA 4I02A 4M6YA 5DYMA 1YW8A 2YPRA 5D8KB 4HV6A 3HTSB 3ZP5A 2GXGA 4LB6B 5D5WB 4CDGA 3JW4A 3IWFA 1DPRA 5JHUA 2FNPA 2L54A 4JQFA 4M9ZA 4RAZA 1GHCA 3P9KA 2MD5A 1IXCA 1U5TB 2E7XA 2D1VA 4EM1A 1J59A 3L2CA 2HTJA 4RAYA 5AIPA 4LLLA 3L09A 3RI4A 2P7VB 4A0ZA 2BE5F 5HLGA 2QQ9A 2F5FA 1MJAA 1F9NA 4HYEA 5E18F 4IRGA 4S04A 4U0YA 2E7WA 4IVNA 3FZVA 5LHIA 4KN7X 2HWVA 1LQ1A 1CF7A 2BGCA 3J80K 3I58A 2IPQX 2EFNA 1UFMA 3GFIA 1ZREA 5JR3A 1G3YA 2YX7A 4MQVA 3SFZA 4OOIA 1FLIA 1UCRA 4A12A 1FBSA 2Z5UA 5EEHA 4BYYA 1W4MA 1TW2A 1O7LA 3C1DA 3LFKA 4WF2A 4NQWA 3F8BA 1O3SA 3FXQA 3SXYA 1I6XA 4I7HA 4LK1F 5DD8A 1OMIA 3QAHA 4Y17A 3CTAA 4KT5C 4YFNF 1TTYA 2VOPA 2LNBA 2CGPA 4L5JA 2MH9A 3KLOA 3GX4X 3KETA 2IA1A 4FX0A 3Q5FA 4A5NA 1CF7B 4HOBA 1MDMA 1YIOA 1REPC 1WWXA 1KQ0A 2QM3A 4M73A 1R23A 1O57A 1R7JA 2F5EA 1IN8A 2NNNA 1DP7P 2VBWA 3CUOA 3BJ6A 2VN2A 2H27A 4M6XA 1FC3A 3G3ZA 1H0MA 1WQ2A 1ZG3A 4FX4A 1TQIA 2VC1A 2FU4A 4QWQA 4M9XA 1JXSA 3P9CA 5BQTA 1TBXA 3SQNA 4DQ2A 2G9WA 3RPUA 5EEGA 1SMTA 3WU1B 5ED4A 1Z91A 1TLHB 4OU0A 3GFMA 1XSXA 4ZYHA 4L9NA 1I27A 5H6RA 1W5SA 5DV5A 2D1HA 3LAPA 3V4GA 1DPUA 1YW7A 1MDMB 3DP7A 5FB2A 3WTUC 1ZHFA 2Q8KA 3PQKA 5IT9Z 1YFHA 4GGGA 4MTDA 3QP6A 3R6SA 1S6LA 1J75A 3WTZA 1LDJA 1BC8C 2Z33A 1I1GA 1FZPB 4BH9A 2PBIA 1BIBA 2RN7A 5CLSA 4EM0B 1FSHA 3DEUA 3ML6A 1RI7A 4LG0A 2RKHA 2IW5A 2ZBKA 2KKOA 5LLQA 3J80Z 1T6SA 5IT3A 1XB4A 2RQPA 4ESFA 1FP2A 2QUFA 2YU3A 1XMAA 2G7HA 3WODF 1NHAA 2FBKA 1LDDA 1ZG5A 3L9FA 3MQ0A 4KMUX 4L9JA 3GZ6A 1IN6A 1I5ZA 1MZBA 1TW3A 4PZJA 1U2WA 2WTEA 1B6AA 3TO6A 1BM9A 4RGXA 4M72A 3BWGA 3WGIA 4GXOA 1RZ4A 2OZUA 4EM2A 2HR3A 3FXUA 2DLLA 2WC2A 1QPMA 3REOA 2XROA 3WU0A 1LVAA 3BZ6A 3K1MA 2K4BA 1F4KA 1FT9A 4MEXF 3FX3A 4N9HA 3F8FA 2ACJA 4OMZA 3HTUA 1SD4A 2XKPA 3U2RA 3T1BA 3ZMSA 4P55A 4RB0A 5JI6A 3CDHA 2XKOA 3JTHA 4XRFA 3J81K 1W5TA 4MHGA 2ZNZA 4LD5A 4BNCA 3DKWA 3RKYA 2ISZA 3VODA 4XSZF 2BYVE 4GYIA 2XRNA 3CJNA 1JHHA 1HW5A 3DV8A 2Q0OA 3FM5A 4MGRA 4PDKA 4A6DA 5TJJA 2GA2A 2MC3A 2LSOA 1O3QA 1ZLKA 4G8XA 2QBYA 2O6GE 4HX7A 2Y75A 2V1UA 3O3KA 5D5XB 2VODA 4N0BA 2W57A 2VC0A 3H92A 1Y0UA 1KU9A 1SD6A 4ZH4F 5HDNA 5K5QA 2XAHA 1LEBA 3F22A 1HSTA 4QLCU 3C3WA 2QQBA 1RUNA 1FX7A 1AWCA 3C18A 4L18B 5LEKA 1PDNC 4AVPA 3V8JA 4OIPF 1ULYA 1BJAA 1JHFA 1ZAOA 2HFHA 4RGSA 1HKTA 2ZJ2A 5FGMA 3BPVA 4YIIA 4P5OA 2E1NA 4L0ZB 5H20A 1BI3A 3R61A 4WWCA 4HF1A 2FMLA 2JZYA 1BOAA 3T0YA 1ZARA 4JK1X 2K7LA 2W85A 1IW7F 2PFBA 3T5XA 4E70A 4I0BA 1T38A 4BHBA 2F2EA 4IRHA 3RPQA 1ZGJA 1SFEA 4HX4A 4UV9A 3VOEA 3P9IA 3T8TA 1PUEE 4HDUA 1R22A 4KMFA 1SFXA 4ZYGA 1KYZA 2XIGA 1YS7A 4O6JA 1K7AA 2Y48A 1H9GA 2EV5A 3O2PE 4RB2C 2DBBA 4XLNF 1MD0A 4Q4ZF 3HSRA 2A5YB 1R58A 1P92A 4RB3C 4MNUA 2FSWA 3KEQA 1SFUA 2GZWA 1USSA 4IJAA 1MJ9A 1W7PA 4PCQA 5CVRA 2HQRA 3BJAA 5D4RA 1KU7A 5CVJA 2BV6A 4U7BA 3TO9A 4XLPF 3LA2A 4WX9A 2EA2A 2IP2A 2GAUA 5HS8A 1J2XA 2CWEA 1LDKB 5FFXA 3IRRA 3F8CA 1EV7A 2RVCA 2M8EA 3ABTA 3F23A 4AIKA 3M1EA 5K5RA 1ZLJA 3J81Z 1BI0A 4O3MA 3WE3A 2P6TA 1W7PD 1U5TC 3GYHX 1O3TA 4ETSA 1BI2A 3M9AA 2YSRA 5E20A 2LDUA 4KDPA 3L7WA 1L0OC 3RKXA 3VFZA 2DK8A 1ON2A 4KN4X 5ICGA 2YR2A 1W7PB 3HUGA 2QQAA 4ZZDA 2O8XA 4YIFA 3M8EA 1X3UA 1FPQA 1KU2A 4M71A 4B8XA 1U8RA 3E97A 4EGZA 1IN5A 2EFOA 2QVOA 5LHHA 1Z9CA 4UUVA 2VT2A 4IPAA 5ILVA 5LGTA 1H9TA 3BP8A 4ZZLA 5BPIA 2O61A 2QWWA 2D2WA 4M74A 3FF5A 5LGUA 3GF2A 4D0PA 2KJBA 3O6BB 3D5LA 5FD5A 2VXZA 4G7OF 3ZQ7A 3LSTA 3HSFA 2W25A 1JGSA 1IF1A 4S05A 1BBYA 4Z2YA 5HVQC 1XGNA 2XAGA 2P4WA 5J6XA 3FMRA 4H0EA 3DPTA 3HHGA 1HKQA 2L02A 2CYYA 1FY7A 2OZ6A 2GXBA 4YFXF 1J0RA 4Q48A 2VBYA 3E5XA 5ERIA 2Z9OA 4P9FA 1QGPA 1AOYA 3ECHA 2KJCA 5H6QA 4OMYA 1MGTA 4ENKA 1IXRC 2W24A 2M30A 1Z6TA 2HOEA 3FMSA 1TQPA 5DUIA 2L4AA 1HKSA 4HW0A 1XMKA 1K78A 1WRJA 2G7UA 1XDUA 2ESHA 1IUYA 5D5VB 4HLXA 3ISPA 4IRIA 3R60A 3KLNA 2ZKZA 2M5WA 1B9MA 3TDZC 1UHMA 4HQMA 4IF4A 4HBLA 3LWFA 1QZYA 2A07F 5A2QK 1R1UA 4WCGA 3F21A 1ZG1A 4EJOA 1S7OA 2RGVA 4LK0F 2A6EF 5E1ZB 5BOXA 3I4PA 4EMSA 2VBXA 3WGGA 4WXDA 5AONA 1D3YA 2J5OA 2GWRA 3H3ZA 1Z1DA 3SHFA 2ELHA 3I0TA 3GWZA 2DTRA 5CVVA 1ON1A 2EV6A 3FWEA 1OYIA 1K78B 1IZ1A 2MLKA 1ONVA 4AWXB 1IRFA 2OQGA 3E5QA 5ILSA 5E8IA 2EWNA 2Z3YA 3EUHA 1SMYF 4IHSA 2K4JA 4HDVA 2ADUA 4G7HF 3RYPA 3I54A 1J5YA 5J8CA 4A6EA 2DPUA 3COAC 5D6EA 2FOKA 1R1TA 2H6BA 1FSEA 4KIFA 4L5IA 3LAJA 1D5VA 2NNYA 3TO7A 1OKRA 4KUMA 5D8LB 4A0YA 1XGMA 3BJOA 1UHWA 3GXOA 3E6MA 4K2EA 3V7CA 1U6GA 4OIQF 2CW0F 3QOPA 2K02A 2JPCA 4Q47A 3W6KB 4G94A 3E6CC 1P4AA 1BI1A 5K5OA 4U7DA 3WTTC 3OOPA 4L9VA 4LMYA 2V6CA 4RGRA 3ZMZA 2C6YA 4UVBA 2HEOA 1XDSA 3B02A 1LEAA 3GVAA 5E1WA 1YLFA 3RIRA 4AIJA 4XSXF 3HHHA 3ECOA 3WTXC 1RIOH 4MQ9F 4LG0B 5FO5A 4FT8A 4KIGA 1S8NA 3KEOA 3WE2A 2XV4S 3GO5A 3N4MA 3SZTA 3ELKA 1QO0D 1RNLA 3QPHA 3QPTA 3LA7A 4FHTA 3ABUA 5DDGA 3CO7C 2AS5F 2AXLA 2L01A 3F3XA 2UZKA 1ZN2A 1EH6A 3F6VA 1KA8A 1ODDA 2H09A 5F1RA 3KCCA 2OD5A 3TDUC 4A0XA 4EV0A 3JSOA 4R1HA 1SAXA 3WG9A 4RB1A 3M8FA 3GLXA 2XVCA 3KZYA 3MCZA 4PGHA 2A61A 1XSVA 1S29A 3DPLC 3ULQB 5D5UB 2M45A 2A6HF 1QNTA 1TNTA 4R79A 1WSUA 4LGWA 1XGOA 2GQQA 4GYGA 4RS8A 3BROA 3ZMVA 3V8KA 3TQNA 4HX8A 1I1SA 2PJPA 2D45A 1HSJA 3VEPA 4F7ZA 3JTGA 3HSEA 3KP3A 1YYVA 3KP4A 2ISYA 3WGHA 3M7GA 2OU2A 2FNAA 5E1XA 3RTRA 1DDNA 2DO7A 5CVUA 1PP7U 1IAWA 4G7ZF 2VBZA 1OPCA 3GFJA 1U3EM 3FMQA 3RYRA 3QRFF 1IN4A 2PMUA 4HQEA 3I64A 5K1YA 4PGGA 3ZN0A 2ZMEA 1O3RA 2FBIA 3ZMUA 5DCFA 4I2OA 4HAMA 4WXCA 4CZZA 4ENMA 3HRSA 4BXUA 2QBYB 1UB9A 3BDDA 4L0YB 1Q1HA 1FOKA 2WV0A 2FXAA 2X4HA 1B9NA 2MLGA 3LQQA 4ENNA 2EV0A 3IKVA 1OYWA 4A2UA 1HBXG 2OAZA 2H94A 2W84A 3IHUA 3KP6A 3ZMDA 1DUXC 4ON0A 2ZXJA 2NYXA 4DNCA 2CFXA 4OIOF 1D8KA 3U9GA 4I98B 1G3SA 5HOOA 1V4RA 2R3SA 3CO6C 1G4DA 5DD4A 2FA5A 2PEXA 2OQRA 1B1BA 1KYWA 1OYYA 4CO8A 2XUBA 5J8FA 1IN7A 3B73A 5BS6A 2PI0A 2FMYA 2ZMEB 2EK5A 2P5VA 5LBQA 2VE8A 3DF8A 4EVIA 4G9YA 1XGSA 5DEQA 4EJTA 5LRRA 1ZH5A 4HF2A 4R8HA 5BPDA 3VB2A 3K0LA 2J5PA 3I71A 3ZMTA 2QENA 3PFIA 3IL2A 4EJUA 2DQRA 3NRVA 5ILUA 5FLXK 2B0LA 3P7NA 2OA4A 5ICEA 2RDPA 5HLHA 1T98A 3KZZA 4LB5A 1QBJA 2NS0A 4Y13A 3ZPLA 2EA4A 2O03A 3IC7A 1T0FA 5HLIA 2DQLA 3BPXA 1KQ8A 3BOQA 3S2WA 3QU6A 3G73A 4YFKF 3DFGA 1FYMA 2IRFG 4KFCA 1R5HA 3IWZA 5L3EA 1XCVA 5LRSA 2Z99A 1SD5A 2PLYA 1GXPA 2A69F 4KNYA 3EDPA 5IT9K 2M87A 3ZN1A 1R1VA 2KRFA 5CVIA 4AIHA 4NB5A 2ZCWA 3Q9VA 2BBYA 3U1DA 4P96A 2QZ8A 2KIMA 3HIFA 4UVAA 2STWA 3KP7A 4LJZF 4KIBA 2ZNYA 2P5KA 2LF8A 3F8MA 3FHZA 1P2FA 3V7RA 5F64A 3NQOA 3RDIA 5KVRA 1WKMA 1C0WA 1G3WA 3N97A 3BY6A 4HF0A 1L3LA 4Y15A 2JSCA 2ZO4A 1E2XA 1YQAA 5BMZA 2CSOA 1LB2A 3HRUA 4GCVA 4N9IA 2YX4A 4GO1A 1YTYA 3IRQA 2MBFA 3LA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGP A;  4CIC A;  3E5U A;  1F5T A;  1HW2 A;  2DT5 A;  1WI9 A;  1XN7 A;  5E8G A;  2LF7 A;  4U0V A;  5L3D A;  3C7J A;  2CQK A;  2X0L A;  4ENJ A;  3MZH A;  2MA3 A;  2COM A;  3RJP A;  1P6R A;  2WWY A;  3R4K A;  4U0W A;  2UWM A;  3FXR A;  2L3D A;  3DXJ F;  2DFI A;  2DK5 A;  1A04 A;  3JAM K;  1YS6 A;  1R5G A;  2H6C A;  5FFZ A;  1BC7 C;  1FYK A;  2HDC A;  3GUD A;  4EJW A;  4OIR F;  2R7F A;  2GIV A;  1IRG A;  2FBH A;  1EH7 A;  3L00 A;  1FYL A;  3I5U A;  2VOO A;  3E6B A;  1TNS A;  4KA4 A;  4CHU A;  3K9T A;  1TQM A;  2UXN A;  2EJR A;  1R36 A;  4UNO A;  4Q5S F;  2XAQ A;  4AD9 A;  4I0A A;  4IHT A;  5ICF A;  5FLX Z;  1KGS A;  2PQ8 A;  2E1C A;  5DUK A;  4G6D A;  2NRA C;  1YW9 A;  2BEO A;  4I09 A;  2PG4 A;  1VTN C;  1U78 A;  3Q9S A;  3MAJ A;  1O7F A;  2F5D A;  4CYD A;  1V3F A;  5D6F A;  4KIC A;  3I53 A;  2PN6 A;  2FQ3 A;  3ROU A;  2F5C A;  2IJL A;  2XHK A;  1MJB A;  3ERE D;  5FD6 A;  3KE2 A;  1FBU A;  3JSP A;  1HXD A;  2CG4 A;  1OR7 A;  3F72 A;  4WXH A;  1XD7 A;  2HKX A;  4LLN A;  5E17 F;  2HQN A;  1UST A;  3W6J B;  1XCB A;  1P4X A;  3AAF A;  2STT A;  4BHP A;  4M9S A;  2V1X A;  3GZ5 A;  3WTW C;  2HS5 A;  3EET A;  2FF4 A;  3WTS C;  3TOB A;  2RV8 A;  5HDG A;  2HKO A;  4LFU A;  3EYY A;  2K86 A;  2IVM A;  1BIA A;  2V79 A;  1SD7 A;  6PAX A;  1JE8 A;  3K69 A;  1T2K A;  2CO5 A;  1ZRD A;  3R0A A;  1KQ9 A;  2RC4 A;  1FBQ A;  4KYW A;  3DQV C;  4CXF A;  1G3T A;  3GEZ A;  1ZGA A;  3CUQ A;  3F6O A;  2EFP A;  1GXQ A;  2OBP A;  4LLG F;  2QYO A;  1Z6R A;  4ZYD A;  3HRT A;  5LGN A;  5LHG A;  2EFW A;  1HW1 A;  4ASN A;  2FRH A;  3KFW X;  3PQJ A;  3R0J A;  1LNW A;  5JVT A;  4NHJ A;  2XGX A;  2V9V A;  1ZRF A;  3LQR A;  2FEZ A;  5TRD A;  1MKM A;  1J9I A;  1GVJ A;  5HDK A;  3I59 A;  2JRT A;  5LEJ A;  2JPB A;  4MTE A;  4EGY A;  4RGU A;  3HOT A;  5L3C A;  3KP5 A;  1YO5 C;  3EYI A;  1QZZ A;  3JAM Z;  2MH2 A;  2V1D A;  4L9T A;  3NEU A;  1EH8 A;  2ZFW A;  2XAS A;  3K1N A;  4MEY F;  2TDX A;  1FP1 D;  2DPD A;  3E6D A;  4XBF A;  3CUQ C;  5A2Q Z;  2DU9 A;  3OV8 A;  4UVC A;  2DW4 A;  4BAY A;  3CUQ B;  2Q2E A;  1S3J A;  3TOA A;  2XAF A;  2ETH A;  3HOS A;  2RNJ A;  4HA8 A;  5DCM A;  4HLY A;  5KK1 A;  3D0S A;  2P7C B;  4ESJ A;  4U88 A;  4TV7 A;  2A3S A;  2EFQ A;  1K6O A;  2NAZ A;  2P5L C;  2UXX A;  3T8R A;  2DAO A;  4I01 A;  4HZF A;  4B09 A;  4HV5 A;  4IXA A;  3MWM A;  4UXN A;  5AIQ A;  2VON A;  2ESN A;  2HZT A;  3I59 B;  2O0Y A;  2PMH A;  1FNN A;  1K79 A;  1T39 A;  5D4S A;  1HQC A;  2M1B A;  2QLZ A;  3SZP A;  4CGZ A;  3CLO A;  4BQA A;  1Z05 A;  3MFK A;  3KP2 A;  4EQQ A;  2FE3 A;  2KIU A;  2HYG D;  1S7A A;  3HRM A;  1YG2 A;  3WTV C;  2GA1 A;  1QQI A;  3FM3 A;  2HTS A;  4YG2 F;  5DCM B;  2KIF A;  2LKP A;  3QP5 A;  3K2Z A;  4OIN F;  1BN5 A;  2R7D A;  3RKW A;  4WK8 F;  2EB7 A;  2P8T A;  3GFL A;  3TGN A;  4JBA A;  3F8N A;  1G6N A;  4P9U A;  3V7S A;  5HS9 A;  1Z7U A;  3V8L A;  2VE9 A;  2IA2 A;  2VT3 A;  4BHC A;  5CJ9 A;  1IXS B;  2L4M A;  3MZY A;  3HYI A;  3E3V A;  4O5V A;  3WTY C;  1ZRC A;  3EQL F;  1KU3 A;  5CYV A;  2K27 A;  4UHT A;  4A5M A;  1R00 A;  4EJV A;  4ESB A;  1FWZ A;  2DI3 A;  2HYF A;  1U5T A;  5L3F A;  1F1Z A;  2P6S A;  1B59 A;  3TKY A;  2O3F A;  1B4A A;  1P4W A;  5L3B A;  3MEX A;  2HGC A;  1ZYR F;  3K1P A;  5HS7 A;  4ZYE A;  2IA0 A;  2JTV A;  2XAJ A;  1LJ9 A;  4UV8 A;  4G6Q A;  1E17 A;  5ICC A;  3GW2 A;  2Y0M A;  1J7K A;  3H3U A;  5F6F A;  2A68 F;  2JT1 A;  2IT0 A;  1PP8 F;  1STZ A;  1RUO A;  3J7A O;  1XSD A;  3QU3 A;  3IKT A;  1D8J A;  5JFR A;  5L3G A;  4I02 A;  4M6Y A;  5DYM A;  1YW8 A;  2YPR A;  5D8K B;  4HV6 A;  3HTS B;  3ZP5 A;  2GXG A;  4LB6 B;  5D5W B;  4CDG A;  3JW4 A;  3IWF A;  1DPR A;  5JHU A;  2FNP A;  2L54 A;  4JQF A;  4M9Z A;  4RAZ A;  1GHC A;  3P9K A;  2MD5 A;  1IXC A;  1U5T B;  2E7X A;  2D1V A;  4EM1 A;  1J59 A;  3L2C A;  2HTJ A;  4RAY A;  5AIP A;  4LLL A;  3L09 A;  3RI4 A;  2P7V B;  4A0Z A;  2BE5 F;  5HLG A;  2QQ9 A;  2F5F A;  1MJA A;  1F9N A;  4HYE A;  5E18 F;  4IRG A;  4S04 A;  4U0Y A;  2E7W A;  4IVN A;  3FZV A;  5LHI A;  4KN7 X;  2HWV A;  1LQ1 A;  1CF7 A;  2BGC A;  3J80 K;  3I58 A;  2IPQ X;  2EFN A;  1UFM A;  3GFI A;  1ZRE A;  5JR3 A;  1G3Y A;  2YX7 A;  4MQV A;  3SFZ A;  4OOI A;  1FLI A;  1UCR A;  4A12 A;  1FBS A;  2Z5U A;  5EEH A;  4BYY A;  1W4M A;  1TW2 A;  1O7L A;  3C1D A;  3LFK A;  4WF2 A;  4NQW A;  3F8B A;  1O3S A;  3FXQ A;  3SXY A;  1I6X A;  4I7H A;  4LK1 F;  5DD8 A;  1OMI A;  3QAH A;  4Y17 A;  3CTA A;  4KT5 C;  4YFN F;  1TTY A;  2VOP A;  2LNB A;  2CGP A;  4L5J A;  2MH9 A;  3KLO A;  3GX4 X;  3KET A;  2IA1 A;  4FX0 A;  3Q5F A;  4A5N A;  1CF7 B;  4HOB A;  1MDM A;  1YIO A;  1REP C;  1WWX A;  1KQ0 A;  2QM3 A;  4M73 A;  1R23 A;  1O57 A;  1R7J A;  2F5E A;  1IN8 A;  2NNN A;  1DP7 P;  2VBW A;  3CUO A;  3BJ6 A;  2VN2 A;  2H27 A;  4M6X A;  1FC3 A;  3G3Z A;  1H0M A;  1WQ2 A;  1ZG3 A;  4FX4 A;  1TQI A;  2VC1 A;  2FU4 A;  4QWQ A;  4M9X A;  1JXS A;  3P9C A;  5BQT A;  1TBX A;  3SQN A;  4DQ2 A;  2G9W A;  3RPU A;  5EEG A;  1SMT A;  3WU1 B;  5ED4 A;  1Z91 A;  1TLH B;  4OU0 A;  3GFM A;  1XSX A;  4ZYH A;  4L9N A;  1I27 A;  5H6R A;  1W5S A;  5DV5 A;  2D1H A;  3LAP A;  3V4G A;  1DPU A;  1YW7 A;  1MDM B;  3DP7 A;  5FB2 A;  3WTU C;  1ZHF A;  2Q8K A;  3PQK A;  5IT9 Z;  1YFH A;  4GGG A;  4MTD A;  3QP6 A;  3R6S A;  1S6L A;  1J75 A;  3WTZ A;  1LDJ A;  1BC8 C;  2Z33 A;  1I1G A;  1FZP B;  4BH9 A;  2PBI A;  1BIB A;  2RN7 A;  5CLS A;  4EM0 B;  1FSH A;  3DEU A;  3ML6 A;  1RI7 A;  4LG0 A;  2RKH A;  2IW5 A;  2ZBK A;  2KKO A;  5LLQ A;  3J80 Z;  1T6S A;  5IT3 A;  1XB4 A;  2RQP A;  4ESF A;  1FP2 A;  2QUF A;  2YU3 A;  1XMA A;  2G7H A;  3WOD F;  1NHA A;  2FBK A;  1LDD A;  1ZG5 A;  3L9F A;  3MQ0 A;  4KMU X;  4L9J A;  3GZ6 A;  1IN6 A;  1I5Z A;  1MZB A;  1TW3 A;  4PZJ A;  1U2W A;  2WTE A;  1B6A A;  3TO6 A;  1BM9 A;  4RGX A;  4M72 A;  3BWG A;  3WGI A;  4GXO A;  1RZ4 A;  2OZU A;  4EM2 A;  2HR3 A;  3FXU A;  2DLL A;  2WC2 A;  1QPM A;  3REO A;  2XRO A;  3WU0 A;  1LVA A;  3BZ6 A;  3K1M A;  2K4B A;  1F4K A;  1FT9 A;  4MEX F;  3FX3 A;  4N9H A;  3F8F A;  2ACJ A;  4OMZ A;  3HTU A;  1SD4 A;  2XKP A;  3U2R A;  3T1B A;  3ZMS A;  4P55 A;  4RB0 A;  5JI6 A;  3CDH A;  2XKO A;  3JTH A;  4XRF A;  3J81 K;  1W5T A;  4MHG A;  2ZNZ A;  4LD5 A;  4BNC A;  3DKW A;  3RKY A;  2ISZ A;  3VOD A;  4XSZ F;  2BYV E;  4GYI A;  2XRN A;  3CJN A;  1JHH A;  1HW5 A;  3DV8 A;  2Q0O A;  3FM5 A;  4MGR A;  4PDK A;  4A6D A;  5TJJ A;  2GA2 A;  2MC3 A;  2LSO A;  1O3Q A;  1ZLK A;  4G8X A;  2QBY A;  2O6G E;  4HX7 A;  2Y75 A;  2V1U A;  3O3K A;  5D5X B;  2VOD A;  4N0B A;  2W57 A;  2VC0 A;  3H92 A;  1Y0U A;  1KU9 A;  1SD6 A;  4ZH4 F;  5HDN A;  5K5Q A;  2XAH A;  1LEB A;  3F22 A;  1HST A;  4QLC U;  3C3W A;  2QQB A;  1RUN A;  1FX7 A;  1AWC A;  3C18 A;  4L18 B;  5LEK A;  1PDN C;  4AVP A;  3V8J A;  4OIP F;  1ULY A;  1BJA A;  1JHF A;  1ZAO A;  2HFH A;  4RGS A;  1HKT A;  2ZJ2 A;  5FGM A;  3BPV A;  4YII A;  4P5O A;  2E1N A;  4L0Z B;  5H20 A;  1BI3 A;  3R61 A;  4WWC A;  4HF1 A;  2FML A;  2JZY A;  1BOA A;  3T0Y A;  1ZAR A;  4JK1 X;  2K7L A;  2W85 A;  1IW7 F;  2PFB A;  3T5X A;  4E70 A;  4I0B A;  1T38 A;  4BHB A;  2F2E A;  4IRH A;  3RPQ A;  1ZGJ A;  1SFE A;  4HX4 A;  4UV9 A;  3VOE A;  3P9I A;  3T8T A;  1PUE E;  4HDU A;  1R22 A;  4KMF A;  1SFX A;  4ZYG A;  1KYZ A;  2XIG A;  1YS7 A;  4O6J A;  1K7A A;  2Y48 A;  1H9G A;  2EV5 A;  3O2P E;  4RB2 C;  2DBB A;  4XLN F;  1MD0 A;  4Q4Z F;  3HSR A;  2A5Y B;  1R58 A;  1P92 A;  4RB3 C;  4MNU A;  2FSW A;  3KEQ A;  1SFU A;  2GZW A;  1USS A;  4IJA A;  1MJ9 A;  1W7P A;  4PCQ A;  5CVR A;  2HQR A;  3BJA A;  5D4R A;  1KU7 A;  5CVJ A;  2BV6 A;  4U7B A;  3TO9 A;  4XLP F;  3LA2 A;  4WX9 A;  2EA2 A;  2IP2 A;  2GAU A;  5HS8 A;  1J2X A;  2CWE A;  1LDK B;  5FFX A;  3IRR A;  3F8C A;  1EV7 A;  2RVC A;  2M8E A;  3ABT A;  3F23 A;  4AIK A;  3M1E A;  5K5R A;  1ZLJ A;  3J81 Z;  1BI0 A;  4O3M A;  3WE3 A;  2P6T A;  1W7P D;  1U5T C;  3GYH X;  1O3T A;  4ETS A;  1BI2 A;  3M9A A;  2YSR A;  5E20 A;  2LDU A;  4KDP A;  3L7W A;  1L0O C;  3RKX A;  3VFZ A;  2DK8 A;  1ON2 A;  4KN4 X;  5ICG A;  2YR2 A;  1W7P B;  3HUG A;  2QQA A;  4ZZD A;  2O8X A;  4YIF A;  3M8E A;  1X3U A;  1FPQ A;  1KU2 A;  4M71 A;  4B8X A;  1U8R A;  3E97 A;  4EGZ A;  1IN5 A;  2EFO A;  2QVO A;  5LHH A;  1Z9C A;  4UUV A;  2VT2 A;  4IPA A;  5ILV A;  5LGT A;  1H9T A;  3BP8 A;  4ZZL A;  5BPI A;  2O61 A;  2QWW A;  2D2W A;  4M74 A;  3FF5 A;  5LGU A;  3GF2 A;  4D0P A;  2KJB A;  3O6B B;  3D5L A;  5FD5 A;  2VXZ A;  4G7O F;  3ZQ7 A;  3LST A;  3HSF A;  2W25 A;  1JGS A;  1IF1 A;  4S05 A;  1BBY A;  4Z2Y A;  5HVQ C;  1XGN A;  2XAG A;  2P4W A;  5J6X A;  3FMR A;  4H0E A;  3DPT A;  3HHG A;  1HKQ A;  2L02 A;  2CYY A;  1FY7 A;  2OZ6 A;  2GXB A;  4YFX F;  1J0R A;  4Q48 A;  2VBY A;  3E5X A;  5ERI A;  2Z9O A;  4P9F A;  1QGP A;  1AOY A;  3ECH A;  2KJC A;  5H6Q A;  4OMY A;  1MGT A;  4ENK A;  1IXR C;  2W24 A;  2M30 A;  1Z6T A;  2HOE A;  3FMS A;  1TQP A;  5DUI A;  2L4A A;  1HKS A;  4HW0 A;  1XMK A;  1K78 A;  1WRJ A;  2G7U A;  1XDU A;  2ESH A;  1IUY A;  5D5V B;  4HLX A;  3ISP A;  4IRI A;  3R60 A;  3KLN A;  2ZKZ A;  2M5W A;  1B9M A;  3TDZ C;  1UHM A;  4HQM A;  4IF4 A;  4HBL A;  3LWF A;  1QZY A;  2A07 F;  5A2Q K;  1R1U A;  4WCG A;  3F21 A;  1ZG1 A;  4EJO A;  1S7O A;  2RGV A;  4LK0 F;  2A6E F;  5E1Z B;  5BOX A;  3I4P A;  4EMS A;  2VBX A;  3WGG A;  4WXD A;  5AON A;  1D3Y A;  2J5O A;  2GWR A;  3H3Z A;  1Z1D A;  3SHF A;  2ELH A;  3I0T A;  3GWZ A;  2DTR A;  5CVV A;  1ON1 A;  2EV6 A;  3FWE A;  1OYI A;  1K78 B;  1IZ1 A;  2MLK A;  1ONV A;  4AWX B;  1IRF A;  2OQG A;  3E5Q A;  5ILS A;  5E8I A;  2EWN A;  2Z3Y A;  3EUH A;  1SMY F;  4IHS A;  2K4J A;  4HDV A;  2ADU A;  4G7H F;  3RYP A;  3I54 A;  1J5Y A;  5J8C A;  4A6E A;  2DPU A;  3COA C;  5D6E A;  2FOK A;  1R1T A;  2H6B A;  1FSE A;  4KIF A;  4L5I A;  3LAJ A;  1D5V A;  2NNY A;  3TO7 A;  1OKR A;  4KUM A;  5D8L B;  4A0Y A;  1XGM A;  3BJO A;  1UHW A;  3GXO A;  3E6M A;  4K2E A;  3V7C A;  1U6G A;  4OIQ F;  2CW0 F;  3QOP A;  2K02 A;  2JPC A;  4Q47 A;  3W6K B;  4G94 A;  3E6C C;  1P4A A;  1BI1 A;  5K5O A;  4U7D A;  3WTT C;  3OOP A;  4L9V A;  4LMY A;  2V6C A;  4RGR A;  3ZMZ A;  2C6Y A;  4UVB A;  2HEO A;  1XDS A;  3B02 A;  1LEA A;  3GVA A;  5E1W A;  1YLF A;  3RIR A;  4AIJ A;  4XSX F;  3HHH A;  3ECO A;  3WTX C;  1RIO H;  4MQ9 F;  4LG0 B;  5FO5 A;  4FT8 A;  4KIG A;  1S8N A;  3KEO A;  3WE2 A;  2XV4 S;  3GO5 A;  3N4M A;  3SZT A;  3ELK A;  1QO0 D;  1RNL A;  3QPH A;  3QPT A;  3LA7 A;  4FHT A;  3ABU A;  5DDG A;  3CO7 C;  2AS5 F;  2AXL A;  2L01 A;  3F3X A;  2UZK A;  1ZN2 A;  1EH6 A;  3F6V A;  1KA8 A;  1ODD A;  2H09 A;  5F1R A;  3KCC A;  2OD5 A;  3TDU C;  4A0X A;  4EV0 A;  3JSO A;  4R1H A;  1SAX A;  3WG9 A;  4RB1 A;  3M8F A;  3GLX A;  2XVC A;  3KZY A;  3MCZ A;  4PGH A;  2A61 A;  1XSV A;  1S29 A;  3DPL C;  3ULQ B;  5D5U B;  2M45 A;  2A6H F;  1QNT A;  1TNT A;  4R79 A;  1WSU A;  4LGW A;  1XGO A;  2GQQ A;  4GYG A;  4RS8 A;  3BRO A;  3ZMV A;  3V8K A;  3TQN A;  4HX8 A;  1I1S A;  2PJP A;  2D45 A;  1HSJ A;  3VEP A;  4F7Z A;  3JTG A;  3HSE A;  3KP3 A;  1YYV A;  3KP4 A;  2ISY A;  3WGH A;  3M7G A;  2OU2 A;  2FNA A;  5E1X A;  3RTR A;  1DDN A;  2DO7 A;  5CVU A;  1PP7 U;  1IAW A;  4G7Z F;  2VBZ A;  1OPC A;  3GFJ A;  1U3E M;  3FMQ A;  3RYR A;  3QRF F;  1IN4 A;  2PMU A;  4HQE A;  3I64 A;  5K1Y A;  4PGG A;  3ZN0 A;  2ZME A;  1O3R A;  2FBI A;  3ZMU A;  5DCF A;  4I2O A;  4HAM A;  4WXC A;  4CZZ A;  4ENM A;  3HRS A;  4BXU A;  2QBY B;  1UB9 A;  3BDD A;  4L0Y B;  1Q1H A;  1FOK A;  2WV0 A;  2FXA A;  2X4H A;  1B9N A;  2MLG A;  3LQQ A;  4ENN A;  2EV0 A;  3IKV A;  1OYW A;  4A2U A;  1HBX G;  2OAZ A;  2H94 A;  2W84 A;  3IHU A;  3KP6 A;  3ZMD A;  1DUX C;  4ON0 A;  2ZXJ A;  2NYX A;  4DNC A;  2CFX A;  4OIO F;  1D8K A;  3U9G A;  4I98 B;  1G3S A;  5HOO A;  1V4R A;  2R3S A;  3CO6 C;  1G4D A;  5DD4 A;  2FA5 A;  2PEX A;  2OQR A;  1B1B A;  1KYW A;  1OYY A;  4CO8 A;  2XUB A;  5J8F A;  1IN7 A;  3B73 A;  5BS6 A;  2PI0 A;  2FMY A;  2ZME B;  2EK5 A;  2P5V A;  5LBQ A;  2VE8 A;  3DF8 A;  4EVI A;  4G9Y A;  1XGS A;  5DEQ A;  4EJT A;  5LRR A;  1ZH5 A;  4HF2 A;  4R8H A;  5BPD A;  3VB2 A;  3K0L A;  2J5P A;  3I71 A;  3ZMT A;  2QEN A;  3PFI A;  3IL2 A;  4EJU A;  2DQR A;  3NRV A;  5ILU A;  5FLX K;  2B0L A;  3P7N A;  2OA4 A;  5ICE A;  2RDP A;  5HLH A;  1T98 A;  3KZZ A;  4LB5 A;  1QBJ A;  2NS0 A;  4Y13 A;  3ZPL A;  2EA4 A;  2O03 A;  3IC7 A;  1T0F A;  5HLI A;  2DQL A;  3BPX A;  1KQ8 A;  3BOQ A;  3S2W A;  3QU6 A;  3G73 A;  4YFK F;  3DFG A;  1FYM A;  2IRF G;  4KFC A;  1R5H A;  3IWZ A;  5L3E A;  1XCV A;  5LRS A;  2Z99 A;  1SD5 A;  2PLY A;  1GXP A;  2A69 F;  4KNY A;  3EDP A;  5IT9 K;  2M87 A;  3ZN1 A;  1R1V A;  2KRF A;  5CVI A;  4AIH A;  4NB5 A;  2ZCW A;  3Q9V A;  2BBY A;  3U1D A;  4P96 A;  2QZ8 A;  2KIM A;  3HIF A;  4UVA A;  2STW A;  3KP7 A;  4LJZ F;  4KIB A;  2ZNY A;  2P5K A;  2LF8 A;  3F8M A;  3FHZ A;  1P2F A;  3V7R A;  5F64 A;  3NQO A;  3RDI A;  5KVR A;  1WKM A;  1C0W A;  1G3W A;  3N97 A;  3BY6 A;  4HF0 A;  1L3L A;  4Y15 A;  2JSC A;  2ZO4 A;  1E2X A;  1YQA A;  5BMZ A;  2CSO A;  1LB2 A;  3HRU A;  4GCV A;  4N9I A;  2YX4 A;  4GO1 A;  1YTY A;  3IRQ A;  2MBF A;  3LA3 A; 
#chains in the Genus database with same CATH topology
 1Q1V A;  3CLQ A;  4CIC A;  1CGP A;  3E5U A;  2LKX A;  1F5T A;  1MBK A;  1WJB A;  1HW2 A;  2DT5 A;  1WI9 A;  3OIP A;  3AKZ A;  1XN7 A;  5E8G A;  4A3L J;  2LF7 A;  2R7V A;  4U0V A;  2QQ8 A;  4I76 A;  5L3D A;  1RKT A;  2CQK A;  3C7J A;  4HNT A;  1D1A A;  3FHN A;  1QU3 A;  1ZTR A;  2VQC A;  4M6V A;  2X0L A;  2NXN B;  3RZD J;  1UAA A;  4ENJ A;  3MZH A;  2IBD A;  2E1M C;  2MA3 A;  2COM A;  2WAQ A;  3RJP A;  1P6R A;  3OSF A;  1P7J A;  2WWY A;  3W3C A;  3R4K A;  4U0W A;  4CSW A;  2UWM A;  2EZI A;  4AU7 A;  4IHW A;  2E1M B;  2Y69 H;  3FXR A;  2L3D A;  2WY7 Q;  4BBR J;  3DXJ F;  1GDT A;  2DFI A;  2DK5 A;  2F48 A;  1A04 A;  2OTL I;  3JAM K;  1YS6 A;  2ICW G;  1T8I A;  2KMU A;  1DGR M;  4CCJ A;  1R5G A;  2H6C A;  3AG2 H;  5FFZ A;  1BC7 C;  2DOF A;  1FYK A;  2HDC A;  3A1Y A;  3GUD A;  5F04 A;  4EJW A;  2NVY J;  4MIM A;  1ZKG A;  3CMA I;  4II3 A;  2R7F A;  4OIR F;  2PX9 A;  5LD2 C;  2GIV A;  2NVT J;  2LVS A;  1IRG A;  1YIJ I;  4IO9 F;  2FBH A;  4MLO A;  3I4M J;  1EH7 A;  3L00 A;  1FYL A;  3ABM H;  3I5U A;  2VOO A;  3E6B A;  1TNS A;  2CQN A;  1Z3Y A;  5KAI C;  4FQG A;  4KA4 A;  2OPT A;  2IS6 A;  4CHU A;  3K9T A;  1TQM A;  3OL4 A;  2F4M B;  2EJR A;  2UXN A;  1R36 A;  4UNO A;  4A3B J;  2M2E A;  5GPA A;  4Q5S F;  3G1O A;  2XAQ A;  3QPL A;  4XN0 A;  4AD9 A;  4I0A A;  1ORK A;  2L9N A;  4XL9 A;  4IHT A;  2GBY A;  5ICF A;  3FBN B;  5FLX Z;  5HNH A;  3S3O A;  1X58 A;  1KGS A;  1LVK A;  2BXY A;  5FJ8 J;  2PQ8 A;  4V2G A;  2E1C A;  5DUK A;  1FMW A;  3QWL A;  3TW7 A;  3H3V K;  5B5E C;  2BZT A;  4G6D A;  2NRA C;  1YW9 A;  2BEO A;  4I09 A;  2PG4 A;  1IGN A;  1VTN C;  1U78 A;  3Q9S A;  5IYC J;  3MAJ A;  2X9D A;  2HZD A;  1O7F A;  2F5D A;  5FKM A;  3TL4 X;  4CYD A;  1X1A A;  1V3F A;  1XTA A;  5D6F A;  4KIC A;  3I53 A;  4C2M J;  3GTO J;  3CCR I;  2DDB A;  3BG5 A;  2PN6 A;  4XLE A;  2FQ3 A;  3ROU A;  2F5C A;  2IJL A;  2M4K A;  2XHK A;  1MJB A;  2YUS A;  1MMN A;  3BG9 A;  5FD6 A;  3ERE D;  3FIW A;  3BR1 A;  1E0E A;  3KE2 A;  3L2V A;  1FBU A;  4Y52 J;  3JSP A;  2H1L A;  4NUB A;  2ELK A;  1RRJ A;  3LSK A;  1HXD A;  2CG4 A;  1UZC A;  1OR7 A;  3LSG A;  3F72 A;  1GLN A;  4WXH A;  1XD7 A;  4XKW A;  4XMY A;  4IQ4 A;  2HKX A;  4LLN A;  1X3W B;  1D1B A;  2CU7 A;  5E17 F;  1Y1V J;  2HQN A;  1UST A;  2XPV A;  3W6J B;  3DBL B;  1XCB A;  2LRD A;  4DZP A;  2O8K A;  1P4X A;  4J01 A;  3AAF A;  5B1A H;  2HOS A;  2STT A;  4BHP A;  3VYT B;  5H2F C;  2HYJ A;  1VQP I;  2DN0 A;  4M9S A;  4EAT A;  2IXS A;  2V1X A;  3GZ5 A;  1ITY A;  3WTW C;  2HS5 A;  3EET A;  5TIS C;  2FF4 A;  5EZG A;  1HDD C;  3TBI A;  3WTS C;  2H1K A;  3TOB A;  3H0D A;  2HVS A;  2RV8 A;  2X85 A;  4CH7 A;  5HDG A;  1IV8 A;  2HKO A;  4LFU A;  1Y0N A;  3EYY A;  2K86 A;  2EIM H;  2NVX J;  4OAZ A;  4XON A;  2IVM A;  3K2A A;  1BIA A;  2V79 A;  1SD7 A;  6PAX A;  1Y56 A;  3KYC B;  1GV5 A;  4DOZ A;  1JE8 A;  3EUH C;  3K69 A;  1LFB A;  1T2K A;  2CO5 A;  1ZRD A;  1ACI A;  3R0A A;  4E4H A;  1KQ9 A;  2RC4 A;  1FBQ A;  3H5R A;  3LSR A;  3U21 A;  4E7Z A;  4KYW A;  3DQV C;  2CQX A;  4CXF A;  1G3T A;  3GEZ A;  1ZGA A;  1OR7 C;  3CUQ A;  3F6O A;  3SZG A;  2EFP A;  1GXQ A;  2HXO A;  3K70 C;  2OBP A;  4CCO A;  1MW7 A;  2XSD C;  4LLG F;  4C3J J;  3H35 A;  2QYO A;  2CJJ A;  1APL C;  1Z6R A;  4ZYD A;  3HRT A;  5LGN A;  3CP8 A;  5LHG A;  2ZFU A;  1HW1 A;  4ASN A;  2EFW A;  2FRH A;  3KFW X;  3NAU A;  1HCR A;  4DW6 A;  5IP7 J;  3AL0 C;  3PQJ A;  3R0J A;  3OS2 A;  2EPF A;  5E79 C;  4NC7 A;  4IQJ A;  1LNW A;  5JVT A;  4NHJ A;  2XGX A;  4E7S A;  2V9V A;  2WBM A;  1ZRF A;  3LQR A;  2FEZ A;  3GBG A;  1MKM A;  2R5Y A;  5TRD A;  3AL0 B;  1J9I A;  2R0Q C;  1GVJ A;  2VLA A;  5HDK A;  2I10 A;  3I59 A;  2JRT A;  4E7H A;  4M3G A;  5LEJ A;  2JPB A;  4MTE A;  4EGY A;  5CKT A;  4RGU A;  1YE9 A;  3M1C A;  2XGE A;  1WFX A;  3HOT A;  5L3C A;  1Y39 A;  3KP5 A;  4RA2 A;  3ZOB A;  1YO5 C;  3J7Z I;  1QZZ A;  3JAM Z;  3EYI A;  2MH2 A;  3GTG J;  2V1D A;  4L9T A;  3NEU A;  2KFD A;  3NWT A;  5GTI C;  1EH8 A;  1IO2 A;  3TED A;  2ZFW A;  1N75 A;  4PK4 A;  2XAS A;  5DTD A;  1MSF C;  3K1N A;  4MEY F;  2DA2 A;  1G2H A;  3S2D J;  1ETV A;  1LUJ B;  2TDX A;  5GP9 A;  1MBH A;  1FP1 D;  2DPD A;  1MBJ A;  3E6D A;  3CC4 I;  4XBF A;  3CUQ C;  5A2Q Z;  2DU9 A;  2X1E A;  2FUG 2;  2OTJ I;  2M3A A;  2K5C A;  2IGK A;  2F4O B;  3HPH A;  3OV8 A;  4UVC A;  4XOR A;  2DW4 A;  4BAY A;  2CRG A;  2L0K A;  3CUQ B;  1K6Y A;  2Q2E A;  5CQG A;  3OR1 C;  1S3J A;  2QEX I;  2ZSH B;  3TOA A;  3VWB A;  3S1Q J;  2JSP A;  2XAF A;  1LKX A;  2ETH A;  3HOS A;  2RNJ A;  4HA8 A;  4JX6 A;  4BBS J;  1VND A;  5DCM A;  4HLY A;  5KK1 A;  3D0S A;  3VDX A;  3OOU A;  4ESJ A;  2P7C B;  4U88 A;  4TV7 A;  1TWH J;  2A3S A;  2COB A;  2EFQ A;  2NAZ A;  1K6O A;  2P5L C;  2UXX A;  3T8R A;  3PNY A;  2DAO A;  4I01 A;  4HZF A;  3DU6 A;  3A0H C;  3E0J B;  5J3L A;  2DOD A;  2LG4 A;  3GME A;  4HV5 A;  4II2 A;  4RMN A;  2K9M A;  4IXA A;  4B09 A;  5KHD A;  2R5Y B;  3MWM A;  3H1C A;  4IL6 C;  4UXN A;  5AIQ A;  1H88 C;  3HDD A;  1QHG A;  3DBH B;  2M7B A;  2QKM B;  2X6O A;  3LFU A;  2ESN A;  1TP4 A;  2HZT A;  3I59 B;  4QPQ A;  2VON A;  1A35 A;  3NAR A;  1X1D A;  3I56 I;  3MKZ A;  4V19 K;  2O0Y A;  2PMH A;  1E3O C;  1FNN A;  3K4B A;  3K4K A;  1K79 A;  1T39 A;  5D4S A;  2E1O A;  1HQC A;  3Q0V A;  1I6H J;  4IOA F;  1HLV A;  1W36 C;  3AG3 H;  1TT0 A;  2M1B A;  2QLZ A;  3VYS B;  4LG3 A;  2QKL B;  3SZP A;  3MKW B;  2XF5 A;  4CGZ A;  3L2W A;  3CLO A;  1R6R A;  2K40 A;  1WJC A;  1YX3 A;  2OCE A;  4XQF A;  2JA5 J;  1Z05 A;  2DTZ A;  5B1B H;  3MFK A;  2YS9 A;  4BQA A;  3K4M A;  5F0C A;  3KP2 A;  4G12 A;  4EQQ A;  1WZ2 A;  3DU5 A;  2IEK A;  2FE3 A;  2VPR A;  2KIU A;  2HYG D;  2AHQ A;  1S7A A;  3HRM A;  2ID3 A;  2DJI A;  2LOO A;  1KON A;  2O5R A;  1YG2 A;  3WTV C;  3MD2 A;  2GA1 A;  1R4N B;  4XKC A;  2Q2E B;  1G59 A;  1HDP A;  1QQI A;  3FM3 A;  2HTS A;  3A2K A;  4PSX A;  4YG2 F;  4QSH A;  3I9V 2;  3HB9 A;  2DA4 A;  1ETW A;  2XF7 A;  4MFE A;  5DCM B;  2KIF A;  2LKP A;  3QP5 A;  3K2Z A;  4RLF A;  4OIN F;  1FEX A;  1BN5 A;  2XGC A;  2L7Z A;  3FXK A;  3B6A A;  2R7D A;  3RKW A;  5EEA A;  4WK8 F;  3UR3 C;  2AXT C;  2EB7 A;  2P8T A;  3GFL A;  3TGN A;  4JBA A;  3DTI A;  3F8N A;  1HOM A;  1G6N A;  4P9U A;  2HPM A;  2QCO A;  1JT0 A;  3V7S A;  5HS9 A;  1Z7U A;  2XAU A;  3V8L A;  2VE9 A;  2IA2 A;  2VT3 A;  4CCK A;  2LY9 A;  2LLK A;  1VQ4 I;  4BHC A;  5CJ9 A;  2LKS A;  4GRI A;  2E5N A;  1IXS B;  1K4T A;  2L4M A;  3MZY A;  3HYI A;  3E3V A;  4O5V A;  3WTY C;  1ZRC A;  3EQL F;  3EUK L;  1HA8 A;  1TZL A;  3S8P A;  1KU3 A;  5CYV A;  3JRF A;  3JR9 A;  1YIT I;  1D0X A;  2N8G A;  2K27 A;  4UHT A;  4A5M A;  3LSM A;  2ELJ A;  5EGO A;  1XMX A;  3OYC A;  4BY1 J;  3SEQ A;  4NNJ A;  2L9V A;  3PJR A;  2JA6 J;  1R00 A;  5TGT A;  2VKH A;  1KZH A;  4EJV A;  4ESB A;  2LY2 A;  4L5E A;  5GPC A;  1FWZ A;  1WH7 A;  1NH3 A;  2KQR A;  2DI3 A;  2IS1 A;  2HYF A;  5K7Z A;  1U5T A;  5E3N A;  3PFY A;  1AKH B;  1G8X A;  1LFP A;  1F1Z A;  5L3F A;  1OCC H;  2F5V A;  2V4J C;  2P6S A;  1H8A C;  1B59 A;  4CZC A;  1GV2 A;  1EA3 A;  1ZR4 A;  1Y1W J;  3TKY A;  2O3F A;  3C2G A;  3CMM A;  3IP4 B;  2QSF X;  3FXJ A;  1B4A A;  2Q1Z B;  1P4W A;  5L3B A;  3CJR B;  4A3G J;  4XRM A;  3MEX A;  4F55 A;  3KPH A;  2HGC A;  1ZYR F;  3K1P A;  2DA5 A;  2KRC A;  2YU9 J;  1FMV A;  5HS7 A;  1YOV B;  4ZYE A;  2IA0 A;  2JTV A;  2XAJ A;  1LJ9 A;  2R7Z J;  4UV8 A;  3K4J A;  4G6Q A;  2FQ4 A;  1E17 A;  4E7I A;  1B72 B;  5ICC A;  1JUS A;  3GW2 A;  2Y0M A;  2DA7 A;  2TRT A;  2OJE D;  1J7K A;  3OIQ A;  2GIZ A;  2IGM A;  3H3U A;  5F6F A;  4BE1 A;  2A68 F;  3M4O J;  2JT1 A;  1FTT A;  2IT0 A;  3RZO J;  1PP8 F;  1STZ A;  2E36 A;  2HQ5 A;  1RUO A;  1AA7 A;  3J7A O;  1XSD A;  3QU3 A;  3QYE A;  3LOC A;  3IKT A;  1D8J A;  5JFR A;  5L3G A;  1X4O A;  1D1C A;  4I02 A;  4M6Y A;  4M3B A;  5DYM A;  1YW8 A;  1QRY A;  2YPR A;  4XM3 A;  5D8K B;  4HV6 A;  1EKE A;  3HTS B;  4X1E A;  3ZP5 A;  2GXG A;  4LB6 B;  5D5W B;  4CDG A;  3JW4 A;  3IWF A;  1DPR A;  5JHU A;  5EGO B;  2FNP A;  2L54 A;  3MKY B;  4JQF A;  1FOX A;  4M9Z A;  4RAZ A;  3SEZ A;  4AVZ A;  1GHC A;  3P9K A;  1WVR A;  2MD5 A;  3KYD B;  1ZGW A;  1IXC A;  1U5T B;  2H8W A;  2E7X A;  3FBI B;  2D1V A;  2ZXI A;  2JA2 A;  1VI0 A;  2QF7 A;  4EM1 A;  1J59 A;  3L2C A;  5K7H A;  2HTJ A;  4RAY A;  3ZQI A;  2R7S A;  5AIP A;  3G1M A;  5B3S H;  4LLL A;  4A93 J;  5DM6 F;  4RLQ A;  1I39 A;  3L09 A;  3RI4 A;  2P7V B;  4A0Z A;  3CMY A;  2BE5 F;  2B9S A;  5HLG A;  2QQ9 A;  1TC3 C;  2F5F A;  3L2Q A;  2NS7 A;  4DBQ A;  1MJA A;  1F9N A;  4HYE A;  5E18 F;  2WB1 N;  4IRG A;  4BUP A;  3S14 J;  2L7K A;  1U9N A;  4S04 A;  4U0Y A;  2M0C A;  1A6Q A;  1OCP A;  1JKO C;  2E7W A;  4XLH A;  2M34 A;  4IVN A;  3HEF A;  3FZV A;  3M8J A;  3QYF A;  5LHI A;  3GZN B;  4KN7 X;  4N4O B;  4A3C J;  2HWV A;  4LIV A;  1LQ1 A;  1CF7 A;  4IHY A;  3GTQ J;  2BGC A;  3RSN A;  2E2I J;  3J80 K;  2MGQ A;  3I58 A;  2H8R A;  4KIT B;  5F1J A;  2IPQ X;  5HNF A;  1SFK A;  1Y6I A;  2EFN A;  1ZEL A;  3A4C A;  1UFM A;  3GFI A;  1ZRE A;  5JR3 A;  3CZ6 A;  3H9G A;  1G3Y A;  2W48 A;  2YX7 A;  3K7A J;  4MQV A;  3SFZ A;  4OOI A;  5F0F A;  2XSJ C;  1FLI A;  1POG A;  1UCR A;  2QGU A;  2ZJQ F;  1UEL B;  2IS2 A;  4A12 A;  1FBS A;  2K3P A;  2Z5U A;  2VB6 A;  5EEH A;  4BYY A;  1X19 A;  1RET A;  1BR4 A;  1P7I A;  5LFA A;  2L7F P;  2MFZ A;  2ZB9 A;  1W4M A;  1TW2 A;  2EZK A;  3OYG A;  1E3H A;  1O7L A;  2O9L A;  4XID A;  4V2F A;  2ZJP F;  3C1D A;  3S1N J;  3LFK A;  4WF2 A;  4NQW A;  3F8B A;  1O3S A;  3FXQ A;  3SXY A;  1I6X A;  4I7H A;  4LK1 F;  1N78 A;  5DD8 A;  1OMI A;  3QAH A;  4Y17 A;  2EBI A;  2K9N A;  3CTA A;  4KT5 C;  2X1C A;  4YFN F;  1TTY A;  2VOP A;  2LNB A;  1SEU A;  2CGP A;  4L5J A;  1MBG A;  1VQN I;  3CC2 I;  2MH9 A;  1PJR A;  3KLO A;  3HC7 A;  2ZJR F;  2R5Z B;  3MN2 A;  3RQ4 A;  3GX4 X;  3KET A;  2JVG A;  2IA1 A;  4FX0 A;  4DZJ A;  5DS9 A;  4ZTF A;  3A0B C;  1D0Y A;  3FK7 A;  3Q5F A;  1ETO A;  2KT0 A;  4A5N A;  1WH5 A;  2JUC A;  1CF7 B;  4HOB A;  1MDM A;  1YIO A;  1OFC X;  5GAH J;  4BL0 B;  2DA1 A;  4Y3O A;  4A3K J;  1REP C;  1WWX A;  1KQ0 A;  1IRZ A;  2QM3 A;  4M73 A;  1VQ6 I;  3AFH A;  1VQM I;  1D5Y A;  1R23 A;  1O57 A;  5FKN A;  1R7J A;  2F5E A;  1IN8 A;  3P5J A;  2W00 A;  2NNN A;  3HOX J;  2QSG X;  1DP7 P;  2VBW A;  1JTX A;  3CUO A;  2E35 A;  1JKR C;  3BJ6 A;  4B3A A;  4RDU A;  2VN2 A;  2H27 A;  4M6X A;  1FC3 A;  3G3Z A;  1H0M A;  1WQ2 A;  1ZG3 A;  2P81 A;  3KEY A;  3N05 A;  2WV1 A;  4FX4 A;  1TQI A;  1NK3 P;  2VC1 A;  4Z6Y A;  3JRI A;  4IZZ A;  2ME6 A;  2XPW A;  2FU4 A;  2BHZ A;  4QWQ A;  4NQW B;  4XRS A;  4M9X A;  3JCU C;  1JXS A;  1JUM A;  2MYS A;  3P9C A;  5BQT A;  1TBX A;  2DA6 A;  3H9J A;  1QPI A;  3BT9 A;  3ESW B;  3BC8 A;  3SQN A;  3WHB A;  3GTM J;  4DQ2 A;  4YRV A;  2G9W A;  3RPU A;  5J4Y A;  3UNG C;  4ZC3 A;  5EEG A;  2QSH X;  1SMT A;  3H36 A;  2CUJ A;  3S3M A;  3WU1 B;  5ED4 A;  1Z91 A;  3G4S I;  1WPK A;  1VQK I;  1TLH B;  2DFE A;  3GFM A;  4OU0 A;  4UUT A;  1XSX A;  4ZDP A;  3ZQQ A;  4ZYH A;  2DMP A;  4L9N A;  1DQU A;  1I27 A;  3K6G A;  5H6R A;  1B8I A;  2ZSI B;  2VPL A;  1W5S A;  3OIO A;  4BQO A;  4CYC A;  5IYB J;  5DV5 A;  3CME I;  2D1H A;  4F52 A;  2LH9 A;  1VQL I;  3LAP A;  3CF2 A;  4E6K G;  1VFC A;  1MMA A;  3V4G A;  1DPU A;  2BY3 A;  1YW7 A;  3GTP J;  1MDM B;  3DP7 A;  5FB2 A;  3WTU C;  3PO3 J;  2V9K A;  4XR6 A;  1ZHF A;  5EZH A;  2Q8K A;  3PQK A;  3S3N A;  3CC7 I;  5IT9 Z;  1R71 A;  4XLC A;  1YFH A;  4GGG A;  3OYI A;  2P0W A;  3Q0W A;  4CA0 A;  4MTD A;  2VJ4 A;  3QP6 A;  2HVR A;  2EIL H;  3R6S A;  1S6L A;  4CUG A;  1J75 A;  3BQY A;  3WTZ A;  5FKO A;  2M7A A;  1LDJ A;  2RNG A;  4FE7 A;  5CPR B;  9ANT A;  3RPU D;  1Z0X A;  1BC8 C;  3VYR B;  2Z33 A;  5C4X J;  4ANJ A;  1YRN A;  1I1G A;  1FZP B;  4BH9 A;  2EIN H;  2PBI A;  3LL7 A;  4DYR A;  1BIB A;  1E3P A;  3CDI A;  2RN7 A;  3K10 A;  2JMW A;  3ABL H;  2K3F A;  1JJ8 C;  5CLS A;  4EM0 B;  3FXM A;  5IP9 J;  1FSH A;  3DEU A;  1TWA J;  3ML6 A;  5M5W J;  1RI7 A;  4LG0 A;  2RKH A;  2FD5 A;  5E3M A;  2IW5 A;  5JVG F;  1BL0 A;  1I3A A;  1FOY A;  2B63 J;  2ZBK A;  2KKO A;  5LLQ A;  4BGD A;  3J80 Z;  1T6S A;  1VQ8 I;  2VKV A;  1RC9 A;  1MH3 A;  2DYR H;  2FX0 A;  3DPU A;  5IT3 A;  3TW6 A;  3JRC A;  1XB4 A;  3CJQ B;  4BE0 A;  2RQP A;  3K4L A;  4ESF A;  2E2H J;  1FP2 A;  2QUF A;  2YU3 A;  1XMA A;  1B8I B;  2G7H A;  2EQR A;  3WOD F;  2FBK A;  1NHA A;  4C2T A;  1LDD A;  1ZG5 A;  2BOL A;  3L9F A;  2E5Z A;  2VXD A;  2X48 A;  2EIK H;  3MQ0 A;  2LR8 A;  4A3D J;  4KMU X;  4L9J A;  3GZ6 A;  1IN6 A;  1I5Z A;  3LSI A;  1NTC A;  4KT6 A;  2NOJ B;  1MZB A;  1TW3 A;  4PZJ A;  1R5I D;  1YJ9 I;  1LE8 A;  2LC2 A;  2LK2 A;  2NS8 A;  3FKJ A;  3CCY A;  1U2W A;  2WTE A;  1B6A A;  1XG1 A;  4B1R A;  3MVP A;  3TO6 A;  2F4I A;  1BM9 A;  4RGX A;  2HNH A;  4M72 A;  3BWG A;  2DMT A;  3WGI A;  4GXO A;  1T33 A;  1RZ4 A;  2OZU A;  3OYD A;  2Y9Y A;  4EM2 A;  1QVU A;  3H5A A;  4AYB N;  3BG6 A;  3KYL A;  2HR3 A;  3FXU A;  2DLL A;  2R7O A;  2WC2 A;  3LSH A;  1QPM A;  3REO A;  2XRO A;  3WU0 A;  5FLM J;  3CCJ I;  1LVA A;  3BZ6 A;  3K1M A;  3M07 A;  2K4B A;  1EJ9 A;  1F4K A;  2PMZ N;  2EIJ H;  3BCB A;  3B6C A;  4AM3 A;  1FT9 A;  3A01 A;  1VQ7 I;  4MEX F;  1XPX A;  3X2Q H;  3FX3 A;  4F93 B;  5M5Y J;  3HOV J;  4N9H A;  1IDZ A;  3F8F A;  2ACJ A;  4OMZ A;  3ABK H;  3HTU A;  1SD4 A;  2XKP A;  3U2R A;  3J7A Y;  3T1B A;  4BQN A;  3ZMS A;  5F27 A;  1IUF A;  4PFP A;  1BA5 A;  3CCL I;  2M0M A;  3WG7 H;  4XN3 A;  4P55 A;  4RB0 A;  5JI6 A;  3CDH A;  2XKO A;  3HGY A;  3W2A A;  4LOC A;  3JTH A;  1A36 A;  3ZCO A;  2CV1 A;  4XRF A;  1RR8 C;  5HOD A;  4ZTJ A;  2DXI A;  2EZL A;  3J81 K;  1W5T A;  4MHG A;  2ZNZ A;  4LD5 A;  1MMD A;  3EUA A;  1JGG A;  2KP6 A;  4RM3 A;  1O4X A;  1LE8 B;  4BNC A;  1TL8 A;  3DKW A;  2R4G A;  3RKY A;  4FE4 A;  2ISZ A;  3PIO F;  1BJZ A;  2KZG A;  3VOD A;  4PUS A;  3F0C A;  2OV7 A;  4HNV A;  1IC8 A;  3BCA A;  2BYV E;  4XSZ F;  3W2W A;  4GYI A;  2XRN A;  2I8D A;  3CJN A;  1JHH A;  1HW5 A;  1R4M B;  3DV8 A;  3CCQ I;  2LMD A;  3PNT A;  2OUM A;  2Q0O A;  2KLO A;  2VAS A;  3FM5 A;  4MGR A;  4PDK A;  4A6D A;  5TJJ A;  5E3O A;  2GA2 A;  2WAF A;  3MZ8 A;  2ME0 A;  1IG7 A;  2MC3 A;  2LSO A;  3SDB A;  3A01 B;  3S1R J;  4PJJ A;  1O3Q A;  1ETX A;  4G8X A;  1ZLK A;  2QBY A;  2LBF A;  2O6G E;  1A6I A;  4HX7 A;  2M9H A;  3PSI A;  4ZJZ A;  2Y75 A;  2V1U A;  3O3K A;  5D5X B;  2VOD A;  4PJL A;  4N0B A;  3S93 A;  2W57 A;  2MG4 A;  2CUF A;  1D0Z A;  2VC0 A;  2R7T A;  3H92 A;  1Y0U A;  1KU9 A;  1SD6 A;  2W1O A;  2OF7 A;  4ZH4 F;  5HDN A;  3WHC A;  3C2H A;  2XAH A;  5K5Q A;  1LEB A;  3LNQ A;  3F22 A;  3S1M J;  1HST A;  2W82 A;  2ZC2 A;  4QLC U;  2XB5 A;  3C3W A;  2QQB A;  3LSP A;  2LY1 A;  1YJW I;  1RUN A;  1FX7 A;  1AWC A;  3C18 A;  3SDG A;  4L18 B;  4I99 C;  1V55 H;  2DCE A;  2K9S A;  4AVP A;  5LEK A;  3V8J A;  1PDN C;  3DEW A;  4OIP F;  2HOA A;  1ULY A;  1BJA A;  1JHF A;  1ZAO A;  1T08 B;  2HFH A;  4RGS A;  2Y30 A;  3RQI A;  1HKT A;  4BQQ A;  2ZJ2 A;  5FGM A;  3BPV A;  4YII A;  4UY8 I;  3IH4 A;  4DGW B;  4P5O A;  2E1N A;  4L0Z B;  5H20 A;  1BI3 A;  2DDA A;  2EZH A;  3R61 A;  4WWC A;  4ZDO A;  4HF1 A;  4M3E A;  2FML A;  2JZY A;  2L2O A;  3FK6 A;  3CDL A;  1BOA A;  2F6C A;  1S9H A;  2KHM A;  2PJR A;  3PM1 A;  1MNE A;  3T0Y A;  4DJA A;  1T56 A;  1ZAR A;  4JK1 X;  2K7L A;  2W85 A;  1IW7 F;  2PFB A;  3T5X A;  4E70 A;  3QOE A;  4I0B A;  3HPG A;  1T38 A;  4XKV A;  4QTR A;  3FDY A;  3F9K A;  4BHB A;  2F2E A;  3CCV I;  4IHX A;  3L1P A;  1U9O A;  2L5Q A;  4ZYA A;  4IRH A;  4LIT A;  1UHS A;  3BR0 A;  3GTL J;  2RRE A;  1Z21 A;  3CJT B;  2XGD A;  3RPQ A;  1ZGJ A;  2K85 A;  1SFE A;  2BXZ A;  4HX4 A;  4UV9 A;  3DTE A;  3P9I A;  2LBF B;  3T8T A;  3VOE A;  4B3X A;  4HDU A;  1PUE E;  2CUZ A;  1R22 A;  3BR6 A;  4KMF A;  5GTH C;  1SFX A;  4ZYG A;  1KYZ A;  1Y8R B;  5IP6 A;  2XIG A;  1YS7 A;  4O6J A;  1K7A A;  2Y48 A;  1H9G A;  2EV5 A;  2XF6 A;  3O2P E;  4RB2 C;  3D5S C;  2DBB A;  2DT6 A;  3VYU B;  1R9T J;  4XLN F;  1OCT C;  2R93 J;  1MD0 A;  4BEH A;  4C2U A;  1U0J A;  4Q4Z F;  3HSR A;  2A5Y B;  2A5W A;  3ZQG A;  4UUS A;  1R58 A;  1P92 A;  4RB3 C;  1ZR2 A;  4MNU A;  2FSW A;  3KEQ A;  1SFU A;  5C4J J;  2GZW A;  1USS A;  3W2V A;  2VIX A;  1OQY A;  2G0E A;  1OIS A;  4IJA A;  3OYJ A;  1ERD A;  1MJ9 A;  2JRM A;  3JRH A;  1W7P A;  3BG7 A;  4RM2 A;  1JT6 A;  4PCQ A;  5CVR A;  2HQR A;  4E7J A;  3BJA A;  5D4R A;  1KU7 A;  5CVJ A;  3Q0U A;  4E7K A;  2BV6 A;  1MMG A;  4JOM A;  3TO9 A;  4U7B A;  4XLP F;  2DMN A;  3LA2 A;  4WX9 A;  2EA2 A;  2IP2 A;  3ZGK A;  2PJR B;  2GAU A;  5HS8 A;  3CD6 I;  4X6A J;  2M8G X;  3DWL E;  3G1L A;  1J2X A;  2CWE A;  3S15 J;  3OWT A;  2JUG A;  1LDK B;  2X1D A;  5FFX A;  2RQQ A;  4PJ0 C;  3IRR A;  3F8C A;  1EV7 A;  3CF5 F;  2RVC A;  4CCM A;  2M8E A;  3ABT A;  3F23 A;  4AIK A;  1UG2 A;  5EG0 A;  4DYQ A;  2TCT A;  3M1E A;  5K5R A;  4C30 A;  1ZLJ A;  1HF0 A;  2V1N A;  3D5R C;  3J81 Z;  2VQH A;  1BI0 A;  2HXI A;  5DM7 F;  4QPO A;  3TP0 A;  5EF6 A;  4O3M A;  3U1K A;  3WE3 A;  4PJN A;  1OLT A;  2P6T A;  1W7P D;  1U5T C;  3GYH X;  2CH0 A;  1O3T A;  4ETS A;  1BI2 A;  3M9A A;  2YSR A;  2FJ1 A;  3ERM A;  4BEH B;  5E20 A;  2LDU A;  3IH3 A;  4FTH A;  4KDP A;  1BR2 A;  3L7W A;  5IYD J;  1L0O C;  3RKX A;  1V5G A;  3VFZ A;  1A5J A;  2DK8 A;  1WJE A;  4A3J J;  1ON2 A;  3OY9 A;  4KN4 X;  1X2N A;  4BDZ A;  1QHH D;  2KIQ A;  5ICG A;  3H9Q A;  4XLF A;  1MBE A;  2YR2 A;  1WJA A;  3QOD A;  1W7P B;  3HUG A;  1ETQ A;  2QQA A;  4ZZD A;  1LFU P;  2BY0 A;  3OSG A;  2O8X A;  4YIF A;  3M8E A;  4OAY A;  2DYS H;  1X3U A;  3MMY B;  1Z77 A;  1FPQ A;  1KU2 A;  2AQF A;  1BW6 A;  4M71 A;  4B8X A;  3PNV A;  3K4C A;  2BVL A;  2Y0S N;  1BOB A;  4HST A;  4BJT A;  1U8R A;  1DGW Y;  3BLY A;  3E97 A;  2LP0 A;  4EGZ A;  1IN5 A;  2A6T A;  2EFO A;  2UV1 A;  2QVO A;  5LHH A;  1Z9C A;  4UUV A;  3BZC A;  1ZK8 A;  2VT2 A;  2L9R A;  4IPA A;  4AUX A;  5ILV A;  5LGT A;  4C3I J;  4HEA 2;  4JYK A;  3BP8 A;  4PJM A;  1H9T A;  3OYN A;  4BXF A;  4ZZL A;  2DMQ A;  1S5L C;  2L7M P;  5BPI A;  3OR2 C;  2O61 A;  1TWC J;  5EG0 B;  2QWW A;  5GAD J;  2D2W A;  4M74 A;  2V26 A;  4UB6 C;  3FF5 A;  4Y7N J;  5LGU A;  1PYV A;  4XK4 A;  1MND A;  3GF2 A;  2Z1D A;  1RR7 A;  4D0P A;  2KJB A;  4A3I J;  2KPM A;  3O6B B;  3D5L A;  3KX2 A;  5FD5 A;  2KRH A;  2VXZ A;  3I55 I;  2DMU A;  4G7O F;  3ZQ7 A;  2CQ7 A;  3OL3 A;  4JX5 A;  1GVD A;  4D9J A;  1WGX A;  3LST A;  3HSF A;  2W25 A;  3BTI A;  2X6Y A;  4I6Z A;  1JGS A;  2IAI A;  1IF1 A;  3AG1 H;  4S05 A;  4BY7 J;  3OYB A;  5J1U A;  1S72 I;  1BBY A;  4Z2Y A;  3SYT A;  2E71 A;  4A3M J;  2GXA A;  4UB8 C;  5HVQ C;  4FAS D;  1XGN A;  2XAG A;  2P4W A;  5J6X A;  5C3E J;  2L9S A;  3JRA A;  3FMR A;  1F43 A;  4H0E A;  3HKZ N;  3DPT A;  3IV5 A;  3HHG A;  1HKQ A;  1MBF A;  2L02 A;  2AQE A;  4KIS A;  1U8B A;  1SC7 A;  2VUM J;  2CYY A;  1FY7 A;  2OZ6 A;  5BNG A;  2GXB A;  4YFX F;  1J0R A;  3G71 I;  4Q48 A;  3DKX A;  2VI6 A;  2O7O A;  2VBY A;  3BR5 A;  3E5X A;  3VPR A;  3BG3 A;  1GUU A;  1SVO A;  4J19 A;  5ERI A;  2Z9O A;  4P9F A;  1QGP A;  3GCM A;  3OYK A;  1AOY A;  3ZQF A;  4BDY A;  2WA0 A;  3ECH A;  1IV6 A;  2KJC A;  5H6Q A;  2NVQ J;  4OMY A;  1I3Q J;  4ABZ A;  1MGT A;  4CCL A;  1SAN A;  1H89 C;  2JQ7 A;  4ENK A;  1IXR C;  2W24 A;  2M30 A;  1A31 A;  1Z6T A;  4HSR A;  2CV2 A;  2HOE A;  4BXX J;  3FMS A;  1TQP A;  5EJC A;  5DUI A;  2L4A A;  1HKS A;  4HW0 A;  1XMK A;  1K78 A;  2DFH A;  1WRJ A;  2BW3 A;  1JJ6 C;  4BJ6 C;  2BY2 A;  2G7U A;  1XDU A;  2RAE A;  3IAM 2;  4YIR X;  2ESH A;  1IUY A;  4BS9 A;  2DJN A;  4HLX A;  3ISP A;  5D5V B;  1XS9 A;  4IRI A;  1VZ0 A;  2V9P A;  3A03 A;  2JA8 J;  1X1P A;  4Y4R A;  3QPS A;  3R60 A;  3KLN A;  5M3F J;  4GDF A;  2ZKZ A;  3IUO A;  2M5W A;  1B9M A;  3TDZ C;  3ZRG A;  3OYE A;  1UHM A;  4HQM A;  3JRE A;  3C2B A;  4IF4 A;  4HBL A;  1VQ5 I;  3IH2 A;  3LWF A;  1QZY A;  2E19 A;  4U87 A;  1CQT A;  2A07 F;  5A2Q K;  2R7Q A;  1R1U A;  4WCG A;  3F21 A;  1ZG1 A;  4BJ5 C;  1S7O A;  4EJO A;  2RGV A;  4LK0 F;  3O8H A;  4XLA A;  2A6E F;  2CUE A;  3HM5 A;  5E1Z B;  5BOX A;  3I4P A;  3PSF A;  4EMS A;  2LYC A;  2VBX A;  4JP0 A;  2Y31 A;  3WGG A;  4C3H J;  4WXD A;  5AON A;  3ASO H;  1D3Y A;  2J5O A;  2VJI A;  2WAQ N;  3AG4 H;  5J47 A;  2E60 A;  2KIS A;  4DIQ A;  2GWR A;  1SAU A;  2KDO A;  3H3Z A;  1RES A;  1PVE A;  1ENH A;  2JN6 A;  2R7W A;  1Z1D A;  3SHF A;  2ELH A;  3I0T A;  2JA7 J;  2AO9 A;  3GWZ A;  2DTR A;  2Z2S B;  5CVV A;  2BY1 A;  4F91 B;  1VQO I;  1ON1 A;  2EV6 A;  3FWE A;  1OYI A;  3DLL F;  1UMQ A;  2V6E A;  4M3D A;  1JI8 A;  3E7L A;  1VQ9 I;  3D1N I;  1K78 B;  1IZ1 A;  1V5F A;  2MLK A;  4W97 A;  1ONV A;  2BW3 B;  4AWX B;  1IRF A;  2CQQ A;  2OQG A;  5J1R A;  3E5Q A;  5ILS A;  5E8I A;  1MH4 A;  2EWN A;  2Z3Y A;  3EUH A;  2CMP A;  1SMY F;  4IHS A;  2K4J A;  1BW5 A;  3OYH A;  4HDV A;  3HG9 A;  4LIU A;  2HQA A;  2ADU A;  2CW7 A;  2X51 A;  3HBL A;  3RYP A;  4G7H F;  3I54 A;  1YI2 I;  2DA3 A;  5J4V A;  1J5Y A;  2JWT A;  5J8C A;  2ZXH A;  1QVT A;  4A6E A;  3IAS 2;  1FIP A;  2IS4 A;  1X1B A;  2DPU A;  4A3E J;  3COA C;  2EH3 A;  1V54 H;  2MAB A;  5D6E A;  5K7F A;  2FOK A;  4AYB A;  1YJN I;  1R1T A;  4YEJ A;  2H6B A;  1FSE A;  1W1W E;  4Y33 A;  2K9Q A;  4KIF A;  5J40 A;  4L5I A;  2PMZ A;  3LAJ A;  2CW8 A;  1WHU A;  3DCF A;  2W7N A;  1D5V A;  2NNY A;  1MMS A;  4YEL A;  3TO7 A;  4RBO A;  1PUF A;  1OKR A;  4KUM A;  3ONQ A;  2FOW A;  5D8L B;  5IOY A;  3FXO A;  4A0Y A;  1XGM A;  4CYC B;  1UJ8 A;  3BJO A;  4MFD A;  1UHW A;  5JHF A;  3GXO A;  1JKQ C;  2ID6 A;  3E6M A;  4K2E A;  2Z16 A;  3V7C A;  2BVM A;  4DYC A;  1U6G A;  3CES A;  4J00 A;  4OIQ F;  2CW0 F;  1NG7 A;  3QOP A;  2K02 A;  2JPC A;  3HJE A;  4Q47 A;  4D1Q A;  4P1W A;  3MKL A;  3DLA A;  3W6K B;  3K70 D;  2WY8 Q;  2Y2Z A;  4G94 A;  3E6C C;  2HDW A;  3OS0 A;  1ZQ3 P;  5FLV A;  4N4N B;  1P4A A;  2CV0 A;  1BI1 A;  5K5O A;  1FIA A;  1MIJ A;  4U7D A;  3WTT C;  3OOP A;  4L9V A;  4MO7 A;  1YHQ I;  3BR3 A;  1ETY A;  3UKG A;  5J1Y A;  4LMY A;  2V6C A;  5FKL A;  1WCM J;  3PL8 A;  1TWG J;  4RAF A;  4RGR A;  3ZMZ A;  3FXL A;  4UVB A;  1YRN B;  2C6Y A;  2HEO A;  1BR1 A;  3S2H J;  2K9L A;  2VKE A;  1XDS A;  3KZI C;  3B02 A;  2M4G A;  1LEA A;  3GVA A;  5E1W A;  1YLF A;  3RIR A;  4AIJ A;  2BHY A;  1TWF J;  4XSX F;  1FJL A;  3HHH A;  3ECO A;  3WTX C;  1F36 A;  1RIO H;  4MQ9 F;  1OJL A;  4LG0 B;  5FO5 A;  2R92 J;  1MSE C;  3PO2 J;  3BZK A;  4FT8 A;  5GAE J;  4QIW N;  4KIG A;  2VKD A;  1S8N A;  3KEO A;  1WJ5 A;  3WE2 A;  2XV4 S;  2JVH A;  3H0G J;  2E2J J;  1QA6 A;  2D5V A;  3CP2 A;  4KJZ A;  1DU6 A;  3GO5 A;  4B43 A;  1PUF B;  3N4M A;  2LD5 A;  3SZT A;  3ELK A;  1QO0 D;  1RNL A;  3CCE I;  1S7E A;  3G2B A;  3QPH A;  5F08 A;  3QPT A;  3LA7 A;  4FHT A;  2X6X A;  2QA4 I;  3PUB A;  2LFB A;  3ABU A;  4CCN A;  1IRX A;  3HGG A;  4G6T B;  5DDG A;  3CO7 C;  4E7L A;  2AS5 F;  2AXL A;  3LMM A;  2KDZ A;  2L01 A;  2XPU A;  1NG6 A;  1ZN2 A;  1EH6 A;  3F3X A;  3F6V A;  1KA8 A;  3OYF A;  2UZK A;  2DFF A;  2XRL A;  3JRG A;  3HZJ A;  4NDL A;  1ODD A;  4EEF G;  2H09 A;  5F1R A;  3KCC A;  1VF9 A;  2OD5 A;  3TDU C;  1FTZ A;  3BTL A;  4A0X A;  1JKP C;  2HVQ A;  5F0H A;  2ECC A;  2W4S A;  1IJW C;  3ZQC A;  4EV0 A;  3JSO A;  4R1H A;  3I3L A;  1SAX A;  5FRO A;  3WG9 A;  2GM4 A;  4HNU A;  4NC6 A;  4RB1 A;  2WAE A;  3M8F A;  3GLX A;  2XVC A;  3KZY A;  3MCZ A;  1XX5 A;  3HOY J;  5B66 C;  4PGH A;  2A61 A;  1HC8 A;  1XSV A;  1S29 A;  3DPL C;  3ULQ B;  4FIS A;  5D5U B;  2M45 A;  2A6H F;  1W0U A;  4IOC F;  3FKI J;  1QNT A;  1TNT A;  4R79 A;  1WSU A;  4LGW A;  1XGO A;  3W6V A;  2GQQ A;  4GYG A;  1J09 A;  4IX7 A;  4A3F J;  5EDN A;  4RS8 A;  2X6W A;  4JX4 A;  3BRO A;  3ZMV A;  2MD0 A;  3V8K A;  3TQN A;  2I5U A;  4HX8 A;  1I1S A;  1W36 D;  2PJP A;  2DOE A;  3L2R A;  3BR2 A;  2D45 A;  1HSJ A;  3VEP A;  4F7Z A;  4XKB A;  3JTG A;  1N77 A;  3HSE A;  1AU7 A;  2MSY A;  3OMY A;  4XOT A;  3KP3 A;  4XOP A;  1YYV A;  2ZXW H;  3KP4 A;  2ISY A;  3WGH A;  4AID A;  4D7M A;  4D7N A;  3M7G A;  2OU2 A;  2FNA A;  5E1X A;  3RTR A;  1DDN A;  2E34 A;  1JUP A;  3S17 J;  2HOT A;  3OS1 A;  2DO7 A;  2OCC H;  3JRD A;  5CVU A;  1V5E A;  5GAG J;  1K83 J;  1PP7 U;  2IGN A;  1IAW A;  1MNM C;  3L2U A;  3GTJ J;  4G7Z F;  1NK2 P;  1X2M A;  2VBZ A;  2UUZ A;  1OPC A;  3VSK A;  1K61 A;  3GFJ A;  1U3E M;  2Y9Z A;  3HL2 A;  3FMQ A;  3CCS I;  2V7F A;  2JK3 A;  4RAG A;  1AKH A;  3RYR A;  3QRF F;  5IOZ A;  1IN4 A;  2PMU A;  1X3Z B;  4HQE A;  2CFO A;  2KL4 A;  4ITV A;  3OYM A;  3S32 A;  4S0H B;  3I64 A;  3OYL A;  5JLX A;  5K1Y A;  3Q3S A;  4A69 C;  5KCM A;  4B4C A;  4BKX A;  4PGG A;  3ZN0 A;  5EYR A;  5IY5 H;  2ZME A;  4AC0 A;  1O3R A;  3ZXS A;  3QQA A;  2FBI A;  3ZMU A;  4XIC A;  4DBR A;  3LSJ A;  5KNL A;  5DCF A;  4I2O A;  4HAM A;  4WXC A;  4CZZ A;  4ENM A;  3HRS A;  4BXU A;  2QBY B;  1UB9 A;  2XC7 A;  1GT0 C;  3BDD A;  3M3Y J;  1UG0 A;  1W5C C;  1B72 A;  4L0Y B;  1Q1H A;  1FOK A;  2WV0 A;  2FXA A;  2X4H A;  1B9N A;  2MLG A;  3LQQ A;  4ENN A;  2EV0 A;  3IKV A;  1OYW A;  4A2U A;  1HBX G;  2OAZ A;  3GLL A;  4PFO A;  4NC8 A;  3S16 J;  2H94 A;  3J7Y J;  2W84 A;  3DTK A;  3IHU A;  3KP6 A;  1RPW A;  4D5F A;  3ZMD A;  5FKK A;  1DUX C;  4ON0 A;  2ZXJ A;  3E1S A;  4F92 B;  2NYX A;  5JLW A;  4DNC A;  3JRB A;  2KZV A;  1SVM A;  2XDV A;  2CFX A;  4OIO F;  1D8K A;  3RKQ A;  3U9G A;  4I98 B;  1SVL A;  1G3S A;  1P9Q C;  3DKY A;  5HOO A;  2VJ5 A;  4OWR B;  3RCO A;  4ZDL A;  1V4R A;  1T95 A;  2GOX B;  2R3S A;  4FET A;  3CO6 C;  1G4D A;  5DD4 A;  3H5N A;  4BU2 A;  1DP3 A;  1EF4 A;  4FCY A;  1JTY A;  2FA5 A;  2HU9 A;  2OQR A;  2PEX A;  1B1B A;  5FRN A;  1KYW A;  4D5C A;  2GLO A;  2ZME C;  3SJM A;  3NWS A;  1OYY A;  4CO8 A;  2HDD A;  5CQE A;  1AHD P;  2XUB A;  5J8F A;  1IN7 A;  3PUF A;  3B73 A;  4X0G A;  3G6E I;  4XRS G;  5BS6 A;  2PI0 A;  2FMY A;  2ZME B;  2EK5 A;  2P5V A;  2VE8 A;  5LBQ A;  2Y0S A;  4W1U A;  1OCO H;  2OC6 A;  4GFB A;  3DF8 A;  3VSL A;  4EVI A;  3HXL A;  2WB1 A;  4G9Y A;  1XGS A;  5DEQ A;  3V42 A;  4BAC A;  5LRR A;  3ZQH A;  4EJT A;  5FRM A;  1ZH5 A;  3DBR B;  2R7R A;  4R8H A;  4HF2 A;  5BPD A;  3VB2 A;  3HOZ J;  1LPQ A;  3K0L A;  4XNF A;  2J5P A;  3I71 A;  3ZMT A;  2VQL A;  1WI3 A;  2QEN A;  3PFI A;  3IL2 A;  3DEE A;  4C9Y A;  4EJU A;  2DQR A;  3NRV A;  5ILU A;  3CCM I;  5FLX K;  2LRE A;  2B0L A;  3P7N A;  1WJD A;  2OA4 A;  1OCR H;  5ICE A;  4BE2 A;  2RDP A;  5HLH A;  1T98 A;  3KZZ A;  2DT7 B;  4UUS B;  4LB5 A;  1QBJ A;  2NS0 A;  4Y13 A;  3ZPL A;  2EA4 A;  2O03 A;  3IC7 A;  3KIO A;  3ZQL A;  2MC4 A;  2R7U A;  2R7X A;  3WU2 C;  1Z67 A;  1T0F A;  3I4N J;  5HLI A;  1XC5 A;  2DQL A;  3BPX A;  1KQ8 A;  3BOQ A;  3S2W A;  3QU6 A;  3G73 A;  1YX5 A;  1Z7L A;  4YFK F;  3DFG A;  4B47 A;  2VQG A;  4B44 A;  1FYM A;  2IRF G;  5IPA A;  4KFC A;  1R5H A;  3IWZ A;  5L3E A;  4HG2 A;  1XCV A;  5LRS A;  3QYB A;  2HI3 A;  1DU0 A;  2Z99 A;  2VL8 A;  1SD5 A;  1W0T A;  1SFO J;  1GXP A;  2PLY A;  3ZR8 X;  4HPQ A;  1R49 A;  1ETK A;  1K4S A;  3HOW J;  2A69 F;  5KAF C;  4B48 A;  2B7E A;  4KNY A;  4IKF A;  1Y8Q B;  2A05 A;  3EDP A;  5IT9 K;  2M87 A;  3ZN1 A;  1R1V A;  4IHV A;  2KRF A;  3HKZ A;  5CVI A;  5C44 J;  4AIH A;  4NB5 A;  2ZCW A;  4IEJ A;  3Q9V A;  2BBY A;  4M3F A;  4PSW A;  3U1D A;  1I50 J;  4P96 A;  1X1C A;  2QZ8 A;  2KIM A;  3HIF A;  3TMO A;  4UVA A;  3ASN H;  2STW A;  2MW8 A;  1IDY A;  2JJ7 A;  3HOU J;  3CQZ J;  3KP7 A;  3BTJ A;  2DOA A;  2VJJ A;  3O8G A;  2LTP A;  4LJZ F;  3CCU I;  1M1E B;  3BQZ A;  3BTC A;  4KIB A;  1FOW A;  2WAD A;  5M3M J;  2R5Z A;  2ZNY A;  2P5K A;  3A02 A;  2LF8 A;  3PIP F;  3F8M A;  2NVU B;  3FHZ A;  1P2F A;  5E3L A;  1QZE A;  3V7R A;  3EPZ A;  5F64 A;  5M5X J;  4HRI A;  1OCZ H;  1Z3X A;  4H4K C;  3NQO A;  2XB0 X;  1N25 A;  1RKW A;  2ECB A;  1T0F C;  3RDI A;  3GTK J;  5KVR A;  1WKM A;  1X4P A;  3SFI A;  1C0W A;  1G3W A;  3N97 A;  3FIS A;  3BY6 A;  1TT5 B;  3OYA A;  4HF0 A;  4NBQ A;  4Y15 A;  1L3L A;  2JSC A;  2ZO4 A;  3K4N A;  1E2X A;  1YQA A;  5BMZ A;  2CS3 A;  1WJF A;  2CSO A;  1LB2 A;  3HRU A;  4GCV A;  4N9I A;  2YX4 A;  4GO1 A;  1YTY A;  5HLT A;  2NOG A;  2HPI A;  3HUG B;  3TP3 A;  3IRQ A;  2GOM A;  4F3Q A;  2IGO A;  2MBF A;  3LA3 A; 
#chains in the Genus database with same CATH homology
 1CGP A;  4CIC A;  3E5U A;  1F5T A;  1HW2 A;  2DT5 A;  1WI9 A;  1XN7 A;  5E8G A;  2LF7 A;  4U0V A;  5L3D A;  3C7J A;  2CQK A;  2X0L A;  4ENJ A;  3MZH A;  2MA3 A;  2COM A;  3RJP A;  1P6R A;  2WWY A;  3R4K A;  4U0W A;  2UWM A;  3FXR A;  2L3D A;  3DXJ F;  2DFI A;  2DK5 A;  1A04 A;  3JAM K;  1YS6 A;  1R5G A;  2H6C A;  5FFZ A;  1BC7 C;  1FYK A;  2HDC A;  3GUD A;  4EJW A;  4OIR F;  2R7F A;  2GIV A;  1IRG A;  2FBH A;  1EH7 A;  3L00 A;  1FYL A;  3I5U A;  2VOO A;  3E6B A;  1TNS A;  4KA4 A;  4CHU A;  3K9T A;  1TQM A;  2UXN A;  2EJR A;  1R36 A;  4UNO A;  4Q5S F;  2XAQ A;  4AD9 A;  4I0A A;  4IHT A;  5ICF A;  5FLX Z;  1KGS A;  2PQ8 A;  2E1C A;  5DUK A;  4G6D A;  2NRA C;  1YW9 A;  2BEO A;  4I09 A;  2PG4 A;  1VTN C;  1U78 A;  3Q9S A;  3MAJ A;  1O7F A;  2F5D A;  4CYD A;  1V3F A;  5D6F A;  4KIC A;  3I53 A;  2PN6 A;  2FQ3 A;  3ROU A;  2F5C A;  2IJL A;  2XHK A;  1MJB A;  3ERE D;  5FD6 A;  3KE2 A;  1FBU A;  3JSP A;  1HXD A;  2CG4 A;  1OR7 A;  3F72 A;  4WXH A;  1XD7 A;  2HKX A;  4LLN A;  5E17 F;  2HQN A;  1UST A;  3W6J B;  1XCB A;  1P4X A;  3AAF A;  2STT A;  4BHP A;  4M9S A;  2V1X A;  3GZ5 A;  3WTW C;  2HS5 A;  3EET A;  2FF4 A;  3WTS C;  3TOB A;  2RV8 A;  5HDG A;  2HKO A;  4LFU A;  3EYY A;  2K86 A;  2IVM A;  1BIA A;  2V79 A;  1SD7 A;  6PAX A;  1JE8 A;  3K69 A;  1T2K A;  2CO5 A;  1ZRD A;  3R0A A;  1KQ9 A;  2RC4 A;  1FBQ A;  4KYW A;  3DQV C;  4CXF A;  1G3T A;  3GEZ A;  1ZGA A;  3CUQ A;  3F6O A;  2EFP A;  1GXQ A;  2OBP A;  4LLG F;  2QYO A;  1Z6R A;  4ZYD A;  3HRT A;  5LGN A;  5LHG A;  2EFW A;  1HW1 A;  4ASN A;  2FRH A;  3KFW X;  3PQJ A;  3R0J A;  1LNW A;  5JVT A;  4NHJ A;  2XGX A;  2V9V A;  1ZRF A;  3LQR A;  2FEZ A;  5TRD A;  1MKM A;  1J9I A;  1GVJ A;  5HDK A;  3I59 A;  2JRT A;  5LEJ A;  2JPB A;  4MTE A;  4EGY A;  4RGU A;  3HOT A;  5L3C A;  3KP5 A;  1YO5 C;  3EYI A;  1QZZ A;  3JAM Z;  2MH2 A;  2V1D A;  4L9T A;  3NEU A;  1EH8 A;  2ZFW A;  2XAS A;  3K1N A;  4MEY F;  2TDX A;  1FP1 D;  2DPD A;  3E6D A;  4XBF A;  3CUQ C;  5A2Q Z;  2DU9 A;  3OV8 A;  4UVC A;  2DW4 A;  4BAY A;  3CUQ B;  2Q2E A;  1S3J A;  3TOA A;  2XAF A;  2ETH A;  3HOS A;  2RNJ A;  4HA8 A;  5DCM A;  4HLY A;  5KK1 A;  3D0S A;  2P7C B;  4ESJ A;  4U88 A;  4TV7 A;  2A3S A;  2EFQ A;  1K6O A;  2NAZ A;  2P5L C;  2UXX A;  3T8R A;  2DAO A;  4I01 A;  4HZF A;  4B09 A;  4HV5 A;  4IXA A;  3MWM A;  4UXN A;  5AIQ A;  2VON A;  2ESN A;  2HZT A;  3I59 B;  2O0Y A;  2PMH A;  1FNN A;  1K79 A;  1T39 A;  5D4S A;  1HQC A;  2M1B A;  2QLZ A;  3SZP A;  4CGZ A;  3CLO A;  4BQA A;  1Z05 A;  3MFK A;  3KP2 A;  4EQQ A;  2FE3 A;  2KIU A;  2HYG D;  1S7A A;  3HRM A;  1YG2 A;  3WTV C;  2GA1 A;  1QQI A;  3FM3 A;  2HTS A;  4YG2 F;  5DCM B;  2KIF A;  2LKP A;  3QP5 A;  3K2Z A;  4OIN F;  1BN5 A;  2R7D A;  3RKW A;  4WK8 F;  2EB7 A;  2P8T A;  3GFL A;  3TGN A;  4JBA A;  3F8N A;  1G6N A;  4P9U A;  3V7S A;  5HS9 A;  1Z7U A;  3V8L A;  2VE9 A;  2IA2 A;  2VT3 A;  4BHC A;  5CJ9 A;  1IXS B;  2L4M A;  3MZY A;  3HYI A;  3E3V A;  4O5V A;  3WTY C;  1ZRC A;  3EQL F;  1KU3 A;  5CYV A;  2K27 A;  4UHT A;  4A5M A;  1R00 A;  4EJV A;  4ESB A;  1FWZ A;  2DI3 A;  2HYF A;  1U5T A;  5L3F A;  1F1Z A;  2P6S A;  1B59 A;  3TKY A;  2O3F A;  1B4A A;  1P4W A;  5L3B A;  3MEX A;  2HGC A;  1ZYR F;  3K1P A;  5HS7 A;  4ZYE A;  2IA0 A;  2JTV A;  2XAJ A;  1LJ9 A;  4UV8 A;  4G6Q A;  1E17 A;  5ICC A;  3GW2 A;  2Y0M A;  1J7K A;  3H3U A;  5F6F A;  2A68 F;  2JT1 A;  2IT0 A;  1PP8 F;  1STZ A;  1RUO A;  3J7A O;  1XSD A;  3QU3 A;  3IKT A;  1D8J A;  5JFR A;  5L3G A;  4I02 A;  4M6Y A;  5DYM A;  1YW8 A;  2YPR A;  5D8K B;  4HV6 A;  3HTS B;  3ZP5 A;  2GXG A;  4LB6 B;  5D5W B;  4CDG A;  3JW4 A;  3IWF A;  1DPR A;  5JHU A;  2FNP A;  2L54 A;  4JQF A;  4M9Z A;  4RAZ A;  1GHC A;  3P9K A;  2MD5 A;  1IXC A;  1U5T B;  2E7X A;  2D1V A;  4EM1 A;  1J59 A;  3L2C A;  2HTJ A;  4RAY A;  5AIP A;  4LLL A;  3L09 A;  3RI4 A;  2P7V B;  4A0Z A;  2BE5 F;  5HLG A;  2QQ9 A;  2F5F A;  1MJA A;  1F9N A;  4HYE A;  5E18 F;  4IRG A;  4S04 A;  4U0Y A;  2E7W A;  4IVN A;  3FZV A;  5LHI A;  4KN7 X;  2HWV A;  1LQ1 A;  1CF7 A;  2BGC A;  3J80 K;  3I58 A;  2IPQ X;  2EFN A;  1UFM A;  3GFI A;  1ZRE A;  5JR3 A;  1G3Y A;  2YX7 A;  4MQV A;  3SFZ A;  4OOI A;  1FLI A;  1UCR A;  4A12 A;  1FBS A;  2Z5U A;  5EEH A;  4BYY A;  1W4M A;  1TW2 A;  1O7L A;  3C1D A;  3LFK A;  4WF2 A;  4NQW A;  3F8B A;  1O3S A;  3FXQ A;  3SXY A;  1I6X A;  4I7H A;  4LK1 F;  5DD8 A;  1OMI A;  3QAH A;  4Y17 A;  3CTA A;  4KT5 C;  4YFN F;  1TTY A;  2VOP A;  2LNB A;  2CGP A;  4L5J A;  2MH9 A;  3KLO A;  3GX4 X;  3KET A;  2IA1 A;  4FX0 A;  3Q5F A;  4A5N A;  1CF7 B;  4HOB A;  1MDM A;  1YIO A;  1REP C;  1WWX A;  1KQ0 A;  2QM3 A;  4M73 A;  1R23 A;  1O57 A;  1R7J A;  2F5E A;  1IN8 A;  2NNN A;  1DP7 P;  2VBW A;  3CUO A;  3BJ6 A;  2VN2 A;  2H27 A;  4M6X A;  1FC3 A;  3G3Z A;  1H0M A;  1WQ2 A;  1ZG3 A;  4FX4 A;  1TQI A;  2VC1 A;  2FU4 A;  4QWQ A;  4M9X A;  1JXS A;  3P9C A;  5BQT A;  1TBX A;  3SQN A;  4DQ2 A;  2G9W A;  3RPU A;  5EEG A;  1SMT A;  3WU1 B;  5ED4 A;  1Z91 A;  1TLH B;  4OU0 A;  3GFM A;  1XSX A;  4ZYH A;  4L9N A;  1I27 A;  5H6R A;  1W5S A;  5DV5 A;  2D1H A;  3LAP A;  3V4G A;  1DPU A;  1YW7 A;  1MDM B;  3DP7 A;  5FB2 A;  3WTU C;  1ZHF A;  2Q8K A;  3PQK A;  5IT9 Z;  1YFH A;  4GGG A;  4MTD A;  3QP6 A;  3R6S A;  1S6L A;  1J75 A;  3WTZ A;  1LDJ A;  1BC8 C;  2Z33 A;  1I1G A;  1FZP B;  4BH9 A;  2PBI A;  1BIB A;  2RN7 A;  5CLS A;  4EM0 B;  1FSH A;  3DEU A;  3ML6 A;  1RI7 A;  4LG0 A;  2RKH A;  2IW5 A;  2ZBK A;  2KKO A;  5LLQ A;  3J80 Z;  1T6S A;  5IT3 A;  1XB4 A;  2RQP A;  4ESF A;  1FP2 A;  2QUF A;  2YU3 A;  1XMA A;  2G7H A;  3WOD F;  1NHA A;  2FBK A;  1LDD A;  1ZG5 A;  3L9F A;  3MQ0 A;  4KMU X;  4L9J A;  3GZ6 A;  1IN6 A;  1I5Z A;  1MZB A;  1TW3 A;  4PZJ A;  1U2W A;  2WTE A;  1B6A A;  3TO6 A;  1BM9 A;  4RGX A;  4M72 A;  3BWG A;  3WGI A;  4GXO A;  1RZ4 A;  2OZU A;  4EM2 A;  2HR3 A;  3FXU A;  2DLL A;  2WC2 A;  1QPM A;  3REO A;  2XRO A;  3WU0 A;  1LVA A;  3BZ6 A;  3K1M A;  2K4B A;  1F4K A;  1FT9 A;  4MEX F;  3FX3 A;  4N9H A;  3F8F A;  2ACJ A;  4OMZ A;  3HTU A;  1SD4 A;  2XKP A;  3U2R A;  3T1B A;  3ZMS A;  4P55 A;  4RB0 A;  5JI6 A;  3CDH A;  2XKO A;  3JTH A;  4XRF A;  3J81 K;  1W5T A;  4MHG A;  2ZNZ A;  4LD5 A;  4BNC A;  3DKW A;  3RKY A;  2ISZ A;  3VOD A;  4XSZ F;  2BYV E;  4GYI A;  2XRN A;  3CJN A;  1JHH A;  1HW5 A;  3DV8 A;  2Q0O A;  3FM5 A;  4MGR A;  4PDK A;  4A6D A;  5TJJ A;  2GA2 A;  2MC3 A;  2LSO A;  1O3Q A;  1ZLK A;  4G8X A;  2QBY A;  2O6G E;  4HX7 A;  2Y75 A;  2V1U A;  3O3K A;  5D5X B;  2VOD A;  4N0B A;  2W57 A;  2VC0 A;  3H92 A;  1Y0U A;  1KU9 A;  1SD6 A;  4ZH4 F;  5HDN A;  5K5Q A;  2XAH A;  1LEB A;  3F22 A;  1HST A;  4QLC U;  3C3W A;  2QQB A;  1RUN A;  1FX7 A;  1AWC A;  3C18 A;  4L18 B;  5LEK A;  1PDN C;  4AVP A;  3V8J A;  4OIP F;  1ULY A;  1BJA A;  1JHF A;  1ZAO A;  2HFH A;  4RGS A;  1HKT A;  2ZJ2 A;  5FGM A;  3BPV A;  4YII A;  4P5O A;  2E1N A;  4L0Z B;  5H20 A;  1BI3 A;  3R61 A;  4WWC A;  4HF1 A;  2FML A;  2JZY A;  1BOA A;  3T0Y A;  1ZAR A;  4JK1 X;  2K7L A;  2W85 A;  1IW7 F;  2PFB A;  3T5X A;  4E70 A;  4I0B A;  1T38 A;  4BHB A;  2F2E A;  4IRH A;  3RPQ A;  1ZGJ A;  1SFE A;  4HX4 A;  4UV9 A;  3VOE A;  3P9I A;  3T8T A;  1PUE E;  4HDU A;  1R22 A;  4KMF A;  1SFX A;  4ZYG A;  1KYZ A;  2XIG A;  1YS7 A;  4O6J A;  1K7A A;  2Y48 A;  1H9G A;  2EV5 A;  3O2P E;  4RB2 C;  2DBB A;  4XLN F;  1MD0 A;  4Q4Z F;  3HSR A;  2A5Y B;  1R58 A;  1P92 A;  4RB3 C;  4MNU A;  2FSW A;  3KEQ A;  1SFU A;  2GZW A;  1USS A;  4IJA A;  1MJ9 A;  1W7P A;  4PCQ A;  5CVR A;  2HQR A;  3BJA A;  5D4R A;  1KU7 A;  5CVJ A;  2BV6 A;  4U7B A;  3TO9 A;  4XLP F;  3LA2 A;  4WX9 A;  2EA2 A;  2IP2 A;  2GAU A;  5HS8 A;  1J2X A;  2CWE A;  1LDK B;  5FFX A;  3IRR A;  3F8C A;  1EV7 A;  2RVC A;  2M8E A;  3ABT A;  3F23 A;  4AIK A;  3M1E A;  5K5R A;  1ZLJ A;  3J81 Z;  1BI0 A;  4O3M A;  3WE3 A;  2P6T A;  1W7P D;  1U5T C;  3GYH X;  1O3T A;  4ETS A;  1BI2 A;  3M9A A;  2YSR A;  5E20 A;  2LDU A;  4KDP A;  3L7W A;  1L0O C;  3RKX A;  3VFZ A;  2DK8 A;  1ON2 A;  4KN4 X;  5ICG A;  2YR2 A;  1W7P B;  3HUG A;  2QQA A;  4ZZD A;  2O8X A;  4YIF A;  3M8E A;  1X3U A;  1FPQ A;  1KU2 A;  4M71 A;  4B8X A;  1U8R A;  3E97 A;  4EGZ A;  1IN5 A;  2EFO A;  2QVO A;  5LHH A;  1Z9C A;  4UUV A;  2VT2 A;  4IPA A;  5ILV A;  5LGT A;  1H9T A;  3BP8 A;  4ZZL A;  5BPI A;  2O61 A;  2QWW A;  2D2W A;  4M74 A;  3FF5 A;  5LGU A;  3GF2 A;  4D0P A;  2KJB A;  3O6B B;  3D5L A;  5FD5 A;  2VXZ A;  4G7O F;  3ZQ7 A;  3LST A;  3HSF A;  2W25 A;  1JGS A;  1IF1 A;  4S05 A;  1BBY A;  4Z2Y A;  5HVQ C;  1XGN A;  2XAG A;  2P4W A;  5J6X A;  3FMR A;  4H0E A;  3DPT A;  3HHG A;  1HKQ A;  2L02 A;  2CYY A;  1FY7 A;  2OZ6 A;  2GXB A;  4YFX F;  1J0R A;  4Q48 A;  2VBY A;  3E5X A;  5ERI A;  2Z9O A;  4P9F A;  1QGP A;  1AOY A;  3ECH A;  2KJC A;  5H6Q A;  4OMY A;  1MGT A;  4ENK A;  1IXR C;  2W24 A;  2M30 A;  1Z6T A;  2HOE A;  3FMS A;  1TQP A;  5DUI A;  2L4A A;  1HKS A;  4HW0 A;  1XMK A;  1K78 A;  1WRJ A;  2G7U A;  1XDU A;  2ESH A;  1IUY A;  5D5V B;  4HLX A;  3ISP A;  4IRI A;  3R60 A;  3KLN A;  2ZKZ A;  2M5W A;  1B9M A;  3TDZ C;  1UHM A;  4HQM A;  4IF4 A;  4HBL A;  3LWF A;  1QZY A;  2A07 F;  5A2Q K;  1R1U A;  4WCG A;  3F21 A;  1ZG1 A;  4EJO A;  1S7O A;  2RGV A;  4LK0 F;  2A6E F;  5E1Z B;  5BOX A;  3I4P A;  4EMS A;  2VBX A;  3WGG A;  4WXD A;  5AON A;  1D3Y A;  2J5O A;  2GWR A;  3H3Z A;  1Z1D A;  3SHF A;  2ELH A;  3I0T A;  3GWZ A;  2DTR A;  5CVV A;  1ON1 A;  2EV6 A;  3FWE A;  1OYI A;  1K78 B;  1IZ1 A;  2MLK A;  1ONV A;  4AWX B;  1IRF A;  2OQG A;  3E5Q A;  5ILS A;  5E8I A;  2EWN A;  2Z3Y A;  3EUH A;  1SMY F;  4IHS A;  2K4J A;  4HDV A;  2ADU A;  4G7H F;  3RYP A;  3I54 A;  1J5Y A;  5J8C A;  4A6E A;  2DPU A;  3COA C;  5D6E A;  2FOK A;  1R1T A;  2H6B A;  1FSE A;  4KIF A;  4L5I A;  3LAJ A;  1D5V A;  2NNY A;  3TO7 A;  1OKR A;  4KUM A;  5D8L B;  4A0Y A;  1XGM A;  3BJO A;  1UHW A;  3GXO A;  3E6M A;  4K2E A;  3V7C A;  1U6G A;  4OIQ F;  2CW0 F;  3QOP A;  2K02 A;  2JPC A;  4Q47 A;  3W6K B;  4G94 A;  3E6C C;  1P4A A;  1BI1 A;  5K5O A;  4U7D A;  3WTT C;  3OOP A;  4L9V A;  4LMY A;  2V6C A;  4RGR A;  3ZMZ A;  2C6Y A;  4UVB A;  2HEO A;  1XDS A;  3B02 A;  1LEA A;  3GVA A;  5E1W A;  1YLF A;  3RIR A;  4AIJ A;  4XSX F;  3HHH A;  3ECO A;  3WTX C;  1RIO H;  4MQ9 F;  4LG0 B;  5FO5 A;  4FT8 A;  4KIG A;  1S8N A;  3KEO A;  3WE2 A;  2XV4 S;  3GO5 A;  3N4M A;  3SZT A;  3ELK A;  1QO0 D;  1RNL A;  3QPH A;  3QPT A;  3LA7 A;  4FHT A;  3ABU A;  5DDG A;  3CO7 C;  2AS5 F;  2AXL A;  2L01 A;  3F3X A;  2UZK A;  1ZN2 A;  1EH6 A;  3F6V A;  1KA8 A;  1ODD A;  2H09 A;  5F1R A;  3KCC A;  2OD5 A;  3TDU C;  4A0X A;  4EV0 A;  3JSO A;  4R1H A;  1SAX A;  3WG9 A;  4RB1 A;  3M8F A;  3GLX A;  2XVC A;  3KZY A;  3MCZ A;  4PGH A;  2A61 A;  1XSV A;  1S29 A;  3DPL C;  3ULQ B;  5D5U B;  2M45 A;  2A6H F;  1QNT A;  1TNT A;  4R79 A;  1WSU A;  4LGW A;  1XGO A;  2GQQ A;  4GYG A;  4RS8 A;  3BRO A;  3ZMV A;  3V8K A;  3TQN A;  4HX8 A;  1I1S A;  2PJP A;  2D45 A;  1HSJ A;  3VEP A;  4F7Z A;  3JTG A;  3HSE A;  3KP3 A;  1YYV A;  3KP4 A;  2ISY A;  3WGH A;  3M7G A;  2OU2 A;  2FNA A;  5E1X A;  3RTR A;  1DDN A;  2DO7 A;  5CVU A;  1PP7 U;  1IAW A;  4G7Z F;  2VBZ A;  1OPC A;  3GFJ A;  1U3E M;  3FMQ A;  3RYR A;  3QRF F;  1IN4 A;  2PMU A;  4HQE A;  3I64 A;  5K1Y A;  4PGG A;  3ZN0 A;  2ZME A;  1O3R A;  2FBI A;  3ZMU A;  5DCF A;  4I2O A;  4HAM A;  4WXC A;  4CZZ A;  4ENM A;  3HRS A;  4BXU A;  2QBY B;  1UB9 A;  3BDD A;  4L0Y B;  1Q1H A;  1FOK A;  2WV0 A;  2FXA A;  2X4H A;  1B9N A;  2MLG A;  3LQQ A;  4ENN A;  2EV0 A;  3IKV A;  1OYW A;  4A2U A;  1HBX G;  2OAZ A;  2H94 A;  2W84 A;  3IHU A;  3KP6 A;  3ZMD A;  1DUX C;  4ON0 A;  2ZXJ A;  2NYX A;  4DNC A;  2CFX A;  4OIO F;  1D8K A;  3U9G A;  4I98 B;  1G3S A;  5HOO A;  1V4R A;  2R3S A;  3CO6 C;  1G4D A;  5DD4 A;  2FA5 A;  2PEX A;  2OQR A;  1B1B A;  1KYW A;  1OYY A;  4CO8 A;  2XUB A;  5J8F A;  1IN7 A;  3B73 A;  5BS6 A;  2PI0 A;  2FMY A;  2ZME B;  2EK5 A;  2P5V A;  5LBQ A;  2VE8 A;  3DF8 A;  4EVI A;  4G9Y A;  1XGS A;  5DEQ A;  4EJT A;  5LRR A;  1ZH5 A;  4HF2 A;  4R8H A;  5BPD A;  3VB2 A;  3K0L A;  2J5P A;  3I71 A;  3ZMT A;  2QEN A;  3PFI A;  3IL2 A;  4EJU A;  2DQR A;  3NRV A;  5ILU A;  5FLX K;  2B0L A;  3P7N A;  2OA4 A;  5ICE A;  2RDP A;  5HLH A;  1T98 A;  3KZZ A;  4LB5 A;  1QBJ A;  2NS0 A;  4Y13 A;  3ZPL A;  2EA4 A;  2O03 A;  3IC7 A;  1T0F A;  5HLI A;  2DQL A;  3BPX A;  1KQ8 A;  3BOQ A;  3S2W A;  3QU6 A;  3G73 A;  4YFK F;  3DFG A;  1FYM A;  2IRF G;  4KFC A;  1R5H A;  3IWZ A;  5L3E A;  1XCV A;  5LRS A;  2Z99 A;  1SD5 A;  2PLY A;  1GXP A;  2A69 F;  4KNY A;  3EDP A;  5IT9 K;  2M87 A;  3ZN1 A;  1R1V A;  2KRF A;  5CVI A;  4AIH A;  4NB5 A;  2ZCW A;  3Q9V A;  2BBY A;  3U1D A;  4P96 A;  2QZ8 A;  2KIM A;  3HIF A;  4UVA A;  2STW A;  3KP7 A;  4LJZ F;  4KIB A;  2ZNY A;  2P5K A;  2LF8 A;  3F8M A;  3FHZ A;  1P2F A;  3V7R A;  5F64 A;  3NQO A;  3RDI A;  5KVR A;  1WKM A;  1C0W A;  1G3W A;  3N97 A;  3BY6 A;  4HF0 A;  1L3L A;  4Y15 A;  2JSC A;  2ZO4 A;  1E2X A;  1YQA A;  5BMZ A;  2CSO A;  1LB2 A;  3HRU A;  4GCV A;  4N9I A;  2YX4 A;  4GO1 A;  1YTY A;  3IRQ A;  2MBF A;  3LA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...