1CF7A

Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*TP*TP*TP*TP*CP*GP*CP*GP*CP*GP*GP*TP*TP*TP*T)-3
publication title Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02319 E2F_TDP E2F/DP family winged-helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cf7A00
4ENKA 1FBSA 3JSPA 5FFZA 5D5XB 2PJPA 3R60A 2EV0A 2P8TA 1HW5A 3WE3A 3RIRA 2QM3A 1ZGAA 4M72A 1XN7A 4L18B 3GF2A 1S7AA 4E70A 4HV5A 2XV4S 5LGNA 4R8HA 2EFOA 2IA2A 3F22A 2XAHA 1Z1DA 3LWFA 1ZRDA 2VN2A 3RKWA 4JBAA 5LHIA 1IW7F 2YSRA 3F8MA 1LJ9A 4U0YA 2OQRA 1Z6RA 2VOPA 2ISYA 5DCFA 3GO5A 2RQPA 3F6VA 3HHHA 3E97A 2PN6A 5DCMB 3WGIA 3C18A 3RYPA 1STZA 3IRQA 3BP8A 5IT9Z 4I01A 5D8LB 3R6SA 1KU7A 3P9IA 1TQPA 5CVJA 1SMYF 4LK0F 1F4KA 1WRJA 3LAJA 5F64A 5JFRA 2R7FA 1QZZA 4EV0A 2UXXA 5HVQC 1XB4A 3GLXA 2HKOA 1G6NA 2EFQA 1HBXG 3CUQC 4GCVA 5HOOA 1HSTA 1G3WA 1JHFA 4ESFA 3E5XA 4AVPA 4ZYHA 4HF1A 2MC3A 3DF8A 1YS6A 1RUNA 1O3TA 2DK8A 3CO7C 2HQNA 4O3MA 3GEZA 3HRTA 1I5ZA 1HW2A 2KRFA 1Z05A 2QZ8A 1TQIA 2MA3A 4M71A 1YS7A 3RKYA 4RB2C 3MEXA 1B4AA 4Q4ZF 1OPCA 3DQVC 4LG0A 3K2ZA 3EYIA 5E1XA 3TGNA 2GWRA 1G3TA 1D8KA 3IWFA 1YW9A 3HTSB 3ZMVA 2CFXA 2KKOA 5LRRA 4Y13A 4RGRA 4HLYA 1O3RA 4KFCA 4EQQA 2VBWA 4KMUX 3P7NA 4OIPF 2NS0A 2ZNZA 5CLSA 3ZPLA 2Y0MA 2FRHA 3WODF 1IZ1A 2ZKZA 1YW7A 2W57A 1WQ2A 5E8IA 2LDUA 1U78A 2XKPA 2XVCA 2W25A 3WGHA 4M6XA 3KFWX 3CDHA 3PFIA 1J9IA 2HGCA 4YIFA 5FO5A 1XSDA 1F5TA 2QVOA 3V4GA 4RAYA 3HOTA 1YQAA 2MLGA 4I0AA 1XSVA 5D6EA 1DDNA 1J0RA 2CG4A 3CUQA 2G7HA 1D3YA 4G8XA 5LHGA 4Q48A 2QQBA 5ICEA 3COAC 5E18F 3WTZA 4M73A 3K1MA 2QBYB 3TO7A 1G4DA 3KZYA 3FM5A 3VFZA 1FWZA 4LFUA 3MZHA 5BPDA 4IHSA 2DQLA 4H0EA 1V3FA 4WX9A 5H6RA 4S04A 2P5VA 4A12A 4KIGA 3RPUA 4XBFA 1DPUA 2ZNYA 1ZGJA 3WTUC 3N97A 4PDKA 3TDUC 1OYYA 4Q47A 1S3JA 4P5OA 5BQTA 1K6OA 2VBXA 2WV0A 3BY6A 3E6DA 1ZRFA 3CUOA 4EJTA 2VODA 3QU3A 3R61A 4HV6A 4MGRA 5HLGA 2W24A 2NRAC 2H27A 4XSXF 1JHHA 3CO6C 4BQAA 2O3FA 4QWQA 5HS7A 2K02A 3KP7A 2OZ6A 3EYYA 3WU0A 4G7ZF 4QLCU 4IPAA 3HSFA 5D5VB 1TNTA 3IWZA 1W4MA 3WTXC 3L9FA 3MAJA 4HOBA 1R58A 1BIBA 3SFZA 3SZTA 4MNUA 1H0MA 4CHUA 2DTRA 3IKVA 3L2CA 4ASNA 4GYGA 3MWMA 3RI4A 1MDMB 2HFHA 1IAWA 2YR2A 3BJAA 5D5UB 2RGVA 3KEQA 2DO7A 1FBQA 5LGUA 5TRDA 1XGOA 2G9WA 4EJUA 2E7WA 5F1RA 2HTSA 1ZG5A 1O3QA 1IN6A 5ILVA 5JI6A 1FC3A 1UHMA 1V4RA 4OMYA 2EJRA 4GXOA 5ICGA 3K1PA 5LLQA 3F8BA 2RDPA 2WWYA 1MJ9A 5ED4A 1JE8A 1FP1D 2P7CB 2RN7A 1MZBA 4EJOA 4O5VA 3E6BA 2Y48A 3TQNA 2P5KA 5DUKA 3ECHA 1BBYA 4LD5A 1DUXC 3WTWC 4CZZA 5CVRA 4IXAA 1FY7A 3ABTA 5LRSA 1XGNA 5E17F 4N9IA 4KYWA 4HQMA 1BJAA 2Z33A 4G7HF 5KK1A 3R4KA 4FT8A 2M8EA 5HS8A 4FX4A 3DXJF 4IVNA 3ZMZA 3PQKA 1IUYA 4KT5C 3HYIA 1FOKA 4D0PA 4ZH4F 5F6FA 5FLXZ 3F72A 4KN7X 4CXFA 2OD5A 3U2RA 2L4AA 2LF8A 2QUFA 1S6LA 2WC2A 1UFMA 2XKOA 5D6FA 5E1ZB 2GXGA 2A6EF 3FX3A 4UXNA 3VEPA 3F8NA 1Z6TA 3SXYA 4HF0A 4KIBA 3TOAA 4WWCA 2YU3A 5E8GA 1YIOA 3L00A 3RJPA 2ZXJA 3HSRA 5DCMA 2ESNA 4BHBA 1LEBA 3GZ6A 4OOIA 5J6XA 2BGCA 5E1WA 3MCZA 5D4SA 3GZ5A 3E6CC 3L09A 2IA0A 3BZ6A 1H9GA 4ENJA 4A0YA 3QPTA 2EFWA 3J81K 2O6GE 3D0SA 2W84A 1T2KA 1Z91A 3ERED 5BMZA 5AONA 3T0YA 1YLFA 3RYRA 2MH2A 1BI3A 1KQ9A 2HQRA 3H3ZA 4WF2A 1SD4A 4ZYGA 3G73A 4JK1X 5AIQA 4IRIA 3F6OA 1PP7U 4OINF 1LDDA 4LLNA 4KICA 1P6RA 1XDSA 3VB2A 3Q9VA 3VOEA 3KLOA 4F7ZA 1SD7A 4A6DA 1SFXA 2FSWA 4LLGF 3B02A 4AIKA 1Y0UA 3KLNA 1VTNC 3I59B 1Q1HA 3HOSA 2UWMA 2OZUA 1W7PD 2Q0OA 4G94A 4AWXB 2VONA 4ZYDA 2A3SA 1XMAA 1X3UA 1L3LA 1J5YA 4HF2A 3DEUA 2BYVE 2G7UA 2F5EA 2F5FA 1L0OC 4YG2F 1O57A 1IRGA 2PEXA 2KIUA 5L3BA 1KYWA 1RI7A 1GHCA 2PQ8A 4EM1A 2W85A 5K1YA 4XSZF 1TTYA 1O7FA 1QPMA 1PDNC 1HSJA 3QP6A 2IP2A 3ECOA 1W7PB 1SFUA 1I1GA 4K2EA 2ETHA 4P9UA 1R5GA 4KIFA 3T1BA 2ELHA 4PCQA 2ESHA 3I71A 2K7LA 4P9FA 4MTEA 4PGGA 4L9TA 1B6AA 1KYZA 2NAZA 3FXQA 4EM2A 2IJLA 3MQ0A 4HAMA 1FT9A 4ZYEA 1ZG3A 1QZYA 1ZLJA 4HZFA 3GFIA 3C7JA 3BOQA 3HUGA 3U1DA 4EM0B 3RTRA 2H94A 2HZTA 1HKSA 1K78B 1FSHA 1QBJA 2RC4A 3F23A 2QBYA 2STWA 2Z3YA 4G6DA 1IXRC 2XAQA 5ERIA 4A2UA 1QO0D 2ZJ2A 2FEZA 4HQEA 1SMTA 1D8JA 3I54A 4ESJA 2DW4A 3DKWA 4BAYA 2LKPA 3DPTA 4IHTA 1ZHFA 1MJAA 4EJWA 4RGXA 2AXLA 1FYKA 2KIFA 3GW2A 1J59A 4U0VA 1R00A 4YFNF 3KP6A 5JVTA 5A2QK 1B9NA 2HYGD 3BJOA 5EEHA 4MTDA 4N0BA 5ILSA 1SD6A 1IN8A 4NB5A 2P4WA 4BH9A 3C3WA 5HS9A 1EH8A 3WTVC 2F2EA 4RGUA 1XCVA 4I02A 5LBQA 2A6HF 2XRNA 4L5IA 2HOEA 1IN4A 3GYHX 2HYFA 1HXDA 3ZMDA 2VT3A 1P2FA 3KP2A 1OYIA 2ZMEA 2GA1A 3OV8A 2CO5A 4ENMA 1MKMA 3N4MA 4I0BA 3M9AA 2K86A 2VBZA 4CGZA 1UHWA 4U7DA 2XAFA 2X0LA 3KZZA 5DUIA 1IF1A 1E17A 1OR7A 3EUHA 3I0TA 2CGPA 3W6JB 2Z9OA 2K27A 4OIRF 3IC7A 4KUMA 1LDJA 4RS8A 3R0AA 2XASA 4L0ZB 1OKRA 3HRMA 4YFXF 4P55A 1FNNA 4G6QA 5FD6A 3GFLA 4HLXA 1RUOA 5AIPA 1LB2A 1ZLKA 2ZO4A 3M8FA 3JAMK 1P4AA 1BC7C 2JRTA 1C0WA 3GWZA 1U3EM 2OU2A 3NRVA 1B59A 4LB6B 3KEOA 3QAHA 5LEKA 1YW8A 2D1HA 1XDUA 1WSUA 2XUBA 2QYOA 3HRUA 4OMZA 3K9TA 1BI0A 3FXUA 3JTGA 2M5WA 1HW1A 2F5CA 3QP5A 2FNAA 2COMA 2HTJA 3I58A 2STTA 3TKYA 2DT5A 3FHZA 2VT2A 2PFBA 2ZCWA 1ZG1A 2LSOA 2DI3A 3TO6A 1ZAOA 1E2XA 2HR3A 3V8JA 2EA2A 5ILUA 2M87A 1ON2A 6PAXA 4ON0A 3ZMTA 2FU4A 3P9CA 4PZJA 1ODDA 2EV5A 1CF7B 2KJBA 4BYYA 1ZH5A 1OMIA 3U9GA 4RAZA 1GXPA 1ZRCA 3ZMUA 3JSOA 2QQ9A 4UUVA 4M9XA 3JW4A 3I4PA 2ZBKA 1SAXA 2FNPA 3ABUA 2NNNA 4HX8A 1O3SA 3K1NA 2V1XA 1RIOH 4OIQF 2VBYA 3S2WA 5BS6A 3EQLF 3IL2A 1LDKB 2FF4A 1REPC 2CYYA 1J7KA 4YFKF 3ROUA 5BPIA 1IXCA 2LF7A 3M7GA 3KE2A 5JR3A 2E7XA 3ML6A 2ZFWA 3NQOA 3ELKA 2EB7A 1T0FA 3O6BB 2CSOA 2EFPA 1R23A 4UV8A 3EDPA 5HLHA 1LQ1A 2HS5A 1FX7A 2D1VA 3LQQA 2DAOA 2HEOA 2QWWA 2H09A 4CDGA 4WK8F 1IN7A 2UXNA 1EH7A 4I09A 2VC0A 2H6BA 1ZARA 5DDGA 3GX4X 1TBXA 1SD5A 4OIOF 1IRFA 2EWNA 1I1SA 1S29A 1KQ0A 3FMRA 3W6KB 4L0YB 2A69F 4MQ9F 3WTYC 3GVAA 2X4HA 1R22A 1P4WA 5IT9K 3J7AO 5HDKA 2V9VA 4UVBA 1BM9A 4Y15A 5IT3A 2DLLA 5J8FA 5TJJA 3QOPA 4GYIA 3LA7A 3HRSA 1BI2A 3LA2A 2B0LA 2PMHA 3O2PE 2A5YB 2PI0A 3GFMA 4LMYA 2OBPA 1NHAA 1U2WA 2J5PA 4ENNA 4IRGA 4LB5A 1W7PA 1AWCA 4ZZDA 1S8NA 3E5QA 3IRRA 3H92A 5DD4A 3V8LA 4CYDA 1BOAA 5K5RA 4HDVA 2ACJA 1Z7UA 1ZN2A 1U5TB 4G7OF 2BEOA 4TV7A 1QGPA 1KQ8A 4M9ZA 2O8XA 5FGMA 1BI1A 5CVVA 4RGSA 3I53A 1J2XA 3SQNA 3KP5A 1JGSA 1HKQA 4M6YA 5K5QA 4HYEA 3ZMSA 2K4JA 3E3VA 4P96A 2DPDA 3BJ6A 4MEXF 1D5VA 1XD7A 1S7OA 1XMKA 3Q5FA 3CJNA 1FYLA 1YFHA 2O61A 4NQWA 3TO9A 4ETSA 2M30A 4MEYF 2JPBA 3WG9A 4LGWA 2TDXA 2H6CA 5EEGA 2GXBA 1KGSA 4MQVA 1F9NA 3F21A 2FBIA 4BHPA 1FP2A 1ULYA 2V6CA 2DK5A 1UB9A 2QQAA 3I64A 4HA8A 2VC1A 4HW0A 4HX7A 1YTYA 1IN5A 4UNOA 2FQ3A 2O03A 4HBLA 3RDIA 3SZPA 1O7LA 4B8XA 2IRFG 1R7JA 4LJZF 1PP8F 1PUEE 3LQRA 4Z2YA 2NNYA 1LVAA 1FSEA 3O3KA 2IT0A 2GA2A 2OAZA 4RB3C 1YG2A 2L54A 2A68F 4UHTA 2CW0F 3DFGA 3M1EA 4AIHA 4EVIA 2D45A 4JQFA 5CVIA 2ISZA 2C6YA 4BHCA 3GUDA 3FMSA 4A0ZA 4EMSA 4FX0A 3L7WA 1P92A 2MBFA 2IA1A 2V79A 4RB0A 2CQKA 2D2WA 5L3GA 3DPLC 4L9JA 2DQRA 3F8FA 3TOBA 2PMUA 1KU2A 2ADUA 4XRFA 4DQ2A 1WWXA 1RNLA 4A0XA 4IRHA 5L3FA 1MD0A 4XLPF 3T5XA 5HDGA 4LK1F 5CJ9A 1F1ZA 4KNYA 2FXAA 4UVCA 2FBKA 1T39A 2P5LC 3V8KA 5JHUA 2JSCA 2Z5UA 5CYVA 5DD8A 3WU1B 1AOYA 3KP4A 2DPUA 3C1DA 3H3UA 3TDZC 3WGGA 2XROA 3CTAA 3J81Z 3BWGA 1MGTA 1EH6A 3BROA 3R0JA 2QLZA 3FZVA 4DNCA 4G9YA 2VE8A 4A5NA 3CLOA 2FA5A 2FE3A 1WKMA 3FMQA 5FB2A 4NHJA 2V1DA 1FLIA 1R36A 1A04A 2KJCA 2WTEA 3Q9SA 3EETA 4AD9A 2RKHA 3JTHA 3FWEA 4L5JA 3G3ZA 2UZKA 1MDMA 5FFXA 3KCCA 4L9VA 3WTTC 1R5HA 2EK5A 4CICA 1CGPA 1GVJA 2PLYA 2GAUA 2XGXA 3NEUA 1CF7A 5DEQA 5L3EA 2BBYA 3HTUA 3ISPA 3LFKA 3IKTA 1OYWA 3ZQ7A 2YX4A 2VE9A 4AIJA 5LHHA 5DYMA 1ONVA 2O0YA 2E1NA 4PGHA 2FOKA 2PG4A 5KVRA 1K7AA 4HX4A 1ON1A 4B09A 1P4XA 2HWVA 2XIGA 2R7DA 4M74A 1TW2A 3V7CA 3FM3A 5H20A 1Z9CA 2P6SA 3BDDA 1TLHB 3V7RA 2MH9A 3ZN0A 4ZZLA 3BPVA 1LNWA 4FHTA 2FBHA 1W5SA 5DV5A 3FF5A 1U5TC 4XLNF 1T98A 3B73A 1IXSB 3I5UA 2Q2EA 5FLXK 4LG0B 1G3SA 1G3YA 3J80K 4IJAA 1U8RA 1HQCA 2YX7A 3K69A 4KDPA 4EJVA 4GO1A 2PBIA 4LLLA 1FZPB 3PQJA 3E5UA 4BNCA 2M1BA 4OU0A 2EFNA 2YPRA 1XCBA 3QPHA 1YYVA 2IW5A 1KU9A 1U6GA 2L02A 4UV9A 1FBUA 1DP7P 3IHUA 4R79A 2OA4A 4WXHA 3MFKA 1USSA 2GIVA 4I7HA 4A6EA 2ZMEB 4YIIA 4BXUA 4I2OA 2A61A 5H6QA 5A2QZ 1LEAA 1SFEA 2V1UA 2RV8A 3CUQB 5D5WB 4EGYA 3SHFA 3D5LA 1QNTA 4ESBA 3OOPA 4WCGA 3GXOA 1T6SA 2RNJA 2RVCA 5K5OA 2OQGA 3GFJA 4Q5SF 1R1VA 4MHGA 1W5TA 3KETA 2L3DA 2DFIA 5J8CA 1FPQA 5BOXA 1J75A 3RPQA 2A07F 2P6TA 1U5TA 1XGSA 1EV7A 2HDCA 1WI9A 1HKTA 1TW3A 1BC8C 5D8KB 2Y75A 3ZN1A 3ZP5A 3E6MA 2XHKA 4U7BA 2BV6A 3FXRA 2AS5F 2L01A 2Q8KA 1T38A 4R1HA 3DP7A 1XSXA 2HKXA 1TNSA 2P7VB 1R1TA 4N9HA 2Z99A 1B1BA 3WTSC 3ULQB 3WE2A 1YO5C 4I98B 5L3DA 3V7SA 3I59A 2MLKA 4CO8A 2GQQA 5L3CA 3LA3A 3QU6A 1UCRA 3JAMZ 4RB1A 4O6JA 4KN4X 1TQMA 5HLIA 1DPRA 1XGMA 1MJBA 2J5OA 2IVMA 3LSTA 3F8CA 2FMYA 3HSEA 1QQIA 1R1UA 1K79A 2LNBA 1JXSA 1FYMA 4KA4A 2EV6A 2FMLA 4UVAA 3J80Z 1B9MA 3T8TA 1GXQA 2JTVA 4EGZA 5HDNA 4Y17A 2VXZA 4GGGA 2XAJA 4U88A 2JT1A 1BIAA 4M9SA 3HHGA 4IF4A 2DU9A 3VODA 5D4RA 3M8EA 2VOOA 2JPCA 1H9TA 5E20A 3DV8A 4WXDA 3RKXA 4S05A 2IPQX 3T8RA 3AAFA 3LAPA 3BPXA 3REOA 5CVUA 2GZWA 1ZYRF 4U0WA 2MD5A 5FD5A 2QENA 5LEJA 4HDUA 1BN5A 3K0LA 5ICCA 5ICFA 3HIFA 5LGTA 2CWEA 3P9KA 1K78A 4KMFA 1RZ4A 3MZYA 2NYXA 1USTA 2DBBA 2XAGA 2L4MA 2M45A 3F3XA 4L9NA 2R3SA 2E1CA 2F5DA 4A5MA 2EA4A 4WXCA 3KP3A 2JZYA 2KIMA 1I27A 2BE5F 1I6XA 1KU3A 1ZREA 3QRFF 2K4BA 1KA8A
chains in the Genus database with same CATH superfamily
3X2QH 2F4IA 4N4NB 4ENKA 3FKIJ 3NAUA 1PUFA 1FBSA 2MC4A 3JSPA 5FFZA 5D5XB 2PJPA 3R60A 2EV0A 2P8TA 5CQEA 5J47A 4HEA2 2DXIA 2WB1N 4CCKA 1HW5A 2WAQN 3W6VA 2DTZA 3WE3A 3RIRA 2QM3A 1ZGAA 2BHYA 4M72A 3S15J 1XN7A 4L18B 3OYJA 3GF2A 1S7AA 1FMVA 3LNQA 4AUXA 4E70A 2WAFA 3NWSA 4HV5A 4II2A 2XV4S 3F9KA 3KZIC 5LGNA 4R8HA 2EFOA 3ZQLA 2IA2A 3K7AJ 1ZR2A 3WU2C 3F22A 2XAHA 1Z1DA 2DOFA 2JN6A 3LWFA 5KNLA 1ZRDA 2VN2A 3RKWA 4JBAA 3DBLB 4ZDPA 5LHIA 1IW7F 2YSRA 3F8MA 4PJMA 5E3LA 2EINH 3IAM2 1LJ9A 2VXDA 4U0YA 1YRNB 2OQRA 2CQQA 1ERDA 3QODA 1Z6RA 4H4KC 2VOPA 1R5ID 2ISYA 5DCFA 3JR9A 1ETVA 3GO5A 3MMYB 2RQPA 3F6VA 3HHHA 4DIQA 1RKTA 2CU7A 2OPTA 3E97A 3LSJA 4DW6A 4IHYA 2PN6A 3H9QA 5DCMB 3WGIA 3C18A 3RYPA 1MBGA 2V9KA 1T08B 1STZA 3IRQA 3BP8A 1QHGA 5IT9Z 2MSYA 4I01A 5D8LB 3R6SA 4FCYA 3FKJA 4PJJA 1KU7A 3P9IA 2PJRA 2ZMEC 2E1OA 1TQPA 2QQ8A 5CVJA 1SMYF 4F93B 2L7FP 4LK0F 4ABZA 1K4TA 1WRJA 1F4KA 3LSGA 3SEZA 4UUSA 2DYRH 2CRGA 3LAJA 5F64A 5JFRA 1UMQA 1QZZA 2R7FA 4EV0A 1MBFA 2CUJA 2UXXA 5HVQC 1XB4A 3GLXA 2HKOA 2CUEA 1G6NA 2EFQA 3CCYA 5F1JA 1YE9A 1HBXG 3DPUA 3GMEA 4F55A 3CUQC 3P5JA 4GCVA 4CCLA 1OR7C 3EUHC 5IP9J 4E7IA 5HOOA 1HSTA 2JQ7A 1ZGWA 1G3WA 1UELB 1QVUA 2VI6A 1YX5A 2Y9YA 1JHFA 4ESFA 3E5XA 4AVPA 4ZYHA 4C3JJ 2L0KA 4HF1A 2MC3A 1D0XA 3DF8A 3WHCA 1YS6A 3HDDA 3GZNB 1RUNA 1O3TA 2PMZN 2DK8A 3CO7C 4IO9F 2HQNA 1FOXA 4O3MA 1VQ5I 2X51A 2EQRA 3U21A 1JT0A 4DYCA 3GEZA 3HRTA 1I5ZA 2HQ5A 3TEDA 2P81A 5JLXA 1W5CC 1HW2A 5FLVA 2KRFA 1Z05A 2BVMA 2QZ8A 1TQIA 2MA3A 4BL0B 3GTGJ 3NARA 4M71A 3CMEI 1YS7A 3RKYA 4BQOA 4CH7A 1MBKA 4PUSA 3MEXA 4RB2C 1B4AA 4Q4ZF 1OPCA 3DQVC 3SDGA 2MD0A 1OCOH 4LG0A 1KONA 1BR4A 3K2ZA 1QA6A 3EYIA 5E1XA 5E3OA 1NK2P 2ZFUA 2EPFA 1BL0A 3TGNA 2GWRA 1G3TA 1D8KA 1HDDC 3IWFA 1RC9A 1YW9A 1WHUA 1W0TA 3Q0VA 3HTSB 3ZMVA 1K6YA 2CFXA 3GTKJ 2KKOA 5LRRA 4Y13A 4RGRA 4HLYA 1O3RA 4KFCA 4C3IJ 4QPOA 4EQQA 2RAEA 2VBWA 2HVRA 4KMUX 3P7NA 4OIPF 2NS0A 2ZNZA 5CLSA 3ZPLA 2Y0MA 4C2UA 3MN2A 1IC8A 3CC4I 2FRHA 3WODF 1IZ1A 3JRBA 2ZKZA 1YW7A 3OL4A 2W57A 4HG2A 2JVHA 3PIOF 2Y30A 4RM2A 1WQ2A 2DOAA 5C4JJ 5FKLA 5E8IA 4XQFA 2CQ7A 2LDUA 2X6WA 3JRGA 1U78A 1I6HJ 2XKPA 4S0HB 4UY8I 2XVCA 2W25A 2NVUB 3WGHA 2XPVA 4M6XA 3KFWX 1W36C 3CDHA 3PFIA 3TMOA 1J9IA 3BR1A 2HGCA 1X1BA 1HC8A 3GTPJ 3JRDA 4YIFA 5FO5A 4AU7A 1XSDA 1S72I 2QVOA 3V4GA 5GAHJ 1F5TA 1P9QC 2H8WA 4RA2A 3B6CA 4RAYA 3HOTA 1VI0A 3SJMA 1YQAA 2MLGA 1POGA 4I0AA 1XSVA 5D6EA 1DDNA 2L5QA 1J0RA 2CG4A 3CUQA 2DFHA 1D3YA 2G7HA 3ZRGA 3HPGA 1XS9A 4CSWA 4JYKA 4G8XA 2CUZA 2JWTA 3UR3C 5LHGA 4Q48A 2QQBA 4G6TB 3BTLA 5ICEA 3COAC 2M8GX 5E18F 2Y2ZA 3HUGB 3Q0UA 1A6IA 3WTZA 3EUKL 3FDYA 3IH2A 1GV5A 2DA4A 4M73A 3K1MA 2QBYB 4Y3OA 2BXYA 2VPRA 3TO7A 3OYDA 1QPIA 3BTJA 1LFBA 4V19K 2CFOA 1G4DA 1GVDA 3KZYA 3JRCA 3FM5A 5K7ZA 4NUBA 2JSPA 2CQNA 3VFZA 4KISA 1FWZA 4LFUA 3MZHA 5BPDA 3ZQHA 4IHSA 5IOYA 2DQLA 5EGOA 3KX2A 2JA5J 4H0EA 2ECBA 1V3FA 4WX9A 5H6RA 4PSXA 2G0EA 3BCBA 4S04A 2P5VA 4KIGA 3RPUA 4XBFA 4A12A 1DPUA 2ZNYA 1ZGJA 4BJ6C 4B47A 2W48A 3CJQB 3L2RA 3S3MA 3WTUC 3AG2H 1ZK8A 3N97A 4PDKA 1VQ4I 3TDUC 1X58A 2I5UA 1OYYA 5B1BH 4Q47A 1TWHJ 1ETKA 1N75A 4RAFA 1S3JA 1BR2A 3I3LA 4P5OA 5BQTA 1UZCA 3JRHA 1S7EA 4UB8C 1K6OA 2VBXA 2WV0A 3BY6A 3E6DA 3HG9A 1ZRFA 3HGYA 2A5WA 2X1EA 3BG9A 3CUOA 3S93A 4EJTA 3PSIA 5IP6A 2IS2A 1T0FC 2VODA 1QHHD 2CV1A 3QU3A 3R61A 4HV6A 4MGRA 5HLGA 3HC7A 1WH5A 2W24A 2NRAC 2H27A 4NC8A 4XSXF 2E36A 1JHHA 4C30A 4JX6A 3CO6C 4BQAA 2O3FA 3OIQA 1TWGJ 4QWQA 1DGRM 5HS7A 1JUPA 4JP0A 3LFUA 3JRAA 2K02A 3SZGA 1VQPI 3CCEI 1JI8A 3KP7A 2OZ6A 4HNUA 3EYYA 2R4GA 3WU0A 4G7ZF 2WADA 4QLCU 4IPAA 3HSFA 4YEJA 1SAUA 5D5VB 1TNTA 3OYGA 3IWZA 3L2VA 1BW6A 1W0UA 5LFAA 1W4MA 5B66C 3WTXC 3L9FA 3MAJA 4IX7A 4HOBA 1R58A 1BIBA 2DA1A 4NNJA 3SZTA 3SFZA 4MNUA 1H0MA 1VQ6I 3CCMI 4XK4A 2DTRA 4CHUA 3IKVA 3L2CA 3LMMA 4ASNA 4GYGA 1T56A 3MWMA 3RI4A 2WY8Q 1MDMB 2DFFA 2HFHA 1IAWA 2YR2A 3OYHA 3BJAA 3EPZA 5D5UB 4C2MJ 2RGVA 4B3AA 3QYBA 3S3NA 2E1MC 3KEQA 2DO7A 4A3MJ 3AG4H 1FBQA 2X9DA 2X85A 5LGUA 1N78A 5TRDA 1XGOA 2G9WA 3S3OA 4EJUA 1YI2I 1SEUA 4BE0A 4XM3A 2DJNA 2E7WA 2R7OA 2KDOA 5F1RA 3W2AA 2HTSA 3ZQQA 2Z1DA 3OOUA 4BQNA 2W4SA 1ZG5A 4PFPA 3CLQA 1IN6A 1O3QA 5ILVA 5JI6A 1FC3A 1UHMA 1V4RA 4OMYA 2B9SA 5DM7F 2EJRA 1V5GA 4GXOA 5ICGA 3H9JA 3K1PA 2B63J 5LLQA 2UUZA 1ETWA 1Y8RB 2RDPA 3F8BA 3Q3SA 4V2FA 2WWYA 1FTZA 1MJ9A 5ED4A 4IHXA 4F3QA 1SVOA 3K4MA 4DBQA 1WVRA 4I76A 1JE8A 2E2IJ 3CMMA 1G59A 1MSEC 3OYBA 3L1PA 1FP1D 4XORA 2P7CB 2RN7A 1R71A 3TW7A 2F6CA 1MZBA 4EJOA 1W36D 4O5VA 1F43A 3E6BA 3K70D 2LBFA 2Y48A 3BTCA 3TQNA 2P5KA 5DUKA 4F92B 3LSPA 3ECHA 1YIJI 2HXIA 5DS9A 1BBYA 4LD5A 1DUXC 1Y1WJ 4HNVA 4ZDLA 3PL8A 4V2GA 3WTWC 4MIMA 4NDLA 4CZZA 4I6ZA 5CVRA 4IXAA 1A6QA 4XKWA 1FY7A 2EILH 1MNEA 3ABTA 2Q2EB 5LRSA 1JUSA 3H3VK 2R0QC 1EJ9A 1WJBA 4ZC3A 1XGNA 4RBOA 4XRMA 2IBDA 5E17F 4N9IA 1HLVA 1HDPA 4XL9A 3G2BA 4KYWA 4DYRA 2K40A 4HQMA 3S2DJ 1BJAA 2Z33A 3HKZN 1U8BA 1E3HA 4J01A 4G7HF 5KK1A 3R4KA 4FT8A 4HPQA 2M8EA 5HS8A 4FX4A 3DXJF 4IVNA 4BDZA 3ZMZA 1NG7A 1OQYA 1WI3A 3PQKA 1IUFA 5KCMA 1IUYA 4KT5C 2LRDA 3HYIA 5EJCA 1RR7A 5EEAA 5M5XJ 2BHZA 1FOKA 2JUGA 4D0PA 4ZH4F 5HODA 2X6XA 2RREA 5F6FA 5FLXZ 4XLEA 3F72A 4KN7X 1JJ8C 4CXFA 3H9GA 2OD5A 3U2RA 2L4AA 2LF8A 2QUFA 1S6LA 4QTRA 2WC2A 1Z3YA 3BG3A 4RMNA 1UFMA 3VSLA 2XKOA 1FJLA 5D6FA 3OR1C 5E1ZB 2DN0A 3K4NA 2GXGA 1TT0A 3PIPF 2A6EF 3FX3A 3CF5F 4UXNA 1DU0A 1UG2A 3VEPA 3F8NA 3K4BA 2ZB9A 3M4OJ 1Z6TA 1D0YA 2KRHA 3SXYA 2E35A 4G12A 4HF0A 4KIBA 3TOAA 2VQLA 3FXMA 4WWCA 3HZJA 1IRXA 1MBHA 3IH4A 3HOWJ 2W1OA 4D9JA 1Y39A 2ME0A 2YU3A 5E8GA 1YRNA 3MVPA 1YIOA 3ABLH 1X2NA 3L00A 3RQIA 2JA6J 1RPWA 2CMPA 3RJPA 4BXFA 2ZXJA 3KPHA 3PSFA 3RSNA 3HSRA 5DCMA 1LPQA 2ESNA 2Z16A 2DMPA 3TL4X 4BHBA 5EDNA 3GZ6A 1LEBA 4OOIA 5J6XA 2ELKA 2ME6A 2BGCA 2P0WA 5E1WA 3FISA 3MCZA 2WB1A 1WJAA 2IS1A 4BQQA 5D4SA 3GZ5A 3E6CC 2JUCA 2WAQA 3L09A 1GT0C 3BT9A 3EUAA 5GTIC 2IA0A 3BQZA 2VJIA 3BZ6A 1H9GA 1R9TJ 4ENJA 4A0YA 3QPTA 2EFWA 3BZCA 3J81K 2O6GE 3D0SA 4BKXA 3DEWA 3ABKH 2W84A 1T2KA 1Z91A 1S9HA 2VKEA 3ERED 5BMZA 5AONA 3T0YA 1YLFA 2LLKA 2QSHX 2HOSA 2KHMA 2LY1A 3G1MA 3RYRA 2MH2A 3KYCB 3FIWA 1BI3A 1KQ9A 2HQRA 2ELJA 3H3ZA 4WF2A 5J3LA 1SD4A 4ZYGA 3G73A 4JK1X 5AIQA 4IRIA 3F6OA 1PP7U 4OINF 1LDDA 2E2HJ 4LLNA 2LVSA 4KICA 1P6RA 3H35A 1ETYA 1XDSA 2M7BA 3A2KA 3VB2A 3Q9VA 3VOEA 3C2HA 2DOEA 3KLOA 4F7ZA 1SD7A 5M5WJ 1ZR4A 2QCOA 4A6DA 2KPMA 5GP9A 2H1KA 2DA2A 1SFXA 2FSWA 3H0GJ 3B02A 3Q0WA 4LLGF 1VQNI 4AIKA 1Y0UA 3KLNA 3I59B 1VTNC 1Q1HA 3A02A 3HOSA 2UWMA 2VKHA 1YOVB 2OZUA 1QZEA 1W7PD 2Q0OA 2XRLA 4G94A 4AWXB 4E6KG 2VONA 4ZYDA 1TZLA 2A3SA 3PNYA 2E1MB 4AM3A 1XMAA 1X3UA 4B48A 4D5FA 1L3LA 2LKSA 5TISC 1J5YA 2R93J 4XKCA 4HF2A 3BQYA 3DEUA 2BYVE 2VIXA 1ETXA 3AG1H 2G7UA 3O8HA 3AFHA 1YITI 3KEYA 2F5EA 2F5FA 1L0OC 4YG2F 1O57A 2BY3A 2LFBA 2WV1A 1IRGA 2BY2A 2QGUA 2PEXA 1N25A 2KIUA 5L3BA 1KYWA 1RI7A 2H8RA 1GHCA 2PQ8A 1R4MB 4II3A 1A5JA 1OFCX 4EM1A 5F04A 2W85A 3WHBA 5K1YA 4XSZF 1TTYA 1PJRA 1GUUA 1BW5A 1O7FA 4DZJA 2VB6A 2VLAA 1JJ6C 1QPMA 2PMZA 1PDNC 4A3FJ 1HSJA 1MMSA 2VQHA 2L7ZA 3QP6A 3OR2C 5IYBJ 4IOAF 2K9MA 1PVEA 1N77A 2IP2A 4A3KJ 3OS2A 3ECOA 1W7PB 1VQ9I 4EATA 1ZQ3P 4XLHA 1H88C 1SFUA 3A1YA 3BG7A 2ZJRF 3FXLA 4LG3A 1I1GA 4K2EA 5FKNA 2ETHA 2EZIA 2HZDA 2KDZA 4P9UA 3IH3A 3QPLA 3DLLF 5M3MJ 1R5GA 4KIFA 3FXKA 3T1BA 3VYUB 3OS1A 3HPHA 2ELHA 4PCQA 2RQQA 2ESHA 4E7JA 2DMUA 3I71A 2K7LA 4P9FA 4MTEA 4CCOA 1LE8B 2R7VA 3W2VA 4PGGA 4L9TA 1B6AA 2BW3B 4BS9A 1KYZA 2NAZA 3FXQA 4PJNA 3PFYA 4EM2A 2IJLA 3MQ0A 4HAMA 3UNGC 1VQ8I 1FT9A 2JA2A 1ZG3A 1QZYA 1ZLJA 4HZFA 4ZYEA 5GPAA 3GFIA 3C7JA 5J1UA 4PSWA 3BOQA 5DTDA 3HUGA 3U1DA 1B72B 4EM0B 3RTRA 2H94A 2ID3A 2Y9ZA 2HZTA 1HKSA 2EIJH 2HQAA 1K78B 1FSHA 3DLAA 4RAGA 1QBJA 2RC4A 3F23A 5E3NA 4L5EA 2QBYA 2STWA 2Z3YA 2EZLA 4G6DA 1VQMI 4IQ4A 1NK3P 1IXRC 2XAQA 5ERIA 5F0FA 1QO0D 4M3GA 4A2UA 1WFXA 2CS3A 2RNGA 2ZJ2A 4MLOA 2FEZA 4XKBA 1OLTA 4HQEA 1SMTA 4IL6C 4NQWB 1D8JA 5E79C 3I54A 2IGNA 4KT6A 4ESJA 2LY9A 2DW4A 2V6EA 3DKWA 4BAYA 2LKPA 3DPTA 3VDXA 4BUPA 1I3AA 2X48A 3F0CA 2D5VA 5IY5H 4IHTA 1ZHFA 1MJAA 4EJWA 3D5SC 3PUBA 4RGXA 2AXLA 1FYKA 2KIFA 3CMAI 3GW2A 1J59A 2L9VA 3BC8A 2XC7A 4U0VA 1R00A 4YFNF 2JVGA 3W2WA 1FMWA 2GLOA 3KP6A 5JVTA 3TBIA 5A2QK 5FKOA 4FQGA 1B9NA 1PUFB 5EZGA 1ETOA 2HYGD 3BJOA 1O4XA 5EEHA 2FD5A 4MTDA 3OIOA 4N0BA 5ILSA 1SD6A 2GM4A 1IN8A 2XSJC 2P4WA 3K4JA 4NB5A 3C3WA 4BH9A 5IP7J 5HS9A 1K4SA 4DJAA 2KP6A 1X1CA 1EH8A 1RESA 3WTVC 4YIRX 2F2EA 4RGUA 2VL8A 1XCVA 4XRSA 3B6AA 1AKHB 4I02A 5LBQA 2A6HF 2XRNA 2LH9A 2XGEA 4L5IA 2JA7J 2HOEA 2KMUA 1IN4A 4A3DJ 4F52A 2HPMA 3E7LA 3CCJI 3GYHX 2ZSIB 2WA0A 2HYFA 5HLTA 1HXDA 3ZMDA 2VT3A 1XX5A 1DQUA 1P2FA 1FOYA 3KP2A 1OYIA 3D5RC 3LSMA 4XR6A 4QPQA 2ZMEA 1RETA 1PYVA 2GA1A 3OV8A 2CO5A 2LY2A 1MKMA 4ENMA 3N4MA 4I0BA 2WY7Q 3M9AA 3K70C 2K86A 1EKEA 2VBZA 2XF5A 3LL7A 4CGZA 4IHVA 1UHWA 4U7DA 2QSGX 2XAFA 2X0LA 4B1RA 3KZZA 2E60A 1IDYA 3RZDJ 5DUIA 1IF1A 4BXXJ 3V42A 1E17A 1OR7A 3EUHA 2L7KA 3I0TA 4XN3A 3LOCA 4C3HJ 2CGPA 3J7AY 2XF6A 4B3XA 5J40A 3W6JB 2Z9OA 2K27A 1NH3A 4A3IJ 1OISA 2M7AA 5CQGA 2FUG2 3GLLA 3SFIA 1X2MA 4OIRF 3IC7A 2AO9A 4KUMA 1MMDA 2DYSH 2DT7B 1LDJA 4M3FA 2JA8J 5EZHA 4RS8A 1HOMA 3S17J 3OY9A 3R0AA 5DM6F 2FJ1A 2XASA 3BCAA 2EZKA 3SDBA 4QIWN 2R92J 3IUOA 1MW7A 2R7XA 4L0ZB 1MBJA 2XAUA 1WZ2A 1OKRA 4FETA 3SYTA 3HRMA 4YFXF 4P55A 1FNNA 2E19A 4P1WA 1ACIA 4CYCB 4G6QA 5FD6A 3GFLA 4HLXA 1RUOA 3G1OA 3VSKA 5AIPA 1LB2A 1ZLKA 2ZO4A 3M8FA 2NOJB 3DTIA 2LR8A 3DKYA 3QWLA 3DU5A 2LYCA 3JAMK 4M3EA 1P4AA 4X0GA 1BC7C 5FRMA 1R6RA 2JRTA 1C0WA 3GWZA 2HOTA 1U3EM 2OU2A 3NRVA 3RQ4A 2VASA 1B59A 4LB6B 2HNHA 3KEOA 3QAHA 4ANJA 3JCUC 5LEKA 1YW8A 2HDWA 3M07A 3HB9A 2D1HA 1TP4A 3HXLA 5BNGA 3PUFA 1XDUA 4JX4A 4HNTA 1WSUA 2XUBA 2LKXA 2QYOA 3HRUA 4OMZA 3GTJJ 3K9TA 4M6VA 4BBRJ 1BI0A 3RZOJ 3FXUA 3HOUJ 3JTGA 4AYBN 2M5WA 1HW1A 2F5CA 1R4NB 3QP5A 2FNAA 3HM5A 2COMA 2HTJA 3I58A 4IEJA 1Y0NA 3TKYA 2DT5A 3FHZA 2STTA 2VT2A 2PFBA 4BDYA 2ZCWA 4FISA 2CUFA 2OCEA 1I3QJ 2R7ZJ 3CJTB 1ZG1A 2LSOA 2DI3A 3TO6A 5B5EC 1ZAOA 4ZDOA 2IS6A 1E2XA 1YHQI 2DFEA 2HR3A 1V5FA 5FRNA 2GOMA 3V8JA 2K3FA 2EA2A 1TWCJ 4E7SA 5ILUA 1QU3A 1X19A 1VZ0A 1ON2A 2M87A 3CZ6A 2I10A 2IGKA 6PAXA 4YELA 4ON0A 1P7IA 2IS4A 3ZMTA 2FU4A 2O7OA 3ZR8X 4CZCA 2NVYJ 1OCCH 3O8GA 3P9CA 4PZJA 1ENHA 1ODDA 4XOTA 2QEXI 4XONA 3IP4B 2EV5A 1Y56A 1E0EA 3OYKA 1CF7B 2KJBA 4BYYA 1MBEA 2DA5A 1ZH5A 1OMIA 5J1YA 3U9GA 4RAZA 1UG0A 5IPAA 1GXPA 1ZRCA 1LKXA 3ZMUA 5KAIC 3CCVI 2EBIA 3JSOA 4XLAA 3ERMA 2QQ9A 4UUVA 2BZTA 2DJIA 4M9XA 4RLFA 3JW4A 3FBNB 2HVSA 2XGCA 2M0MA 2Y0SN 3I4PA 2ZBKA 3W3CA 1SAXA 3HKZA 3PM1A 2FNPA 3ABUA 3JRFA 4XLCA 2NNNA 2QSFX 4HX8A 4A3LJ 1O3SA 1OCTC 3K1NA 4LOCA 2V1XA 2LOOA 5EG0B 1RIOH 3MKWB 1OCZH 4CCJA 1YX3A 4OIQF 2VBYA 3S2WA 1WJCA 2XB5A 4J00A 5BS6A 3EQLF 3IL2A 2V7FA 1LDKB 3OYFA 5GTHC 5M3FJ 2FF4A 2H1LA 2Z2SB 4RM3A 3HEFA 3BR3A 1Y1VJ 4X1EA 4AC0A 5JVGF 3KYLA 1YJNI 2YU9J 1REPC 4B4CA 4BJTA 2V26A 2CYYA 3AL0B 4ITVA 1J7KA 4YFKF 2QA4I 4D5CA 3ROUA 5BPIA 1IXCA 2LF7A 1T8IA 1OCPA 2GXAA 3M7GA 3KE2A 4DGWB 2E7XA 3ASNH 5JR3A 3ML6A 2ZFWA 3NQOA 3ELKA 2ZXWH 4Y52J 1T0FA 2EB7A 2ZC2A 5GAGJ 3L2UA 9ANTA 3O6BB 4BJ5C 4XIDA 4KJZA 2CSOA 2AHQA 2EFPA 4QSHA 1R23A 4UV8A 3K4CA 1D1CA 3EDPA 3HBLA 1VQ7I 5HLHA 1LQ1A 1EA3A 2I8DA 1U9OA 2MGQA 2R5ZB 3OYEA 2BOLA 2HS5A 3S2HJ 4DBRA 1FX7A 2D1VA 1IV8A 3LQQA 1SC7A 2CW8A 2DAOA 5FKKA 2HEOA 2QWWA 3PNTA 2H09A 4CDGA 5B3SH 4WK8F 3UKGA 3BR5A 5J1RA 1IN7A 1I50J 2E71A 2UXNA 1EH7A 2LK2A 4I09A 2VC0A 2H6BA 1ZARA 5DDGA 2FX0A 3GX4X 1TBXA 1SD5A 4NC7A 3M8JA 4OIOF 4E7LA 1IRFA 4A3EJ 2EWNA 1I1SA 1S29A 1KQ0A 2BY1A 2X6OA 3ABMH 3OYCA 2NXNB 2DA6A 2X1DA 3FMRA 3W6KB 2OTJI 4L0YB 1MH3A 2A69F 1IDZA 4MQ9F 2HDDA 3S32A 4M3DA 2LC2A 3GVAA 3WTYC 3A01B 2HU9A 2X4HA 3G1LA 1BOBA 1R22A 1P4WA 1WCMJ 5IT9K 3J7AO 5HDKA 1APLC 2R7SA 2V9VA 4UVBA 1WJDA 1BM9A 2W82A 4Y15A 5IT3A 2DLLA 2EZHA 5J8FA 5TJJA 1H89C 3QOPA 1IO2A 3CD6I 1FIPA 4UUTA 3OSFA 4GYIA 2XB0X 3LA7A 1XC5A 1V54H 3HRSA 1BI2A 3RKQA 3HOYJ 1RRJA 2V4JC 3LA2A 4D7MA 2B0LA 2PMHA 1XG1A 2MFZA 3O2PE 3GTLJ 3VPRA 2A5YB 2PI0A 3GFMA 3OYLA 3CDIA 4LMYA 1IG7A 2OBPA 2DODA 2JK3A 1NHAA 1U2WA 1V5EA 2J5PA 3FK7A 4ENNA 2OF7A 5C44J 3GTMJ 4I99C 2KZVA 4IRGA 4LB5A 1W7PA 2LD5A 1AWCA 4ZZDA 1S8NA 3E5QA 3K2AA 4PFOA 3IRRA 3H92A 2X1CA 1JT6A 5DD4A 3V8LA 5K7HA 4W97A 1JUMA 4CYDA 5B1AH 1BOAA 5KHDA 5K5RA 4HDVA 2IGOA 2ACJA 1Z7UA 1ZN2A 2IGMA 1U5TB 4G7OF 2NS7A 2BEOA 2F48A 4TV7A 1LE8A 1QGPA 2BW3A 1KQ8A 3MKZA 4M9ZA 1IV6A 2O8XA 5FGMA 2OCCH 4IOCF 1BI1A 2BXZA 2M34A 5CVVA 4RGSA 3JREA 3I53A 2HOAA 1J2XA 1JKRC 3H5AA 3SQNA 3OYNA 2O8KA 3KP5A 2DMTA 2KT0A 4GRIA 1B72A 1JGSA 1HKQA 4E7ZA 2IXSA 3DCFA 3DBHB 3C2GA 2R7TA 4M6YA 5K5QA 4HYEA 3ZMSA 2CV2A 3A0HC 2K4JA 3E3VA 1GLNA 4P96A 2DPDA 3BJ6A 3CCUI 4BEHB 1LFUP 1X1DA 4MEXF 1D5VA 1XD7A 1FOWA 1S7OA 1XMKA 4M3BA 2K3PA 3CJNA 5JHFA 3Q5FA 2W00A 1DU6A 1FYLA 3ASOH 4E4HA 1YFHA 2O61A 4NQWA 3TO9A 4ETSA 2M30A 2A05A 5JLWA 4MEYF 3OYAA 2JPBA 1M1EB 3WG9A 4LGWA 2TDXA 2H6CA 5EEGA 2GXBA 2F4MB 1KGSA 4MQVA 1F9NA 1YJWI 3F21A 1ZTRA 2FBIA 4BHPA 1MNMC 2LG4A 1FP2A 1ULYA 2V6CA 2DK5A 3N05A 1WJ5A 3D1NI 1U0JA 1UB9A 2QQAA 3I64A 4CUGA 3OL3A 1HF0A 4IQJA 3H36A 4HA8A 2IAIA 2VC1A 4HW0A 3J7YJ 4HX7A 1FEXA 2VJJA 1YTYA 1IN5A 4UNOA 3G71I 2EIKH 2A6TA 2FQ3A 3S16J 2ZJQF 2O03A 2E5NA 4XLFA 4HBLA 3RDIA 5TGTA 5F0HA 3SZPA 5IYCJ 4CA0A 1O7LA 4B8XA 2IRFG 1R7JA 2LMDA 1HCRA 3ZXSA 4LJZF 1G2HA 2DMNA 1PP8F 1PUEE 3LQRA 4Z2YA 1AKHA 3LSKA 2NNYA 3MD2A 2CV0A 2L9RA 1LVAA 1FSEA 3O3KA 4DOZA 4B43A 2IT0A 2GA2A 2OAZA 3GCMA 4RB3C 2BVLA 2DT6A 2NVTJ 2LTPA 3CESA 1YG2A 4KITB 2O9LA 3CC7I 2F5VA 2L54A 5F0CA 2MYSA 3J7ZI 2A68F 4UHTA 4B44A 3BZKA 2CW0F 3U1KA 4XRSG 1IRZA 3S1RJ 3DFGA 2K9SA 3M1EA 4AIHA 4EVIA 2D45A 1Z3XA 3L2WA 1UJ8A 4JQFA 5CVIA 2ISZA 1B8IB 2ZSHB 2C6YA 3S1NJ 4BHCA 1AA7A 3H1CA 3GUDA 3FMSA 4A0ZA 4EMSA 2Y69H 4FX0A 3L7WA 2KRCA 4EEFG 1P92A 2M4KA 2MBFA 2IA1A 2MW8A 2R5YB 2V79A 3I9V2 2CQKA 4RB0A 2D2WA 3CCSI 3KIOA 5L3GA 2R7QA 3DPLC 5C4XJ 3DBRB 3ZQFA 1U9NA 4IKFA 1RKWA 4L9JA 5KAFC 2DQRA 1LVKA 3F8FA 1UHSA 1MMGA 4BGDA 3TOBA 3GBGA 2PMUA 5K7FA 1KU2A 2ADUA 4XRFA 4DQ2A 1WWXA 1RNLA 1SANA 3HOXJ 4A0XA 1VNDA 4IRHA 2COBA 4BY1J 1JKQC 3FXOA 2L9NA 4ZYAA 1MD0A 1T33A 5L3FA 3H0DA 5CPRB 4XLPF 2VJ5A 3T5XA 5HDGA 4LK1F 5CJ9A 1F1ZA 4KNYA 2FXAA 2VJ4A 1H8AC 4CYCA 1D1AA 4UVCA 2ZXHA 2FBKA 2X6YA 1T39A 2P5LC 3V8KA 1W1WE 4Y33A 5JHUA 1TWFJ 3I4NJ 2JSCA 2Z5UA 5CYVA 5DD8A 3WU1B 1AOYA 4OWRB 1UAAA 3KP4A 2DPUA 3C1DA 1T95A 4NC6A 3H3UA 3WG7H 3TDZC 3AL0C 1WJEA 3OWTA 3WGGA 4D7NA 2XROA 4PJ0C 3VYSB 3CTAA 3J81Z 3BWGA 3ZQGA 3ZQIA 4IZZA 1MGTA 3CDLA 1MSFC 4BE2A 1X4OA 1WPKA 1SVLA 1EH6A 3BROA 2QLZA 3R0JA 2F4OB 5H2FC 3HOZJ 2KLOA 3FZVA 4DNCA 4G9YA 3A4CA 3BG6A 2BY0A 2QKLB 1OCRH 2VE8A 4A5NA 1SFKA 4FE4A 4HSRA 4PJLA 2CH0A 3CLOA 2FA5A 1R49A 2FE3A 1X3ZB 1QRYA 4Z6YA 3FBIB 1WKMA 2HYJA 2V1NA 3FMQA 5FB2A 2B7EA 2VUMJ 4NHJA 2V1DA 1FLIA 1R36A 4XNFA 1A04A 2KJCA 2VKVA 3DTEA 2WTEA 3Q9SA 1SFOJ 3EETA 3FHNA 4AD9A 2RKHA 2VQGA 4OAZA 3JTHA 1CQTA 3FWEA 2QKMB 2HXOA 4L5JA 2EIMH 5CKTA 3G3ZA 1GV2A 2UZKA 1MDMA 1XMXA 3MZ8A 4MO7A 5FFXA 3KCCA 4L9VA 1VQLI 3WTTC 1R5HA 1A36A 4FE7A 4XN0A 2EK5A 4CICA 1CGPA 1GVJA 2PLYA 1XPXA 2E2JJ 2GAUA 4RLQA 2UV1A 2XGXA 3NEUA 1CF7A 5DEQA 3BLYA 4LITA 1TWAJ 5L3EA 2BBYA 2M4GA 3HTUA 2PJRB 4BBSJ 3DEEA 3ISPA 3LFKA 2K5CA 3IKTA 1X3WB 4UUSB 1OYWA 1MNDA 4AYBA 3CF2A 3PJRA 4BE1A 1J09A 2VKDA 3PNVA 2M2EA 3ZQ7A 1Z7LA 2YX4A 3QOEA 5FROA 2VE9A 4BU2A 3BR0A 5DYMA 5LHHA 4AIJA 1ONVA 2O0YA 2E1NA 4PGHA 2FOKA 1ZELA 2PG4A 3OSGA 1FTTA 4IHWA 4PK4A 2JMWA 3BG5A 3KYDB 2AXTC 5KVRA 1K7AA 1Y6IA 4HX4A 2HI3A 3HJEA 3CJRB 1ON1A 4B09A 5EG0A 1P4XA 4A3GJ 2HWVA 2XIGA 2R7DA 4M74A 1TW2A 3V7CA 4ZTJA 3FM3A 5H20A 1Z77A 2XF7A 1Z9CA 4FASD 2P6SA 3K4LA 5GAEJ 3BDDA 1TLHB 3V7RA 2MH9A 2VQCA 3I4MJ 3QPSA 3ZN0A 5IOZA 4C2TA 2WBMA 2R7UA 3E1SA 4XOPA 1MMAA 1VF9A 4ZZLA 2V9PA 3BPVA 4CCMA 4Y4RA 4XICA 2GIZA 2ZXIA 1LNWA 3SEQA 1VQKI 4FHTA 2FBHA 3CCLI 1HA8A 3CP8A 1W5SA 4NBQA 1DGWY 3TP0A 5DV5A 4A3CJ 3S1MJ 3FF5A 1U5TC 4W1UA 2LREA 4XLNF 1T98A 3B73A 3HL2A 1IXSB 3I5UA 2Q2EA 5FLXK 4LG0B 1BR1A 2KIQA 1G3SA 3M3YJ 1G3YA 3J80K 4IJAA 3VWBA 1U8RA 1Z21A 1HQCA 3CP2A 4A93J 2KQRA 2YX7A 3K69A 4KDPA 2Y0SA 2EH3A 4A3BJ 2M3AA 4EJVA 4FTHA 4GO1A 2PBIA 4A69C 3MKYB 2R5ZA 4XKVA 4LLLA 1K61A 1KZHA 2Y31A 3AG3H 1FZPB 3GTQJ 3IAS2 3PQJA 3E5UA 1D0ZA 2JJ7A 4BNCA 2M1BA 1Q1VA 4OU0A 1FIAA 2EFNA 2YPRA 1XCBA 2NS8A 3QPHA 1YYVA 1MMNA 1V55H 2CJJA 2JRMA 3LSHA 2IW5A 2GBYA 1KU9A 1U6GA 2L02A 4UV9A 2L9SA 3BR2A 4MFDA 1JKOC 1FBUA 4HRIA 1DP7P 3IHUA 2KL4A 3TW6A 1MIJA 4R79A 1AU7A 2OA4A 4WXHA 4ZJZA 3MFKA 5GADJ 1USSA 1Z67A 2GIVA 5HNHA 3DKXA 3A01A 4I7HA 4A6EA 2ZMEB 4YIIA 4BXUA 4Y7NJ 1JGGA 2A61A 3RPUD 4I2OA 5H6QA 4C9YA 5A2QZ 2K9QA 5J4YA 3LSIA 3CCQI 3DWLE 3MKLA 1F36A 1LEAA 1Y8QB 1SFEA 2XGDA 2V1UA 2OTLI 2RV8A 3CUQB 4AVZA 5D5WB 3LSRA 3SHFA 4EGYA 3D5LA 1QNTA 4ESBA 4MFEA 4D1QA 3OOPA 3C2BA 3G6EI 3OIPA 3S14J 4WCGA 3GXOA 1WJFA 1T6SA 2RNJA 2RVCA 3CQZJ 5K5OA 2OQGA 3GFJA 4Q5SF 2YUSA 4ZTFA 3DTKA 3ESWB 1R1VA 2DDAA 4MHGA 3QYFA 1W5TA 3FXJA 4CCNA 3KETA 1ETQA 2FOWA 2L3DA 2DFIA 5J8CA 4N4OB 1FPQA 5BOXA 1VQOI 1J75A 3RPQA 2XPUA 3S8PA 2XSDC 1QVTA 1S5LC 1BJZA 2DMQA 2A07F 5EGOB 2P6TA 3S1QJ 5FLMJ 1U5TA 1LUJB 4A3JJ 1XGSA 2KFDA 1EV7A 2HPIA 2OJED 2HDCA 1WI9A 4AIDA 2VPLA 1HKTA 2IEKA 1TW3A 1BC8C 2CW7A 5D8KB 2Y75A 3ZN1A 3ZP5A 3E6MA 1A31A 2XHKA 5C3EJ 3IV5A 4U7BA 1K83J 2WAEA 2BV6A 4OAYA 1WH7A 3FXRA 3ZGKA 2AS5F 2L01A 2DCEA 2HVQA 3FK6A 2Q8KA 1T38A 4R1HA 2N8GA 1ORKA 3OS0A 3CCRI 2E34A 3DP7A 3QQAA 1XSXA 1SVMA 3ZQCA 2NVXJ 4BEHA 3PO2J 2HKXA 1TNSA 2P7VB 2ID6A 4DYQA 1R1TA 4N9HA 1TT5B 3H5NA 2Z99A 1VFCA 1B1BA 3WTSC 3ULQB 3WE2A 1YO5C 4I98B 3OYMA 5L3DA 5EF6A 3QYEA 3V7SA 3I59A 2MLKA 4CO8A 2PX9A 4GFBA 2ICWG 2GQQA 2GOXB 5L3CA 2M9HA 3LA3A 3ZOBA 2OV7A 3QU6A 5F27A 1UCRA 3JAMZ 4RB1A 4O6JA 4E7HA 2K9LA 4KN4X 1TQMA 5HLIA 1DPRA 1ZKGA 1JKPC 1XGMA 1OJLA 1MJBA 2J5OA 1X4PA 2IVMA 3LSTA 3F8CA 1YJ9I 2FMYA 2M0CA 2E5ZA 3HSEA 3TP3A 1QQIA 1R1UA 1K79A 2LNBA 1JXSA 4U87A 1FYMA 3L2QA 1LFPA 4KA4A 2KISA 2EV6A 2MABA 3I55I 5IYDJ 3I56I 1E3PA 2FMLA 4UVAA 4YRVA 3J80Z 1JTXA 1B9MA 3T8TA 1EF4A 2XDVA 1GXQA 3AKZA 3BR6A 2JTVA 3G4SI 4EGZA 3BTIA 5HDNA 4UB6C 2NOGA 4E7KA 1X1PA 1G8XA 1NG6A 4Y17A 2VXZA 4GGGA 2K9NA 2XAJA 2TCTA 4U88A 2JT1A 2W7NA 3CMYA 1BIAA 2OC6A 2Q1ZB 3H5RA 3HHGA 4IF4A 4M9SA 4XMYA 1X1AA 2DU9A 3K6GA 1I39A 3VODA 5D4RA 3M8EA 5GPCA 2NVQJ 1D1BA 2VOOA 2JPCA 2AQEA 2K85A 1JTYA 3ZCOA 3DU6A 1H9TA 5M5YJ 3PO3J 2ZJPF 5E3MA 2ECCA 5E20A 2MG4A 2DA3A 4F91B 2R7RA 5J4VA 3DV8A 4WXDA 3NWTA 3RKXA 4S05A 2IPQX 3T8RA 3AAFA 3LAPA 5FJ8J 3BPXA 1D5YA 3REOA 3OMYA 5CVUA 2GZWA 3JRIA 4X6AJ 1ZYRF 4U0WA 1B8IA 5F08A 3M1CA 2MD5A 4JX5A 3HGGA 5FD5A 4BACA 2QENA 5LEJA 1BA5A 1WGXA 1AHDP 4HDUA 1BN5A 2DA7A 2LBFB 1TC3C 1TL8A 3K0LA 1MH4A 2R5YA 5ICCA 2FQ4A 3RCOA 5ICFA 3ONQA 3HIFA 5EYRA 2KZGA 1P7JA 2TRTA 5LGTA 2CWEA 3A0BC 1DP3A 3P9KA 1K78A 2O5RA 1Z0XA 4KMFA 2AQFA 1RZ4A 3MZYA 1XTAA 2LP0A 1GDTA 5FKMA 4LIVA 3HOVJ 4LIUA 2NYXA 3OYIA 1USTA 2XPWA 5HNFA 1RR8C 2DBBA 2XAGA 3GTOJ 2L4MA 2M45A 3F3XA 4L9NA 1IJWC 4JOMA 1A35A 1IGNA 2R3SA 3A03A 1ITYA 2E1CA 2F5DA 2QF7A 4A5MA 4J19A 2EA4A 3CC2I 1NTCA 3VYTB 4WXCA 4HSTA 2OUMA 3VYRB 5LD2C 3KP3A 4RDUA 2DDBA 2JZYA 2KIMA 2L2OA 1I27A 2BE5F 2R7WA 1E3OC 1I6XA 4DZPA 2CQXA 1KU3A 1ZREA 3E0JB 3K10A 2L7MP 3K4KA 3QRFF 2YS9A 2K4BA 1KA8A 4GDFA 4BY7J
chains in the Genus database with same CATH topology
4ENKA 1FBSA 3JSPA 5FFZA 5D5XB 2PJPA 3R60A 2EV0A 2P8TA 1HW5A 3WE3A 3RIRA 2QM3A 1ZGAA 4M72A 1XN7A 4L18B 3GF2A 1S7AA 4E70A 4HV5A 2XV4S 5LGNA 4R8HA 2EFOA 2IA2A 3F22A 2XAHA 1Z1DA 3LWFA 1ZRDA 2VN2A 3RKWA 4JBAA 5LHIA 1IW7F 2YSRA 3F8MA 1LJ9A 4U0YA 2OQRA 1Z6RA 2VOPA 2ISYA 5DCFA 3GO5A 2RQPA 3F6VA 3HHHA 3E97A 2PN6A 5DCMB 3WGIA 3C18A 3RYPA 1STZA 3IRQA 3BP8A 5IT9Z 4I01A 5D8LB 3R6SA 1KU7A 3P9IA 1TQPA 5CVJA 1SMYF 4LK0F 1F4KA 1WRJA 3LAJA 5F64A 5JFRA 2R7FA 1QZZA 4EV0A 2UXXA 5HVQC 1XB4A 3GLXA 2HKOA 1G6NA 2EFQA 1HBXG 3CUQC 4GCVA 5HOOA 1HSTA 1G3WA 1JHFA 4ESFA 3E5XA 4AVPA 4ZYHA 4HF1A 2MC3A 3DF8A 1YS6A 1RUNA 1O3TA 2DK8A 3CO7C 2HQNA 4O3MA 3GEZA 3HRTA 1I5ZA 1HW2A 2KRFA 1Z05A 2QZ8A 1TQIA 2MA3A 4M71A 1YS7A 3RKYA 4RB2C 3MEXA 1B4AA 4Q4ZF 1OPCA 3DQVC 4LG0A 3K2ZA 3EYIA 5E1XA 3TGNA 2GWRA 1G3TA 1D8KA 3IWFA 1YW9A 3HTSB 3ZMVA 2CFXA 2KKOA 5LRRA 4Y13A 4RGRA 4HLYA 1O3RA 4KFCA 4EQQA 2VBWA 4KMUX 3P7NA 4OIPF 2NS0A 2ZNZA 5CLSA 3ZPLA 2Y0MA 2FRHA 3WODF 1IZ1A 2ZKZA 1YW7A 2W57A 1WQ2A 5E8IA 2LDUA 1U78A 2XKPA 2XVCA 2W25A 3WGHA 4M6XA 3KFWX 3CDHA 3PFIA 1J9IA 2HGCA 4YIFA 5FO5A 1XSDA 1F5TA 2QVOA 3V4GA 4RAYA 3HOTA 1YQAA 2MLGA 4I0AA 1XSVA 5D6EA 1DDNA 1J0RA 2CG4A 3CUQA 2G7HA 1D3YA 4G8XA 5LHGA 4Q48A 2QQBA 5ICEA 3COAC 5E18F 3WTZA 4M73A 3K1MA 2QBYB 3TO7A 1G4DA 3KZYA 3FM5A 3VFZA 1FWZA 4LFUA 3MZHA 5BPDA 4IHSA 2DQLA 4H0EA 1V3FA 4WX9A 5H6RA 4S04A 2P5VA 4A12A 4KIGA 3RPUA 4XBFA 1DPUA 2ZNYA 1ZGJA 3WTUC 3N97A 4PDKA 3TDUC 1OYYA 4Q47A 1S3JA 4P5OA 5BQTA 1K6OA 2VBXA 2WV0A 3BY6A 3E6DA 1ZRFA 3CUOA 4EJTA 2VODA 3QU3A 3R61A 4HV6A 4MGRA 5HLGA 2W24A 2NRAC 2H27A 4XSXF 1JHHA 3CO6C 4BQAA 2O3FA 4QWQA 5HS7A 2K02A 3KP7A 2OZ6A 3EYYA 3WU0A 4G7ZF 4QLCU 4IPAA 3HSFA 5D5VB 1TNTA 3IWZA 1W4MA 3WTXC 3L9FA 3MAJA 4HOBA 1R58A 1BIBA 3SFZA 3SZTA 4MNUA 1H0MA 4CHUA 2DTRA 3IKVA 3L2CA 4ASNA 4GYGA 3MWMA 3RI4A 1MDMB 2HFHA 1IAWA 2YR2A 3BJAA 5D5UB 2RGVA 3KEQA 2DO7A 1FBQA 5LGUA 5TRDA 1XGOA 2G9WA 4EJUA 2E7WA 5F1RA 2HTSA 1ZG5A 1O3QA 1IN6A 5ILVA 5JI6A 1FC3A 1UHMA 1V4RA 4OMYA 2EJRA 4GXOA 5ICGA 3K1PA 5LLQA 3F8BA 2RDPA 2WWYA 1MJ9A 5ED4A 1JE8A 1FP1D 2P7CB 2RN7A 1MZBA 4EJOA 4O5VA 3E6BA 2Y48A 3TQNA 2P5KA 5DUKA 3ECHA 1BBYA 4LD5A 1DUXC 3WTWC 4CZZA 5CVRA 4IXAA 1FY7A 3ABTA 5LRSA 1XGNA 5E17F 4N9IA 4KYWA 4HQMA 1BJAA 2Z33A 4G7HF 5KK1A 3R4KA 4FT8A 2M8EA 5HS8A 4FX4A 3DXJF 4IVNA 3ZMZA 3PQKA 1IUYA 4KT5C 3HYIA 1FOKA 4D0PA 4ZH4F 5F6FA 5FLXZ 3F72A 4KN7X 4CXFA 2OD5A 3U2RA 2L4AA 2LF8A 2QUFA 1S6LA 2WC2A 1UFMA 2XKOA 5D6FA 5E1ZB 2GXGA 2A6EF 3FX3A 4UXNA 3VEPA 3F8NA 1Z6TA 3SXYA 4HF0A 4KIBA 3TOAA 4WWCA 2YU3A 5E8GA 1YIOA 3L00A 3RJPA 2ZXJA 3HSRA 5DCMA 2ESNA 4BHBA 1LEBA 3GZ6A 4OOIA 5J6XA 2BGCA 5E1WA 3MCZA 5D4SA 3GZ5A 3E6CC 3L09A 2IA0A 3BZ6A 1H9GA 4ENJA 4A0YA 3QPTA 2EFWA 3J81K 2O6GE 3D0SA 2W84A 1T2KA 1Z91A 3ERED 5BMZA 5AONA 3T0YA 1YLFA 3RYRA 2MH2A 1BI3A 1KQ9A 2HQRA 3H3ZA 4WF2A 1SD4A 4ZYGA 3G73A 4JK1X 5AIQA 4IRIA 3F6OA 1PP7U 4OINF 1LDDA 4LLNA 4KICA 1P6RA 1XDSA 3VB2A 3Q9VA 3VOEA 3KLOA 4F7ZA 1SD7A 4A6DA 1SFXA 2FSWA 4LLGF 3B02A 4AIKA 1Y0UA 3KLNA 1VTNC 3I59B 1Q1HA 3HOSA 2UWMA 2OZUA 1W7PD 2Q0OA 4G94A 4AWXB 2VONA 4ZYDA 2A3SA 1XMAA 1X3UA 1L3LA 1J5YA 4HF2A 3DEUA 2BYVE 2G7UA 2F5EA 2F5FA 1L0OC 4YG2F 1O57A 1IRGA 2PEXA 2KIUA 5L3BA 1KYWA 1RI7A 1GHCA 2PQ8A 4EM1A 2W85A 5K1YA 4XSZF 1TTYA 1O7FA 1QPMA 1PDNC 1HSJA 3QP6A 2IP2A 3ECOA 1W7PB 1SFUA 1I1GA 4K2EA 2ETHA 4P9UA 1R5GA 4KIFA 3T1BA 2ELHA 4PCQA 2ESHA 3I71A 2K7LA 4P9FA 4MTEA 4PGGA 4L9TA 1B6AA 1KYZA 2NAZA 3FXQA 4EM2A 2IJLA 3MQ0A 4HAMA 1FT9A 4ZYEA 1ZG3A 1QZYA 1ZLJA 4HZFA 3GFIA 3C7JA 3BOQA 3HUGA 3U1DA 4EM0B 3RTRA 2H94A 2HZTA 1HKSA 1K78B 1FSHA 1QBJA 2RC4A 3F23A 2QBYA 2STWA 2Z3YA 4G6DA 1IXRC 2XAQA 5ERIA 4A2UA 1QO0D 2ZJ2A 2FEZA 4HQEA 1SMTA 1D8JA 3I54A 4ESJA 2DW4A 3DKWA 4BAYA 2LKPA 3DPTA 4IHTA 1ZHFA 1MJAA 4EJWA 4RGXA 2AXLA 1FYKA 2KIFA 3GW2A 1J59A 4U0VA 1R00A 4YFNF 3KP6A 5JVTA 5A2QK 1B9NA 2HYGD 3BJOA 5EEHA 4MTDA 4N0BA 5ILSA 1SD6A 1IN8A 4NB5A 2P4WA 4BH9A 3C3WA 5HS9A 1EH8A 3WTVC 2F2EA 4RGUA 1XCVA 4I02A 5LBQA 2A6HF 2XRNA 4L5IA 2HOEA 1IN4A 3GYHX 2HYFA 1HXDA 3ZMDA 2VT3A 1P2FA 3KP2A 1OYIA 2ZMEA 2GA1A 3OV8A 2CO5A 4ENMA 1MKMA 3N4MA 4I0BA 3M9AA 2K86A 2VBZA 4CGZA 1UHWA 4U7DA 2XAFA 2X0LA 3KZZA 5DUIA 1IF1A 1E17A 1OR7A 3EUHA 3I0TA 2CGPA 3W6JB 2Z9OA 2K27A 4OIRF 3IC7A 4KUMA 1LDJA 4RS8A 3R0AA 2XASA 4L0ZB 1OKRA 3HRMA 4YFXF 4P55A 1FNNA 4G6QA 5FD6A 3GFLA 4HLXA 1RUOA 5AIPA 1LB2A 1ZLKA 2ZO4A 3M8FA 3JAMK 1P4AA 1BC7C 2JRTA 1C0WA 3GWZA 1U3EM 2OU2A 3NRVA 1B59A 4LB6B 3KEOA 3QAHA 5LEKA 1YW8A 2D1HA 1XDUA 1WSUA 2XUBA 2QYOA 3HRUA 4OMZA 3K9TA 1BI0A 3FXUA 3JTGA 2M5WA 1HW1A 2F5CA 3QP5A 2FNAA 2COMA 2HTJA 3I58A 2STTA 3TKYA 2DT5A 3FHZA 2VT2A 2PFBA 2ZCWA 1ZG1A 2LSOA 2DI3A 3TO6A 1ZAOA 1E2XA 2HR3A 3V8JA 2EA2A 5ILUA 2M87A 1ON2A 6PAXA 4ON0A 3ZMTA 2FU4A 3P9CA 4PZJA 1ODDA 2EV5A 1CF7B 2KJBA 4BYYA 1ZH5A 1OMIA 3U9GA 4RAZA 1GXPA 1ZRCA 3ZMUA 3JSOA 2QQ9A 4UUVA 4M9XA 3JW4A 3I4PA 2ZBKA 1SAXA 2FNPA 3ABUA 2NNNA 4HX8A 1O3SA 3K1NA 2V1XA 1RIOH 4OIQF 2VBYA 3S2WA 5BS6A 3EQLF 3IL2A 1LDKB 2FF4A 1REPC 2CYYA 1J7KA 4YFKF 3ROUA 5BPIA 1IXCA 2LF7A 3M7GA 3KE2A 5JR3A 2E7XA 3ML6A 2ZFWA 3NQOA 3ELKA 2EB7A 1T0FA 3O6BB 2CSOA 2EFPA 1R23A 4UV8A 3EDPA 5HLHA 1LQ1A 2HS5A 1FX7A 2D1VA 3LQQA 2DAOA 2HEOA 2QWWA 2H09A 4CDGA 4WK8F 1IN7A 2UXNA 1EH7A 4I09A 2VC0A 2H6BA 1ZARA 5DDGA 3GX4X 1TBXA 1SD5A 4OIOF 1IRFA 2EWNA 1I1SA 1S29A 1KQ0A 3FMRA 3W6KB 4L0YB 2A69F 4MQ9F 3WTYC 3GVAA 2X4HA 1R22A 1P4WA 5IT9K 3J7AO 5HDKA 2V9VA 4UVBA 1BM9A 4Y15A 5IT3A 2DLLA 5J8FA 5TJJA 3QOPA 4GYIA 3LA7A 3HRSA 1BI2A 3LA2A 2B0LA 2PMHA 3O2PE 2A5YB 2PI0A 3GFMA 4LMYA 2OBPA 1NHAA 1U2WA 2J5PA 4ENNA 4IRGA 4LB5A 1W7PA 1AWCA 4ZZDA 1S8NA 3E5QA 3IRRA 3H92A 5DD4A 3V8LA 4CYDA 1BOAA 5K5RA 4HDVA 2ACJA 1Z7UA 1ZN2A 1U5TB 4G7OF 2BEOA 4TV7A 1QGPA 1KQ8A 4M9ZA 2O8XA 5FGMA 1BI1A 5CVVA 4RGSA 3I53A 1J2XA 3SQNA 3KP5A 1JGSA 1HKQA 4M6YA 5K5QA 4HYEA 3ZMSA 2K4JA 3E3VA 4P96A 2DPDA 3BJ6A 4MEXF 1D5VA 1XD7A 1S7OA 1XMKA 3Q5FA 3CJNA 1FYLA 1YFHA 2O61A 4NQWA 3TO9A 4ETSA 2M30A 4MEYF 2JPBA 3WG9A 4LGWA 2TDXA 2H6CA 5EEGA 2GXBA 1KGSA 4MQVA 1F9NA 3F21A 2FBIA 4BHPA 1FP2A 1ULYA 2V6CA 2DK5A 1UB9A 2QQAA 3I64A 4HA8A 2VC1A 4HW0A 4HX7A 1YTYA 1IN5A 4UNOA 2FQ3A 2O03A 4HBLA 3RDIA 3SZPA 1O7LA 4B8XA 2IRFG 1R7JA 4LJZF 1PP8F 1PUEE 3LQRA 4Z2YA 2NNYA 1LVAA 1FSEA 3O3KA 2IT0A 2GA2A 2OAZA 4RB3C 1YG2A 2L54A 2A68F 4UHTA 2CW0F 3DFGA 3M1EA 4AIHA 4EVIA 2D45A 4JQFA 5CVIA 2ISZA 2C6YA 4BHCA 3GUDA 3FMSA 4A0ZA 4EMSA 4FX0A 3L7WA 1P92A 2MBFA 2IA1A 2V79A 4RB0A 2CQKA 2D2WA 5L3GA 3DPLC 4L9JA 2DQRA 3F8FA 3TOBA 2PMUA 1KU2A 2ADUA 4XRFA 4DQ2A 1WWXA 1RNLA 4A0XA 4IRHA 5L3FA 1MD0A 4XLPF 3T5XA 5HDGA 4LK1F 5CJ9A 1F1ZA 4KNYA 2FXAA 4UVCA 2FBKA 1T39A 2P5LC 3V8KA 5JHUA 2JSCA 2Z5UA 5CYVA 5DD8A 3WU1B 1AOYA 3KP4A 2DPUA 3C1DA 3H3UA 3TDZC 3WGGA 2XROA 3CTAA 3J81Z 3BWGA 1MGTA 1EH6A 3BROA 3R0JA 2QLZA 3FZVA 4DNCA 4G9YA 2VE8A 4A5NA 3CLOA 2FA5A 2FE3A 1WKMA 3FMQA 5FB2A 4NHJA 2V1DA 1FLIA 1R36A 1A04A 2KJCA 2WTEA 3Q9SA 3EETA 4AD9A 2RKHA 3JTHA 3FWEA 4L5JA 3G3ZA 2UZKA 1MDMA 5FFXA 3KCCA 4L9VA 3WTTC 1R5HA 2EK5A 4CICA 1CGPA 1GVJA 2PLYA 2GAUA 2XGXA 3NEUA 1CF7A 5DEQA 5L3EA 2BBYA 3HTUA 3ISPA 3LFKA 3IKTA 1OYWA 3ZQ7A 2YX4A 2VE9A 4AIJA 5LHHA 5DYMA 1ONVA 2O0YA 2E1NA 4PGHA 2FOKA 2PG4A 5KVRA 1K7AA 4HX4A 1ON1A 4B09A 1P4XA 2HWVA 2XIGA 2R7DA 4M74A 1TW2A 3V7CA 3FM3A 5H20A 1Z9CA 2P6SA 3BDDA 1TLHB 3V7RA 2MH9A 3ZN0A 4ZZLA 3BPVA 1LNWA 4FHTA 2FBHA 1W5SA 5DV5A 3FF5A 1U5TC 4XLNF 1T98A 3B73A 1IXSB 3I5UA 2Q2EA 5FLXK 4LG0B 1G3SA 1G3YA 3J80K 4IJAA 1U8RA 1HQCA 2YX7A 3K69A 4KDPA 4EJVA 4GO1A 2PBIA 4LLLA 1FZPB 3PQJA 3E5UA 4BNCA 2M1BA 4OU0A 2EFNA 2YPRA 1XCBA 3QPHA 1YYVA 2IW5A 1KU9A 1U6GA 2L02A 4UV9A 1FBUA 1DP7P 3IHUA 4R79A 2OA4A 4WXHA 3MFKA 1USSA 2GIVA 4I7HA 4A6EA 2ZMEB 4YIIA 4BXUA 4I2OA 2A61A 5H6QA 5A2QZ 1LEAA 1SFEA 2V1UA 2RV8A 3CUQB 5D5WB 4EGYA 3SHFA 3D5LA 1QNTA 4ESBA 3OOPA 4WCGA 3GXOA 1T6SA 2RNJA 2RVCA 5K5OA 2OQGA 3GFJA 4Q5SF 1R1VA 4MHGA 1W5TA 3KETA 2L3DA 2DFIA 5J8CA 1FPQA 5BOXA 1J75A 3RPQA 2A07F 2P6TA 1U5TA 1XGSA 1EV7A 2HDCA 1WI9A 1HKTA 1TW3A 1BC8C 5D8KB 2Y75A 3ZN1A 3ZP5A 3E6MA 2XHKA 4U7BA 2BV6A 3FXRA 2AS5F 2L01A 2Q8KA 1T38A 4R1HA 3DP7A 1XSXA 2HKXA 1TNSA 2P7VB 1R1TA 4N9HA 2Z99A 1B1BA 3WTSC 3ULQB 3WE2A 1YO5C 4I98B 5L3DA 3V7SA 3I59A 2MLKA 4CO8A 2GQQA 5L3CA 3LA3A 3QU6A 1UCRA 3JAMZ 4RB1A 4O6JA 4KN4X 1TQMA 5HLIA 1DPRA 1XGMA 1MJBA 2J5OA 2IVMA 3LSTA 3F8CA 2FMYA 3HSEA 1QQIA 1R1UA 1K79A 2LNBA 1JXSA 1FYMA 4KA4A 2EV6A 2FMLA 4UVAA 3J80Z 1B9MA 3T8TA 1GXQA 2JTVA 4EGZA 5HDNA 4Y17A 2VXZA 4GGGA 2XAJA 4U88A 2JT1A 1BIAA 4M9SA 3HHGA 4IF4A 2DU9A 3VODA 5D4RA 3M8EA 2VOOA 2JPCA 1H9TA 5E20A 3DV8A 4WXDA 3RKXA 4S05A 2IPQX 3T8RA 3AAFA 3LAPA 3BPXA 3REOA 5CVUA 2GZWA 1ZYRF 4U0WA 2MD5A 5FD5A 2QENA 5LEJA 4HDUA 1BN5A 3K0LA 5ICCA 5ICFA 3HIFA 5LGTA 2CWEA 3P9KA 1K78A 4KMFA 1RZ4A 3MZYA 2NYXA 1USTA 2DBBA 2XAGA 2L4MA 2M45A 3F3XA 4L9NA 2R3SA 2E1CA 2F5DA 4A5MA 2EA4A 4WXCA 3KP3A 2JZYA 2KIMA 1I27A 2BE5F 1I6XA 1KU3A 1ZREA 3QRFF 2K4BA 1KA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENK A;  1FBS A;  3JSP A;  5FFZ A;  5D5X B;  2PJP A;  3R60 A;  2EV0 A;  2P8T A;  1HW5 A;  3WE3 A;  3RIR A;  2QM3 A;  1ZGA A;  4M72 A;  1XN7 A;  4L18 B;  3GF2 A;  1S7A A;  4E70 A;  4HV5 A;  2XV4 S;  5LGN A;  4R8H A;  2EFO A;  2IA2 A;  3F22 A;  2XAH A;  1Z1D A;  3LWF A;  1ZRD A;  2VN2 A;  3RKW A;  4JBA A;  5LHI A;  1IW7 F;  2YSR A;  3F8M A;  1LJ9 A;  4U0Y A;  2OQR A;  1Z6R A;  2VOP A;  2ISY A;  5DCF A;  3GO5 A;  2RQP A;  3F6V A;  3HHH A;  3E97 A;  2PN6 A;  5DCM B;  3WGI A;  3C18 A;  3RYP A;  1STZ A;  3IRQ A;  3BP8 A;  5IT9 Z;  4I01 A;  5D8L B;  3R6S A;  1KU7 A;  3P9I A;  1TQP A;  5CVJ A;  1SMY F;  4LK0 F;  1F4K A;  1WRJ A;  3LAJ A;  5F64 A;  5JFR A;  2R7F A;  1QZZ A;  4EV0 A;  2UXX A;  5HVQ C;  1XB4 A;  3GLX A;  2HKO A;  1G6N A;  2EFQ A;  1HBX G;  3CUQ C;  4GCV A;  5HOO A;  1HST A;  1G3W A;  1JHF A;  4ESF A;  3E5X A;  4AVP A;  4ZYH A;  4HF1 A;  2MC3 A;  3DF8 A;  1YS6 A;  1RUN A;  1O3T A;  2DK8 A;  3CO7 C;  2HQN A;  4O3M A;  3GEZ A;  3HRT A;  1I5Z A;  1HW2 A;  2KRF A;  1Z05 A;  2QZ8 A;  1TQI A;  2MA3 A;  4M71 A;  1YS7 A;  3RKY A;  4RB2 C;  3MEX A;  1B4A A;  4Q4Z F;  1OPC A;  3DQV C;  4LG0 A;  3K2Z A;  3EYI A;  5E1X A;  3TGN A;  2GWR A;  1G3T A;  1D8K A;  3IWF A;  1YW9 A;  3HTS B;  3ZMV A;  2CFX A;  2KKO A;  5LRR A;  4Y13 A;  4RGR A;  4HLY A;  1O3R A;  4KFC A;  4EQQ A;  2VBW A;  4KMU X;  3P7N A;  4OIP F;  2NS0 A;  2ZNZ A;  5CLS A;  3ZPL A;  2Y0M A;  2FRH A;  3WOD F;  1IZ1 A;  2ZKZ A;  1YW7 A;  2W57 A;  1WQ2 A;  5E8I A;  2LDU A;  1U78 A;  2XKP A;  2XVC A;  2W25 A;  3WGH A;  4M6X A;  3KFW X;  3CDH A;  3PFI A;  1J9I A;  2HGC A;  4YIF A;  5FO5 A;  1XSD A;  1F5T A;  2QVO A;  3V4G A;  4RAY A;  3HOT A;  1YQA A;  2MLG A;  4I0A A;  1XSV A;  5D6E A;  1DDN A;  1J0R A;  2CG4 A;  3CUQ A;  2G7H A;  1D3Y A;  4G8X A;  5LHG A;  4Q48 A;  2QQB A;  5ICE A;  3COA C;  5E18 F;  3WTZ A;  4M73 A;  3K1M A;  2QBY B;  3TO7 A;  1G4D A;  3KZY A;  3FM5 A;  3VFZ A;  1FWZ A;  4LFU A;  3MZH A;  5BPD A;  4IHS A;  2DQL A;  4H0E A;  1V3F A;  4WX9 A;  5H6R A;  4S04 A;  2P5V A;  4A12 A;  4KIG A;  3RPU A;  4XBF A;  1DPU A;  2ZNY A;  1ZGJ A;  3WTU C;  3N97 A;  4PDK A;  3TDU C;  1OYY A;  4Q47 A;  1S3J A;  4P5O A;  5BQT A;  1K6O A;  2VBX A;  2WV0 A;  3BY6 A;  3E6D A;  1ZRF A;  3CUO A;  4EJT A;  2VOD A;  3QU3 A;  3R61 A;  4HV6 A;  4MGR A;  5HLG A;  2W24 A;  2NRA C;  2H27 A;  4XSX F;  1JHH A;  3CO6 C;  4BQA A;  2O3F A;  4QWQ A;  5HS7 A;  2K02 A;  3KP7 A;  2OZ6 A;  3EYY A;  3WU0 A;  4G7Z F;  4QLC U;  4IPA A;  3HSF A;  5D5V B;  1TNT A;  3IWZ A;  1W4M A;  3WTX C;  3L9F A;  3MAJ A;  4HOB A;  1R58 A;  1BIB A;  3SFZ A;  3SZT A;  4MNU A;  1H0M A;  4CHU A;  2DTR A;  3IKV A;  3L2C A;  4ASN A;  4GYG A;  3MWM A;  3RI4 A;  1MDM B;  2HFH A;  1IAW A;  2YR2 A;  3BJA A;  5D5U B;  2RGV A;  3KEQ A;  2DO7 A;  1FBQ A;  5LGU A;  5TRD A;  1XGO A;  2G9W A;  4EJU A;  2E7W A;  5F1R A;  2HTS A;  1ZG5 A;  1O3Q A;  1IN6 A;  5ILV A;  5JI6 A;  1FC3 A;  1UHM A;  1V4R A;  4OMY A;  2EJR A;  4GXO A;  5ICG A;  3K1P A;  5LLQ A;  3F8B A;  2RDP A;  2WWY A;  1MJ9 A;  5ED4 A;  1JE8 A;  1FP1 D;  2P7C B;  2RN7 A;  1MZB A;  4EJO A;  4O5V A;  3E6B A;  2Y48 A;  3TQN A;  2P5K A;  5DUK A;  3ECH A;  1BBY A;  4LD5 A;  1DUX C;  3WTW C;  4CZZ A;  5CVR A;  4IXA A;  1FY7 A;  3ABT A;  5LRS A;  1XGN A;  5E17 F;  4N9I A;  4KYW A;  4HQM A;  1BJA A;  2Z33 A;  4G7H F;  5KK1 A;  3R4K A;  4FT8 A;  2M8E A;  5HS8 A;  4FX4 A;  3DXJ F;  4IVN A;  3ZMZ A;  3PQK A;  1IUY A;  4KT5 C;  3HYI A;  1FOK A;  4D0P A;  4ZH4 F;  5F6F A;  5FLX Z;  3F72 A;  4KN7 X;  4CXF A;  2OD5 A;  3U2R A;  2L4A A;  2LF8 A;  2QUF A;  1S6L A;  2WC2 A;  1UFM A;  2XKO A;  5D6F A;  5E1Z B;  2GXG A;  2A6E F;  3FX3 A;  4UXN A;  3VEP A;  3F8N A;  1Z6T A;  3SXY A;  4HF0 A;  4KIB A;  3TOA A;  4WWC A;  2YU3 A;  5E8G A;  1YIO A;  3L00 A;  3RJP A;  2ZXJ A;  3HSR A;  5DCM A;  2ESN A;  4BHB A;  1LEB A;  3GZ6 A;  4OOI A;  5J6X A;  2BGC A;  5E1W A;  3MCZ A;  5D4S A;  3GZ5 A;  3E6C C;  3L09 A;  2IA0 A;  3BZ6 A;  1H9G A;  4ENJ A;  4A0Y A;  3QPT A;  2EFW A;  3J81 K;  2O6G E;  3D0S A;  2W84 A;  1T2K A;  1Z91 A;  3ERE D;  5BMZ A;  5AON A;  3T0Y A;  1YLF A;  3RYR A;  2MH2 A;  1BI3 A;  1KQ9 A;  2HQR A;  3H3Z A;  4WF2 A;  1SD4 A;  4ZYG A;  3G73 A;  4JK1 X;  5AIQ A;  4IRI A;  3F6O A;  1PP7 U;  4OIN F;  1LDD A;  4LLN A;  4KIC A;  1P6R A;  1XDS A;  3VB2 A;  3Q9V A;  3VOE A;  3KLO A;  4F7Z A;  1SD7 A;  4A6D A;  1SFX A;  2FSW A;  4LLG F;  3B02 A;  4AIK A;  1Y0U A;  3KLN A;  1VTN C;  3I59 B;  1Q1H A;  3HOS A;  2UWM A;  2OZU A;  1W7P D;  2Q0O A;  4G94 A;  4AWX B;  2VON A;  4ZYD A;  2A3S A;  1XMA A;  1X3U A;  1L3L A;  1J5Y A;  4HF2 A;  3DEU A;  2BYV E;  2G7U A;  2F5E A;  2F5F A;  1L0O C;  4YG2 F;  1O57 A;  1IRG A;  2PEX A;  2KIU A;  5L3B A;  1KYW A;  1RI7 A;  1GHC A;  2PQ8 A;  4EM1 A;  2W85 A;  5K1Y A;  4XSZ F;  1TTY A;  1O7F A;  1QPM A;  1PDN C;  1HSJ A;  3QP6 A;  2IP2 A;  3ECO A;  1W7P B;  1SFU A;  1I1G A;  4K2E A;  2ETH A;  4P9U A;  1R5G A;  4KIF A;  3T1B A;  2ELH A;  4PCQ A;  2ESH A;  3I71 A;  2K7L A;  4P9F A;  4MTE A;  4PGG A;  4L9T A;  1B6A A;  1KYZ A;  2NAZ A;  3FXQ A;  4EM2 A;  2IJL A;  3MQ0 A;  4HAM A;  1FT9 A;  4ZYE A;  1ZG3 A;  1QZY A;  1ZLJ A;  4HZF A;  3GFI A;  3C7J A;  3BOQ A;  3HUG A;  3U1D A;  4EM0 B;  3RTR A;  2H94 A;  2HZT A;  1HKS A;  1K78 B;  1FSH A;  1QBJ A;  2RC4 A;  3F23 A;  2QBY A;  2STW A;  2Z3Y A;  4G6D A;  1IXR C;  2XAQ A;  5ERI A;  4A2U A;  1QO0 D;  2ZJ2 A;  2FEZ A;  4HQE A;  1SMT A;  1D8J A;  3I54 A;  4ESJ A;  2DW4 A;  3DKW A;  4BAY A;  2LKP A;  3DPT A;  4IHT A;  1ZHF A;  1MJA A;  4EJW A;  4RGX A;  2AXL A;  1FYK A;  2KIF A;  3GW2 A;  1J59 A;  4U0V A;  1R00 A;  4YFN F;  3KP6 A;  5JVT A;  5A2Q K;  1B9N A;  2HYG D;  3BJO A;  5EEH A;  4MTD A;  4N0B A;  5ILS A;  1SD6 A;  1IN8 A;  4NB5 A;  2P4W A;  4BH9 A;  3C3W A;  5HS9 A;  1EH8 A;  3WTV C;  2F2E A;  4RGU A;  1XCV A;  4I02 A;  5LBQ A;  2A6H F;  2XRN A;  4L5I A;  2HOE A;  1IN4 A;  3GYH X;  2HYF A;  1HXD A;  3ZMD A;  2VT3 A;  1P2F A;  3KP2 A;  1OYI A;  2ZME A;  2GA1 A;  3OV8 A;  2CO5 A;  4ENM A;  1MKM A;  3N4M A;  4I0B A;  3M9A A;  2K86 A;  2VBZ A;  4CGZ A;  1UHW A;  4U7D A;  2XAF A;  2X0L A;  3KZZ A;  5DUI A;  1IF1 A;  1E17 A;  1OR7 A;  3EUH A;  3I0T A;  2CGP A;  3W6J B;  2Z9O A;  2K27 A;  4OIR F;  3IC7 A;  4KUM A;  1LDJ A;  4RS8 A;  3R0A A;  2XAS A;  4L0Z B;  1OKR A;  3HRM A;  4YFX F;  4P55 A;  1FNN A;  4G6Q A;  5FD6 A;  3GFL A;  4HLX A;  1RUO A;  5AIP A;  1LB2 A;  1ZLK A;  2ZO4 A;  3M8F A;  3JAM K;  1P4A A;  1BC7 C;  2JRT A;  1C0W A;  3GWZ A;  1U3E M;  2OU2 A;  3NRV A;  1B59 A;  4LB6 B;  3KEO A;  3QAH A;  5LEK A;  1YW8 A;  2D1H A;  1XDU A;  1WSU A;  2XUB A;  2QYO A;  3HRU A;  4OMZ A;  3K9T A;  1BI0 A;  3FXU A;  3JTG A;  2M5W A;  1HW1 A;  2F5C A;  3QP5 A;  2FNA A;  2COM A;  2HTJ A;  3I58 A;  2STT A;  3TKY A;  2DT5 A;  3FHZ A;  2VT2 A;  2PFB A;  2ZCW A;  1ZG1 A;  2LSO A;  2DI3 A;  3TO6 A;  1ZAO A;  1E2X A;  2HR3 A;  3V8J A;  2EA2 A;  5ILU A;  2M87 A;  1ON2 A;  6PAX A;  4ON0 A;  3ZMT A;  2FU4 A;  3P9C A;  4PZJ A;  1ODD A;  2EV5 A;  1CF7 B;  2KJB A;  4BYY A;  1ZH5 A;  1OMI A;  3U9G A;  4RAZ A;  1GXP A;  1ZRC A;  3ZMU A;  3JSO A;  2QQ9 A;  4UUV A;  4M9X A;  3JW4 A;  3I4P A;  2ZBK A;  1SAX A;  2FNP A;  3ABU A;  2NNN A;  4HX8 A;  1O3S A;  3K1N A;  2V1X A;  1RIO H;  4OIQ F;  2VBY A;  3S2W A;  5BS6 A;  3EQL F;  3IL2 A;  1LDK B;  2FF4 A;  1REP C;  2CYY A;  1J7K A;  4YFK F;  3ROU A;  5BPI A;  1IXC A;  2LF7 A;  3M7G A;  3KE2 A;  5JR3 A;  2E7X A;  3ML6 A;  2ZFW A;  3NQO A;  3ELK A;  2EB7 A;  1T0F A;  3O6B B;  2CSO A;  2EFP A;  1R23 A;  4UV8 A;  3EDP A;  5HLH A;  1LQ1 A;  2HS5 A;  1FX7 A;  2D1V A;  3LQQ A;  2DAO A;  2HEO A;  2QWW A;  2H09 A;  4CDG A;  4WK8 F;  1IN7 A;  2UXN A;  1EH7 A;  4I09 A;  2VC0 A;  2H6B A;  1ZAR A;  5DDG A;  3GX4 X;  1TBX A;  1SD5 A;  4OIO F;  1IRF A;  2EWN A;  1I1S A;  1S29 A;  1KQ0 A;  3FMR A;  3W6K B;  4L0Y B;  2A69 F;  4MQ9 F;  3WTY C;  3GVA A;  2X4H A;  1R22 A;  1P4W A;  5IT9 K;  3J7A O;  5HDK A;  2V9V A;  4UVB A;  1BM9 A;  4Y15 A;  5IT3 A;  2DLL A;  5J8F A;  5TJJ A;  3QOP A;  4GYI A;  3LA7 A;  3HRS A;  1BI2 A;  3LA2 A;  2B0L A;  2PMH A;  3O2P E;  2A5Y B;  2PI0 A;  3GFM A;  4LMY A;  2OBP A;  1NHA A;  1U2W A;  2J5P A;  4ENN A;  4IRG A;  4LB5 A;  1W7P A;  1AWC A;  4ZZD A;  1S8N A;  3E5Q A;  3IRR A;  3H92 A;  5DD4 A;  3V8L A;  4CYD A;  1BOA A;  5K5R A;  4HDV A;  2ACJ A;  1Z7U A;  1ZN2 A;  1U5T B;  4G7O F;  2BEO A;  4TV7 A;  1QGP A;  1KQ8 A;  4M9Z A;  2O8X A;  5FGM A;  1BI1 A;  5CVV A;  4RGS A;  3I53 A;  1J2X A;  3SQN A;  3KP5 A;  1JGS A;  1HKQ A;  4M6Y A;  5K5Q A;  4HYE A;  3ZMS A;  2K4J A;  3E3V A;  4P96 A;  2DPD A;  3BJ6 A;  4MEX F;  1D5V A;  1XD7 A;  1S7O A;  1XMK A;  3Q5F A;  3CJN A;  1FYL A;  1YFH A;  2O61 A;  4NQW A;  3TO9 A;  4ETS A;  2M30 A;  4MEY F;  2JPB A;  3WG9 A;  4LGW A;  2TDX A;  2H6C A;  5EEG A;  2GXB A;  1KGS A;  4MQV A;  1F9N A;  3F21 A;  2FBI A;  4BHP A;  1FP2 A;  1ULY A;  2V6C A;  2DK5 A;  1UB9 A;  2QQA A;  3I64 A;  4HA8 A;  2VC1 A;  4HW0 A;  4HX7 A;  1YTY A;  1IN5 A;  4UNO A;  2FQ3 A;  2O03 A;  4HBL A;  3RDI A;  3SZP A;  1O7L A;  4B8X A;  2IRF G;  1R7J A;  4LJZ F;  1PP8 F;  1PUE E;  3LQR A;  4Z2Y A;  2NNY A;  1LVA A;  1FSE A;  3O3K A;  2IT0 A;  2GA2 A;  2OAZ A;  4RB3 C;  1YG2 A;  2L54 A;  2A68 F;  4UHT A;  2CW0 F;  3DFG A;  3M1E A;  4AIH A;  4EVI A;  2D45 A;  4JQF A;  5CVI A;  2ISZ A;  2C6Y A;  4BHC A;  3GUD A;  3FMS A;  4A0Z A;  4EMS A;  4FX0 A;  3L7W A;  1P92 A;  2MBF A;  2IA1 A;  2V79 A;  4RB0 A;  2CQK A;  2D2W A;  5L3G A;  3DPL C;  4L9J A;  2DQR A;  3F8F A;  3TOB A;  2PMU A;  1KU2 A;  2ADU A;  4XRF A;  4DQ2 A;  1WWX A;  1RNL A;  4A0X A;  4IRH A;  5L3F A;  1MD0 A;  4XLP F;  3T5X A;  5HDG A;  4LK1 F;  5CJ9 A;  1F1Z A;  4KNY A;  2FXA A;  4UVC A;  2FBK A;  1T39 A;  2P5L C;  3V8K A;  5JHU A;  2JSC A;  2Z5U A;  5CYV A;  5DD8 A;  3WU1 B;  1AOY A;  3KP4 A;  2DPU A;  3C1D A;  3H3U A;  3TDZ C;  3WGG A;  2XRO A;  3CTA A;  3J81 Z;  3BWG A;  1MGT A;  1EH6 A;  3BRO A;  3R0J A;  2QLZ A;  3FZV A;  4DNC A;  4G9Y A;  2VE8 A;  4A5N A;  3CLO A;  2FA5 A;  2FE3 A;  1WKM A;  3FMQ A;  5FB2 A;  4NHJ A;  2V1D A;  1FLI A;  1R36 A;  1A04 A;  2KJC A;  2WTE A;  3Q9S A;  3EET A;  4AD9 A;  2RKH A;  3JTH A;  3FWE A;  4L5J A;  3G3Z A;  2UZK A;  1MDM A;  5FFX A;  3KCC A;  4L9V A;  3WTT C;  1R5H A;  2EK5 A;  4CIC A;  1CGP A;  1GVJ A;  2PLY A;  2GAU A;  2XGX A;  3NEU A;  1CF7 A;  5DEQ A;  5L3E A;  2BBY A;  3HTU A;  3ISP A;  3LFK A;  3IKT A;  1OYW A;  3ZQ7 A;  2YX4 A;  2VE9 A;  4AIJ A;  5LHH A;  5DYM A;  1ONV A;  2O0Y A;  2E1N A;  4PGH A;  2FOK A;  2PG4 A;  5KVR A;  1K7A A;  4HX4 A;  1ON1 A;  4B09 A;  1P4X A;  2HWV A;  2XIG A;  2R7D A;  4M74 A;  1TW2 A;  3V7C A;  3FM3 A;  5H20 A;  1Z9C A;  2P6S A;  3BDD A;  1TLH B;  3V7R A;  2MH9 A;  3ZN0 A;  4ZZL A;  3BPV A;  1LNW A;  4FHT A;  2FBH A;  1W5S A;  5DV5 A;  3FF5 A;  1U5T C;  4XLN F;  1T98 A;  3B73 A;  1IXS B;  3I5U A;  2Q2E A;  5FLX K;  4LG0 B;  1G3S A;  1G3Y A;  3J80 K;  4IJA A;  1U8R A;  1HQC A;  2YX7 A;  3K69 A;  4KDP A;  4EJV A;  4GO1 A;  2PBI A;  4LLL A;  1FZP B;  3PQJ A;  3E5U A;  4BNC A;  2M1B A;  4OU0 A;  2EFN A;  2YPR A;  1XCB A;  3QPH A;  1YYV A;  2IW5 A;  1KU9 A;  1U6G A;  2L02 A;  4UV9 A;  1FBU A;  1DP7 P;  3IHU A;  4R79 A;  2OA4 A;  4WXH A;  3MFK A;  1USS A;  2GIV A;  4I7H A;  4A6E A;  2ZME B;  4YII A;  4BXU A;  4I2O A;  2A61 A;  5H6Q A;  5A2Q Z;  1LEA A;  1SFE A;  2V1U A;  2RV8 A;  3CUQ B;  5D5W B;  4EGY A;  3SHF A;  3D5L A;  1QNT A;  4ESB A;  3OOP A;  4WCG A;  3GXO A;  1T6S A;  2RNJ A;  2RVC A;  5K5O A;  2OQG A;  3GFJ A;  4Q5S F;  1R1V A;  4MHG A;  1W5T A;  3KET A;  2L3D A;  2DFI A;  5J8C A;  1FPQ A;  5BOX A;  1J75 A;  3RPQ A;  2A07 F;  2P6T A;  1U5T A;  1XGS A;  1EV7 A;  2HDC A;  1WI9 A;  1HKT A;  1TW3 A;  1BC8 C;  5D8K B;  2Y75 A;  3ZN1 A;  3ZP5 A;  3E6M A;  2XHK A;  4U7B A;  2BV6 A;  3FXR A;  2AS5 F;  2L01 A;  2Q8K A;  1T38 A;  4R1H A;  3DP7 A;  1XSX A;  2HKX A;  1TNS A;  2P7V B;  1R1T A;  4N9H A;  2Z99 A;  1B1B A;  3WTS C;  3ULQ B;  3WE2 A;  1YO5 C;  4I98 B;  5L3D A;  3V7S A;  3I59 A;  2MLK A;  4CO8 A;  2GQQ A;  5L3C A;  3LA3 A;  3QU6 A;  1UCR A;  3JAM Z;  4RB1 A;  4O6J A;  4KN4 X;  1TQM A;  5HLI A;  1DPR A;  1XGM A;  1MJB A;  2J5O A;  2IVM A;  3LST A;  3F8C A;  2FMY A;  3HSE A;  1QQI A;  1R1U A;  1K79 A;  2LNB A;  1JXS A;  1FYM A;  4KA4 A;  2EV6 A;  2FML A;  4UVA A;  3J80 Z;  1B9M A;  3T8T A;  1GXQ A;  2JTV A;  4EGZ A;  5HDN A;  4Y17 A;  2VXZ A;  4GGG A;  2XAJ A;  4U88 A;  2JT1 A;  1BIA A;  4M9S A;  3HHG A;  4IF4 A;  2DU9 A;  3VOD A;  5D4R A;  3M8E A;  2VOO A;  2JPC A;  1H9T A;  5E20 A;  3DV8 A;  4WXD A;  3RKX A;  4S05 A;  2IPQ X;  3T8R A;  3AAF A;  3LAP A;  3BPX A;  3REO A;  5CVU A;  2GZW A;  1ZYR F;  4U0W A;  2MD5 A;  5FD5 A;  2QEN A;  5LEJ A;  4HDU A;  1BN5 A;  3K0L A;  5ICC A;  5ICF A;  3HIF A;  5LGT A;  2CWE A;  3P9K A;  1K78 A;  4KMF A;  1RZ4 A;  3MZY A;  2NYX A;  1UST A;  2DBB A;  2XAG A;  2L4M A;  2M45 A;  3F3X A;  4L9N A;  2R3S A;  2E1C A;  2F5D A;  4A5M A;  2EA4 A;  4WXC A;  3KP3 A;  2JZY A;  2KIM A;  1I27 A;  2BE5 F;  1I6X A;  1KU3 A;  1ZRE A;  3QRF F;  2K4B A;  1KA8 A; 
#chains in the Genus database with same CATH topology
 3X2Q H;  2F4I A;  4N4N B;  4ENK A;  3FKI J;  3NAU A;  1PUF A;  1FBS A;  2MC4 A;  3JSP A;  5FFZ A;  5D5X B;  2PJP A;  3R60 A;  2EV0 A;  2P8T A;  5CQE A;  5J47 A;  4HEA 2;  2DXI A;  2WB1 N;  4CCK A;  1HW5 A;  2WAQ N;  3W6V A;  2DTZ A;  3WE3 A;  3RIR A;  2QM3 A;  1ZGA A;  2BHY A;  4M72 A;  3S15 J;  1XN7 A;  4L18 B;  3OYJ A;  3GF2 A;  1S7A A;  1FMV A;  3LNQ A;  4AUX A;  4E70 A;  2WAF A;  3NWS A;  4HV5 A;  4II2 A;  2XV4 S;  3F9K A;  3KZI C;  5LGN A;  4R8H A;  2EFO A;  3ZQL A;  2IA2 A;  3K7A J;  1ZR2 A;  3WU2 C;  3F22 A;  2XAH A;  1Z1D A;  2DOF A;  2JN6 A;  3LWF A;  5KNL A;  1ZRD A;  2VN2 A;  3RKW A;  4JBA A;  3DBL B;  4ZDP A;  5LHI A;  1IW7 F;  2YSR A;  3F8M A;  4PJM A;  5E3L A;  2EIN H;  3IAM 2;  1LJ9 A;  2VXD A;  4U0Y A;  1YRN B;  2OQR A;  2CQQ A;  1ERD A;  3QOD A;  1Z6R A;  4H4K C;  2VOP A;  1R5I D;  2ISY A;  5DCF A;  3JR9 A;  1ETV A;  3GO5 A;  3MMY B;  2RQP A;  3F6V A;  3HHH A;  4DIQ A;  1RKT A;  2CU7 A;  2OPT A;  3E97 A;  3LSJ A;  4DW6 A;  4IHY A;  2PN6 A;  3H9Q A;  5DCM B;  3WGI A;  3C18 A;  3RYP A;  1MBG A;  2V9K A;  1T08 B;  1STZ A;  3IRQ A;  3BP8 A;  1QHG A;  5IT9 Z;  2MSY A;  4I01 A;  5D8L B;  3R6S A;  4FCY A;  3FKJ A;  4PJJ A;  1KU7 A;  3P9I A;  2PJR A;  2ZME C;  2E1O A;  1TQP A;  2QQ8 A;  5CVJ A;  1SMY F;  4F93 B;  2L7F P;  4LK0 F;  4ABZ A;  1K4T A;  1WRJ A;  1F4K A;  3LSG A;  3SEZ A;  4UUS A;  2DYR H;  2CRG A;  3LAJ A;  5F64 A;  5JFR A;  1UMQ A;  1QZZ A;  2R7F A;  4EV0 A;  1MBF A;  2CUJ A;  2UXX A;  5HVQ C;  1XB4 A;  3GLX A;  2HKO A;  2CUE A;  1G6N A;  2EFQ A;  3CCY A;  5F1J A;  1YE9 A;  1HBX G;  3DPU A;  3GME A;  4F55 A;  3CUQ C;  3P5J A;  4GCV A;  4CCL A;  1OR7 C;  3EUH C;  5IP9 J;  4E7I A;  5HOO A;  1HST A;  2JQ7 A;  1ZGW A;  1G3W A;  1UEL B;  1QVU A;  2VI6 A;  1YX5 A;  2Y9Y A;  1JHF A;  4ESF A;  3E5X A;  4AVP A;  4ZYH A;  4C3J J;  2L0K A;  4HF1 A;  2MC3 A;  1D0X A;  3DF8 A;  3WHC A;  1YS6 A;  3HDD A;  3GZN B;  1RUN A;  1O3T A;  2PMZ N;  2DK8 A;  3CO7 C;  4IO9 F;  2HQN A;  1FOX A;  4O3M A;  1VQ5 I;  2X51 A;  2EQR A;  3U21 A;  1JT0 A;  4DYC A;  3GEZ A;  3HRT A;  1I5Z A;  2HQ5 A;  3TED A;  2P81 A;  5JLX A;  1W5C C;  1HW2 A;  5FLV A;  2KRF A;  1Z05 A;  2BVM A;  2QZ8 A;  1TQI A;  2MA3 A;  4BL0 B;  3GTG J;  3NAR A;  4M71 A;  3CME I;  1YS7 A;  3RKY A;  4BQO A;  4CH7 A;  1MBK A;  4PUS A;  3MEX A;  4RB2 C;  1B4A A;  4Q4Z F;  1OPC A;  3DQV C;  3SDG A;  2MD0 A;  1OCO H;  4LG0 A;  1KON A;  1BR4 A;  3K2Z A;  1QA6 A;  3EYI A;  5E1X A;  5E3O A;  1NK2 P;  2ZFU A;  2EPF A;  1BL0 A;  3TGN A;  2GWR A;  1G3T A;  1D8K A;  1HDD C;  3IWF A;  1RC9 A;  1YW9 A;  1WHU A;  1W0T A;  3Q0V A;  3HTS B;  3ZMV A;  1K6Y A;  2CFX A;  3GTK J;  2KKO A;  5LRR A;  4Y13 A;  4RGR A;  4HLY A;  1O3R A;  4KFC A;  4C3I J;  4QPO A;  4EQQ A;  2RAE A;  2VBW A;  2HVR A;  4KMU X;  3P7N A;  4OIP F;  2NS0 A;  2ZNZ A;  5CLS A;  3ZPL A;  2Y0M A;  4C2U A;  3MN2 A;  1IC8 A;  3CC4 I;  2FRH A;  3WOD F;  1IZ1 A;  3JRB A;  2ZKZ A;  1YW7 A;  3OL4 A;  2W57 A;  4HG2 A;  2JVH A;  3PIO F;  2Y30 A;  4RM2 A;  1WQ2 A;  2DOA A;  5C4J J;  5FKL A;  5E8I A;  4XQF A;  2CQ7 A;  2LDU A;  2X6W A;  3JRG A;  1U78 A;  1I6H J;  2XKP A;  4S0H B;  4UY8 I;  2XVC A;  2W25 A;  2NVU B;  3WGH A;  2XPV A;  4M6X A;  3KFW X;  1W36 C;  3CDH A;  3PFI A;  3TMO A;  1J9I A;  3BR1 A;  2HGC A;  1X1B A;  1HC8 A;  3GTP J;  3JRD A;  4YIF A;  5FO5 A;  4AU7 A;  1XSD A;  1S72 I;  2QVO A;  3V4G A;  5GAH J;  1F5T A;  1P9Q C;  2H8W A;  4RA2 A;  3B6C A;  4RAY A;  3HOT A;  1VI0 A;  3SJM A;  1YQA A;  2MLG A;  1POG A;  4I0A A;  1XSV A;  5D6E A;  1DDN A;  2L5Q A;  1J0R A;  2CG4 A;  3CUQ A;  2DFH A;  1D3Y A;  2G7H A;  3ZRG A;  3HPG A;  1XS9 A;  4CSW A;  4JYK A;  4G8X A;  2CUZ A;  2JWT A;  3UR3 C;  5LHG A;  4Q48 A;  2QQB A;  4G6T B;  3BTL A;  5ICE A;  3COA C;  2M8G X;  5E18 F;  2Y2Z A;  3HUG B;  3Q0U A;  1A6I A;  3WTZ A;  3EUK L;  3FDY A;  3IH2 A;  1GV5 A;  2DA4 A;  4M73 A;  3K1M A;  2QBY B;  4Y3O A;  2BXY A;  2VPR A;  3TO7 A;  3OYD A;  1QPI A;  3BTJ A;  1LFB A;  4V19 K;  2CFO A;  1G4D A;  1GVD A;  3KZY A;  3JRC A;  3FM5 A;  5K7Z A;  4NUB A;  2JSP A;  2CQN A;  3VFZ A;  4KIS A;  1FWZ A;  4LFU A;  3MZH A;  5BPD A;  3ZQH A;  4IHS A;  5IOY A;  2DQL A;  5EGO A;  3KX2 A;  2JA5 J;  4H0E A;  2ECB A;  1V3F A;  4WX9 A;  5H6R A;  4PSX A;  2G0E A;  3BCB A;  4S04 A;  2P5V A;  4KIG A;  3RPU A;  4XBF A;  4A12 A;  1DPU A;  2ZNY A;  1ZGJ A;  4BJ6 C;  4B47 A;  2W48 A;  3CJQ B;  3L2R A;  3S3M A;  3WTU C;  3AG2 H;  1ZK8 A;  3N97 A;  4PDK A;  1VQ4 I;  3TDU C;  1X58 A;  2I5U A;  1OYY A;  5B1B H;  4Q47 A;  1TWH J;  1ETK A;  1N75 A;  4RAF A;  1S3J A;  1BR2 A;  3I3L A;  4P5O A;  5BQT A;  1UZC A;  3JRH A;  1S7E A;  4UB8 C;  1K6O A;  2VBX A;  2WV0 A;  3BY6 A;  3E6D A;  3HG9 A;  1ZRF A;  3HGY A;  2A5W A;  2X1E A;  3BG9 A;  3CUO A;  3S93 A;  4EJT A;  3PSI A;  5IP6 A;  2IS2 A;  1T0F C;  2VOD A;  1QHH D;  2CV1 A;  3QU3 A;  3R61 A;  4HV6 A;  4MGR A;  5HLG A;  3HC7 A;  1WH5 A;  2W24 A;  2NRA C;  2H27 A;  4NC8 A;  4XSX F;  2E36 A;  1JHH A;  4C30 A;  4JX6 A;  3CO6 C;  4BQA A;  2O3F A;  3OIQ A;  1TWG J;  4QWQ A;  1DGR M;  5HS7 A;  1JUP A;  4JP0 A;  3LFU A;  3JRA A;  2K02 A;  3SZG A;  1VQP I;  3CCE I;  1JI8 A;  3KP7 A;  2OZ6 A;  4HNU A;  3EYY A;  2R4G A;  3WU0 A;  4G7Z F;  2WAD A;  4QLC U;  4IPA A;  3HSF A;  4YEJ A;  1SAU A;  5D5V B;  1TNT A;  3OYG A;  3IWZ A;  3L2V A;  1BW6 A;  1W0U A;  5LFA A;  1W4M A;  5B66 C;  3WTX C;  3L9F A;  3MAJ A;  4IX7 A;  4HOB A;  1R58 A;  1BIB A;  2DA1 A;  4NNJ A;  3SZT A;  3SFZ A;  4MNU A;  1H0M A;  1VQ6 I;  3CCM I;  4XK4 A;  2DTR A;  4CHU A;  3IKV A;  3L2C A;  3LMM A;  4ASN A;  4GYG A;  1T56 A;  3MWM A;  3RI4 A;  2WY8 Q;  1MDM B;  2DFF A;  2HFH A;  1IAW A;  2YR2 A;  3OYH A;  3BJA A;  3EPZ A;  5D5U B;  4C2M J;  2RGV A;  4B3A A;  3QYB A;  3S3N A;  2E1M C;  3KEQ A;  2DO7 A;  4A3M J;  3AG4 H;  1FBQ A;  2X9D A;  2X85 A;  5LGU A;  1N78 A;  5TRD A;  1XGO A;  2G9W A;  3S3O A;  4EJU A;  1YI2 I;  1SEU A;  4BE0 A;  4XM3 A;  2DJN A;  2E7W A;  2R7O A;  2KDO A;  5F1R A;  3W2A A;  2HTS A;  3ZQQ A;  2Z1D A;  3OOU A;  4BQN A;  2W4S A;  1ZG5 A;  4PFP A;  3CLQ A;  1IN6 A;  1O3Q A;  5ILV A;  5JI6 A;  1FC3 A;  1UHM A;  1V4R A;  4OMY A;  2B9S A;  5DM7 F;  2EJR A;  1V5G A;  4GXO A;  5ICG A;  3H9J A;  3K1P A;  2B63 J;  5LLQ A;  2UUZ A;  1ETW A;  1Y8R B;  2RDP A;  3F8B A;  3Q3S A;  4V2F A;  2WWY A;  1FTZ A;  1MJ9 A;  5ED4 A;  4IHX A;  4F3Q A;  1SVO A;  3K4M A;  4DBQ A;  1WVR A;  4I76 A;  1JE8 A;  2E2I J;  3CMM A;  1G59 A;  1MSE C;  3OYB A;  3L1P A;  1FP1 D;  4XOR A;  2P7C B;  2RN7 A;  1R71 A;  3TW7 A;  2F6C A;  1MZB A;  4EJO A;  1W36 D;  4O5V A;  1F43 A;  3E6B A;  3K70 D;  2LBF A;  2Y48 A;  3BTC A;  3TQN A;  2P5K A;  5DUK A;  4F92 B;  3LSP A;  3ECH A;  1YIJ I;  2HXI A;  5DS9 A;  1BBY A;  4LD5 A;  1DUX C;  1Y1W J;  4HNV A;  4ZDL A;  3PL8 A;  4V2G A;  3WTW C;  4MIM A;  4NDL A;  4CZZ A;  4I6Z A;  5CVR A;  4IXA A;  1A6Q A;  4XKW A;  1FY7 A;  2EIL H;  1MNE A;  3ABT A;  2Q2E B;  5LRS A;  1JUS A;  3H3V K;  2R0Q C;  1EJ9 A;  1WJB A;  4ZC3 A;  1XGN A;  4RBO A;  4XRM A;  2IBD A;  5E17 F;  4N9I A;  1HLV A;  1HDP A;  4XL9 A;  3G2B A;  4KYW A;  4DYR A;  2K40 A;  4HQM A;  3S2D J;  1BJA A;  2Z33 A;  3HKZ N;  1U8B A;  1E3H A;  4J01 A;  4G7H F;  5KK1 A;  3R4K A;  4FT8 A;  4HPQ A;  2M8E A;  5HS8 A;  4FX4 A;  3DXJ F;  4IVN A;  4BDZ A;  3ZMZ A;  1NG7 A;  1OQY A;  1WI3 A;  3PQK A;  1IUF A;  5KCM A;  1IUY A;  4KT5 C;  2LRD A;  3HYI A;  5EJC A;  1RR7 A;  5EEA A;  5M5X J;  2BHZ A;  1FOK A;  2JUG A;  4D0P A;  4ZH4 F;  5HOD A;  2X6X A;  2RRE A;  5F6F A;  5FLX Z;  4XLE A;  3F72 A;  4KN7 X;  1JJ8 C;  4CXF A;  3H9G A;  2OD5 A;  3U2R A;  2L4A A;  2LF8 A;  2QUF A;  1S6L A;  4QTR A;  2WC2 A;  1Z3Y A;  3BG3 A;  4RMN A;  1UFM A;  3VSL A;  2XKO A;  1FJL A;  5D6F A;  3OR1 C;  5E1Z B;  2DN0 A;  3K4N A;  2GXG A;  1TT0 A;  3PIP F;  2A6E F;  3FX3 A;  3CF5 F;  4UXN A;  1DU0 A;  1UG2 A;  3VEP A;  3F8N A;  3K4B A;  2ZB9 A;  3M4O J;  1Z6T A;  1D0Y A;  2KRH A;  3SXY A;  2E35 A;  4G12 A;  4HF0 A;  4KIB A;  3TOA A;  2VQL A;  3FXM A;  4WWC A;  3HZJ A;  1IRX A;  1MBH A;  3IH4 A;  3HOW J;  2W1O A;  4D9J A;  1Y39 A;  2ME0 A;  2YU3 A;  5E8G A;  1YRN A;  3MVP A;  1YIO A;  3ABL H;  1X2N A;  3L00 A;  3RQI A;  2JA6 J;  1RPW A;  2CMP A;  3RJP A;  4BXF A;  2ZXJ A;  3KPH A;  3PSF A;  3RSN A;  3HSR A;  5DCM A;  1LPQ A;  2ESN A;  2Z16 A;  2DMP A;  3TL4 X;  4BHB A;  5EDN A;  3GZ6 A;  1LEB A;  4OOI A;  5J6X A;  2ELK A;  2ME6 A;  2BGC A;  2P0W A;  5E1W A;  3FIS A;  3MCZ A;  2WB1 A;  1WJA A;  2IS1 A;  4BQQ A;  5D4S A;  3GZ5 A;  3E6C C;  2JUC A;  2WAQ A;  3L09 A;  1GT0 C;  3BT9 A;  3EUA A;  5GTI C;  2IA0 A;  3BQZ A;  2VJI A;  3BZ6 A;  1H9G A;  1R9T J;  4ENJ A;  4A0Y A;  3QPT A;  2EFW A;  3BZC A;  3J81 K;  2O6G E;  3D0S A;  4BKX A;  3DEW A;  3ABK H;  2W84 A;  1T2K A;  1Z91 A;  1S9H A;  2VKE A;  3ERE D;  5BMZ A;  5AON A;  3T0Y A;  1YLF A;  2LLK A;  2QSH X;  2HOS A;  2KHM A;  2LY1 A;  3G1M A;  3RYR A;  2MH2 A;  3KYC B;  3FIW A;  1BI3 A;  1KQ9 A;  2HQR A;  2ELJ A;  3H3Z A;  4WF2 A;  5J3L A;  1SD4 A;  4ZYG A;  3G73 A;  4JK1 X;  5AIQ A;  4IRI A;  3F6O A;  1PP7 U;  4OIN F;  1LDD A;  2E2H J;  4LLN A;  2LVS A;  4KIC A;  1P6R A;  3H35 A;  1ETY A;  1XDS A;  2M7B A;  3A2K A;  3VB2 A;  3Q9V A;  3VOE A;  3C2H A;  2DOE A;  3KLO A;  4F7Z A;  1SD7 A;  5M5W J;  1ZR4 A;  2QCO A;  4A6D A;  2KPM A;  5GP9 A;  2H1K A;  2DA2 A;  1SFX A;  2FSW A;  3H0G J;  3B02 A;  3Q0W A;  4LLG F;  1VQN I;  4AIK A;  1Y0U A;  3KLN A;  3I59 B;  1VTN C;  1Q1H A;  3A02 A;  3HOS A;  2UWM A;  2VKH A;  1YOV B;  2OZU A;  1QZE A;  1W7P D;  2Q0O A;  2XRL A;  4G94 A;  4AWX B;  4E6K G;  2VON A;  4ZYD A;  1TZL A;  2A3S A;  3PNY A;  2E1M B;  4AM3 A;  1XMA A;  1X3U A;  4B48 A;  4D5F A;  1L3L A;  2LKS A;  5TIS C;  1J5Y A;  2R93 J;  4XKC A;  4HF2 A;  3BQY A;  3DEU A;  2BYV E;  2VIX A;  1ETX A;  3AG1 H;  2G7U A;  3O8H A;  3AFH A;  1YIT I;  3KEY A;  2F5E A;  2F5F A;  1L0O C;  4YG2 F;  1O57 A;  2BY3 A;  2LFB A;  2WV1 A;  1IRG A;  2BY2 A;  2QGU A;  2PEX A;  1N25 A;  2KIU A;  5L3B A;  1KYW A;  1RI7 A;  2H8R A;  1GHC A;  2PQ8 A;  1R4M B;  4II3 A;  1A5J A;  1OFC X;  4EM1 A;  5F04 A;  2W85 A;  3WHB A;  5K1Y A;  4XSZ F;  1TTY A;  1PJR A;  1GUU A;  1BW5 A;  1O7F A;  4DZJ A;  2VB6 A;  2VLA A;  1JJ6 C;  1QPM A;  2PMZ A;  1PDN C;  4A3F J;  1HSJ A;  1MMS A;  2VQH A;  2L7Z A;  3QP6 A;  3OR2 C;  5IYB J;  4IOA F;  2K9M A;  1PVE A;  1N77 A;  2IP2 A;  4A3K J;  3OS2 A;  3ECO A;  1W7P B;  1VQ9 I;  4EAT A;  1ZQ3 P;  4XLH A;  1H88 C;  1SFU A;  3A1Y A;  3BG7 A;  2ZJR F;  3FXL A;  4LG3 A;  1I1G A;  4K2E A;  5FKN A;  2ETH A;  2EZI A;  2HZD A;  2KDZ A;  4P9U A;  3IH3 A;  3QPL A;  3DLL F;  5M3M J;  1R5G A;  4KIF A;  3FXK A;  3T1B A;  3VYU B;  3OS1 A;  3HPH A;  2ELH A;  4PCQ A;  2RQQ A;  2ESH A;  4E7J A;  2DMU A;  3I71 A;  2K7L A;  4P9F A;  4MTE A;  4CCO A;  1LE8 B;  2R7V A;  3W2V A;  4PGG A;  4L9T A;  1B6A A;  2BW3 B;  4BS9 A;  1KYZ A;  2NAZ A;  3FXQ A;  4PJN A;  3PFY A;  4EM2 A;  2IJL A;  3MQ0 A;  4HAM A;  3UNG C;  1VQ8 I;  1FT9 A;  2JA2 A;  1ZG3 A;  1QZY A;  1ZLJ A;  4HZF A;  4ZYE A;  5GPA A;  3GFI A;  3C7J A;  5J1U A;  4PSW A;  3BOQ A;  5DTD A;  3HUG A;  3U1D A;  1B72 B;  4EM0 B;  3RTR A;  2H94 A;  2ID3 A;  2Y9Z A;  2HZT A;  1HKS A;  2EIJ H;  2HQA A;  1K78 B;  1FSH A;  3DLA A;  4RAG A;  1QBJ A;  2RC4 A;  3F23 A;  5E3N A;  4L5E A;  2QBY A;  2STW A;  2Z3Y A;  2EZL A;  4G6D A;  1VQM I;  4IQ4 A;  1NK3 P;  1IXR C;  2XAQ A;  5ERI A;  5F0F A;  1QO0 D;  4M3G A;  4A2U A;  1WFX A;  2CS3 A;  2RNG A;  2ZJ2 A;  4MLO A;  2FEZ A;  4XKB A;  1OLT A;  4HQE A;  1SMT A;  4IL6 C;  4NQW B;  1D8J A;  5E79 C;  3I54 A;  2IGN A;  4KT6 A;  4ESJ A;  2LY9 A;  2DW4 A;  2V6E A;  3DKW A;  4BAY A;  2LKP A;  3DPT A;  3VDX A;  4BUP A;  1I3A A;  2X48 A;  3F0C A;  2D5V A;  5IY5 H;  4IHT A;  1ZHF A;  1MJA A;  4EJW A;  3D5S C;  3PUB A;  4RGX A;  2AXL A;  1FYK A;  2KIF A;  3CMA I;  3GW2 A;  1J59 A;  2L9V A;  3BC8 A;  2XC7 A;  4U0V A;  1R00 A;  4YFN F;  2JVG A;  3W2W A;  1FMW A;  2GLO A;  3KP6 A;  5JVT A;  3TBI A;  5A2Q K;  5FKO A;  4FQG A;  1B9N A;  1PUF B;  5EZG A;  1ETO A;  2HYG D;  3BJO A;  1O4X A;  5EEH A;  2FD5 A;  4MTD A;  3OIO A;  4N0B A;  5ILS A;  1SD6 A;  2GM4 A;  1IN8 A;  2XSJ C;  2P4W A;  3K4J A;  4NB5 A;  3C3W A;  4BH9 A;  5IP7 J;  5HS9 A;  1K4S A;  4DJA A;  2KP6 A;  1X1C A;  1EH8 A;  1RES A;  3WTV C;  4YIR X;  2F2E A;  4RGU A;  2VL8 A;  1XCV A;  4XRS A;  3B6A A;  1AKH B;  4I02 A;  5LBQ A;  2A6H F;  2XRN A;  2LH9 A;  2XGE A;  4L5I A;  2JA7 J;  2HOE A;  2KMU A;  1IN4 A;  4A3D J;  4F52 A;  2HPM A;  3E7L A;  3CCJ I;  3GYH X;  2ZSI B;  2WA0 A;  2HYF A;  5HLT A;  1HXD A;  3ZMD A;  2VT3 A;  1XX5 A;  1DQU A;  1P2F A;  1FOY A;  3KP2 A;  1OYI A;  3D5R C;  3LSM A;  4XR6 A;  4QPQ A;  2ZME A;  1RET A;  1PYV A;  2GA1 A;  3OV8 A;  2CO5 A;  2LY2 A;  1MKM A;  4ENM A;  3N4M A;  4I0B A;  2WY7 Q;  3M9A A;  3K70 C;  2K86 A;  1EKE A;  2VBZ A;  2XF5 A;  3LL7 A;  4CGZ A;  4IHV A;  1UHW A;  4U7D A;  2QSG X;  2XAF A;  2X0L A;  4B1R A;  3KZZ A;  2E60 A;  1IDY A;  3RZD J;  5DUI A;  1IF1 A;  4BXX J;  3V42 A;  1E17 A;  1OR7 A;  3EUH A;  2L7K A;  3I0T A;  4XN3 A;  3LOC A;  4C3H J;  2CGP A;  3J7A Y;  2XF6 A;  4B3X A;  5J40 A;  3W6J B;  2Z9O A;  2K27 A;  1NH3 A;  4A3I J;  1OIS A;  2M7A A;  5CQG A;  2FUG 2;  3GLL A;  3SFI A;  1X2M A;  4OIR F;  3IC7 A;  2AO9 A;  4KUM A;  1MMD A;  2DYS H;  2DT7 B;  1LDJ A;  4M3F A;  2JA8 J;  5EZH A;  4RS8 A;  1HOM A;  3S17 J;  3OY9 A;  3R0A A;  5DM6 F;  2FJ1 A;  2XAS A;  3BCA A;  2EZK A;  3SDB A;  4QIW N;  2R92 J;  3IUO A;  1MW7 A;  2R7X A;  4L0Z B;  1MBJ A;  2XAU A;  1WZ2 A;  1OKR A;  4FET A;  3SYT A;  3HRM A;  4YFX F;  4P55 A;  1FNN A;  2E19 A;  4P1W A;  1ACI A;  4CYC B;  4G6Q A;  5FD6 A;  3GFL A;  4HLX A;  1RUO A;  3G1O A;  3VSK A;  5AIP A;  1LB2 A;  1ZLK A;  2ZO4 A;  3M8F A;  2NOJ B;  3DTI A;  2LR8 A;  3DKY A;  3QWL A;  3DU5 A;  2LYC A;  3JAM K;  4M3E A;  1P4A A;  4X0G A;  1BC7 C;  5FRM A;  1R6R A;  2JRT A;  1C0W A;  3GWZ A;  2HOT A;  1U3E M;  2OU2 A;  3NRV A;  3RQ4 A;  2VAS A;  1B59 A;  4LB6 B;  2HNH A;  3KEO A;  3QAH A;  4ANJ A;  3JCU C;  5LEK A;  1YW8 A;  2HDW A;  3M07 A;  3HB9 A;  2D1H A;  1TP4 A;  3HXL A;  5BNG A;  3PUF A;  1XDU A;  4JX4 A;  4HNT A;  1WSU A;  2XUB A;  2LKX A;  2QYO A;  3HRU A;  4OMZ A;  3GTJ J;  3K9T A;  4M6V A;  4BBR J;  1BI0 A;  3RZO J;  3FXU A;  3HOU J;  3JTG A;  4AYB N;  2M5W A;  1HW1 A;  2F5C A;  1R4N B;  3QP5 A;  2FNA A;  3HM5 A;  2COM A;  2HTJ A;  3I58 A;  4IEJ A;  1Y0N A;  3TKY A;  2DT5 A;  3FHZ A;  2STT A;  2VT2 A;  2PFB A;  4BDY A;  2ZCW A;  4FIS A;  2CUF A;  2OCE A;  1I3Q J;  2R7Z J;  3CJT B;  1ZG1 A;  2LSO A;  2DI3 A;  3TO6 A;  5B5E C;  1ZAO A;  4ZDO A;  2IS6 A;  1E2X A;  1YHQ I;  2DFE A;  2HR3 A;  1V5F A;  5FRN A;  2GOM A;  3V8J A;  2K3F A;  2EA2 A;  1TWC J;  4E7S A;  5ILU A;  1QU3 A;  1X19 A;  1VZ0 A;  1ON2 A;  2M87 A;  3CZ6 A;  2I10 A;  2IGK A;  6PAX A;  4YEL A;  4ON0 A;  1P7I A;  2IS4 A;  3ZMT A;  2FU4 A;  2O7O A;  3ZR8 X;  4CZC A;  2NVY J;  1OCC H;  3O8G A;  3P9C A;  4PZJ A;  1ENH A;  1ODD A;  4XOT A;  2QEX I;  4XON A;  3IP4 B;  2EV5 A;  1Y56 A;  1E0E A;  3OYK A;  1CF7 B;  2KJB A;  4BYY A;  1MBE A;  2DA5 A;  1ZH5 A;  1OMI A;  5J1Y A;  3U9G A;  4RAZ A;  1UG0 A;  5IPA A;  1GXP A;  1ZRC A;  1LKX A;  3ZMU A;  5KAI C;  3CCV I;  2EBI A;  3JSO A;  4XLA A;  3ERM A;  2QQ9 A;  4UUV A;  2BZT A;  2DJI A;  4M9X A;  4RLF A;  3JW4 A;  3FBN B;  2HVS A;  2XGC A;  2M0M A;  2Y0S N;  3I4P A;  2ZBK A;  3W3C A;  1SAX A;  3HKZ A;  3PM1 A;  2FNP A;  3ABU A;  3JRF A;  4XLC A;  2NNN A;  2QSF X;  4HX8 A;  4A3L J;  1O3S A;  1OCT C;  3K1N A;  4LOC A;  2V1X A;  2LOO A;  5EG0 B;  1RIO H;  3MKW B;  1OCZ H;  4CCJ A;  1YX3 A;  4OIQ F;  2VBY A;  3S2W A;  1WJC A;  2XB5 A;  4J00 A;  5BS6 A;  3EQL F;  3IL2 A;  2V7F A;  1LDK B;  3OYF A;  5GTH C;  5M3F J;  2FF4 A;  2H1L A;  2Z2S B;  4RM3 A;  3HEF A;  3BR3 A;  1Y1V J;  4X1E A;  4AC0 A;  5JVG F;  3KYL A;  1YJN I;  2YU9 J;  1REP C;  4B4C A;  4BJT A;  2V26 A;  2CYY A;  3AL0 B;  4ITV A;  1J7K A;  4YFK F;  2QA4 I;  4D5C A;  3ROU A;  5BPI A;  1IXC A;  2LF7 A;  1T8I A;  1OCP A;  2GXA A;  3M7G A;  3KE2 A;  4DGW B;  2E7X A;  3ASN H;  5JR3 A;  3ML6 A;  2ZFW A;  3NQO A;  3ELK A;  2ZXW H;  4Y52 J;  1T0F A;  2EB7 A;  2ZC2 A;  5GAG J;  3L2U A;  9ANT A;  3O6B B;  4BJ5 C;  4XID A;  4KJZ A;  2CSO A;  2AHQ A;  2EFP A;  4QSH A;  1R23 A;  4UV8 A;  3K4C A;  1D1C A;  3EDP A;  3HBL A;  1VQ7 I;  5HLH A;  1LQ1 A;  1EA3 A;  2I8D A;  1U9O A;  2MGQ A;  2R5Z B;  3OYE A;  2BOL A;  2HS5 A;  3S2H J;  4DBR A;  1FX7 A;  2D1V A;  1IV8 A;  3LQQ A;  1SC7 A;  2CW8 A;  2DAO A;  5FKK A;  2HEO A;  2QWW A;  3PNT A;  2H09 A;  4CDG A;  5B3S H;  4WK8 F;  3UKG A;  3BR5 A;  5J1R A;  1IN7 A;  1I50 J;  2E71 A;  2UXN A;  1EH7 A;  2LK2 A;  4I09 A;  2VC0 A;  2H6B A;  1ZAR A;  5DDG A;  2FX0 A;  3GX4 X;  1TBX A;  1SD5 A;  4NC7 A;  3M8J A;  4OIO F;  4E7L A;  1IRF A;  4A3E J;  2EWN A;  1I1S A;  1S29 A;  1KQ0 A;  2BY1 A;  2X6O A;  3ABM H;  3OYC A;  2NXN B;  2DA6 A;  2X1D A;  3FMR A;  3W6K B;  2OTJ I;  4L0Y B;  1MH3 A;  2A69 F;  1IDZ A;  4MQ9 F;  2HDD A;  3S32 A;  4M3D A;  2LC2 A;  3GVA A;  3WTY C;  3A01 B;  2HU9 A;  2X4H A;  3G1L A;  1BOB A;  1R22 A;  1P4W A;  1WCM J;  5IT9 K;  3J7A O;  5HDK A;  1APL C;  2R7S A;  2V9V A;  4UVB A;  1WJD A;  1BM9 A;  2W82 A;  4Y15 A;  5IT3 A;  2DLL A;  2EZH A;  5J8F A;  5TJJ A;  1H89 C;  3QOP A;  1IO2 A;  3CD6 I;  1FIP A;  4UUT A;  3OSF A;  4GYI A;  2XB0 X;  3LA7 A;  1XC5 A;  1V54 H;  3HRS A;  1BI2 A;  3RKQ A;  3HOY J;  1RRJ A;  2V4J C;  3LA2 A;  4D7M A;  2B0L A;  2PMH A;  1XG1 A;  2MFZ A;  3O2P E;  3GTL J;  3VPR A;  2A5Y B;  2PI0 A;  3GFM A;  3OYL A;  3CDI A;  4LMY A;  1IG7 A;  2OBP A;  2DOD A;  2JK3 A;  1NHA A;  1U2W A;  1V5E A;  2J5P A;  3FK7 A;  4ENN A;  2OF7 A;  5C44 J;  3GTM J;  4I99 C;  2KZV A;  4IRG A;  4LB5 A;  1W7P A;  2LD5 A;  1AWC A;  4ZZD A;  1S8N A;  3E5Q A;  3K2A A;  4PFO A;  3IRR A;  3H92 A;  2X1C A;  1JT6 A;  5DD4 A;  3V8L A;  5K7H A;  4W97 A;  1JUM A;  4CYD A;  5B1A H;  1BOA A;  5KHD A;  5K5R A;  4HDV A;  2IGO A;  2ACJ A;  1Z7U A;  1ZN2 A;  2IGM A;  1U5T B;  4G7O F;  2NS7 A;  2BEO A;  2F48 A;  4TV7 A;  1LE8 A;  1QGP A;  2BW3 A;  1KQ8 A;  3MKZ A;  4M9Z A;  1IV6 A;  2O8X A;  5FGM A;  2OCC H;  4IOC F;  1BI1 A;  2BXZ A;  2M34 A;  5CVV A;  4RGS A;  3JRE A;  3I53 A;  2HOA A;  1J2X A;  1JKR C;  3H5A A;  3SQN A;  3OYN A;  2O8K A;  3KP5 A;  2DMT A;  2KT0 A;  4GRI A;  1B72 A;  1JGS A;  1HKQ A;  4E7Z A;  2IXS A;  3DCF A;  3DBH B;  3C2G A;  2R7T A;  4M6Y A;  5K5Q A;  4HYE A;  3ZMS A;  2CV2 A;  3A0H C;  2K4J A;  3E3V A;  1GLN A;  4P96 A;  2DPD A;  3BJ6 A;  3CCU I;  4BEH B;  1LFU P;  1X1D A;  4MEX F;  1D5V A;  1XD7 A;  1FOW A;  1S7O A;  1XMK A;  4M3B A;  2K3P A;  3CJN A;  5JHF A;  3Q5F A;  2W00 A;  1DU6 A;  1FYL A;  3ASO H;  4E4H A;  1YFH A;  2O61 A;  4NQW A;  3TO9 A;  4ETS A;  2M30 A;  2A05 A;  5JLW A;  4MEY F;  3OYA A;  2JPB A;  1M1E B;  3WG9 A;  4LGW A;  2TDX A;  2H6C A;  5EEG A;  2GXB A;  2F4M B;  1KGS A;  4MQV A;  1F9N A;  1YJW I;  3F21 A;  1ZTR A;  2FBI A;  4BHP A;  1MNM C;  2LG4 A;  1FP2 A;  1ULY A;  2V6C A;  2DK5 A;  3N05 A;  1WJ5 A;  3D1N I;  1U0J A;  1UB9 A;  2QQA A;  3I64 A;  4CUG A;  3OL3 A;  1HF0 A;  4IQJ A;  3H36 A;  4HA8 A;  2IAI A;  2VC1 A;  4HW0 A;  3J7Y J;  4HX7 A;  1FEX A;  2VJJ A;  1YTY A;  1IN5 A;  4UNO A;  3G71 I;  2EIK H;  2A6T A;  2FQ3 A;  3S16 J;  2ZJQ F;  2O03 A;  2E5N A;  4XLF A;  4HBL A;  3RDI A;  5TGT A;  5F0H A;  3SZP A;  5IYC J;  4CA0 A;  1O7L A;  4B8X A;  2IRF G;  1R7J A;  2LMD A;  1HCR A;  3ZXS A;  4LJZ F;  1G2H A;  2DMN A;  1PP8 F;  1PUE E;  3LQR A;  4Z2Y A;  1AKH A;  3LSK A;  2NNY A;  3MD2 A;  2CV0 A;  2L9R A;  1LVA A;  1FSE A;  3O3K A;  4DOZ A;  4B43 A;  2IT0 A;  2GA2 A;  2OAZ A;  3GCM A;  4RB3 C;  2BVL A;  2DT6 A;  2NVT J;  2LTP A;  3CES A;  1YG2 A;  4KIT B;  2O9L A;  3CC7 I;  2F5V A;  2L54 A;  5F0C A;  2MYS A;  3J7Z I;  2A68 F;  4UHT A;  4B44 A;  3BZK A;  2CW0 F;  3U1K A;  4XRS G;  1IRZ A;  3S1R J;  3DFG A;  2K9S A;  3M1E A;  4AIH A;  4EVI A;  2D45 A;  1Z3X A;  3L2W A;  1UJ8 A;  4JQF A;  5CVI A;  2ISZ A;  1B8I B;  2ZSH B;  2C6Y A;  3S1N J;  4BHC A;  1AA7 A;  3H1C A;  3GUD A;  3FMS A;  4A0Z A;  4EMS A;  2Y69 H;  4FX0 A;  3L7W A;  2KRC A;  4EEF G;  1P92 A;  2M4K A;  2MBF A;  2IA1 A;  2MW8 A;  2R5Y B;  2V79 A;  3I9V 2;  2CQK A;  4RB0 A;  2D2W A;  3CCS I;  3KIO A;  5L3G A;  2R7Q A;  3DPL C;  5C4X J;  3DBR B;  3ZQF A;  1U9N A;  4IKF A;  1RKW A;  4L9J A;  5KAF C;  2DQR A;  1LVK A;  3F8F A;  1UHS A;  1MMG A;  4BGD A;  3TOB A;  3GBG A;  2PMU A;  5K7F A;  1KU2 A;  2ADU A;  4XRF A;  4DQ2 A;  1WWX A;  1RNL A;  1SAN A;  3HOX J;  4A0X A;  1VND A;  4IRH A;  2COB A;  4BY1 J;  1JKQ C;  3FXO A;  2L9N A;  4ZYA A;  1MD0 A;  1T33 A;  5L3F A;  3H0D A;  5CPR B;  4XLP F;  2VJ5 A;  3T5X A;  5HDG A;  4LK1 F;  5CJ9 A;  1F1Z A;  4KNY A;  2FXA A;  2VJ4 A;  1H8A C;  4CYC A;  1D1A A;  4UVC A;  2ZXH A;  2FBK A;  2X6Y A;  1T39 A;  2P5L C;  3V8K A;  1W1W E;  4Y33 A;  5JHU A;  1TWF J;  3I4N J;  2JSC A;  2Z5U A;  5CYV A;  5DD8 A;  3WU1 B;  1AOY A;  4OWR B;  1UAA A;  3KP4 A;  2DPU A;  3C1D A;  1T95 A;  4NC6 A;  3H3U A;  3WG7 H;  3TDZ C;  3AL0 C;  1WJE A;  3OWT A;  3WGG A;  4D7N A;  2XRO A;  4PJ0 C;  3VYS B;  3CTA A;  3J81 Z;  3BWG A;  3ZQG A;  3ZQI A;  4IZZ A;  1MGT A;  3CDL A;  1MSF C;  4BE2 A;  1X4O A;  1WPK A;  1SVL A;  1EH6 A;  3BRO A;  2QLZ A;  3R0J A;  2F4O B;  5H2F C;  3HOZ J;  2KLO A;  3FZV A;  4DNC A;  4G9Y A;  3A4C A;  3BG6 A;  2BY0 A;  2QKL B;  1OCR H;  2VE8 A;  4A5N A;  1SFK A;  4FE4 A;  4HSR A;  4PJL A;  2CH0 A;  3CLO A;  2FA5 A;  1R49 A;  2FE3 A;  1X3Z B;  1QRY A;  4Z6Y A;  3FBI B;  1WKM A;  2HYJ A;  2V1N A;  3FMQ A;  5FB2 A;  2B7E A;  2VUM J;  4NHJ A;  2V1D A;  1FLI A;  1R36 A;  4XNF A;  1A04 A;  2KJC A;  2VKV A;  3DTE A;  2WTE A;  3Q9S A;  1SFO J;  3EET A;  3FHN A;  4AD9 A;  2RKH A;  2VQG A;  4OAZ A;  3JTH A;  1CQT A;  3FWE A;  2QKM B;  2HXO A;  4L5J A;  2EIM H;  5CKT A;  3G3Z A;  1GV2 A;  2UZK A;  1MDM A;  1XMX A;  3MZ8 A;  4MO7 A;  5FFX A;  3KCC A;  4L9V A;  1VQL I;  3WTT C;  1R5H A;  1A36 A;  4FE7 A;  4XN0 A;  2EK5 A;  4CIC A;  1CGP A;  1GVJ A;  2PLY A;  1XPX A;  2E2J J;  2GAU A;  4RLQ A;  2UV1 A;  2XGX A;  3NEU A;  1CF7 A;  5DEQ A;  3BLY A;  4LIT A;  1TWA J;  5L3E A;  2BBY A;  2M4G A;  3HTU A;  2PJR B;  4BBS J;  3DEE A;  3ISP A;  3LFK A;  2K5C A;  3IKT A;  1X3W B;  4UUS B;  1OYW A;  1MND A;  4AYB A;  3CF2 A;  3PJR A;  4BE1 A;  1J09 A;  2VKD A;  3PNV A;  2M2E A;  3ZQ7 A;  1Z7L A;  2YX4 A;  3QOE A;  5FRO A;  2VE9 A;  4BU2 A;  3BR0 A;  5DYM A;  5LHH A;  4AIJ A;  1ONV A;  2O0Y A;  2E1N A;  4PGH A;  2FOK A;  1ZEL A;  2PG4 A;  3OSG A;  1FTT A;  4IHW A;  4PK4 A;  2JMW A;  3BG5 A;  3KYD B;  2AXT C;  5KVR A;  1K7A A;  1Y6I A;  4HX4 A;  2HI3 A;  3HJE A;  3CJR B;  1ON1 A;  4B09 A;  5EG0 A;  1P4X A;  4A3G J;  2HWV A;  2XIG A;  2R7D A;  4M74 A;  1TW2 A;  3V7C A;  4ZTJ A;  3FM3 A;  5H20 A;  1Z77 A;  2XF7 A;  1Z9C A;  4FAS D;  2P6S A;  3K4L A;  5GAE J;  3BDD A;  1TLH B;  3V7R A;  2MH9 A;  2VQC A;  3I4M J;  3QPS A;  3ZN0 A;  5IOZ A;  4C2T A;  2WBM A;  2R7U A;  3E1S A;  4XOP A;  1MMA A;  1VF9 A;  4ZZL A;  2V9P A;  3BPV A;  4CCM A;  4Y4R A;  4XIC A;  2GIZ A;  2ZXI A;  1LNW A;  3SEQ A;  1VQK I;  4FHT A;  2FBH A;  3CCL I;  1HA8 A;  3CP8 A;  1W5S A;  4NBQ A;  1DGW Y;  3TP0 A;  5DV5 A;  4A3C J;  3S1M J;  3FF5 A;  1U5T C;  4W1U A;  2LRE A;  4XLN F;  1T98 A;  3B73 A;  3HL2 A;  1IXS B;  3I5U A;  2Q2E A;  5FLX K;  4LG0 B;  1BR1 A;  2KIQ A;  1G3S A;  3M3Y J;  1G3Y A;  3J80 K;  4IJA A;  3VWB A;  1U8R A;  1Z21 A;  1HQC A;  3CP2 A;  4A93 J;  2KQR A;  2YX7 A;  3K69 A;  4KDP A;  2Y0S A;  2EH3 A;  4A3B J;  2M3A A;  4EJV A;  4FTH A;  4GO1 A;  2PBI A;  4A69 C;  3MKY B;  2R5Z A;  4XKV A;  4LLL A;  1K61 A;  1KZH A;  2Y31 A;  3AG3 H;  1FZP B;  3GTQ J;  3IAS 2;  3PQJ A;  3E5U A;  1D0Z A;  2JJ7 A;  4BNC A;  2M1B A;  1Q1V A;  4OU0 A;  1FIA A;  2EFN A;  2YPR A;  1XCB A;  2NS8 A;  3QPH A;  1YYV A;  1MMN A;  1V55 H;  2CJJ A;  2JRM A;  3LSH A;  2IW5 A;  2GBY A;  1KU9 A;  1U6G A;  2L02 A;  4UV9 A;  2L9S A;  3BR2 A;  4MFD A;  1JKO C;  1FBU A;  4HRI A;  1DP7 P;  3IHU A;  2KL4 A;  3TW6 A;  1MIJ A;  4R79 A;  1AU7 A;  2OA4 A;  4WXH A;  4ZJZ A;  3MFK A;  5GAD J;  1USS A;  1Z67 A;  2GIV A;  5HNH A;  3DKX A;  3A01 A;  4I7H A;  4A6E A;  2ZME B;  4YII A;  4BXU A;  4Y7N J;  1JGG A;  2A61 A;  3RPU D;  4I2O A;  5H6Q A;  4C9Y A;  5A2Q Z;  2K9Q A;  5J4Y A;  3LSI A;  3CCQ I;  3DWL E;  3MKL A;  1F36 A;  1LEA A;  1Y8Q B;  1SFE A;  2XGD A;  2V1U A;  2OTL I;  2RV8 A;  3CUQ B;  4AVZ A;  5D5W B;  3LSR A;  3SHF A;  4EGY A;  3D5L A;  1QNT A;  4ESB A;  4MFE A;  4D1Q A;  3OOP A;  3C2B A;  3G6E I;  3OIP A;  3S14 J;  4WCG A;  3GXO A;  1WJF A;  1T6S A;  2RNJ A;  2RVC A;  3CQZ J;  5K5O A;  2OQG A;  3GFJ A;  4Q5S F;  2YUS A;  4ZTF A;  3DTK A;  3ESW B;  1R1V A;  2DDA A;  4MHG A;  3QYF A;  1W5T A;  3FXJ A;  4CCN A;  3KET A;  1ETQ A;  2FOW A;  2L3D A;  2DFI A;  5J8C A;  4N4O B;  1FPQ A;  5BOX A;  1VQO I;  1J75 A;  3RPQ A;  2XPU A;  3S8P A;  2XSD C;  1QVT A;  1S5L C;  1BJZ A;  2DMQ A;  2A07 F;  5EGO B;  2P6T A;  3S1Q J;  5FLM J;  1U5T A;  1LUJ B;  4A3J J;  1XGS A;  2KFD A;  1EV7 A;  2HPI A;  2OJE D;  2HDC A;  1WI9 A;  4AID A;  2VPL A;  1HKT A;  2IEK A;  1TW3 A;  1BC8 C;  2CW7 A;  5D8K B;  2Y75 A;  3ZN1 A;  3ZP5 A;  3E6M A;  1A31 A;  2XHK A;  5C3E J;  3IV5 A;  4U7B A;  1K83 J;  2WAE A;  2BV6 A;  4OAY A;  1WH7 A;  3FXR A;  3ZGK A;  2AS5 F;  2L01 A;  2DCE A;  2HVQ A;  3FK6 A;  2Q8K A;  1T38 A;  4R1H A;  2N8G A;  1ORK A;  3OS0 A;  3CCR I;  2E34 A;  3DP7 A;  3QQA A;  1XSX A;  1SVM A;  3ZQC A;  2NVX J;  4BEH A;  3PO2 J;  2HKX A;  1TNS A;  2P7V B;  2ID6 A;  4DYQ A;  1R1T A;  4N9H A;  1TT5 B;  3H5N A;  2Z99 A;  1VFC A;  1B1B A;  3WTS C;  3ULQ B;  3WE2 A;  1YO5 C;  4I98 B;  3OYM A;  5L3D A;  5EF6 A;  3QYE A;  3V7S A;  3I59 A;  2MLK A;  4CO8 A;  2PX9 A;  4GFB A;  2ICW G;  2GQQ A;  2GOX B;  5L3C A;  2M9H A;  3LA3 A;  3ZOB A;  2OV7 A;  3QU6 A;  5F27 A;  1UCR A;  3JAM Z;  4RB1 A;  4O6J A;  4E7H A;  2K9L A;  4KN4 X;  1TQM A;  5HLI A;  1DPR A;  1ZKG A;  1JKP C;  1XGM A;  1OJL A;  1MJB A;  2J5O A;  1X4P A;  2IVM A;  3LST A;  3F8C A;  1YJ9 I;  2FMY A;  2M0C A;  2E5Z A;  3HSE A;  3TP3 A;  1QQI A;  1R1U A;  1K79 A;  2LNB A;  1JXS A;  4U87 A;  1FYM A;  3L2Q A;  1LFP A;  4KA4 A;  2KIS A;  2EV6 A;  2MAB A;  3I55 I;  5IYD J;  3I56 I;  1E3P A;  2FML A;  4UVA A;  4YRV A;  3J80 Z;  1JTX A;  1B9M A;  3T8T A;  1EF4 A;  2XDV A;  1GXQ A;  3AKZ A;  3BR6 A;  2JTV A;  3G4S I;  4EGZ A;  3BTI A;  5HDN A;  4UB6 C;  2NOG A;  4E7K A;  1X1P A;  1G8X A;  1NG6 A;  4Y17 A;  2VXZ A;  4GGG A;  2K9N A;  2XAJ A;  2TCT A;  4U88 A;  2JT1 A;  2W7N A;  3CMY A;  1BIA A;  2OC6 A;  2Q1Z B;  3H5R A;  3HHG A;  4IF4 A;  4M9S A;  4XMY A;  1X1A A;  2DU9 A;  3K6G A;  1I39 A;  3VOD A;  5D4R A;  3M8E A;  5GPC A;  2NVQ J;  1D1B A;  2VOO A;  2JPC A;  2AQE A;  2K85 A;  1JTY A;  3ZCO A;  3DU6 A;  1H9T A;  5M5Y J;  3PO3 J;  2ZJP F;  5E3M A;  2ECC A;  5E20 A;  2MG4 A;  2DA3 A;  4F91 B;  2R7R A;  5J4V A;  3DV8 A;  4WXD A;  3NWT A;  3RKX A;  4S05 A;  2IPQ X;  3T8R A;  3AAF A;  3LAP A;  5FJ8 J;  3BPX A;  1D5Y A;  3REO A;  3OMY A;  5CVU A;  2GZW A;  3JRI A;  4X6A J;  1ZYR F;  4U0W A;  1B8I A;  5F08 A;  3M1C A;  2MD5 A;  4JX5 A;  3HGG A;  5FD5 A;  4BAC A;  2QEN A;  5LEJ A;  1BA5 A;  1WGX A;  1AHD P;  4HDU A;  1BN5 A;  2DA7 A;  2LBF B;  1TC3 C;  1TL8 A;  3K0L A;  1MH4 A;  2R5Y A;  5ICC A;  2FQ4 A;  3RCO A;  5ICF A;  3ONQ A;  3HIF A;  5EYR A;  2KZG A;  1P7J A;  2TRT A;  5LGT A;  2CWE A;  3A0B C;  1DP3 A;  3P9K A;  1K78 A;  2O5R A;  1Z0X A;  4KMF A;  2AQF A;  1RZ4 A;  3MZY A;  1XTA A;  2LP0 A;  1GDT A;  5FKM A;  4LIV A;  3HOV J;  4LIU A;  2NYX A;  3OYI A;  1UST A;  2XPW A;  5HNF A;  1RR8 C;  2DBB A;  2XAG A;  3GTO J;  2L4M A;  2M45 A;  3F3X A;  4L9N A;  1IJW C;  4JOM A;  1A35 A;  1IGN A;  2R3S A;  3A03 A;  1ITY A;  2E1C A;  2F5D A;  2QF7 A;  4A5M A;  4J19 A;  2EA4 A;  3CC2 I;  1NTC A;  3VYT B;  4WXC A;  4HST A;  2OUM A;  3VYR B;  5LD2 C;  3KP3 A;  4RDU A;  2DDB A;  2JZY A;  2KIM A;  2L2O A;  1I27 A;  2BE5 F;  2R7W A;  1E3O C;  1I6X A;  4DZP A;  2CQX A;  1KU3 A;  1ZRE A;  3E0J B;  3K10 A;  2L7M P;  3K4K A;  3QRF F;  2YS9 A;  2K4B A;  1KA8 A;  4GDF A;  4BY7 J; 
#chains in the Genus database with same CATH homology
 4ENK A;  1FBS A;  3JSP A;  5FFZ A;  5D5X B;  2PJP A;  3R60 A;  2EV0 A;  2P8T A;  1HW5 A;  3WE3 A;  3RIR A;  2QM3 A;  1ZGA A;  4M72 A;  1XN7 A;  4L18 B;  3GF2 A;  1S7A A;  4E70 A;  4HV5 A;  2XV4 S;  5LGN A;  4R8H A;  2EFO A;  2IA2 A;  3F22 A;  2XAH A;  1Z1D A;  3LWF A;  1ZRD A;  2VN2 A;  3RKW A;  4JBA A;  5LHI A;  1IW7 F;  2YSR A;  3F8M A;  1LJ9 A;  4U0Y A;  2OQR A;  1Z6R A;  2VOP A;  2ISY A;  5DCF A;  3GO5 A;  2RQP A;  3F6V A;  3HHH A;  3E97 A;  2PN6 A;  5DCM B;  3WGI A;  3C18 A;  3RYP A;  1STZ A;  3IRQ A;  3BP8 A;  5IT9 Z;  4I01 A;  5D8L B;  3R6S A;  1KU7 A;  3P9I A;  1TQP A;  5CVJ A;  1SMY F;  4LK0 F;  1F4K A;  1WRJ A;  3LAJ A;  5F64 A;  5JFR A;  2R7F A;  1QZZ A;  4EV0 A;  2UXX A;  5HVQ C;  1XB4 A;  3GLX A;  2HKO A;  1G6N A;  2EFQ A;  1HBX G;  3CUQ C;  4GCV A;  5HOO A;  1HST A;  1G3W A;  1JHF A;  4ESF A;  3E5X A;  4AVP A;  4ZYH A;  4HF1 A;  2MC3 A;  3DF8 A;  1YS6 A;  1RUN A;  1O3T A;  2DK8 A;  3CO7 C;  2HQN A;  4O3M A;  3GEZ A;  3HRT A;  1I5Z A;  1HW2 A;  2KRF A;  1Z05 A;  2QZ8 A;  1TQI A;  2MA3 A;  4M71 A;  1YS7 A;  3RKY A;  4RB2 C;  3MEX A;  1B4A A;  4Q4Z F;  1OPC A;  3DQV C;  4LG0 A;  3K2Z A;  3EYI A;  5E1X A;  3TGN A;  2GWR A;  1G3T A;  1D8K A;  3IWF A;  1YW9 A;  3HTS B;  3ZMV A;  2CFX A;  2KKO A;  5LRR A;  4Y13 A;  4RGR A;  4HLY A;  1O3R A;  4KFC A;  4EQQ A;  2VBW A;  4KMU X;  3P7N A;  4OIP F;  2NS0 A;  2ZNZ A;  5CLS A;  3ZPL A;  2Y0M A;  2FRH A;  3WOD F;  1IZ1 A;  2ZKZ A;  1YW7 A;  2W57 A;  1WQ2 A;  5E8I A;  2LDU A;  1U78 A;  2XKP A;  2XVC A;  2W25 A;  3WGH A;  4M6X A;  3KFW X;  3CDH A;  3PFI A;  1J9I A;  2HGC A;  4YIF A;  5FO5 A;  1XSD A;  1F5T A;  2QVO A;  3V4G A;  4RAY A;  3HOT A;  1YQA A;  2MLG A;  4I0A A;  1XSV A;  5D6E A;  1DDN A;  1J0R A;  2CG4 A;  3CUQ A;  2G7H A;  1D3Y A;  4G8X A;  5LHG A;  4Q48 A;  2QQB A;  5ICE A;  3COA C;  5E18 F;  3WTZ A;  4M73 A;  3K1M A;  2QBY B;  3TO7 A;  1G4D A;  3KZY A;  3FM5 A;  3VFZ A;  1FWZ A;  4LFU A;  3MZH A;  5BPD A;  4IHS A;  2DQL A;  4H0E A;  1V3F A;  4WX9 A;  5H6R A;  4S04 A;  2P5V A;  4A12 A;  4KIG A;  3RPU A;  4XBF A;  1DPU A;  2ZNY A;  1ZGJ A;  3WTU C;  3N97 A;  4PDK A;  3TDU C;  1OYY A;  4Q47 A;  1S3J A;  4P5O A;  5BQT A;  1K6O A;  2VBX A;  2WV0 A;  3BY6 A;  3E6D A;  1ZRF A;  3CUO A;  4EJT A;  2VOD A;  3QU3 A;  3R61 A;  4HV6 A;  4MGR A;  5HLG A;  2W24 A;  2NRA C;  2H27 A;  4XSX F;  1JHH A;  3CO6 C;  4BQA A;  2O3F A;  4QWQ A;  5HS7 A;  2K02 A;  3KP7 A;  2OZ6 A;  3EYY A;  3WU0 A;  4G7Z F;  4QLC U;  4IPA A;  3HSF A;  5D5V B;  1TNT A;  3IWZ A;  1W4M A;  3WTX C;  3L9F A;  3MAJ A;  4HOB A;  1R58 A;  1BIB A;  3SFZ A;  3SZT A;  4MNU A;  1H0M A;  4CHU A;  2DTR A;  3IKV A;  3L2C A;  4ASN A;  4GYG A;  3MWM A;  3RI4 A;  1MDM B;  2HFH A;  1IAW A;  2YR2 A;  3BJA A;  5D5U B;  2RGV A;  3KEQ A;  2DO7 A;  1FBQ A;  5LGU A;  5TRD A;  1XGO A;  2G9W A;  4EJU A;  2E7W A;  5F1R A;  2HTS A;  1ZG5 A;  1O3Q A;  1IN6 A;  5ILV A;  5JI6 A;  1FC3 A;  1UHM A;  1V4R A;  4OMY A;  2EJR A;  4GXO A;  5ICG A;  3K1P A;  5LLQ A;  3F8B A;  2RDP A;  2WWY A;  1MJ9 A;  5ED4 A;  1JE8 A;  1FP1 D;  2P7C B;  2RN7 A;  1MZB A;  4EJO A;  4O5V A;  3E6B A;  2Y48 A;  3TQN A;  2P5K A;  5DUK A;  3ECH A;  1BBY A;  4LD5 A;  1DUX C;  3WTW C;  4CZZ A;  5CVR A;  4IXA A;  1FY7 A;  3ABT A;  5LRS A;  1XGN A;  5E17 F;  4N9I A;  4KYW A;  4HQM A;  1BJA A;  2Z33 A;  4G7H F;  5KK1 A;  3R4K A;  4FT8 A;  2M8E A;  5HS8 A;  4FX4 A;  3DXJ F;  4IVN A;  3ZMZ A;  3PQK A;  1IUY A;  4KT5 C;  3HYI A;  1FOK A;  4D0P A;  4ZH4 F;  5F6F A;  5FLX Z;  3F72 A;  4KN7 X;  4CXF A;  2OD5 A;  3U2R A;  2L4A A;  2LF8 A;  2QUF A;  1S6L A;  2WC2 A;  1UFM A;  2XKO A;  5D6F A;  5E1Z B;  2GXG A;  2A6E F;  3FX3 A;  4UXN A;  3VEP A;  3F8N A;  1Z6T A;  3SXY A;  4HF0 A;  4KIB A;  3TOA A;  4WWC A;  2YU3 A;  5E8G A;  1YIO A;  3L00 A;  3RJP A;  2ZXJ A;  3HSR A;  5DCM A;  2ESN A;  4BHB A;  1LEB A;  3GZ6 A;  4OOI A;  5J6X A;  2BGC A;  5E1W A;  3MCZ A;  5D4S A;  3GZ5 A;  3E6C C;  3L09 A;  2IA0 A;  3BZ6 A;  1H9G A;  4ENJ A;  4A0Y A;  3QPT A;  2EFW A;  3J81 K;  2O6G E;  3D0S A;  2W84 A;  1T2K A;  1Z91 A;  3ERE D;  5BMZ A;  5AON A;  3T0Y A;  1YLF A;  3RYR A;  2MH2 A;  1BI3 A;  1KQ9 A;  2HQR A;  3H3Z A;  4WF2 A;  1SD4 A;  4ZYG A;  3G73 A;  4JK1 X;  5AIQ A;  4IRI A;  3F6O A;  1PP7 U;  4OIN F;  1LDD A;  4LLN A;  4KIC A;  1P6R A;  1XDS A;  3VB2 A;  3Q9V A;  3VOE A;  3KLO A;  4F7Z A;  1SD7 A;  4A6D A;  1SFX A;  2FSW A;  4LLG F;  3B02 A;  4AIK A;  1Y0U A;  3KLN A;  1VTN C;  3I59 B;  1Q1H A;  3HOS A;  2UWM A;  2OZU A;  1W7P D;  2Q0O A;  4G94 A;  4AWX B;  2VON A;  4ZYD A;  2A3S A;  1XMA A;  1X3U A;  1L3L A;  1J5Y A;  4HF2 A;  3DEU A;  2BYV E;  2G7U A;  2F5E A;  2F5F A;  1L0O C;  4YG2 F;  1O57 A;  1IRG A;  2PEX A;  2KIU A;  5L3B A;  1KYW A;  1RI7 A;  1GHC A;  2PQ8 A;  4EM1 A;  2W85 A;  5K1Y A;  4XSZ F;  1TTY A;  1O7F A;  1QPM A;  1PDN C;  1HSJ A;  3QP6 A;  2IP2 A;  3ECO A;  1W7P B;  1SFU A;  1I1G A;  4K2E A;  2ETH A;  4P9U A;  1R5G A;  4KIF A;  3T1B A;  2ELH A;  4PCQ A;  2ESH A;  3I71 A;  2K7L A;  4P9F A;  4MTE A;  4PGG A;  4L9T A;  1B6A A;  1KYZ A;  2NAZ A;  3FXQ A;  4EM2 A;  2IJL A;  3MQ0 A;  4HAM A;  1FT9 A;  4ZYE A;  1ZG3 A;  1QZY A;  1ZLJ A;  4HZF A;  3GFI A;  3C7J A;  3BOQ A;  3HUG A;  3U1D A;  4EM0 B;  3RTR A;  2H94 A;  2HZT A;  1HKS A;  1K78 B;  1FSH A;  1QBJ A;  2RC4 A;  3F23 A;  2QBY A;  2STW A;  2Z3Y A;  4G6D A;  1IXR C;  2XAQ A;  5ERI A;  4A2U A;  1QO0 D;  2ZJ2 A;  2FEZ A;  4HQE A;  1SMT A;  1D8J A;  3I54 A;  4ESJ A;  2DW4 A;  3DKW A;  4BAY A;  2LKP A;  3DPT A;  4IHT A;  1ZHF A;  1MJA A;  4EJW A;  4RGX A;  2AXL A;  1FYK A;  2KIF A;  3GW2 A;  1J59 A;  4U0V A;  1R00 A;  4YFN F;  3KP6 A;  5JVT A;  5A2Q K;  1B9N A;  2HYG D;  3BJO A;  5EEH A;  4MTD A;  4N0B A;  5ILS A;  1SD6 A;  1IN8 A;  4NB5 A;  2P4W A;  4BH9 A;  3C3W A;  5HS9 A;  1EH8 A;  3WTV C;  2F2E A;  4RGU A;  1XCV A;  4I02 A;  5LBQ A;  2A6H F;  2XRN A;  4L5I A;  2HOE A;  1IN4 A;  3GYH X;  2HYF A;  1HXD A;  3ZMD A;  2VT3 A;  1P2F A;  3KP2 A;  1OYI A;  2ZME A;  2GA1 A;  3OV8 A;  2CO5 A;  4ENM A;  1MKM A;  3N4M A;  4I0B A;  3M9A A;  2K86 A;  2VBZ A;  4CGZ A;  1UHW A;  4U7D A;  2XAF A;  2X0L A;  3KZZ A;  5DUI A;  1IF1 A;  1E17 A;  1OR7 A;  3EUH A;  3I0T A;  2CGP A;  3W6J B;  2Z9O A;  2K27 A;  4OIR F;  3IC7 A;  4KUM A;  1LDJ A;  4RS8 A;  3R0A A;  2XAS A;  4L0Z B;  1OKR A;  3HRM A;  4YFX F;  4P55 A;  1FNN A;  4G6Q A;  5FD6 A;  3GFL A;  4HLX A;  1RUO A;  5AIP A;  1LB2 A;  1ZLK A;  2ZO4 A;  3M8F A;  3JAM K;  1P4A A;  1BC7 C;  2JRT A;  1C0W A;  3GWZ A;  1U3E M;  2OU2 A;  3NRV A;  1B59 A;  4LB6 B;  3KEO A;  3QAH A;  5LEK A;  1YW8 A;  2D1H A;  1XDU A;  1WSU A;  2XUB A;  2QYO A;  3HRU A;  4OMZ A;  3K9T A;  1BI0 A;  3FXU A;  3JTG A;  2M5W A;  1HW1 A;  2F5C A;  3QP5 A;  2FNA A;  2COM A;  2HTJ A;  3I58 A;  2STT A;  3TKY A;  2DT5 A;  3FHZ A;  2VT2 A;  2PFB A;  2ZCW A;  1ZG1 A;  2LSO A;  2DI3 A;  3TO6 A;  1ZAO A;  1E2X A;  2HR3 A;  3V8J A;  2EA2 A;  5ILU A;  2M87 A;  1ON2 A;  6PAX A;  4ON0 A;  3ZMT A;  2FU4 A;  3P9C A;  4PZJ A;  1ODD A;  2EV5 A;  1CF7 B;  2KJB A;  4BYY A;  1ZH5 A;  1OMI A;  3U9G A;  4RAZ A;  1GXP A;  1ZRC A;  3ZMU A;  3JSO A;  2QQ9 A;  4UUV A;  4M9X A;  3JW4 A;  3I4P A;  2ZBK A;  1SAX A;  2FNP A;  3ABU A;  2NNN A;  4HX8 A;  1O3S A;  3K1N A;  2V1X A;  1RIO H;  4OIQ F;  2VBY A;  3S2W A;  5BS6 A;  3EQL F;  3IL2 A;  1LDK B;  2FF4 A;  1REP C;  2CYY A;  1J7K A;  4YFK F;  3ROU A;  5BPI A;  1IXC A;  2LF7 A;  3M7G A;  3KE2 A;  5JR3 A;  2E7X A;  3ML6 A;  2ZFW A;  3NQO A;  3ELK A;  2EB7 A;  1T0F A;  3O6B B;  2CSO A;  2EFP A;  1R23 A;  4UV8 A;  3EDP A;  5HLH A;  1LQ1 A;  2HS5 A;  1FX7 A;  2D1V A;  3LQQ A;  2DAO A;  2HEO A;  2QWW A;  2H09 A;  4CDG A;  4WK8 F;  1IN7 A;  2UXN A;  1EH7 A;  4I09 A;  2VC0 A;  2H6B A;  1ZAR A;  5DDG A;  3GX4 X;  1TBX A;  1SD5 A;  4OIO F;  1IRF A;  2EWN A;  1I1S A;  1S29 A;  1KQ0 A;  3FMR A;  3W6K B;  4L0Y B;  2A69 F;  4MQ9 F;  3WTY C;  3GVA A;  2X4H A;  1R22 A;  1P4W A;  5IT9 K;  3J7A O;  5HDK A;  2V9V A;  4UVB A;  1BM9 A;  4Y15 A;  5IT3 A;  2DLL A;  5J8F A;  5TJJ A;  3QOP A;  4GYI A;  3LA7 A;  3HRS A;  1BI2 A;  3LA2 A;  2B0L A;  2PMH A;  3O2P E;  2A5Y B;  2PI0 A;  3GFM A;  4LMY A;  2OBP A;  1NHA A;  1U2W A;  2J5P A;  4ENN A;  4IRG A;  4LB5 A;  1W7P A;  1AWC A;  4ZZD A;  1S8N A;  3E5Q A;  3IRR A;  3H92 A;  5DD4 A;  3V8L A;  4CYD A;  1BOA A;  5K5R A;  4HDV A;  2ACJ A;  1Z7U A;  1ZN2 A;  1U5T B;  4G7O F;  2BEO A;  4TV7 A;  1QGP A;  1KQ8 A;  4M9Z A;  2O8X A;  5FGM A;  1BI1 A;  5CVV A;  4RGS A;  3I53 A;  1J2X A;  3SQN A;  3KP5 A;  1JGS A;  1HKQ A;  4M6Y A;  5K5Q A;  4HYE A;  3ZMS A;  2K4J A;  3E3V A;  4P96 A;  2DPD A;  3BJ6 A;  4MEX F;  1D5V A;  1XD7 A;  1S7O A;  1XMK A;  3Q5F A;  3CJN A;  1FYL A;  1YFH A;  2O61 A;  4NQW A;  3TO9 A;  4ETS A;  2M30 A;  4MEY F;  2JPB A;  3WG9 A;  4LGW A;  2TDX A;  2H6C A;  5EEG A;  2GXB A;  1KGS A;  4MQV A;  1F9N A;  3F21 A;  2FBI A;  4BHP A;  1FP2 A;  1ULY A;  2V6C A;  2DK5 A;  1UB9 A;  2QQA A;  3I64 A;  4HA8 A;  2VC1 A;  4HW0 A;  4HX7 A;  1YTY A;  1IN5 A;  4UNO A;  2FQ3 A;  2O03 A;  4HBL A;  3RDI A;  3SZP A;  1O7L A;  4B8X A;  2IRF G;  1R7J A;  4LJZ F;  1PP8 F;  1PUE E;  3LQR A;  4Z2Y A;  2NNY A;  1LVA A;  1FSE A;  3O3K A;  2IT0 A;  2GA2 A;  2OAZ A;  4RB3 C;  1YG2 A;  2L54 A;  2A68 F;  4UHT A;  2CW0 F;  3DFG A;  3M1E A;  4AIH A;  4EVI A;  2D45 A;  4JQF A;  5CVI A;  2ISZ A;  2C6Y A;  4BHC A;  3GUD A;  3FMS A;  4A0Z A;  4EMS A;  4FX0 A;  3L7W A;  1P92 A;  2MBF A;  2IA1 A;  2V79 A;  4RB0 A;  2CQK A;  2D2W A;  5L3G A;  3DPL C;  4L9J A;  2DQR A;  3F8F A;  3TOB A;  2PMU A;  1KU2 A;  2ADU A;  4XRF A;  4DQ2 A;  1WWX A;  1RNL A;  4A0X A;  4IRH A;  5L3F A;  1MD0 A;  4XLP F;  3T5X A;  5HDG A;  4LK1 F;  5CJ9 A;  1F1Z A;  4KNY A;  2FXA A;  4UVC A;  2FBK A;  1T39 A;  2P5L C;  3V8K A;  5JHU A;  2JSC A;  2Z5U A;  5CYV A;  5DD8 A;  3WU1 B;  1AOY A;  3KP4 A;  2DPU A;  3C1D A;  3H3U A;  3TDZ C;  3WGG A;  2XRO A;  3CTA A;  3J81 Z;  3BWG A;  1MGT A;  1EH6 A;  3BRO A;  3R0J A;  2QLZ A;  3FZV A;  4DNC A;  4G9Y A;  2VE8 A;  4A5N A;  3CLO A;  2FA5 A;  2FE3 A;  1WKM A;  3FMQ A;  5FB2 A;  4NHJ A;  2V1D A;  1FLI A;  1R36 A;  1A04 A;  2KJC A;  2WTE A;  3Q9S A;  3EET A;  4AD9 A;  2RKH A;  3JTH A;  3FWE A;  4L5J A;  3G3Z A;  2UZK A;  1MDM A;  5FFX A;  3KCC A;  4L9V A;  3WTT C;  1R5H A;  2EK5 A;  4CIC A;  1CGP A;  1GVJ A;  2PLY A;  2GAU A;  2XGX A;  3NEU A;  1CF7 A;  5DEQ A;  5L3E A;  2BBY A;  3HTU A;  3ISP A;  3LFK A;  3IKT A;  1OYW A;  3ZQ7 A;  2YX4 A;  2VE9 A;  4AIJ A;  5LHH A;  5DYM A;  1ONV A;  2O0Y A;  2E1N A;  4PGH A;  2FOK A;  2PG4 A;  5KVR A;  1K7A A;  4HX4 A;  1ON1 A;  4B09 A;  1P4X A;  2HWV A;  2XIG A;  2R7D A;  4M74 A;  1TW2 A;  3V7C A;  3FM3 A;  5H20 A;  1Z9C A;  2P6S A;  3BDD A;  1TLH B;  3V7R A;  2MH9 A;  3ZN0 A;  4ZZL A;  3BPV A;  1LNW A;  4FHT A;  2FBH A;  1W5S A;  5DV5 A;  3FF5 A;  1U5T C;  4XLN F;  1T98 A;  3B73 A;  1IXS B;  3I5U A;  2Q2E A;  5FLX K;  4LG0 B;  1G3S A;  1G3Y A;  3J80 K;  4IJA A;  1U8R A;  1HQC A;  2YX7 A;  3K69 A;  4KDP A;  4EJV A;  4GO1 A;  2PBI A;  4LLL A;  1FZP B;  3PQJ A;  3E5U A;  4BNC A;  2M1B A;  4OU0 A;  2EFN A;  2YPR A;  1XCB A;  3QPH A;  1YYV A;  2IW5 A;  1KU9 A;  1U6G A;  2L02 A;  4UV9 A;  1FBU A;  1DP7 P;  3IHU A;  4R79 A;  2OA4 A;  4WXH A;  3MFK A;  1USS A;  2GIV A;  4I7H A;  4A6E A;  2ZME B;  4YII A;  4BXU A;  4I2O A;  2A61 A;  5H6Q A;  5A2Q Z;  1LEA A;  1SFE A;  2V1U A;  2RV8 A;  3CUQ B;  5D5W B;  4EGY A;  3SHF A;  3D5L A;  1QNT A;  4ESB A;  3OOP A;  4WCG A;  3GXO A;  1T6S A;  2RNJ A;  2RVC A;  5K5O A;  2OQG A;  3GFJ A;  4Q5S F;  1R1V A;  4MHG A;  1W5T A;  3KET A;  2L3D A;  2DFI A;  5J8C A;  1FPQ A;  5BOX A;  1J75 A;  3RPQ A;  2A07 F;  2P6T A;  1U5T A;  1XGS A;  1EV7 A;  2HDC A;  1WI9 A;  1HKT A;  1TW3 A;  1BC8 C;  5D8K B;  2Y75 A;  3ZN1 A;  3ZP5 A;  3E6M A;  2XHK A;  4U7B A;  2BV6 A;  3FXR A;  2AS5 F;  2L01 A;  2Q8K A;  1T38 A;  4R1H A;  3DP7 A;  1XSX A;  2HKX A;  1TNS A;  2P7V B;  1R1T A;  4N9H A;  2Z99 A;  1B1B A;  3WTS C;  3ULQ B;  3WE2 A;  1YO5 C;  4I98 B;  5L3D A;  3V7S A;  3I59 A;  2MLK A;  4CO8 A;  2GQQ A;  5L3C A;  3LA3 A;  3QU6 A;  1UCR A;  3JAM Z;  4RB1 A;  4O6J A;  4KN4 X;  1TQM A;  5HLI A;  1DPR A;  1XGM A;  1MJB A;  2J5O A;  2IVM A;  3LST A;  3F8C A;  2FMY A;  3HSE A;  1QQI A;  1R1U A;  1K79 A;  2LNB A;  1JXS A;  1FYM A;  4KA4 A;  2EV6 A;  2FML A;  4UVA A;  3J80 Z;  1B9M A;  3T8T A;  1GXQ A;  2JTV A;  4EGZ A;  5HDN A;  4Y17 A;  2VXZ A;  4GGG A;  2XAJ A;  4U88 A;  2JT1 A;  1BIA A;  4M9S A;  3HHG A;  4IF4 A;  2DU9 A;  3VOD A;  5D4R A;  3M8E A;  2VOO A;  2JPC A;  1H9T A;  5E20 A;  3DV8 A;  4WXD A;  3RKX A;  4S05 A;  2IPQ X;  3T8R A;  3AAF A;  3LAP A;  3BPX A;  3REO A;  5CVU A;  2GZW A;  1ZYR F;  4U0W A;  2MD5 A;  5FD5 A;  2QEN A;  5LEJ A;  4HDU A;  1BN5 A;  3K0L A;  5ICC A;  5ICF A;  3HIF A;  5LGT A;  2CWE A;  3P9K A;  1K78 A;  4KMF A;  1RZ4 A;  3MZY A;  2NYX A;  1UST A;  2DBB A;  2XAG A;  2L4M A;  2M45 A;  3F3X A;  4L9N A;  2R3S A;  2E1C A;  2F5D A;  4A5M A;  2EA4 A;  4WXC A;  3KP3 A;  2JZY A;  2KIM A;  1I27 A;  2BE5 F;  1I6X A;  1KU3 A;  1ZRE A;  3QRF F;  2K4B A;  1KA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...